1EQZB

X-ray structure of the nucleosome core particle at 2.5 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
b'VTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146 NUCLEOTIDES LONG DNA
publication title Asymmetries in the nucleosome core particle at 2.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein/dna
total genus 33
structure length 108
sequence length 108
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1eqzB00
1P34B 5B31G 1WWIA 3X1TB 1JFIA 2CV5A 1S32C 4XZQB 4XUJD 2NQBD 3AZID 3AZJC 2CV5B 5E5AA 3X1TC 5CPIB 4XZQC 3V9RA 4H9PA 4CSRB 3KXBD 5E5AB 2NZDD 2CV5C 5F99A 3MVDA 5CPIC 3V9RB 4JJNA 4ZUXA 4J8UD 2YFVA 3AZMA 3MVDB 5E5AC 3LELD 4WZSB 5B2IA 1M18A 1HQ3D 5AV6A 4JJNB 4ZUXB 2YFVB 3AZLB 3B0BA 1P3GD 5B2IB 5F99C 3MVDC 5AV6B 4JJNC 4ZUXC 3WAAA 4J8WD 1P3MD 5GT0A 3AV1A 5B2IC 5JRGA 4KUDD 5AV6C 4YM6A 3LZ0D 3AZHD 5JA4B 3RELD 4KGCA 3AN2D 3B6GD 3B0CW 4H9RA 2RVQD 4M6BA 3WAAC 4DRBA 5GT0C 3AV1C 4H9RB 4EO5B 3REJD 5CPJA 1BH9A 2F8NA 3REHA 1P3OB 3X1VB 5CPJB 3W99B 5G49B 3MGRD 5B0ZD 4E44A 2YFWB 1P3KA 2F8NB 3O62B 4J8XD 1P3OC 5CPJC 2PYOA 1P3FA 1P3KB 4DRAA 4WNNB 4LD9A 3A6NA 1P3IA 4WU9D 1P3FB 4WU8B 5DNMA 1P3KC 3WKJD 3A6NB 3AFAD 1P3IB 5B1MA 5BS7C 1P3FC 5DNMB 1P3LD 3UT9B 2HUEB 1P3BA 3A6NC 5AV9B 1P3IC 2AROD 3REKB 5DNMC 1P3BB 3UT9C 2HUEC 3X1SA 3LJAB 5AV9C 3B6FD 5B1MC 3REKC 1B67A 4H9SA 3WA9B 5B24A 1P3BC 5AY8D 3LJAC 3UTAD 4Z66B 2HIOB 4G92B 5B1LB 4H9NA 5B0YB 5B24B 1U35D 2CWEA 1F66A 4Z66C 2HIOC 4H9NB 4G92C 4H9SC 1BH8A 5B24C 1ZLAA 5CP6A 4X23A 3AZFA 1BH8B 3AZKD 4CAYA 1ZLAB 5B33D 3MGQA 5BO0A 5CP6B 4X23B 3AZFB 1M19A 1N1JA 1ZLAC 3VH5T 5BO0B 4YS3D 1M19B 1ID3A 5CP6C 4X23C 3AZFC 1KX4A 1KX5A 1S32D 3TU4A 1ID3B 2LY8A 1M19C 3AZJD 1KX4B 1KX5B 3X1TD 3TU4B 5CPKB 5CHLB 5B32G 3WTPB 3MGSA 1ID3C 5B40B 1KX5C 3KSYA 1KX4C 2CV5D 1P34A 3TU4C 5AVCB 3AV2B 3WTPC 1KU5A 5GT3B 3MGPB 5E5AD 5B40C 4XZQA 5BNXB 5AVCC 3MGSC 4R8PA 2L5AA 5GT3C 5F99D 3W96A 3MGPC 1P34C 5CPIA 4JJND 4ZUXD 4R8PB 3AZMD 4CSRA 3W98D 3WTPE 3W96B 5B2ID 1P3AA 1M18D 5AV6D 4QLCB 1M1AA 4R8PC 3W97A 3W96C 1TZYA 1P3AB 2F8NH 1M1AB 3MNNA 3AZLA 5BT1C 4WV4B 3W97B 4QLCC 3WAAD 1TZYB 5GT0D 3AV1D 5JRGD 1P3AC 4YM6D 3MNNB 5AVBB 1M1AC 4KGCD 3W97C 5AV5B 5AV8B 1TZYC 2FJ7A 5KDMB 3MNNC 3AZLC 5AVBC 5JA4A 5B2JB 5AV5C 2FJ7B 5AV8C 3KWQA 5CPJD 3AYWD 3VH5A 3KWQB 2F8ND 3REHD 2BYKA 4UUZA 2FJ7C 2JSSA 4XUJB 2NQBB 1P3KD 5DNND 2BYKB 4UUZB 3KWQC 1P3OA 3X1VA 3W99A 3VH6A 5G49A 2PYOD 2YFWA 4XUJC 1WWSA 4LD9D 3A6ND 3O62A 1P3ID 4EO5C 2NZDB 4WNNA 4NFTA 4J8VA 3X1VC 3W99C 5BS7A 5B1MD 4WU8A 3NQUA 1P3BD 4J8VB 3O62C 3NQUB 3UT9A 4KUDA 3X1SD 3B0DB 4J8VC 5AV9A 1P3MB 4H9QB 3REKA 4WU8C 4KUDB 3LZ0B 5B24D 3AZHB 5B32D 3RELB 3LJAA 3B0DC 4ZBJB 5GSUA 5BNVB 3B6GB 3WA9A 1HTAA 4KUDC 3LZ0C 1F66D 3RELC 4ZBJC 4Z66A 2HIOA 5GSUB 5B1LA 5B0YA 2F8NG 1P3PD 5CP6D 4X23D 3AZFD 5GSUC 3WA9C 1EQZA 5B0ZB 3MGQD 5B1LC 4J8XB 5B0YC 1EQZB 2BYMB 1ID3D 2IO5B 1KX4D 4WU9B 4J8XC 3TU4D 1EQZC 3AFAB 1AOID 2IO5C 4KHAA 4WU9C 3MGSD 