1EQZB

X-ray structure of the nucleosome core particle at 2.5 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asymmetries in the nucleosome core particle at 2.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein/dna
molecule keywords 146 NUCLEOTIDES LONG DNA
total genus 33
structure length 108
sequence length 108
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1eqzB00
3W97C 3REKD 5B40C 3AZGC 1HQ3A 2F8NH 1P3LB 3KWQA 3MGQC 1P3AA 3KUYB 4J8VD 3W99B 3AZLC 1P3PD 5GSUA 4H9OA 3W97B 4YM6D 4G91B 2F8NA 1M18A 1KX4D 3WTPA 3WAAA 4KGCB 1TAFB 5B24A 3MNND 3AZLA 3AZJC 3AZNB 1F1EA 5CPJD 3X1TD 1ID3D 5GXQC 1EQZA 5B1MB 5JA4A 4Z66A 3MGSB 3AZMA 1U35B 1BH8A 3WAAC 3WTPC 5DNMA 5GT0B 4AWLB 5AV8B 3W97D 3AZID 4H9PB 4DRAA 4R8PA 5AY8B 3AZED 3RELB 3REIB 5B31C 4JJNC 3MGRA 4H9SA 3MGQB 1KX4A 4H9NB 3W96B 3RELA 3AZLD 4R8PC 2YFVA 3AZFA 3AZHC 2BYMA 5B31A 3A6NB 1ID3A 4XUJD 3WA9A 1F66A 1KX4C 4QLCC 2NZDA 1BH8B 4ZBJC 3LELD 4J8UC 4DRBA 4KHAB 3REKA 1H3OA 1ID3C 2FJ7B 2F8NK 5G49B 1TAFA 1P3OD 4J8XC 3WTPB 3WAAB 3REJA 1M18B 1AOIC 4E44A 4AWLC 3AZGD 4WV4B 2FJ7D 5GSUB 5AY8C 2F8NB 3VH5W 4J8XA 3LELB 4XZQB 3W99A 3LZ1D 3W96C 3KUYA 3B6FC 4LD9A 3KXBA 5B2IB 3MGPB 1EQZD 4WNNB 1HQ3B 3AZKA 1P3KB 4H9QA 5CPIC 4YS3C 1P3ID 1KX5D 5F99D 3X1TC 3LELC 5GXQD 2F8NG 5B40A 5AVCC 1S32D 3LJAB 3B0CT 4WU8A 5AV9B 1P34A 3MGQD 5BO0B 5GSUC 4JJND 3AZFD 3KXBD 1P3BA 1M1AD 3X1SA 3AZKD 1KX3D 1P34B 4E45A 5FUGA 5B1MC 5B32G 1ZLAA 2HIOA 3MVDB 2CV5B 5B0YA 1M1AB 3LJAA 3UTAD 4QLCD 1EQZC 4J8UD 4J8VB 5DNMC 2HIOC 4JJNB 3WTPD 3WAAD 3NQUA 2NZDD 5B0ZB 5AVBB 5GT3D 3MGSC 1U35C 1HTAA 4XZQD 1TZYA 3B6GB 4WU9A 4KUDC 4NE3A 3X1VD 2HUEC 1P3IA 1P3IB 2YFWB 1KX3C 3MGPD 1KX5C 5CPID 5AVBA 1ULYA 3WKJC 3LZ0C 3O62D 3AFAB 2NQBA 3REHA 1P3OC 1P34D 3WKJA 1AOID 1P3BD 2BYMB 1M1AA 3UTBB 1ID3B 3AZFB 2YFVB 5BT1C 3REHC 2BYKB 5CPKB 5AV6C 1S32A 3W96A 2F8ND 3UTAB 3AFAD 1S32C 3MVDD 3LZ1C 2LY8A 4YS3A 2HUEB 3B6FD 1P3MC 1Q9CA 5AV6A 4M6BA 4CAYB 3AZHB 5GT0A 5AV5B 3LZ1A 4QLCB 5BNVA 4J8UB 5B32D 4X23D 3REIC 5KDMB 1WWIA 1P34C 1P3GD 3MGSD 1U35D 5B1LB 5CP6C 5B0ZD 1P3BC 2PYOA 2IO5B 3MGPA 5B2IA 4KUDD 5AV6D 1M18D 3B0BA 4J8VC 3X1VC 5CP6A 5AV9C 4H9RA 3AZIB 2JSSA 3UT9C 3X1UD 5CPIB 5DNNA 5B1LA 3UTBD 4KUDB 5G49A 5KDMA 4QLCA 2NZDC 5B2JB 5B32C 4NE6A 4X23C 4ZUXC 4KHAA 3REKB 4J8UA 5BNVB 5BT1D 5B1LC 5C3IB 5CP6D 1P3PB 3REHD 4WZSB 3WA9B 3KUYD 3X1UB 3AFAC 4YS3B 4CSRB 4R8PD 4H9NA 5AY8A 1P3MD 3AZHD 3C1CA 3UTBA 4XUJC 5AVCB 4R8PB 3X1UC 1P3OA 4J8WC 1P3PA 3REHB 5AV8A 5DNMB 3WKJB 2NQBB 5GT0D 5B2JA 1P3GB 3AV1B 4X23B 4ZUXD 5B32B 3AZNA 5B0ZC 1P3MB 3AZLB 2FJ7C 2YFWA 5AY8D 1M19D 4KGCA 1M18C 5B0YD 5B33A 2AROC 4H9OB 3W97A 4H9RB 3AZIA 1P3FB 5CPKC 3AZJA 3AZEA 3TU4D 1P3AB 4WU9B 5GXQB 3AV2A 3UT9D 3B6GA 2AROA 1TZYB 3NQUB 3WTPE 3LZ0B 5AV5C 4WU8D 1TZYD 3B6GC 1M19A 1JFIA 4JJNA 5B1LD 4J8VA 3X1VA 3VH6T 1KX3B 5AV5A 5GSUD 5FUGB 4Z66C 3AZFC 3AZHA 4CAYA 2CWEA 5E5AA 3AZMC 1P3KD 5AV6B 3AN2D 1P3BB 1KX5B 3R45B 2AROD 4G92C 2IO5C 4HGAB 3X1VB 4ZUXB 1BFMA 4H9SC 3V9RA 4Z5TB 1KX3A 1JFIB 4UUZB 5DNMD 2HIOD 5AV5D 3LZ0A 5BS7C 5B40B 1F66C 4WNNA 5JRGD 1P3KA 3AFAA 4XZQC 4LD9B 3KUYC 5B40D 3REKC 3AZEB 3B6FA 4YM6A 4Z5TD 3AV2B 3VH5A 5C3IC 4J8XB 1P3KC 5B33B 5CPKD 3REJC 4XUJA 1KU5A 4XZQA 3LELA 3C1BD 4YM6C 3LZ0D 3O62C 5JRGA 1P3MA 3REJB 3AN2B 4WU8C 1A7WA 5B0ZA 1N1JB 5GT0C 3AV1A 2PYOD 3B6GD 5GT3B 2FJ7A 2L5AA 1HQ3C 2NZDB 3X1SC 5B31B 3A6NA 1P3AC 3X1TB 1P3OB 3C1CB 3B0DC 4NFTA 4Z66D 3AZIC 1B67A 5B2JD 3AV1C 3MNNB 5B0YC 5AVCA 3AZEC 3AN2C 5CPJB 5B31D 5B31G 3AV2C 3MGRB 1ZLAB 3A6NC 3X1SB 1KX4B 5B24C 4KGCD 5E5AD 3KWQD 4WU9D 3MGRD 5AV9A 3AYWB 5JA4B 5B1MA 4Z66B 3MGSA 1U35A 1ZLAC 1N1JA 1TZYC 3REID 5DNNB 5JRGB 5B24B 5BNXB 3B0CW 5B2ID 1P3GC 1EQZB 4KUDA 3C1BB 4J8XD 3X1SD 4H9QB 3W99D 3AZMD 4Z5TC 4Z2MH 5CP6B 3KXBB 4XUJB 3REJD 5AVBC 5AV9D 1P3LA 3VH5T 3C1BC 5DNND 4WU9C 3AYWC 5BNXA 2RVQD 2PYOB 4YS3D 1P3IC 4EO5C 3UTBC 3C1BA 2CV5D 1HQ3D 3WA9D 4UUZA 1F66D 1H3OB 5AVCD 3AZGB 5AV8C 3AYWA 1BH9B 3LZ1B 5B2JC 3AV1D 1F66B 1B6WA 3W98B 3W99C 3C1CD 3AV2D 4LD9C 3LJAD 3UTAA 3KXBC 3A6ND 5AVBD 1M1AC 5E5AB 3AZKC 1S32B 5B24D 3MNNA 3O62A 4KGCC 5B1MD 3KWQC 3MGQA 4HGAC 5B33C 3KSYA 5CPJA 3X1TA 1P3FD 3REIA 3VH6A 2BYKA 5CPKA 3UTAC 4ZBJB 4J8WD 4H9PA 1M19B 1R4VA 3AYWD 5GT3A 3MNNC 3NQJB 3AZND 2PYOC 5CHLB 5CPJC 5B2IC 3AZMB 4G91C 3AN2A 3TU4B 5AV8D 1P3AD 5GT3C 5GXQA 1P3LD 1M19C 3AZJB 4Z2MG 1P3FA 3UT9A 3UT9B 3VH6W 3LJAC 5DNNC 3B6FB 5E5AC 3TU4C 2NQBD 3MGRC 3MGPC 3KWQB 5B33D 1P3FC 4YM6B 5B32A 4X23A 3RELC 2RVQC 3WKJD 3W98D 1P3GA 1ZLAD 3TU4A 2CV5C 3WA9C 4Z5TA 3NQJA 3MVDA 2HIOB 2CV5A 5BS7A 1P3LC 3V9RB 3C1CC 4CSRA 4LD9D 5B0YB 4ZUXA 3R45A 4EO5B 1AOIA 1WWSA 5F99B 1KX5A 3O62B 3X1UA 4J8WA 4J8WB 1P3PC 3W98A 3MVDC 5F99A 4WU8B 3W96D 1AOIB 1BH9A 2NQBC 4G92B 5BO0A 3RELD 3AZJD 3AZNC 3W98C 5F99C 3B0DB 3AZGA 5CPIA 4NE5A 5JRGC 3AZKB 2AROB