1P34D 4KHAB 2AROB 5CPKA 3B6FA 3WTPA 3AZGA 1KX3A 5GXQA 5B40A 5B31A 3X1UA 4XZQD 3B6FB 2AROC 5AVCA 3AV2A 3AZGB 1F1EA 1KX3B 5GXQB 4R8PD 5B31B 5GT3A 1BFMA 1S32B 3X1UB 3VH5W 5AY8B 3MGPA 3W96D 5CPID 5CPKC 1R4VA 5BNXA 3B6FC 3AZGC 1U35B 1KX3C 5GXQC 5B31C 3X1UC 5AY8C 1P3AD 3R45A 3AV2C 1U35C 3AZKA 3VH6W 1H3OA 3MVDD 1TZYD 3R45B 3MNND 3AZLD 4QLCA 3AZKB 1H3OB 3NQJA 4AWLB 3AZNA 4Z5TA 3NQJB 3AZKC 1ULYA 3AZNB 4YS3B 2FJ7D 4Z5TB 5AVBA 5AV5A 5AV8A 3UTBA 3AZNC 4YS3C 3C1BA 5FUGA 3KWQD 5KDMA 3KUYA 3REIA 1TAFB 4Z5TC 3AZJB 5B2JA 3UTBB 3AZEA 3LZ1A 5FUGB 4NE5A 3KUYB 3C1BB 3REIB 3C1CA 1JFIB 1B6WA 4NE6A 3AZEB 3LZ1B 3UTBC 5C3IB 3C1BC 3KUYC 3C1CB 3REIC 1P3OD 3X1VD 3W99D 4XUJA 5B2JC 2NQBA 3AZEC 3LZ1C 4H9PB 3AZIA 5C3IC 3O62D 3C1CC 3W98A 5F99B 3AZIB 3AZMB 3W98B 4J8VD 3KXBA 2NZDA 3B0CT 1P3FD 4WU8D 1M18B 2NQBC 4J8UA 3AZIC 3AZMC 4H9OA 3KXBB 3W98C 3LELA 5DNMD 1HQ3A 3UT9D 1M18C 4J8UB 4H9OB 4Z2MH 5AV9D 3KXBC 3LELB 1P3GA 5GT0B 3AV1B 3WAAB 5JRGB 2NZDC 3REKD 1HQ3B 4YM6B 4J8UC 3LJAD 4KGCB 1P3GB 4J8WA 1P3MA 3LELC 5GSUD 4H9QA 5JRGC 1HQ3C 3WA9D 4YM6C 3LZ0A 3AYWA 3AZHA 3RELA 4E45A 4J8WB 3AN2A 4KGCC 1P3GC 4Z66D 2HIOD 5B1LD 5BNVA 5B0YD 3AYWB 3B6GA 3AN2B 4J8WC 1BH9B 1P3MC 5DNNA 3REHB 1A7WA 3REJA 3AZHC 3AYWC 1EQZD 3AN2C 5DNNB 3REJB 3REHC 3B6GC 1ZLAD 3MGRA 2RVQC 2PYOB 5B0ZA 5DNNC 4LD9B 1Q9CA 3REJC 4J8XA 3MGRB 4G91B 2PYOC 2BYMA 1M19D 4LD9C 4WU9A 5B1MB 3MGRC 5B0ZC 4G91C 3WKJA 3AFAA 1KX5D 2F8NK 5CPKD 3WTPD 1P3LA 3WKJB 3AZGD 1KX3D 5GXQD 5B40D 5B31D 5B32A 3X1SB 3X1UD 2AROA 5AVCD 3AV2D 1P3LB 3WKJC 5GT3D 5B32B 3AFAC 3MGPD 3X1SC 1P3LC 1F66B 5B32C 1P3PA 5AY8A 3UTAA 1U35A 4HGAB 1P3PB 1F66C 3UTAB 4Z2MG 5BT1D 4QLCD 4CAYB 4HGAC 3AZND 1P3PC 3UTAC 3MGQB 4Z5TD 1N1JB 1M1AD 3W97D 5B33A 4NE3A 3MGQC 1AOIA 5AVBD 5B33B 5AV5D 3VH6T 5AV8D 3UTBD 4YS3A 3C1BD 3KUYD 3REID 1AOIB 1S32A 5B2JD 5B33C 4AWLC 3MGSB 3AZED 3LZ1D 3C1CD 3AZJA 1AOIC 1TAFA 3X1TA
chains in the Genus database with same CATH superfamily
1P34B 5B31G 1WWIA 2Y2OA 3X1TB 1JFIA 2CV5A 1S32C 4XZQB 4XUJD 2NQBD 3AZID 3AZJC 2CV5B 5E5AA 3X1TC 5CPIB 4XZQC 3V9RA 3F6TA 4H9PA 4CSRB 3KXBD 5E5AB 2NZDD 2CV5C 5F99A 2Y2GA 3MVDA 2XD1A 5CPIC 3V9RB 4JJNA 4ZUXA 4J8UD 2YFVA 3AZMA 3MVDB 5E5AC 3LELD 4WZSB 5B2IA 1M18A 1HQ3D 5AV6A 4JJNB 4ZUXB 2YFVB 3AZLB 3B0BA 1P3GD 5B2IB 5F99C 3MVDC 5AV6B 4JJNC 4ZUXC 3WAAA 4J8WD 1P3MD 5GT0A 3AV1A 5B2IC 5JRGA 3KFUG 4KUDD 5AV6C 4YM6A 3LZ0D 3EPKA 3AZHD 5JA4B 3RELD 4KGCA 3AN2D 3B6GD 2Y2MA 3B0CW 4H9RA 2RVQD 4M6BA 3WAAC 2Y2IA 4DRBA 5GT0C 3AV1C 4H9RB 4EO5B 3REJD 5CPJA 1BH9A 2F8NA 3REHA 1P3OB 3X1VB 5CPJB 3W99B 2Y2PA 5G49B 3MGRD 5B0ZD 4E44A 2YFWB 1P3KA 2F8NB 3O62B 4J8XD 1P3OC 5CPJC 2PYOA 1P3FA 1P3KB 4DRAA 4WNNB 4LD9A 3A6NA 3A1KA 1P3IA 4WU9D 1P3FB 4WU8B 5DNMA 1P3KC 3WKJD 3A6NB 3AFAD 1P3IB 2VQRA 5B1MA 5BS7C 1P3FC 2BG1A 5DNMB 1P3LD 3UT9B 2HUEB 1P3BA 3A6NC 5AV9B 1P3IC 2AROD 3REKB 5DNMC 1P3BB 3UT9C 2HUEC 3X1SA 3LJAB 5AV9C 3B6FD 5B1MC 3REKC 1B67A 4H9SA 3WA9B 5B24A 1P3BC 2UWXA 5AY8D 3LJAC 3UTAD 4Z66B 2HIOB 4G92B 5B1LB 4H9NA 5B0YB 5B24B 1U35D 2CWEA 1F66A 4Z66C 2HIOC 4H9NB 4G92C 4H9SC 1BH8A 5B24C 1ZLAA 2ZY5A 5CP6A 4X23A 3AZFA 1BH8B 3AZKD 4CAYA 1ZLAB 5B33D 3MGQA 5BO0A 5CP6B 4X23B 3EPLA 3AZFB 1M19A 1N1JA 1ZLAC 3VH5T 5BO0B 4YS3D 1M19B 1ID3A 5CP6C 4X23C 3AZFC 1KX4A 1KX5A 1S32D 3TU4A 3AL0C 1ID3B 2LY8A 1M19C 3AZJD 1KX4B 1KX5B 3X1TD 3TU4B 5CPKB 5CHLB 5B32G 3WTPB 3MGSA 1ID3C 5B40B 1KX5C 3KSYA 1KX4C 2CV5D 1P34A 4WJ3C 3TU4C 4UPKA 5AVCB 3AV2B 1Z2CB 3WTPC 1KU5A 5GT3B 3MGPB 5E5AD 5B40C 4XZQA 2Y2LA 5BNXB 5AVCC 3MGSC 4R8PA 2L5AA 2JE5A 5GT3C 5F99D 3W96A 3MGPC 1P34C 5CPIA 4JJND 4ZUXD 4R8PB 3AZMD 4CSRA 3W98D 3WTPE 3W96B 5B2ID 1P3AA 1M18D 5AV6D 4QLCB 1M1AA 4R8PC 3W97A 3W96C 1TZYA 1P3AB 2F8NH 1M1AB 3MNNA 3AZLA 5BT1C 4WV4B 3W97B 4QLCC 3WAAD 1TZYB 5GT0D 3AV1D 5JRGD 1P3AC 4YM6D 3MNNB 5AVBB 1M1AC 4KGCD 3W97C 5AV5B 5AV8B 1TZYC 2FJ7A 5KDMB 3MNNC 3AZLC 2G5HC 5AVBC 5JA4A 5B2JB 5AV5C 2FJ7B 5AV8C 3KWQA 5CPJD 3AYWD 3VH5A 3KWQB 2F8ND 3REHD 2BYKA 4UUZA 2FJ7C 2JSSA 4XUJB 2NQBB 1P3KD 5DNND 2BYKB 4UUZB 3KWQC 2W8SA 1P3OA 3X1VA 3W99A 3VH6A 5G49A 2PYOD 2YFWA 4DQYB 4XUJC 1WWSA 4LD9D 3A6ND 3O62A 1P3ID 4EO5C 2NZDB 4WNNA 4NFTA 4J8VA 3X1VC 3W99C 5BS7A 5B1MD 4WU8A 3NQUA 1P3BD 4J8VB 3EG5B 3O62C 2DF4C 3H0LC 3NQUB 3UT9A 4KUDA 3X1SD 3B0DB 4J8VC 5AV9A 1P3MB 4H9QB 3REKA 2Y2NA 4WU8C 4KUDB 3H0MC 3LZ0B 5B24D 3AZHB 5B32D 3RELB 3LJAA 3B0DC 4ZBJB 5GSUA 2JCHA 5BNVB 3B6GB 3WA9A 1HTAA 4KUDC 3LZ0C 1F66D 3RELC 4ZBJC 4Z66A 2HIOA 2Y2HA 5GSUB 5B1LA 5B0YA 2F8NG 1P3PD 5CP6D 4X23D 3AZFD 5GSUC 3WA9C 2ZY3A 2Y2QA 1EQZA 5B0ZB 3MGQD 5B1LC 4J8XB 5B0YC 1EQZB 2BYMB 1ID3D 2IO5B 1KX4D 4WU9B 4J8XC 3TU4D 1EQZC 3AFAB 1AOID 2IO5C 1W2EA 4KHAA 4WU9C 3MGSD 2FFFB 1P34D 4KHAB 2AROB 5CPKA 3B6FA 3WTPA 3AZGA 1KX3A 5GXQA 5B40A 5B31A 2DQNC 3X1UA 4XZQD 3B6FB 2AROC 5AVCA 3AV2A 3AZGB 1F1EA 1KX3B 5GXQB 4R8PD 5B31B 5GT3A 1BFMA 1S32B 3X1UB 3VH5W 5AY8B 3MGPA 3W96D 5CPID 5CPKC 1R4VA 5BNXA 3B6FC 3AZGC 1U35B 1KX3C 5GXQC 5B31C 3X1UC 5AY8C 1P3AD 3R45A 3AV2C 1U35C 3AZKA 3VH6W 1H3OA 3MVDD 1TZYD 3R45B 3MNND 3AZLD 4QLCA 3AZKB 1H3OB 3NQJA 4AWLB 3AZNA 4Z5TA 3NQJB 3H0RC 1ULYA 2ZM5A 3AZKC 2ZY2A 3AZNB 4YS3B 2FJ7D 4Z5TB 5AVBA 2ZY4A 5AV5A 5AV8A 3UTBA 3AZNC 4YS3C 3C1BA 5FUGA 3KWQD 5KDMA 3KUYA 3REIA 1TAFB 4Z5TC 3AZJB 5B2JA 3UTBB 3AZEA 3LZ1A 5FUGB 4NE5A 3KUYB 3C1BB 3REIB 3C1CA 1JFIB 1B6WA 4NE6A 3AZEB 3LZ1B 3UTBC 5C3IB 3C1BC 3KUYC 3C1CB 3REIC 1P3OD 3X1VD 3W99D 4XUJA 5B2JC 2NQBA 3AZEC 3LZ1C 4H9PB 3AZIA 5C3IC 3O62D 3C1CC 3W98A 5F99B 3AZIB 3AZMB 3W98B 4J8VD 3KXBA 2NZDA 3B0CT 1P3FD 4WU8D 1M18B 2NQBC 2J8PA 4J8UA 3AZIC 3AZMC 4H9OA 3KXBB 3W98C 3LELA 5DNMD 1HQ3A 3UT9D 1M18C 4J8UB 4H9OB 4Z2MH 5AV9D 3KXBC 3LELB 1P3GA 5GT0B 3AV1B 3WAAB 5JRGB 2NZDC 3REKD 1HQ3B 4YM6B 1T3UA 4J8UC 3LJAD 4KGCB 1P3GB 4J8WA 1P3MA 3LELC 5GSUD 4H9QA 5JRGC 1HQ3C 3WA9D 4YM6C 3LZ0A 3EPJA 3AYWA 3AZHA 3RELA 4E45A 4J8WB 3AN2A 4KGCC 1P3GC 4Z66D 2HIOD 5B1LD 1PZRA 5BNVA 5B0YD 3AYWB 3B6GA 3AN2B 4J8WC 