chains in the Genus database with same CATH superfamily
3W97C 3REKD 5B40C 3AZGC 1HQ3A 2F8NH 1P3LB 3KWQA 3MGQC 1P3AA 3KUYB 4J8VD 3W99B 3AZLC 1P3PD 5GSUA 4H9OA 3W97B 4YM6D 4G91B 2F8NA 1M18A 1KX4D 3WTPA 3WAAA 4KGCB 1TAFB 5B24A 3MNND 3AZLA 3AZJC 3AZNB 1F1EA 5CPJD 3X1TD 1ID3D 5GXQC 1EQZA 5B1MB 5JA4A 4Z66A 3MGSB 3AZMA 1U35B 1BH8A 3WAAC 3WTPC 5DNMA 5GT0B 4AWLB 5AV8B 2Y2QA 3W97D 3AZID 4H9PB 4DRAA 4R8PA 5AY8B 3AZED 3RELB 3REIB 5B31C 1PZRA 1W2EA 4JJNC 3MGRA 4H9SA 3MGQB 1KX4A 4H9NB 3W96B 3RELA 3AZLD 4R8PC 2YFVA 3AZFA 2W8SA 3AZHC 2BYMA 5B31A 3A6NB 1ID3A 4XUJD 3WA9A 1F66A 1KX4C 4QLCC 2NZDA 1BH8B 4ZBJC 3LELD 4J8UC 4DRBA 4KHAB 3REKA 1H3OA 1ID3C 2FJ7B 2F8NK 5G49B 1TAFA 3H0RC 1P3OD 4J8XC 3WTPB 3WAAB 3REJA 2G5IC 1M18B 1AOIC 4E44A 4AWLC 3AZGD 4WV4B 2FJ7D 3IP4C 5GSUB 2Y2KA 5AY8C 2F8NB 3VH5W 4J8XA 3LELB 2DQNC 4XZQB 3W99A 3LZ1D 3W96C 3KUYA 3B6FC 4LD9A 3KXBA 5B2IB 3MGPB 1EQZD 4WNNB 1HQ3B 3AZKA 1P3KB 4H9QA 5CPIC 4YS3C 1P3ID 1KX5D 5F99D 3X1TC 2Y2NA 3LELC 5GXQD 2F8NG 5B40A 5AVCC 1S32D 1T3UA 3LJAB 3B0CT 4WU8A 2XD5A 5AV9B 1P34A 3MGQD 5BO0B 5GSUC 4JJND 3AZFD 3KXBD 1P3BA 1M1AD 3X1SA 3AZKD 1KX3D 1P34B 4E45A 5FUGA 5B1MC 5B32G 1ZLAA 2HIOA 3MVDB 2CV5B 5B0YA 1M1AB 3LJAA 3UTAD 4QLCD 1EQZC 2ZY4A 4J8UD 4J8VB 5DNMC 2HIOC 4JJNB 3WTPD 3WAAD 3NQUA 2NZDD 5B0ZB 5AVBB 2Y2GA 2FFFB 5GT3D 3MGSC 1U35C 1HTAA 4XZQD 1TZYA 3B6GB 4WU9A 4KUDC 4NE3A 3X1VD 2HUEC 1P3IA 1P3IB 2YFWB 1KX3C 3MGPD 1KX5C 5CPID 5AVBA 1ULYA 3WKJC 3LZ0C 3O62D 3AFAB 2NQBA 2JCHA 3REHA 1P3OC 1P34D 3WKJA 1AOID 1P3BD 2BYMB 1M1AA 3UTBB 1ID3B 3AZFB 2YFVB 5BT1C 3REHC 2BYKB 5CPKB 5AV6C 1S32A 3W96A 3EPHA 2F8ND 3UTAB 3AFAD 1S32C 3MVDD 3LZ1C 2LY8A 4YS3A 2HUEB 3B6FD 2Y2LA 1P3MC 1Q9CA 5AV6A 4M6BA 2F2AC 4CAYB 3AZHB 5GT0A 5AV5B 3LZ1A 4QLCB 5BNVA 2Y2IA 4J8UB 5B32D 4X23D 3REIC 5KDMB 1WWIA 1P34C 1P3GD 3MGSD 1U35D 5B1LB 3KFUG 5CP6C 2BG1A 5B0ZD 1P3BC 2PYOA 2IO5B 3MGPA 5B2IA 4KUDD 5AV6D 1M18D 3B0BA 4J8VC 3X1VC 5CP6A 2ZY3A 5AV9C 4H9RA 3AZIB 3P5JB 2JSSA 3AL0C 2ZY2A 3UT9C 3X1UD 5CPIB 5DNNA 5B1LA 3UTBD 4KUDB 5G49A 3H0MC 5KDMA 4QLCA 2NZDC 5B2JB 5B32C 4NE6A 4X23C 4ZUXC 4KHAA 3REKB 4J8UA 5BNVB 2ZY5A 2RIQA 5B1LC 5CP6D 5BT1D 5C3IB 1P3PB 3REHD 4WZSB 3WA9B 3KUYD 3X1UB 3AFAC 4YS3B 4CSRB 4R8PD 3H0LC 4H9NA 5AY8A 2JE5A 1P3MD 3AZHD 3C1CA 3UTBA 4XUJC 5AVCB 4R8PB 3X1UC 1P3OA 4J8WC 1P3PA 3REHB 5AV8A 5DNMB 3WKJB 2NQBB 5GT0D 5B2JA 1P3GB 3AV1B 5B32B 4ZUXD 4X23B 3AZNA 5B0ZC 1P3MB 3AZLB 2FJ7C 2YFWA 5AY8D 1M19D 4KGCA 1M18C 5B0YD 5B33A 2AROC 4H9OB 3W97A 4H9RB 3AZIA 1P3FB 5CPKC 3AZJA 3AZEA 3TU4D 1P3AB 4WU9B 5GXQB 3AV2A 3UT9D 3B6GA 2AROA 2UWXA 1TZYB 3NQUB 3WTPE 3LZ0B 5AV5C 4WU8D 1TZYD 3B6GC 1M19A 1JFIA 4JJNA 5B1LD 4J8VA 3X1VA 3VH6T 1KX3B 5AV5A 5GSUD 5FUGB 4Z66C 3AZFC 3AZHA 4CAYA 2CWEA 5E5AA 3AZMC 1P3KD 5AV6B 3AN2D 1P3BB 1KX5B 3R45B 2G5HC 2AROD 4UPKA 4G92C 2IO5C 4HGAB 3X1VB 4ZUXB 1BFMA 1Z2CB 4H9SC 3V9RA 4Z5TB 1KX3A 1JFIB 4UUZB 5DNMD 2HIOD 5AV5D 3LZ0A 5BS7C 5B40B 1F66C 4WNNA 5JRGD 1P3KA 2Y2PA 3AFAA 4XZQC 4LD9B 3KUYC 5B40D 3REKC 3AZEB 3B6FA 4YM6A 4Z5TD 3AV2B 3VH5A 5C3IC 4J8XB 1P3KC 5B33B 5CPKD 3REJC 4XUJA 1KU5A 4XZQA 3LELA 3C1BD 4YM6C 2Y2MA 3LZ0D 3O62C 5JRGA 1P3MA 3REJB 3AN2B 4WU8C 1A7WA 5B0ZA 1N1JB 5GT0C 3AV1A 2PYOD 3B6GD 5GT3B 2FJ7A 2L5AA 1HQ3C 2NZDB 3X1SC 5B31B 3A6NA 1P3AC 3X1TB 1P3OB 3C1CB 3B0DC 4NFTA 4Z66D 3AZIC 1B67A 5B2JD 3AV1C 3A1IA 3MNNB 5B0YC 5AVCA 3AZEC 3AN2C 5CPJB 5B31D 5B31G 3AV2C 3MGRB 1ZLAB 3A6NC 3X1SB 1KX4B 5B24C 4KGCD 5E5AD 3KWQD 4WU9D 3MGRD 5AV9A 3AYWB 5JA4B 3F6TA 5B1MA 4Z66B 3MGSA 1U35A 1N1JA 1ZLAC 1TZYC 3REID 5DNNB 5JRGB 5B24B 2J8PA 5BNXB 3B0CW 5B2ID 3EPJA 1P3GC 1EQZB 4KUDA 2Y2OA 3C1BB 4J8XD 3X1SD 4H9QB 3W99D 3FDDA 3AZMD 4Z5TC 4Z2MH 5CP6B 3KXBB 4XUJB 3A1KA 3REJD 5AVBC 5AV9D 3EG5B 1P3LA 3VH5T 3C1BC 5DNND 4WU9C 3AYWC 5BNXA 2RVQD 2PYOB 4YS3D 1P3IC 4EO5C 3UTBC 3C1BA 2CV5D 1HQ3D 3WA9D 4UUZA 1F66D 3EPLA 1H3OB 5AVCD 3AZGB 5AV8C 3AYWA 1BH9B 3LZ1B 5B2JC 3AV1D 1F66B 1B6WA 3W98B 3W99C 3C1CD 3AV2D 4LD9C 3LJAD 3UTAA 3KXBC 3A6ND 5AVBD 1M1AC 5E5AB 3AZKC 1S32B 5B24D 3MNNA 3O62A 4KGCC 5B1MD 3KWQC 3MGQA 4HGAC 5B33C 