1BH9B 1P3MC 5DNNA 3REHB 2F2AC 1A7WA 2XD5A 3REJA 3FDDA 3AZHC 3AYWC 1EQZD 3AN2C 5DNNB 3REJB 3REHC 3B6GC 1ZLAD 3MGRA 2RVQC 2PYOB 5B0ZA 5DNNC 4LD9B 1Q9CA 3REJC 4J8XA 3MGRB 4G91B 2PYOC 2BYMA 1M19D 4LD9C 4WU9A 5B1MB 3MGRC 5B0ZC 4G91C 3WKJA 3AFAA 1KX5D 2F8NK 5CPKD 3WTPD 1P3LA 3WKJB 3AZGD 1KX3D 5GXQD 2Y2KA 5B40D 5B32A 5B31D 3X1SB 3X1UD 2AROA 3A1IA 5AVCD 3AV2D 1P3LB 3IP4C 3WKJC 5GT3D 5B32B 2RIQA 3AFAC 3MGPD 3X1SC 1P3LC 1F66B 5B32C 1P3PA 5AY8A 3UTAA 1U35A 4HGAB 1P3PB 1F66C 3UTAB 4Z2MG 5BT1D 4QLCD 4CAYB 4HGAC 2G5IC 3AZND 1P3PC 3UTAC 3MGQB 4Z5TD 1N1JB 1M1AD 3P5JB 3W97D 5B33A 4NE3A 3MGQC 1AOIA 5AVBD 5B33B 3EPHA 5AV5D 3VH6T 5AV8D 3UTBD 4YS3A 3C1BD 3KUYD 3REID 1AOIB 1S32A 5B2JD 5B33C 4AWLC 3MGSB 3AZED 3LZ1D 2Y2JA 3C1CD 3AZJA 1AOIC 1TAFA 3X1TA
chains in the Genus database with same CATH topology
1P34B 5B31G 1WWIA 2Y2OA 3X1TB 1JFIA 2CV5A 1S32C 4XZQB 4XUJD 2NQBD 3AZID 3AZJC 2CV5B 5E5AA 3X1TC 5CPIB 4XZQC 3V9RA 3F6TA 4H9PA 4CSRB 3KXBD 5E5AB 2NZDD 2CV5C 5F99A 2Y2GA 3MVDA 2XD1A 5CPIC 3V9RB 4JJNA 4ZUXA 4J8UD 2YFVA 3AZMA 3MVDB 5E5AC 3LELD 4WZSB 5B2IA 1M18A 1HQ3D 5AV6A 4JJNB 4ZUXB 2YFVB 3AZLB 3B0BA 1P3GD 5B2IB 5F99C 3MVDC 5AV6B 4JJNC 4ZUXC 3WAAA 4J8WD 1P3MD 5GT0A 3AV1A 5B2IC 5JRGA 3KFUG 4KUDD 5AV6C 4YM6A 3LZ0D 3EPKA 3AZHD 5JA4B 3RELD 4KGCA 3AN2D 3B6GD 2Y2MA 3B0CW 4H9RA 2RVQD 4M6BA 3WAAC 2Y2IA 4DRBA 5GT0C 3AV1C 4H9RB 4EO5B 3REJD 5CPJA 1BH9A 2F8NA 3REHA 1P3OB 3X1VB 5CPJB 3W99B 2Y2PA 5G49B 3MGRD 5B0ZD 4E44A 2YFWB 1P3KA 2F8NB 3O62B 4J8XD 1P3OC 5CPJC 2PYOA 1P3FA 1P3KB 4DRAA 4WNNB 4LD9A 3A6NA 3A1KA 1P3IA 4WU9D 1P3FB 4WU8B 5DNMA 1P3KC 3WKJD 3A6NB 3AFAD 1P3IB 2VQRA 5B1MA 5BS7C 1P3FC 2BG1A 5DNMB 1P3LD 3UT9B 2HUEB 1P3BA 3A6NC 5AV9B 1P3IC 2AROD 3REKB 5DNMC 1P3BB 3UT9C 2HUEC 3X1SA 3LJAB 5AV9C 3B6FD 5B1MC 3REKC 1B67A 4H9SA 3WA9B 5B24A 1P3BC 2UWXA 5AY8D 3LJAC 3UTAD 4Z66B 2HIOB 4G92B 5B1LB 4H9NA 5B0YB 5B24B 1U35D 2CWEA 1F66A 4Z66C 2HIOC 4H9NB 4G92C 4H9SC 1BH8A 5B24C 1ZLAA 2ZY5A 5CP6A 4X23A 3AZFA 1BH8B 3AZKD 4CAYA 1ZLAB 5B33D 3MGQA 5BO0A 5CP6B 4X23B 3EPLA 3AZFB 1M19A 1N1JA 1ZLAC 3VH5T 5BO0B 4YS3D 1M19B 1ID3A 5CP6C 4X23C 3AZFC 1KX4A 1KX5A 1S32D 3TU4A 3AL0C 1ID3B 2LY8A 1M19C 3AZJD 1KX4B 1KX5B 3X1TD 3TU4B 5CPKB 5CHLB 5B32G 3WTPB 3MGSA 1ID3C 5B40B 1KX5C 3KSYA 1KX4C 2CV5D 1P34A 4WJ3C 3TU4C 4UPKA 5AVCB 3AV2B 1Z2CB 3WTPC 1KU5A 5GT3B 3MGPB 5E5AD 5B40C 4XZQA 2Y2LA 5BNXB 5AVCC 3MGSC 4R8PA 2L5AA 2JE5A 5GT3C 5F99D 3W96A 3MGPC 1P34C 5CPIA 4JJND 4ZUXD 4R8PB 3AZMD 4CSRA 3W98D 3WTPE 3W96B 5B2ID 1P3AA 1M18D 5AV6D 4QLCB 1M1AA 4R8PC 3W97A 3W96C 1TZYA 1P3AB 2F8NH 1M1AB 3MNNA 3AZLA 5BT1C 4WV4B 3W97B 4QLCC 3WAAD 1TZYB 5GT0D 3AV1D 5JRGD 1P3AC 4YM6D 3MNNB 5AVBB 1M1AC 4KGCD 3W97C 5AV5B 5AV8B 1TZYC 2FJ7A 5KDMB 3MNNC 3AZLC 2G5HC 5AVBC 5JA4A 5B2JB 5AV5C 2FJ7B 5AV8C 3KWQA 5CPJD 3AYWD 3VH5A 3KWQB 2F8ND 3REHD 2BYKA 4UUZA 2FJ7C 2JSSA 4XUJB 2NQBB 1P3KD 5DNND 2BYKB 4UUZB 3KWQC 2W8SA 1P3OA 3X1VA 3W99A 3VH6A 5G49A 2PYOD 2YFWA 4DQYB 4XUJC 1WWSA 4LD9D 3A6ND 3O62A 1P3ID 4EO5C 2NZDB 4WNNA 4NFTA 4J8VA 3X1VC 3W99C 5BS7A 5B1MD 4WU8A 3NQUA 1P3BD 4J8VB 3EG5B 3O62C 2DF4C 3H0LC 3NQUB 3UT9A 4KUDA 3X1SD 3B0DB 4J8VC 5AV9A 1P3MB 4H9QB 3REKA 2Y2NA 4WU8C 4KUDB 3H0MC 3LZ0B 5B24D 3AZHB 5B32D 3RELB 3LJAA 3B0DC 4ZBJB 5GSUA 2JCHA 5BNVB 3B6GB 3WA9A 1HTAA 4KUDC 3LZ0C 1F66D 3RELC 4ZBJC 4Z66A 2HIOA 2Y2HA 5GSUB 5B1LA 5B0YA 2F8NG 1P3PD 5CP6D 4X23D 3AZFD 5GSUC 3WA9C 2ZY3A 2Y2QA 1EQZA 5B0ZB 3MGQD 5B1LC 4J8XB 5B0YC 1EQZB 2BYMB 1ID3D 2IO5B 1KX4D 4WU9B 4J8XC 3TU4D 1EQZC 3AFAB 1AOID 2IO5C 1W2EA 4KHAA 4WU9C 3MGSD 2FFFB 1P34D 4KHAB 2AROB 5CPKA 3B6FA 3WTPA 3AZGA 1KX3A 5GXQA 5B40A 5B31A 2DQNC 3X1UA 4XZQD 3B6FB 2AROC 5AVCA 3AV2A 3AZGB 1F1EA 1KX3B 5GXQB 4R8PD 5B31B 5GT3A 1BFMA 1S32B 3X1UB 3VH5W 5AY8B 3MGPA 3W96D 5CPID 5CPKC 1R4VA 5BNXA 3B6FC 3AZGC 1U35B 1KX3C 5GXQC 5B31C 3X1UC 5AY8C 1P3AD 3R45A 3AV2C 1U35C 3AZKA 3VH6W 1H3OA 3MVDD 1TZYD 3R45B 3MNND 3AZLD 4QLCA 3AZKB 1H3OB 3NQJA 4AWLB 3AZNA 4Z5TA 3NQJB 3H0RC 1ULYA 2ZM5A 3AZKC 2ZY2A 3AZNB 4YS3B 2FJ7D 4Z5TB 5AVBA 2ZY4A 5AV5A 5AV8A 3UTBA 3AZNC 4YS3C 3C1BA 5FUGA 3KWQD 5KDMA 3KUYA 3REIA 1TAFB 4Z5TC 3AZJB 5B2JA 3UTBB 3AZEA 3LZ1A 5FUGB 4NE5A 3KUYB 3C1BB 3REIB 3C1CA 1JFIB 1B6WA 4NE6A 3AZEB 3LZ1B 3UTBC 5C3IB 3C1BC 3KUYC 3C1CB 3REIC 1P3OD 3X1VD 3W99D 4XUJA 5B2JC 2NQBA 3AZEC 3LZ1C 4H9PB 3AZIA 5C3IC 3O62D 3C1CC 3W98A 5F99B 3AZIB 3AZMB 3W98B 4J8VD 3KXBA 2NZDA 3B0CT 1P3FD 4WU8D 1M18B 2NQBC 2J8PA 4J8UA 3AZIC 3AZMC 4H9OA 3KXBB 3W98C 3LELA 5DNMD 1HQ3A 3UT9D 1M18C 4J8UB 4H9OB 4Z2MH 5AV9D 3KXBC 3LELB 1P3GA 5GT0B 3AV1B 3WAAB 5JRGB 2NZDC 3REKD 1HQ3B 4YM6B 1T3UA 4J8UC 3LJAD 4KGCB 1P3GB 4J8WA 1P3MA 3LELC 5GSUD 4H9QA 5JRGC 1HQ3C 3WA9D 4YM6C 3LZ0A 3EPJA 3AYWA 3AZHA 3RELA 4E45A 4J8WB 3AN2A 4KGCC 1P3GC 4Z66D 2HIOD 5B1LD 1PZRA 5BNVA 5B0YD 3AYWB 3B6GA 3AN2B 4J8WC 1BH9B 1P3MC 5DNNA 3REHB 2F2AC 1A7WA 2XD5A 3REJA 3FDDA 3AZHC 3AYWC 1EQZD 3AN2C 5DNNB 3REJB 3REHC 3B6GC 1ZLAD 3MGRA 2RVQC 2PYOB 5B0ZA 5DNNC 4LD9B 1Q9CA 3REJC 4J8XA 3MGRB 4G91B 2PYOC 2BYMA 1M19D 4LD9C 4WU9A 5B1MB 3MGRC 5B0ZC 4G91C 3WKJA 3AFAA 1KX5D 2F8NK 5CPKD 3WTPD 1P3LA 3WKJB 3AZGD 1KX3D 5GXQD 2Y2KA 5B40D 5B32A 5B31D 3X1SB 3X1UD 2AROA 3A1IA 5AVCD 3AV2D 1P3LB 3IP4C 3WKJC 5GT3D 5B32B 2RIQA 3AFAC 3MGPD 3X1SC 1P3LC 1F66B 5B32C 1P3PA 5AY8A 3UTAA 1U35A 4HGAB 1P3PB 1F66C 3UTAB 4Z2MG 5BT1D 4QLCD 4CAYB 4HGAC 2G5IC 3AZND 1P3PC 3UTAC 3MGQB 4Z5TD 1N1JB 1M1AD 3P5JB 3W97D 5B33A 4NE3A 3MGQC 1AOIA 5AVBD 5B33B 3EPHA 5AV5D 3VH6T 5AV8D 3UTBD 4YS3A 3C1BD 3KUYD 3REID 1AOIB 1S32A 5B2JD 5B33C 4AWLC 3MGSB 3AZED 3LZ1D 2Y2JA 3C1CD 3AZJA 1AOIC 1TAFA 3X1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 B;  5B31 G;  1WWI A;  3X1T B;  1JFI A;  2CV5 A;  1S32 C;  4XZQ B;  4XUJ D;  2NQB D;  3AZI D;  3AZJ C;  2CV5 B;  5E5A A;  3X1T C;  5CPI B;  4XZQ C;  3V9R A;  4H9P A;  4CSR B;  3KXB D;  5E5A B;  2NZD D;  2CV5 C;  5F99 A;  3MVD A;  5CPI C;  3V9R B;  4JJN A;  4ZUX A;  4J8U D;  2YFV