3KSYA 5CPJA 3X1TA 1P3FD 4WJ3C 3REIA 3VH6A 2BYKA 5CPKA 3UTAC 4ZBJB 4J8WD 4H9PA 1M19B 1R4VA 3AYWD 5GT3A 3MNNC 3NQJB 3AZND 2PYOC 5CHLB 5CPJC 5B2IC 3AZMB 2XD1A 4DQYB 4G91C 3AN2A 3TU4B 5AV8D 1P3AD 5GT3C 5GXQA 3EPKA 1P3LD 1M19C 3AZJB 4Z2MG 1P3FA 3UT9A 3UT9B 3VH6W 3LJAC 5DNNC 3B6FB 5E5AC 3TU4C 2NQBD 2DF4C 3MGRC 3MGPC 3KWQB 5B33D 1P3FC 4YM6B 5B32A 4X23A 3RELC 2RVQC 3WKJD 3W98D 1P3GA 1ZLAD 3TU4A 2CV5C 3WA9C 2Y2JA 4Z5TA 2VQRA 3NQJA 3MVDA 2HIOB 2CV5A 5BS7A 1P3LC 2Y2HA 3V9RB 3C1CC 4CSRA 4LD9D 5B0YB 4ZUXA 3R45A 4EO5B 2ZM5A 1AOIA 1WWSA 5F99B 1KX5A 3O62B 3X1UA 4J8WA 4J8WB 1P3PC 3W98A 3MVDC 5F99A 4WU8B 3W96D 1AOIB 1BH9A 2NQBC 4G92B 5BO0A 3RELD 3AZJD 3AZNC 3W98C 5F99C 3B0DB 3AZGA 5CPIA 4NE5A 5JRGC 3AZKB 2AROB
chains in the Genus database with same CATH topology
3W97C 3REKD 5B40C 3AZGC 1HQ3A 2F8NH 1P3LB 3KWQA 3MGQC 1P3AA 3KUYB 4J8VD 3W99B 3AZLC 1P3PD 5GSUA 4H9OA 3W97B 4YM6D 4G91B 2F8NA 1M18A 1KX4D 3WTPA 3WAAA 4KGCB 1TAFB 5B24A 3MNND 3AZLA 3AZJC 3AZNB 1F1EA 5CPJD 3X1TD 1ID3D 5GXQC 1EQZA 5B1MB 5JA4A 4Z66A 3MGSB 3AZMA 1U35B 1BH8A 3WAAC 3WTPC 5DNMA 5GT0B 4AWLB 5AV8B 2Y2QA 3W97D 3AZID 4H9PB 4DRAA 4R8PA 5AY8B 3AZED 3RELB 3REIB 5B31C 1PZRA 1W2EA 4JJNC 3MGRA 4H9SA 3MGQB 1KX4A 4H9NB 3W96B 3RELA 3AZLD 4R8PC 2YFVA 3AZFA 2W8SA 3AZHC 2BYMA 5B31A 3A6NB 1ID3A 4XUJD 3WA9A 1F66A 1KX4C 4QLCC 2NZDA 1BH8B 4ZBJC 3LELD 4J8UC 4DRBA 4KHAB 3REKA 1H3OA 1ID3C 2FJ7B 2F8NK 5G49B 1TAFA 3H0RC 1P3OD 4J8XC 3WTPB 3WAAB 3REJA 2G5IC 1M18B 1AOIC 4E44A 4AWLC 3AZGD 4WV4B 2FJ7D 3IP4C 5GSUB 2Y2KA 5AY8C 2F8NB 3VH5W 4J8XA 3LELB 2DQNC 4XZQB 3W99A 3LZ1D 3W96C 3KUYA 3B6FC 4LD9A 3KXBA 5B2IB 3MGPB 1EQZD 4WNNB 1HQ3B 3AZKA 1P3KB 4H9QA 5CPIC 4YS3C 1P3ID 1KX5D 5F99D 3X1TC 2Y2NA 3LELC 5GXQD 2F8NG 5B40A 5AVCC 1S32D 1T3UA 3LJAB 3B0CT 4WU8A 2XD5A 5AV9B 1P34A 3MGQD 5BO0B 5GSUC 4JJND 3AZFD 3KXBD 1P3BA 1M1AD 3X1SA 3AZKD 1KX3D 1P34B 4E45A 5FUGA 5B1MC 5B32G 1ZLAA 2HIOA 3MVDB 2CV5B 5B0YA 1M1AB 3LJAA 3UTAD 4QLCD 1EQZC 2ZY4A 4J8UD 4J8VB 5DNMC 2HIOC 4JJNB 3WTPD 3WAAD 3NQUA 2NZDD 5B0ZB 5AVBB 2Y2GA 2FFFB 5GT3D 3MGSC 1U35C 1HTAA 4XZQD 1TZYA 3B6GB 4WU9A 4KUDC 4NE3A 3X1VD 2HUEC 1P3IA 1P3IB 2YFWB 1KX3C 3MGPD 1KX5C 5CPID 5AVBA 1ULYA 3WKJC 3LZ0C 3O62D 3AFAB 2NQBA 2JCHA 3REHA 1P3OC 1P34D 3WKJA 1AOID 1P3BD 2BYMB 1M1AA 3UTBB 1ID3B 3AZFB 2YFVB 5BT1C 3REHC 2BYKB 5CPKB 5AV6C 1S32A 3W96A 3EPHA 2F8ND 3UTAB 3AFAD 1S32C 3MVDD 3LZ1C 2LY8A 4YS3A 2HUEB 3B6FD 2Y2LA 1P3MC 1Q9CA 5AV6A 4M6BA 2F2AC 4CAYB 3AZHB 5GT0A 5AV5B 3LZ1A 4QLCB 5BNVA 2Y2IA 4J8UB 5B32D 4X23D 3REIC 5KDMB 1WWIA 1P34C 1P3GD 3MGSD 1U35D 5B1LB 3KFUG 5CP6C 2BG1A 5B0ZD 1P3BC 2PYOA 2IO5B 3MGPA 5B2IA 4KUDD 5AV6D 1M18D 3B0BA 4J8VC 3X1VC 5CP6A 2ZY3A 5AV9C 4H9RA 3AZIB 3P5JB 2JSSA 3AL0C 2ZY2A 3UT9C 3X1UD 5CPIB 5DNNA 5B1LA 3UTBD 4KUDB 5G49A 3H0MC 5KDMA 4QLCA 2NZDC 5B2JB 5B32C 4NE6A 4X23C 4ZUXC 4KHAA 3REKB 4J8UA 5BNVB 2ZY5A 2RIQA 5B1LC 5CP6D 5BT1D 5C3IB 1P3PB 3REHD 4WZSB 3WA9B 3KUYD 3X1UB 3AFAC 4YS3B 4CSRB 4R8PD 3H0LC 4H9NA 5AY8A 2JE5A 1P3MD 3AZHD 3C1CA 3UTBA 4XUJC 5AVCB 4R8PB 3X1UC 1P3OA 4J8WC 1P3PA 3REHB 5AV8A 5DNMB 3WKJB 2NQBB 5GT0D 5B2JA 1P3GB 3AV1B 5B32B 4ZUXD 4X23B 3AZNA 5B0ZC 1P3MB 3AZLB 2FJ7C 2YFWA 5AY8D 1M19D 4KGCA 1M18C 5B0YD 5B33A 2AROC 4H9OB 3W97A 4H9RB 3AZIA 1P3FB 5CPKC 3AZJA 3AZEA 3TU4D 1P3AB 4WU9B 5GXQB 3AV2A 3UT9D 3B6GA 2AROA 2UWXA 1TZYB 3NQUB 3WTPE 3LZ0B 5AV5C 4WU8D 1TZYD 3B6GC 1M19A 1JFIA 4JJNA 5B1LD 4J8VA 3X1VA 3VH6T 1KX3B 5AV5A 5GSUD 5FUGB 4Z66C 3AZFC 3AZHA 4CAYA 2CWEA 5E5AA 3AZMC 1P3KD 5AV6B 3AN2D 1P3BB 1KX5B 3R45B 2G5HC 2AROD 4UPKA 4G92C 2IO5C 4HGAB 3X1VB 4ZUXB 1BFMA 1Z2CB 4H9SC 3V9RA 4Z5TB 1KX3A 1JFIB 4UUZB 5DNMD 2HIOD 5AV5D 3LZ0A 5BS7C 5B40B 1F66C 4WNNA 5JRGD 1P3KA 2Y2PA 3AFAA 4XZQC 4LD9B 3KUYC 5B40D 3REKC 3AZEB 3B6FA 4YM6A 4Z5TD 3AV2B 3VH5A 5C3IC 4J8XB 1P3KC 5B33B 5CPKD 3REJC 4XUJA 1KU5A 4XZQA 3LELA 3C1BD 4YM6C 2Y2MA 3LZ0D 3O62C 5JRGA 1P3MA 3REJB 3AN2B 4WU8C 1A7WA 5B0ZA 1N1JB 5GT0C 3AV1A 2PYOD 3B6GD 5GT3B 2FJ7A 2L5AA 1HQ3C 2NZDB 3X1SC 5B31B 3A6NA 1P3AC 3X1TB 1P3OB 3C1CB 3B0DC 4NFTA 4Z66D 3AZIC 1B67A 5B2JD 3AV1C 3A1IA 3MNNB 5B0YC 5AVCA 3AZEC 3AN2C 5CPJB 5B31D 5B31G 3AV2C 3MGRB 1ZLAB 3A6NC 3X1SB 1KX4B 5B24C 4KGCD 5E5AD 3KWQD 4WU9D 3MGRD 5AV9A 3AYWB 5JA4B 3F6TA 5B1MA 4Z66B 3MGSA 1U35A 1N1JA 1ZLAC 1TZYC 3REID 5DNNB 5JRGB 5B24B 2J8PA 5BNXB 3B0CW 5B2ID 3EPJA 1P3GC 1EQZB 4KUDA 2Y2OA 3C1BB 4J8XD 3X1SD 4H9QB 3W99D 3FDDA 3AZMD 4Z5TC 4Z2MH 5CP6B 3KXBB 4XUJB 3A1KA 