A;  3AZM A;  3MVD B;  5E5A C;  3LEL D;  4WZS B;  5B2I A;  1M18 A;  1HQ3 D;  5AV6 A;  4JJN B;  4ZUX B;  2YFV B;  3AZL B;  3B0B A;  1P3G D;  5B2I B;  5F99 C;  3MVD C;  5AV6 B;  4JJN C;  4ZUX C;  3WAA A;  4J8W D;  1P3M D;  5GT0 A;  3AV1 A;  5B2I C;  5JRG A;  4KUD D;  5AV6 C;  4YM6 A;  3LZ0 D;  3AZH D;  5JA4 B;  3REL D;  4KGC A;  3AN2 D;  3B6G D;  3B0C W;  4H9R A;  2RVQ D;  4M6B A;  3WAA C;  4DRB A;  5GT0 C;  3AV1 C;  4H9R B;  4EO5 B;  3REJ D;  5CPJ A;  1BH9 A;  2F8N A;  3REH A;  1P3O B;  3X1V B;  5CPJ B;  3W99 B;  5G49 B;  3MGR D;  5B0Z D;  4E44 A;  2YFW B;  1P3K A;  2F8N B;  3O62 B;  4J8X D;  1P3O C;  5CPJ C;  2PYO A;  1P3F A;  1P3K B;  4DRA A;  4WNN B;  4LD9 A;  3A6N A;  1P3I A;  4WU9 D;  1P3F B;  4WU8 B;  5DNM A;  1P3K C;  3WKJ D;  3A6N B;  3AFA D;  1P3I B;  5B1M A;  5BS7 C;  1P3F C;  5DNM B;  1P3L D;  3UT9 B;  2HUE B;  1P3B A;  3A6N C;  5AV9 B;  1P3I C;  2ARO D;  3REK B;  5DNM C;  1P3B B;  3UT9 C;  2HUE C;  3X1S A;  3LJA B;  5AV9 C;  3B6F D;  5B1M C;  3REK C;  1B67 A;  4H9S A;  3WA9 B;  5B24 A;  1P3B C;  5AY8 D;  3LJA C;  3UTA D;  4Z66 B;  2HIO B;  4G92 B;  5B1L B;  4H9N A;  5B0Y B;  5B24 B;  1U35 D;  2CWE A;  1F66 A;  4Z66 C;  2HIO C;  4H9N B;  4G92 C;  4H9S C;  1BH8 A;  5B24 C;  1ZLA A;  5CP6 A;  4X23 A;  3AZF A;  1BH8 B;  3AZK D;  4CAY A;  1ZLA B;  5B33 D;  3MGQ A;  5BO0 A;  5CP6 B;  4X23 B;  3AZF B;  1M19 A;  1N1J A;  1ZLA C;  3VH5 T;  5BO0 B;  4YS3 D;  1M19 B;  1ID3 A;  5CP6 C;  4X23 C;  3AZF C;  1KX4 A;  1KX5 A;  1S32 D;  3TU4 A;  1ID3 B;  2LY8 A;  1M19 C;  3AZJ D;  1KX4 B;  1KX5 B;  3X1T D;  3TU4 B;  5CPK B;  5CHL B;  5B32 G;  3WTP B;  3MGS A;  1ID3 C;  5B40 B;  1KX5 C;  3KSY A;  1KX4 C;  2CV5 D;  1P34 A;  3TU4 C;  5AVC B;  3AV2 B;  3WTP C;  1KU5 A;  5GT3 B;  3MGP B;  5E5A D;  5B40 C;  4XZQ A;  5BNX B;  5AVC C;  3MGS C;  4R8P A;  2L5A A;  5GT3 C;  5F99 D;  3W96 A;  3MGP C;  1P34 C;  5CPI A;  4JJN D;  4ZUX D;  4R8P B;  3AZM D;  4CSR A;  3W98 D;  3WTP E;  3W96 B;  5B2I D;  1P3A A;  1M18 D;  5AV6 D;  4QLC B;  1M1A A;  4R8P C;  3W97 A;  3W96 C;  1TZY A;  1P3A B;  2F8N H;  1M1A B;  3MNN A;  3AZL A;  5BT1 C;  4WV4 B;  3W97 B;  4QLC C;  3WAA D;  1TZY B;  5GT0 D;  3AV1 D;  5JRG D;  1P3A C;  4YM6 D;  3MNN B;  5AVB B;  1M1A C;  4KGC D;  3W97 C;  5AV5 B;  5AV8 B;  1TZY C;  2FJ7 A;  5KDM B;  3MNN C;  3AZL C;  5AVB C;  5JA4 A;  5B2J B;  5AV5 C;  2FJ7 B;  5AV8 C;  3KWQ A;  5CPJ D;  3AYW D;  3VH5 A;  3KWQ B;  2F8N D;  3REH D;  2BYK A;  4UUZ A;  2FJ7 C;  2JSS A;  4XUJ B;  2NQB B;  1P3K D;  5DNN D;  2BYK B;  4UUZ B;  3KWQ C;  1P3O A;  3X1V A;  3W99 A;  3VH6 A;  5G49 A;  2PYO D;  2YFW A;  4XUJ C;  1WWS A;  4LD9 D;  3A6N D;  3O62 A;  1P3I D;  4EO5 C;  2NZD B;  4WNN A;  4NFT A;  4J8V A;  3X1V C;  3W99 C;  5BS7 A;  5B1M D;  4WU8 A;  3NQU A;  1P3B D;  4J8V B;  3O62 C;  3NQU B;  3UT9 A;  4KUD A;  3X1S D;  3B0D B;  4J8V C;  5AV9 A;  1P3M B;  4H9Q B;  3REK A;  4WU8 C;  4KUD B;  