3REJD 5AVBC 5AV9D 3EG5B 1P3LA 3VH5T 3C1BC 5DNND 4WU9C 3AYWC 5BNXA 2RVQD 2PYOB 4YS3D 1P3IC 4EO5C 3UTBC 3C1BA 2CV5D 1HQ3D 3WA9D 4UUZA 1F66D 3EPLA 1H3OB 5AVCD 3AZGB 5AV8C 3AYWA 1BH9B 3LZ1B 5B2JC 3AV1D 1F66B 1B6WA 3W98B 3W99C 3C1CD 3AV2D 4LD9C 3LJAD 3UTAA 3KXBC 3A6ND 5AVBD 1M1AC 5E5AB 3AZKC 1S32B 5B24D 3MNNA 3O62A 4KGCC 5B1MD 3KWQC 3MGQA 4HGAC 5B33C 3KSYA 5CPJA 3X1TA 1P3FD 4WJ3C 3REIA 3VH6A 2BYKA 5CPKA 3UTAC 4ZBJB 4J8WD 4H9PA 1M19B 1R4VA 3AYWD 5GT3A 3MNNC 3NQJB 3AZND 2PYOC 5CHLB 5CPJC 5B2IC 3AZMB 2XD1A 4DQYB 4G91C 3AN2A 3TU4B 5AV8D 1P3AD 5GT3C 5GXQA 3EPKA 1P3LD 1M19C 3AZJB 4Z2MG 1P3FA 3UT9A 3UT9B 3VH6W 3LJAC 5DNNC 3B6FB 5E5AC 3TU4C 2NQBD 2DF4C 3MGRC 3MGPC 3KWQB 5B33D 1P3FC 4YM6B 5B32A 4X23A 3RELC 2RVQC 3WKJD 3W98D 1P3GA 1ZLAD 3TU4A 2CV5C 3WA9C 2Y2JA 4Z5TA 2VQRA 3NQJA 3MVDA 2HIOB 2CV5A 5BS7A 1P3LC 2Y2HA 3V9RB 3C1CC 4CSRA 4LD9D 5B0YB 4ZUXA 3R45A 4EO5B 2ZM5A 1AOIA 1WWSA 5F99B 1KX5A 3O62B 3X1UA 4J8WA 4J8WB 1P3PC 3W98A 3MVDC 5F99A 4WU8B 3W96D 1AOIB 1BH9A 2NQBC 4G92B 5BO0A 3RELD 3AZJD 3AZNC 3W98C 5F99C 3B0DB 3AZGA 5CPIA 4NE5A 5JRGC 3AZKB 2AROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W97 C;  3REK D;  5B40 C;  3AZG C;  1HQ3 A;  2F8N H;  1P3L B;  3KWQ A;  3MGQ C;  1P3A A;  3KUY B;  4J8V D;  3W99 B;  3AZL C;  1P3P D;  5GSU A;  4H9O A;  3W97 B;  4YM6 D;  4G91 B;  2F8N A;  1M18 A;  1KX4 D;  3WTP A;  3WAA A;  4KGC B;  1TAF B;  5B24 A;  3MNN D;  3AZL A;  3AZJ C;  3AZN B;  1F1E A;  5CPJ D;  3X1T D;  1ID3 D;  5GXQ C;  1EQZ A;  5B1M B;  5JA4 A;  4Z66 A;  3MGS B;  3AZM A;  1U35 B;  1BH8 A;  3WAA C;  3WTP C;  5DNM A;  5GT0 B;  4AWL B;  5AV8 B;  3W97 D;  3AZI D;  4H9P B;  4DRA A;  4R8P A;  5AY8 B;  3AZE D;  3REL B;  3REI B;  5B31 C;  4JJN C;  3MGR A;  4H9S A;  3MGQ B;  1KX4 A;  4H9N B;  3W96 B;  3REL A;  3AZL D;  4R8P C;  2YFV A;  3AZF A;  3AZH C;  2BYM A;  5B31 A;  3A6N B;  1ID3 A;  4XUJ D;  3WA9 A;  1F66 A;  1KX4 C;  4QLC C;  2NZD A;  1BH8 B;  4ZBJ C;  3LEL D;  4J8U C;  4DRB A;  4KHA B;  3REK A;  1H3O A;  1ID3 C;  2FJ7 B;  2F8N K;  5G49 B;  1TAF A;  1P3O D;  4J8X C;  3WTP B;  3WAA B;  3REJ A;  1M18 B;  1AOI C;  4E44 A;  4AWL C;  3AZG D;  4WV4 B;  2FJ7 D;  5GSU B;  5AY8 C;  2F8N B;  3VH5 W;  4J8X A;  3LEL B;  4XZQ B;  3W99 A;  3LZ1 D;  3W96 C;  3KUY A;  3B6F C;  4LD9 A;  3KXB A;  5B2I B;  3MGP B;  1EQZ D;  4WNN B;  1HQ3 B;  3AZK A;  1P3K B;  4H9Q A;  5CPI C;  4YS3 C;  1P3I D;  1KX5 D;  5F99 D;  3X1T C;  3LEL C;  5GXQ D;  2F8N G;  5B40 A;  5AVC C;  1S32 D;  3LJA B;  3B0C T;  4WU8 A;  5AV9 B;  1P34 A;  3MGQ D;  5BO0 B;  5GSU C;  4JJN D;  3AZF D;  3KXB D;  1P3B A;  1M1A D;  3X1S A;  3AZK D;  1KX3 D;  1P34 B;  4E45 A;  5FUG A;  5B1M C;  5B32 G;  1ZLA A;  2HIO A;  3MVD B;  2CV5 B;  5B0Y A;  1M1A B;  3LJA A;  3UTA D;  4QLC D;  1EQZ C;  4J8U D;  4J8V B;  5DNM C;  2HIO C;  4JJN B;  3WTP D;  3WAA D;  3NQU A;  2NZD D;  5B0Z B;  5AVB B;  5GT3 D;  3MGS C;  1U35 C;  1HTA A;  4XZQ D;  1TZY A;  3B6G B;  4WU9 A;  4KUD C;  4NE3 A;  3X1V D;  2HUE C;  1P3I A;  1P3I B;  2YFW B;  1KX3 C;  3MGP D;  1KX5 C;  5CPI D;  5AVB A;  1ULY A;  3WKJ C;  3LZ0 C;  3O62 D;  3AFA B;  2NQB A;  3REH A;  1P3O C;  1P34 D;  3WKJ A;  1AOI D;  1P3B D;  2BYM B;  1M1A A;  3UTB B;  1ID3 B;  3AZF B;  2YFV B;  5BT1 C;  3REH C;  2BYK B;  5CPK B;  5AV6 C;  1S32 A;  3W96 A;  2F8N D;  3UTA B;  3AFA D;  1S32 C;  3MVD D;  3LZ1 C;  2LY8 A;  4YS3 A;  2HUE B;  3B6F D;  1P3M C;  1Q9C A;  5AV6 A;  4M6B A;  4CAY B;  3AZH B;  5GT0 A;  5AV5 B;  3LZ1 A;  4QLC B;  5BNV A;  4J8U B;  5B32 D;  4X23 D;  3REI C;  5KDM B;  1WWI A;  1P34 C;  1P3G D;  3MGS D;  1U35 D;  5B1L B;  5CP6 C;  5B0Z D;  1P3B C;  2PYO A;  2IO5 B;  3MGP A;  5B2I A;  4KUD D;  5AV6 D;  1M18 D;  3B0B A;  4J8V C;  3X1V C;  5CP6 A;  5AV9 C;  4H9R A;  3AZI B;  2JSS A;  3UT9 C;  3X1U D;  5CPI B;  5DNN A;  5B1L A;  3UTB D;  4KUD B;  5G49 A;  5KDM A;  4QLC A;  2NZD C;  5B2J B;  5B32 C;  4NE6 A;  4X23 C;  4ZUX C;  4KHA A;  3REK B;  4J8U A;  5BNV B;  5BT1 D;  5B1L C;  5C3I B;  5CP6 D;  1P3P B;  3REH D;  4WZS B;  3WA9 B;  3KUY D;  3X1U B;  3AFA C;  4YS3 B;  4CSR B;  4R8P D;  4H9N A;  5AY8 A;  1P3M D;  3AZH D;  3C1C A;  3UTB A;  4XUJ C;  5AVC B;  4R8P B;  3X1U C;  1P3O A;  4J8W C;  1P3P A;  3REH B;  5AV8 A;  5DNM B;  3WKJ B;  2NQB B;  5GT0 D;  5B2J A;  1P3G B;  3AV1 B;  4X23 B;  4ZUX D;  5B32 B;  3AZN A;  5B0Z C;  1P3M B;  3AZL B;  2FJ7 C;  2YFW