3LZ0 B;  5B24 D;  3AZH B;  5B32 D;  3REL B;  3LJA A;  3B0D C;  4ZBJ B;  5GSU A;  5BNV B;  3B6G B;  3WA9 A;  1HTA A;  4KUD C;  3LZ0 C;  1F66 D;  3REL C;  4ZBJ C;  4Z66 A;  2HIO A;  5GSU B;  5B1L A;  5B0Y A;  2F8N G;  1P3P D;  5CP6 D;  4X23 D;  3AZF D;  5GSU C;  3WA9 C;  1EQZ A;  5B0Z B;  3MGQ D;  5B1L C;  4J8X B;  5B0Y C;  1EQZ B;  2BYM B;  1ID3 D;  2IO5 B;  1KX4 D;  4WU9 B;  4J8X C;  3TU4 D;  1EQZ C;  3AFA B;  1AOI D;  2IO5 C;  4KHA A;  4WU9 C;  3MGS D;  1P34 D;  4KHA B;  2ARO B;  5CPK A;  3B6F A;  3WTP A;  3AZG A;  1KX3 A;  5GXQ A;  5B40 A;  5B31 A;  3X1U A;  4XZQ D;  3B6F B;  2ARO C;  5AVC A;  3AV2 A;  3AZG B;  1F1E A;  1KX3 B;  5GXQ B;  4R8P D;  5B31 B;  5GT3 A;  1BFM A;  1S32 B;  3X1U B;  3VH5 W;  5AY8 B;  3MGP A;  3W96 D;  5CPI D;  5CPK C;  1R4V A;  5BNX A;  3B6F C;  3AZG C;  1U35 B;  1KX3 C;  5GXQ C;  5B31 C;  3X1U C;  5AY8 C;  1P3A D;  3R45 A;  3AV2 C;  1U35 C;  3AZK A;  3VH6 W;  1H3O A;  3MVD D;  1TZY D;  3R45 B;  3MNN D;  3AZL D;  4QLC A;  3AZK B;  1H3O B;  3NQJ A;  4AWL B;  3AZN A;  4Z5T A;  3NQJ B;  3AZK C;  1ULY A;  3AZN B;  4YS3 B;  2FJ7 D;  4Z5T B;  5AVB A;  5AV5 A;  5AV8 A;  3UTB A;  3AZN C;  4YS3 C;  3C1B A;  5FUG A;  3KWQ D;  5KDM A;  3KUY A;  3REI A;  1TAF B;  4Z5T C;  3AZJ B;  5B2J A;  3UTB B;  3AZE A;  3LZ1 A;  5FUG B;  4NE5 A;  3KUY B;  3C1B B;  3REI B;  3C1C A;  1JFI B;  1B6W A;  4NE6 A;  3AZE B;  3LZ1 B;  3UTB C;  5C3I B;  3C1B C;  3KUY C;  3C1C B;  3REI C;  1P3O D;  3X1V D;  3W99 D;  4XUJ A;  5B2J C;  2NQB A;  3AZE C;  3LZ1 C;  4H9P B;  3AZI A;  5C3I C;  3O62 D;  3C1C C;  3W98 A;  5F99 B;  3AZI B;  3AZM B;  3W98 B;  4J8V D;  3KXB A;  2NZD A;  3B0C T;  1P3F D;  4WU8 D;  1M18 B;  2NQB C;  4J8U A;  3AZI C;  3AZM C;  4H9O A;  3KXB B;  3W98 C;  3LEL A;  5DNM D;  1HQ3 A;  3UT9 D;  1M18 C;  4J8U B;  4H9O B;  4Z2M H;  5AV9 D;  3KXB C;  3LEL B;  1P3G A;  5GT0 B;  3AV1 B;  3WAA B;  5JRG B;  2NZD C;  3REK D;  1HQ3 B;  4YM6 B;  4J8U C;  3LJA D;  4KGC B;  1P3G B;  4J8W A;  1P3M A;  3LEL C;  5GSU D;  4H9Q A;  5JRG C;  1HQ3 C;  3WA9 D;  4YM6 C;  3LZ0 A;  3AYW A;  3AZH A;  3REL A;  4E45 A;  4J8W B;  3AN2 A;  4KGC C;  1P3G C;  4Z66 D;  2HIO D;  5B1L D;  5BNV A;  5B0Y D;  3AYW B;  3B6G A;  3AN2 B;  4J8W C;  1BH9 B;  1P3M C;  5DNN A;  3REH B;  1A7W A;  3REJ A;  3AZH C;  3AYW C;  1EQZ D;  3AN2 C;  5DNN B;  3REJ B;  3REH C;  3B6G C;  1ZLA D;  3MGR A;  2RVQ C;  2PYO B;  5B0Z A;  5DNN C;  4LD9 B;  1Q9C A;  3REJ C;  4J8X A;  3MGR B;  4G91 B;  2PYO C;  2BYM A;  1M19 D;  4LD9 C;  4WU9 A;  5B1M B;  3MGR C;  5B0Z C;  4G91 C;  3WKJ A;  3AFA A;  1KX5 D;  2F8N K;  5CPK D;  3WTP D;  1P3L A;  3WKJ B;  3AZG D;  1KX3 D;  5GXQ D;  5B40 D;  5B31 D;  5B32 A;  3X1S B;  3X1U D;  2ARO A;  5AVC D;  3AV2 D;  1P3L B;  3WKJ C;  5GT3 D;  5B32 B;  3AFA C;  3MGP D;  3X1S C;  1P3L C;  1F66 B;  5B32 C;  1P3P A;  5AY8 A;  3UTA A;  1U35 A;  4HGA B;  1P3P B;  1F66 C;  3UTA B;  4Z2M G;  5BT1 D;  4QLC D;  4CAY B;  4HGA C;  3AZN D;  1P3P C;  3UTA C;  3MGQ B;  4Z5T D;  1N1J B;  1M1A D;  3W97 D;  5B33 A;  4NE3 A;  3MGQ C;  1AOI A;  5AVB D;  5B33 B;  5AV5 D;  3VH6 T;  5AV8 D;  3UTB D;  4YS3 A;  3C1B D;  3KUY D;  3REI D;  1AOI B;  1S32 A;  5B2J D;  5B33 C;  4AWL C;  3MGS B;  3AZE D;  3LZ1 D;  3C1C D;  3AZJ A;  1AOI C;  1TAF A;  3X1T A; 