A;  5AY8 D;  1M19 D;  4KGC A;  1M18 C;  5B0Y D;  5B33 A;  2ARO C;  4H9O B;  3W97 A;  4H9R B;  3AZI A;  1P3F B;  5CPK C;  3AZJ A;  3AZE A;  3TU4 D;  1P3A B;  4WU9 B;  5GXQ B;  3AV2 A;  3UT9 D;  3B6G A;  2ARO A;  1TZY B;  3NQU B;  3WTP E;  3LZ0 B;  5AV5 C;  4WU8 D;  1TZY D;  3B6G C;  1M19 A;  1JFI A;  4JJN A;  5B1L D;  4J8V A;  3X1V A;  3VH6 T;  1KX3 B;  5AV5 A;  5GSU D;  5FUG B;  4Z66 C;  3AZF C;  3AZH A;  4CAY A;  2CWE A;  5E5A A;  3AZM C;  1P3K D;  5AV6 B;  3AN2 D;  1P3B B;  1KX5 B;  3R45 B;  2ARO D;  4G92 C;  2IO5 C;  4HGA B;  3X1V B;  4ZUX B;  1BFM A;  4H9S C;  3V9R A;  4Z5T B;  1KX3 A;  1JFI B;  4UUZ B;  5DNM D;  2HIO D;  5AV5 D;  3LZ0 A;  5BS7 C;  5B40 B;  1F66 C;  4WNN A;  5JRG D;  1P3K A;  3AFA A;  4XZQ C;  4LD9 B;  3KUY C;  5B40 D;  3REK C;  3AZE B;  3B6F A;  4YM6 A;  4Z5T D;  3AV2 B;  3VH5 A;  5C3I C;  4J8X B;  1P3K C;  5B33 B;  5CPK D;  3REJ C;  4XUJ A;  1KU5 A;  4XZQ A;  3LEL A;  3C1B D;  4YM6 C;  3LZ0 D;  3O62 C;  5JRG A;  1P3M A;  3REJ B;  3AN2 B;  4WU8 C;  1A7W A;  5B0Z A;  1N1J B;  5GT0 C;  3AV1 A;  2PYO D;  3B6G D;  5GT3 B;  2FJ7 A;  2L5A A;  1HQ3 C;  2NZD B;  3X1S C;  5B31 B;  3A6N A;  1P3A C;  3X1T B;  1P3O B;  3C1C B;  3B0D C;  4NFT A;  4Z66 D;  3AZI C;  1B67 A;  5B2J D;  3AV1 C;  3MNN B;  5B0Y C;  5AVC A;  3AZE C;  3AN2 C;  5CPJ B;  5B31 D;  5B31 G;  3AV2 C;  3MGR B;  1ZLA B;  3A6N C;  3X1S B;  1KX4 B;  5B24 C;  4KGC D;  5E5A D;  3KWQ D;  4WU9 D;  3MGR D;  5AV9 A;  3AYW B;  5JA4 B;  5B1M A;  4Z66 B;  3MGS A;  1U35 A;  1ZLA C;  1N1J A;  1TZY C;  3REI D;  5DNN B;  5JRG B;  5B24 B;  5BNX B;  3B0C W;  5B2I D;  1P3G C;  1EQZ B;  4KUD A;  3C1B B;  4J8X D;  3X1S D;  4H9Q B;  3W99 D;  3AZM D;  4Z5T C;  4Z2M H;  5CP6 B;  3KXB B;  4XUJ B;  3REJ D;  5AVB C;  5AV9 D;  1P3L A;  3VH5 T;  3C1B C;  5DNN D;  4WU9 C;  3AYW C;  5BNX A;  2RVQ D;  2PYO B;  4YS3 D;  1P3I C;  4EO5 C;  3UTB C;  3C1B A;  2CV5 D;  1HQ3 D;  3WA9 D;  4UUZ A;  1F66 D;  1H3O B;  5AVC D;  3AZG B;  5AV8 C;  3AYW A;  1BH9 B;  3LZ1 B;  5B2J C;  3AV1 D;  1F66 B;  1B6W A;  3W98 B;  3W99 C;  3C1C D;  3AV2 D;  4LD9 C;  3LJA D;  3UTA A;  3KXB C;  3A6N D;  5AVB D;  1M1A C;  5E5A B;  3AZK C;  1S32 B;  5B24 D;  3MNN A;  3O62 A;  4KGC C;  5B1M D;  3KWQ C;  3MGQ A;  4HGA C;  5B33 C;  3KSY A;  5CPJ A;  3X1T A;  1P3F D;  3REI A;  3VH6 A;  2BYK A;  5CPK A;  3UTA C;  4ZBJ B;  4J8W D;  4H9P A;  1M19 B;  1R4V A;  3AYW D;  5GT3 A;  3MNN C;  3NQJ B;  3AZN D;  2PYO C;  5CHL B;  5CPJ C;  5B2I C;  3AZM B;  4G91 C;  3AN2 A;  3TU4 B;  5AV8 D;  1P3A D;  5GT3 C;  5GXQ A;  1P3L D;  1M19 C;  3AZJ B;  4Z2M G;  1P3F A;  3UT9 A;  3UT9 B;  3VH6 W;  3LJA C;  5DNN C;  3B6F B;  5E5A C;  3TU4 C;  2NQB D;  3MGR C;  3MGP C;  3KWQ B;  5B33 D;  1P3F C;  4YM6 B;  5B32 A;  4X23 A;  3REL C;  2RVQ C;  3WKJ D;  3W98 D;  1P3G A;  1ZLA D;  3TU4 A;  2CV5 C;  3WA9 C;  4Z5T A;  3NQJ A;  3MVD A;  2HIO B;  2CV5 A;  5BS7 A;  1P3L C;  3V9R B;  3C1C C;  4CSR A;  4LD9 D;  5B0Y B;  4ZUX A;  3R45 A;  4EO5 B;  1AOI A;  1WWS A;  5F99 B;  1KX5 A;  3O62 B;  3X1U A;  4J8W A;  4J8W B;  1P3P C;  3W98 A;  3MVD C;  5F99 A;  4WU8 B;  3W96 D;  1AOI B;  1BH9 A;  2NQB C;  4G92 B;  5BO0 A;  3REL D;  3AZJ D;  3AZN C;  3W98 C;  5F99 C;  3B0D B;  3AZG A;  5CPI A;  4NE5 A;  5JRG C;  3AZK B;  2ARO B; 
#chains in the Genus database with same CATH topology
 3W97 C;  3REK D;  5B40 C;  3AZG C;  1HQ3 A;  2F8N H;  1P3L B;  3KWQ A;  3MGQ C;  1P3A A;  3KUY B;  4J8V D;  3W99 B;  3AZL C;  1P3P D;  5GSU A;  4H9O A;  3W97 B;  4YM6 D;  4G91 B;  2F8N A;  1M18 A;  1KX4 D;  3WTP A;  3WAA A;  4KGC B;  1TAF B;  5B24 A;  3MNN D;  3AZL A;  3AZJ C;  3AZN B;  1F1E A;  5CPJ D;  3X1T D;  1ID3 D;  5GXQ C;  1EQZ A;  5B1M B;  5JA4 A;  4Z66 A;  3MGS B;  3AZM A;  1U35 B;  1BH8 A;  3WAA C;  3WTP C;  5DNM A;  5GT0 B;  4AWL B;  5AV8 B;  2Y2Q A;  3W97 D;  3AZI D;  4H9P B;  4DRA A;  4R8P A;  5AY8 B;  3AZE D;  3REL B;  3REI B;  5B31 C;  1PZR A;  1W2E A;  4JJN C;  3MGR A;  4H9S A;  3MGQ B;  1KX4 A;  4H9N B;  3W96 B;  3REL A;  3AZL D;  4R8P C;  2YFV A;  3AZF A;  2W8S A;  3AZH C;  2BYM A;  5B31 A;  3A6N B;  1ID3 A;  4XUJ D;  3WA9 A;  1F66 A;  1KX4 C;  4QLC C;  2NZD A;  1BH8 B;  4ZBJ C;  3LEL D;  4J8U C;  4DRB A;  4KHA B;  3REK A;  1H3O A;  1ID3 C;  2FJ7 B;  2F8N K;  5G49 B;  1TAF A;  3H0R C;  1P3O D;  4J8X C;  3WTP B;  3WAA B;  3REJ A;  2G5I C;  1M18 B;  1AOI C;  4E44 A;  4AWL C;  3AZG D;  4WV4 B;  2FJ7 D;  3IP4 C;  5GSU B;  2Y2K A;  5AY8 C;  2F8N B;  3VH5 W;  4J8X A;  3LEL B;  2DQN C;  4XZQ B;  3W99 A;  3LZ1 D;  3W96 C;  3KUY A;  3B6F C;  4LD9 A;  3KXB A;  5B2I B;  3MGP B;  1EQZ D;  4WNN B;  1HQ3 B;  3AZK A;  1P3K B;  4H9Q A;  5CPI C;  4YS3 C;  1P3I D;  1KX5 D;  5F99 D;  3X1T C;  2Y2N A;  3LEL C;  5GXQ D;  2F8N G;  5B40 A;  5AVC C;  1S32 D;  1T3U A;  3LJA B;  3B0C T;  4WU8 A;  2XD5 A;  5AV9 B;  1P34 A;  3MGQ D;  5BO0 B;  5GSU C;  4JJN D;  3AZF D;  3KXB D;  1P3B A;  1M1A D;  3X1S A;  3AZK D;  1KX3 D;  1P34 B;  4E45 A;  5FUG A;  5B1M C;  5B32 G;  1ZLA A;  2HIO A;  3MVD B;  2CV5 B;  5B0Y A;  1M1A B;  3LJA A;  3UTA D;  4QLC D;  1EQZ C;  2ZY4 A;  4J8U D;  4J8V B;  5DNM C;  2HIO C;  4JJN B;  3WTP D;  3WAA D;  3NQU A;  2NZD D;  5B0Z B;  5AVB B;  2Y2G A;  2FFF B;  5GT3 D;  3MGS C;  1U35 C;  1HTA A;  4XZQ D;  1TZY A;  3B6G B;  4WU9 A;  4KUD C;  4NE3 A;  3X1V D;  2HUE C;  1P3I A;  1P3I B;  2YFW B;  1KX3 C;  3MGP D;  1KX5 C;  5CPI D;  5AVB A;  1ULY A;  3WKJ C;  3LZ0 C;  3O62 D;  3AFA B;  2NQB A;  2JCH A;  3REH A;  1P3O C;  1P34 D;  3WKJ A;  1AOI D;  1P3B D;  2BYM B;  1M1A A;  3UTB B;  1ID3 B;  3AZF B;  2YFV B;  5BT1 C;  3REH C;  2BYK B;  5CPK B;  5AV6 C;  1S32 A;  3W96 A;  3EPH A;  2F8N D;  3UTA B;  3AFA D;  1S32 C;  3MVD D;  3LZ1 C;  2LY8 A;  4YS3 A;  2HUE B;  3B6F D;  2Y2L A;  1P3M C;  1Q9C A;  5AV6 A;  4M6B A;  2F2A C;  4CAY B;  3AZH B;  5GT0 A;  5AV5 B;  3LZ1 A;  4QLC B;  5BNV A;  2Y2I A;  4J8U B;  5B32 D;  4X23 D;  3REI C;  5KDM B;  1WWI A;  1P34 C;  1P3G D;  3MGS D;  1U35 D;  5B1L B;  3KFU G;  5CP6 C;  2BG1 A;  5B0Z D;  1P3B C;  2PYO A;  2IO5 B;  3MGP A;  5B2I A;  4KUD D;  5AV6 D;  1M18 D;  3B0B A;  4J8V C;  3X1V C;  5CP6 A;  2ZY3 A;  5AV9 C;  4H9R A;  3AZI B;  3P5J B;  2JSS A;  3AL0 C;  2ZY2 A;  3UT9 C;  3X1U D;  5CPI B;  5DNN A;  5B1L A;  3UTB D;  4KUD B;  5G49 A;  3H0M C;  5KDM A;  4QLC A;  2NZD C;  5B2J B;  5B32 C;  4NE6 A;  4X23 C;  4ZUX C;  4KHA A;  3REK B;  4J8U A;  5BNV B;  2ZY5 A;  2RIQ A;  5B1L C;  5CP6 D;  5BT1 D;  5C3I B;  1P3P B;  3REH D;  4WZS B;  3WA9 B;  3KUY D;  3X1U B;  3AFA C;  4YS3 B;  4CSR B;  4R8P D;  3H0L C;  4H9N A;  5AY8 A;  2JE5 A;  1P3M D;  3AZH D;  3C1C A;  3UTB A;  4XUJ C;  5AVC B;  4R8P B;  3X1U C;  1P3O A;  4J8W C;  1P3P A;  3REH B;  5AV8 A;  5DNM B;  3WKJ B;  2NQB B;  5GT0 D;  5B2J A;  1P3G B;  3AV1 B;  5B32 B;  4ZUX D;  4X23 B;  3AZN A;  5B0Z C;  1P3M B;  3AZL B;  2FJ7 C;  2YFW A;  5AY8 D;  1M19 D;  4KGC A;  1M18 C;  5B0Y D;  5B33 A;  2ARO C;  4H9O B;  3W97 A;  4H9R B;  3AZI A;  1P3F B;  5CPK C;  3AZJ A;  3AZE A;  3TU4 D;  1P3A B;  4WU9 B;  5GXQ B;  3AV2 A;  3UT9 D;  3B6G A;  2ARO A;  2UWX A;  1TZY B;  3NQU B;  3WTP E;  3LZ0 B;  5AV5 C;  4WU8 D;  1TZY D;  3B6G C;  1M19 A;  1JFI A;  4JJN A;  5B1L D;  4J8V A;  3X1V A;  3VH6 T;  1KX3 B;  5AV5 A;  5GSU D;  5FUG B;  4Z66 C;  3AZF C;  3AZH A;  4CAY A;  2CWE A;  5E5A A;  3AZM C;  1P3K D;  5AV6 B;  3AN2 D;  1P3B B;  1KX5 B;  3R45 B;  2G5H C;  2ARO D;  4UPK A;  4G92 C;  2IO5 C;  4HGA B;  3X1V B;  4ZUX B;  1BFM A;  1Z2C B;  4H9S C;  3V9R A;  4Z5T B;  1KX3 A;  1JFI B;  4UUZ B;  5DNM D;  2HIO D;  5AV5 D;  3LZ0 A;  5BS7 C;  5B40 B;  1F66 C;  4WNN A;  5JRG D;  1P3K A;  2Y2P A;  3AFA A;  4XZQ C;  4LD9 B;  3KUY C;  5B40 D;  3REK C;  3AZE B;  3B6F A;  4YM6 A;  4Z5T D;  3AV2 B;  3VH5 A;  5C3I C;  4J8X B;  1P3K C;  5B33 B;  5CPK D;  3REJ C;  4XUJ A;  1KU5 A;  4XZQ A;  3LEL A;  3C1B D;  4YM6 C;  2Y2M A;  3LZ0 D;  3O62 C;  5JRG A;  1P3M A;  3REJ B;  3AN2 B;  4WU8 C;  1A7W A;  5B0Z A;  1N1J B;  5GT0 C;  3AV1 A;  2PYO D;  3B6G D;  5GT3 B;  2FJ7 A;  2L5A A;  1HQ3 C;  2NZD B;  3X1S C;  5B31 B;  3A6N A;  1P3A C;  3X1T B;  1P3O B;  3C1C B;  3B0D C;  4NFT A;  4Z66 D;  3AZI C;  1B67 A;  5B2J D;  3AV1 C;  3A1I A;  3MNN B;  5B0Y C;  5AVC A;  3AZE C;  3AN2 C;  5CPJ B;  5B31 D;  5B31 G;  3AV2 C;  3MGR B;  1ZLA B;  3A6N C;  3X1S B;  1KX4 B;  5B24 C;  4KGC D;  5E5A D;  3KWQ D;  4WU9 D;  3MGR D;  5AV9 A;  3AYW B;  5JA4 B;  3F6T A;  5B1M A;  4Z66 B;  3MGS A;  1U35 A;  1N1J A;  1ZLA C;  1TZY C;  3REI D;  5DNN B;  5JRG B;  5B24 B;  2J8P A;  5BNX B;  3B0C W;  5B2I D;  3EPJ A;  1P3G C;  1EQZ B;  4KUD A;  2Y2O A;  3C1B B;  4J8X D;  3X1S D;  4H9Q B;  3W99 D;  3FDD A;  3AZM D;  4Z5T C;  4Z2M H;  5CP6 B;  3KXB B;  4XUJ B;  3A1K A;  3REJ D;  5AVB C;  5AV9 D;  3EG5 B;  1P3L A;  3VH5 T;  3C1B C;  5DNN D;  4WU9 C;  3AYW C;  5BNX A;  2RVQ D;  2PYO B;  4YS3 D;  1P3I C;  4EO5 C;  3UTB C;  3C1B A;  2CV5 D;  1HQ3 D;  3WA9 D;  4UUZ A;  1F66 D;  3EPL A;  1H3O B;  5AVC D;  3AZG B;  5AV8 C;  3AYW A;  1BH9 B;  3LZ1 B;  5B2J C;  3AV1 D;  1F66 B;  1B6W A;  3W98 B;  3W99 C;  3C1C D;  3AV2 D;  4LD9 C;  3LJA D;  3UTA A;  3KXB C;  3A6N D;  5AVB D;  1M1A C;  5E5A B;  3AZK C;  1S32 B;  5B24 D;  3MNN A;  3O62 A;  4KGC C;  5B1M D;  3KWQ C;  3MGQ A;  4HGA C;  5B33 C;  3KSY A;  5CPJ A;  3X1T A;  1P3F D;  4WJ3 C;  3REI A;  3VH6 A;  2BYK A;  5CPK A;  3UTA C;  4ZBJ B;  4J8W D;  4H9P A;  1M19 B;  1R4V A;  3AYW D;  5GT3 A;  3MNN C;  3NQJ B;  3AZN D;  2PYO C;  5CHL B;  5CPJ C;  5B2I C;  3AZM B;  2XD1 A;  4DQY B;  4G91 C;  3AN2 A;  3TU4 B;  5AV8 D;  1P3A D;  5GT3 C;  5GXQ A;  3EPK A;  1P3L D;  1M19 C;  3AZJ B;  4Z2M G;  1P3F A;  3UT9 A;  3UT9 B;  3VH6 W;  3LJA C;  5DNN C;  3B6F B;  5E5A C;  3TU4 C;  2NQB D;  2DF4 C;  3MGR C;  3MGP C;  3KWQ B;  5B33 D;  1P3F C;  4YM6 B;  5B32 A;  4X23 A;  3REL C;  2RVQ C;  3WKJ D;  3W98 D;  1P3G A;  1ZLA D;  3TU4 A;  2CV5 C;  3WA9 C;  2Y2J A;  4Z5T A;  2VQR A;  3NQJ A;  3MVD A;  2HIO B;  2CV5 A;  5BS7 A;  1P3L C;  2Y2H A;  3V9R B;  3C1C C;  4CSR A;  4LD9 D;  5B0Y B;  4ZUX A;  3R45 A;  4EO5 B;  2ZM5 A;  1AOI A;  1WWS A;  5F99 B;  1KX5 A;  3O62 B;  3X1U A;  4J8W A;  4J8W B;  1P3P C;  3W98 A;  3MVD C;  5F99 A;  4WU8 B;  3W96 D;  1AOI B;  1BH9 A;  2NQB C;  4G92 B;  5BO0 A;  3REL D;  3AZJ D;  3AZN C;  3W98 C;  5F99 C;  3B0D B;  3AZG A;  5CPI A;  4NE5 A;  5JRG C;  3AZK B;  2ARO B; 
#chains in the Genus database with same CATH homology
 3W97 C;  3REK D;  5B40 C;  3AZG C;  1HQ3 A;  2F8N H;  1P3L B;  3KWQ A;  3MGQ C;  1P3A A;  3KUY B;  4J8V D;  3W99 B;  3AZL C;  1P3P D;  5GSU A;  4H9O A;  3W97 B;  4YM6 D;  4G91 B;  2F8N A;  1M18 A;  1KX4 D;  3WTP A;  3WAA A;  4KGC B;  1TAF B;  5B24 A;  3MNN D;  3AZL A;  3AZJ C;  3AZN B;  1F1E A;  5CPJ D;  3X1T D;  1ID3 D;  5GXQ C;  1EQZ A;  5B1M B;  5JA4 A;  4Z66 A;  3MGS B;  3AZM A;  1U35 B;  1BH8 A;  3WAA C;  3WTP C;  5DNM A;  5GT0 B;  4AWL B;  5AV8 B;  2Y2Q A;  3W97 D;  3AZI D;  4H9P B;  4DRA A;  4R8P A;  5AY8 B;  3AZE D;  3REL B;  3REI B;  5B31 C;  1PZR A;  1W2E A;  4JJN C;  3MGR A;  4H9S A;  3MGQ B;  1KX4 A;  4H9N B;  3W96 B;  3REL A;  3AZL D;  4R8P C;  2YFV A;  3AZF A;  2W8S A;  3AZH C;  2BYM A;  5B31 A;  3A6N B;  1ID3 A;  4XUJ D;  3WA9 A;  1F66 A;  1KX4 C;  4QLC C;  2NZD A;  1BH8 B;  4ZBJ C;  3LEL D;  4J8U C;  4DRB A;  4KHA B;  3REK A;  1H3O A;  1ID3 C;  2FJ7 B;  2F8N K;  5G49 B;  1TAF A;  3H0R C;  1P3O D;  4J8X C;  3WTP B;  3WAA B;  3REJ A;  2G5I C;  1M18 B;  1AOI C;  4E44 A;  4AWL C;  3AZG D;  4WV4 B;  2FJ7 D;  3IP4 C;  5GSU B;  2Y2K A;  5AY8 C;  2F8N B;  3VH5 W;  4J8X A;  3LEL B;  2DQN C;  4XZQ B;  3W99 A;  3LZ1 D;  3W96 C;  3KUY A;  3B6F C;  4LD9 A;  3KXB A;  5B2I B;  3MGP B;  1EQZ D;  4WNN B;  1HQ3 B;  3AZK A;  1P3K B;  4H9Q A;  5CPI C;  4YS3 C;  1P3I D;  1KX5 D;  5F99 D;  3X1T C;  2Y2N A;  3LEL C;  5GXQ D;  2F8N G;  5B40 A;  5AVC C;  1S32 D;  1T3U A;  3LJA B;  3B0C T;  4WU8 A;  2XD5 A;  5AV9 B;  1P34 A;  3MGQ D;  5BO0 B;  5GSU C;  4JJN D;  3AZF D;  3KXB D;  1P3B A;  1M1A D;  3X1S A;  3AZK D;  1KX3 D;  1P34 B;  4E45 A;  5FUG A;  5B1M C;  5B32 G;  1ZLA A;  2HIO A;  3MVD B;  2CV5 B;  5B0Y A;  1M1A B;  3LJA A;  3UTA D;  4QLC D;  1EQZ C;  2ZY4 A;  4J8U D;  4J8V B;  5DNM C;  2HIO C;  4JJN B;  3WTP D;  3WAA D;  3NQU A;  2NZD D;  5B0Z B;  5AVB B;  2Y2G A;  2FFF B;  5GT3 D;  3MGS C;  1U35 C;  1HTA A;  4XZQ D;  1TZY A;  3B6G B;  4WU9 A;  4KUD C;  4NE3 A;  3X1V D;  2HUE C;  1P3I A;  1P3I B;  2YFW B;  1KX3 C;  3MGP D;  1KX5 C;  5CPI D;  5AVB A;  1ULY A;  3WKJ C;  3LZ0 C;  3O62 D;  3AFA B;  2NQB A;  2JCH A;  3REH A;  1P3O C;  1P34 D;  3WKJ A;  1AOI D;  1P3B D;  2BYM B;  1M1A A;  3UTB B;  1ID3 B;  3AZF B;  2YFV B;  5BT1 C;  3REH C;  2BYK B;  5CPK B;  5AV6 C;  1S32 A;  3W96 A;  3EPH A;  2F8N D;  3UTA B;  3AFA D;  1S32 C;  3MVD D;  3LZ1 C;  2LY8 A;  4YS3 A;  2HUE B;  3B6F D;  2Y2L A;  1P3M C;  1Q9C A;  5AV6 A;  4M6B A;  2F2A C;  4CAY B;  3AZH B;  5GT0 A;  5AV5 B;  3LZ1 A;  4QLC B;  5BNV A;  2Y2I A;  4J8U B;  5B32 D;  4X23 D;  3REI C;  5KDM B;  1WWI A;  1P34 C;  1P3G D;  3MGS D;  1U35 D;  5B1L B;  3KFU G;  5CP6 C;  2BG1 A;  5B0Z D;  1P3B C;  2PYO A;  2IO5 B;  3MGP A;  5B2I A;  4KUD D;  5AV6 D;  1M18 D;  3B0B A;  4J8V C;  3X1V C;  5CP6 A;  2ZY3 A;  5AV9 C;  4H9R A;  3AZI B;  3P5J B;  2JSS A;  3AL0 C;  2ZY2 A;  3UT9 C;  3X1U D;  5CPI B;  5DNN A;  5B1L A;  3UTB D;  4KUD B;  5G49 A;  3H0M C;  5KDM A;  4QLC A;  2NZD C;  5B2J B;  5B32 C;  4NE6 A;  4X23 C;  4ZUX C;  4KHA A;  3REK B;  4J8U A;  5BNV B;  2ZY5 A;  2RIQ A;  5B1L C;  5CP6 D;  5BT1 D;  5C3I B;  1P3P B;  3REH D;  4WZS B;  3WA9 B;  3KUY D;  3X1U B;  3AFA C;  4YS3 B;  4CSR B;  4R8P D;  3H0L C;  4H9N A;  5AY8 A;  2JE5 A;  1P3M D;  3AZH D;  3C1C A;  3UTB A;  4XUJ C;  5AVC B;  4R8P B;  3X1U C;  1P3O A;  4J8W C;  1P3P A;  3REH B;  5AV8 A;  5DNM B;  3WKJ B;  2NQB B;  5GT0 D;  5B2J A;  1P3G B;  3AV1 B;  5B32 B;  4ZUX D;  4X23 B;  3AZN A;  5B0Z C;  1P3M B;  3AZL B;  2FJ7 C;  2YFW A;  5AY8 D;  1M19 D;  4KGC A;  1M18 C;  5B0Y D;  5B33 A;  2ARO C;  4H9O B;  3W97 A;  4H9R B;  3AZI A;  1P3F B;  5CPK C;  3AZJ A;  3AZE A;  3TU4 D;  1P3A B;  4WU9 B;  5GXQ B;  3AV2 A;  3UT9 D;  3B6G A;  2ARO A;  2UWX A;  1TZY B;  3NQU B;  3WTP E;  3LZ0 B;  5AV5 C;  4WU8 D;  1TZY D;  3B6G C;  1M19 A;  1JFI A;  4JJN A;  5B1L D;  4J8V A;  3X1V A;  3VH6 T;  1KX3 B;  5AV5 A;  5GSU D;  5FUG B;  4Z66 C;  3AZF C;  3AZH A;  4CAY A;  2CWE A;  5E5A A;  3AZM C;  1P3K D;  5AV6 B;  3AN2 D;  1P3B B;  1KX5 B;  3R45 B;  2G5H C;  2ARO D;  4UPK A;  4G92 C;  2IO5 C;  4HGA B;  3X1V B;  4ZUX B;  1BFM A;  1Z2C B;  4H9S C;  3V9R A;  4Z5T B;  1KX3 A;  1JFI B;  4UUZ B;  5DNM D;  2HIO D;  5AV5 D;  3LZ0 A;  5BS7 C;  5B40 B;  1F66 C;  4WNN A;  5JRG D;  1P3K A;  2Y2P A;  3AFA A;  4XZQ C;  4LD9 B;  3KUY C;  5B40 D;  3REK C;  3AZE B;  3B6F A;  4YM6 A;  4Z5T D;  3AV2 B;  3VH5 A;  5C3I C;  4J8X B;  1P3K C;  5B33 B;  5CPK D;  3REJ C;  4XUJ A;  1KU5 A;  4XZQ A;  3LEL A;  3C1B D;  4YM6 C;  2Y2M A;  3LZ0 D;  3O62 C;  5JRG A;  1P3M A;  3REJ B;  3AN2 B;  4WU8 C;  1A7W A;  5B0Z A;  1N1J B;  5GT0 C;  3AV1 A;  2PYO D;  3B6G D;  5GT3 B;  2FJ7 A;  2L5A A;  1HQ3 C;  2NZD B;  3X1S C;  5B31 B;  3A6N A;  1P3A C;  3X1T B;  1P3O B;  3C1C B;  3B0D C;  4NFT A;  4Z66 D;  3AZI C;  1B67 A;  5B2J D;  3AV1 C;  3A1I A;  3MNN B;  5B0Y C;  5AVC A;  3AZE C;  3AN2 C;  5CPJ B;  5B31 D;  5B31 G;  3AV2 C;  3MGR B;  1ZLA B;  3A6N C;  3X1S B;  1KX4 B;  5B24 C;  4KGC D;  5E5A D;  3KWQ D;  4WU9 D;  3MGR D;  5AV9 A;  3AYW B;  5JA4 B;  3F6T A;  5B1M A;  4Z66 B;  3MGS A;  1U35 A;  1N1J A;  1ZLA C;  1TZY C;  3REI D;  5DNN B;  5JRG B;  5B24 B;  2J8P A;  5BNX B;  3B0C W;  5B2I D;  3EPJ A;  1P3G C;  1EQZ B;  4KUD A;  2Y2O A;  3C1B B;  4J8X D;  3X1S D;  4H9Q B;  3W99 D;  3FDD A;  3AZM D;  4Z5T C;  4Z2M H;  5CP6 B;  3KXB B;  4XUJ B;  3A1K A;  3REJ D;  5AVB C;  5AV9 D;  3EG5 B;  1P3L A;  3VH5 T;  3C1B C;  5DNN D;  4WU9 C;  3AYW C;  5BNX A;  2RVQ D;  2PYO B;  4YS3 D;  1P3I C;  4EO5 C;  3UTB C;  3C1B A;  2CV5 D;  1HQ3 D;  3WA9 D;  4UUZ A;  1F66 D;  3EPL A;  1H3O B;  5AVC D;  3AZG B;  5AV8 C;  3AYW A;  1BH9 B;  3LZ1 B;  5B2J C;  3AV1 D;  1F66 B;  1B6W A;  3W98 B;  3W99 C;  3C1C D;  3AV2 D;  4LD9 C;  3LJA D;  3UTA A;  3KXB C;  3A6N D;  5AVB D;  1M1A C;  5E5A B;  3AZK C;  1S32 B;  5B24 D;  3MNN A;  3O62 A;  4KGC C;  5B1M D;  3KWQ C;  3MGQ A;  4HGA C;  5B33 C;  3KSY A;  5CPJ A;  3X1T A;  1P3F D;  4WJ3 C;  3REI A;  3VH6 A;  2BYK A;  5CPK A;  3UTA C;  4ZBJ B;  4J8W D;  4H9P A;  1M19 B;  1R4V A;  3AYW D;  5GT3 A;  3MNN C;  3NQJ B;  3AZN D;  2PYO C;  5CHL B;  5CPJ C;  5B2I C;  3AZM B;  2XD1 A;  4DQY B;  4G91 C;  3AN2 A;  3TU4 B;  5AV8 D;  1P3A D;  5GT3 C;  5GXQ A;  3EPK A;  1P3L D;  1M19 C;  3AZJ B;  4Z2M G;  1P3F A;  3UT9 A;  3UT9 B;  3VH6 W;  3LJA C;  5DNN C;  3B6F B;  5E5A C;  3TU4 C;  2NQB D;  2DF4 C;  3MGR C;  3MGP C;  3KWQ B;  5B33 D;  1P3F C;  4YM6 B;  5B32 A;  4X23 A;  3REL C;  2RVQ C;  3WKJ D;  3W98 D;  1P3G A;  1ZLA D;  3TU4 A;  2CV5 C;  3WA9 C;  2Y2J A;  4Z5T A;  2VQR A;  3NQJ A;  3MVD A;  2HIO B;  2CV5 A;  5BS7 A;  1P3L C;  2Y2H A;  3V9R B;  3C1C C;  4CSR A;  4LD9 D;  5B0Y B;  4ZUX A;  3R45 A;  4EO5 B;  2ZM5 A;  1AOI A;  1WWS A;  5F99 B;  1KX5 A;  3O62 B;  3X1U A;  4J8W A;  4J8W B;  1P3P C;  3W98 A;  3MVD C;  5F99 A;  4WU8 B;  3W96 D;  1AOI B;  1BH9 A;  2NQB C;  4G92 B;  5BO0 A;  3REL D;  3AZJ D;  3AZN C;  3W98 C;  5F99 C;  3B0D B;  3AZG A;  5CPI A;  4NE5 A;  5JRG C;  3AZK B;  2ARO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...