#chains in the Genus database with same CATH topology
 1P34 B;  5B31 G;  1WWI A;  2Y2O A;  3X1T B;  1JFI A;  2CV5 A;  1S32 C;  4XZQ B;  4XUJ D;  2NQB D;  3AZI D;  3AZJ C;  2CV5 B;  5E5A A;  3X1T C;  5CPI B;  4XZQ C;  3V9R A;  3F6T A;  4H9P A;  4CSR B;  3KXB D;  5E5A B;  2NZD D;  2CV5 C;  5F99 A;  2Y2G A;  3MVD A;  2XD1 A;  5CPI C;  3V9R B;  4JJN A;  4ZUX A;  4J8U D;  2YFV A;  3AZM A;  3MVD B;  5E5A C;  3LEL D;  4WZS B;  5B2I A;  1M18 A;  1HQ3 D;  5AV6 A;  4JJN B;  4ZUX B;  2YFV B;  3AZL B;  3B0B A;  1P3G D;  5B2I B;  5F99 C;  3MVD C;  5AV6 B;  4JJN C;  4ZUX C;  3WAA A;  4J8W D;  1P3M D;  5GT0 A;  3AV1 A;  5B2I C;  5JRG A;  3KFU G;  4KUD D;  5AV6 C;  4YM6 A;  3LZ0 D;  3EPK A;  3AZH D;  5JA4 B;  3REL D;  4KGC A;  3AN2 D;  3B6G D;  2Y2M A;  3B0C W;  4H9R A;  2RVQ D;  4M6B A;  3WAA C;  2Y2I A;  4DRB A;  5GT0 C;  3AV1 C;  4H9R B;  4EO5 B;  3REJ D;  5CPJ A;  1BH9 A;  2F8N A;  3REH A;  1P3O B;  3X1V B;  5CPJ B;  3W99 B;  2Y2P A;  5G49 B;  3MGR D;  5B0Z D;  4E44 A;  2YFW B;  1P3K A;  2F8N B;  3O62 B;  4J8X D;  1P3O C;  5CPJ C;  2PYO A;  1P3F A;  1P3K B;  4DRA A;  4WNN B;  4LD9 A;  3A6N A;  3A1K A;  1P3I A;  4WU9 D;  1P3F B;  4WU8 B;  5DNM A;  1P3K C;  3WKJ D;  3A6N B;  3AFA D;  1P3I B;  2VQR A;  5B1M A;  5BS7 C;  1P3F C;  2BG1 A;  5DNM B;  1P3L D;  3UT9 B;  2HUE B;  1P3B A;  3A6N C;  5AV9 B;  1P3I C;  2ARO D;  3REK B;  5DNM C;  1P3B B;  3UT9 C;  2HUE C;  3X1S A;  3LJA B;  5AV9 C;  3B6F D;  5B1M C;  3REK C;  1B67 A;  4H9S A;  3WA9 B;  5B24 A;  1P3B C;  2UWX A;  5AY8 D;  3LJA C;  3UTA D;  4Z66 B;  2HIO B;  4G92 B;  5B1L B;  4H9N A;  5B0Y B;  5B24 B;  1U35 D;  2CWE A;  1F66 A;  4Z66 C;  2HIO C;  4H9N B;  4G92 C;  4H9S C;  1BH8 A;  5B24 C;  1ZLA A;  2ZY5 A;  5CP6 A;  4X23 A;  3AZF A;  1BH8 B;  3AZK D;  4CAY A;  1ZLA B;  5B33 D;  3MGQ A;  5BO0 A;  5CP6 B;  4X23 B;  3EPL A;  3AZF B;  1M19 A;  1N1J A;  1ZLA C;  3VH5 T;  5BO0 B;  4YS3 D;  1M19 B;  1ID3 A;  5CP6 C;  4X23 C;  3AZF C;  1KX4 A;  1KX5 A;  1S32 D;  3TU4 A;  3AL0 C;  1ID3 B;  2LY8 A;  1M19 C;  3AZJ D;  1KX4 B;  1KX5 B;  3X1T D;  3TU4 B;  5CPK B;  5CHL B;  5B32 G;  3WTP B;  3MGS A;  1ID3 C;  5B40 B;  1KX5 C;  3KSY A;  1KX4 C;  2CV5 D;  1P34 A;  4WJ3 C;  3TU4 C;  4UPK A;  5AVC B;  3AV2 B;  1Z2C B;  3WTP C;  1KU5 A;  5GT3 B;  3MGP B;  5E5A D;  5B40 C;  4XZQ A;  2Y2L A;  5BNX B;  5AVC C;  3MGS C;  4R8P A;  2L5A A;  2JE5 A;  5GT3 C;  5F99 D;  3W96 A;  3MGP C;  1P34 C;  5CPI A;  4JJN D;  4ZUX D;  4R8P B;  3AZM D;  4CSR A;  3W98 D;  3WTP E;  3W96 B;  5B2I D;  1P3A A;  1M18 D;  5AV6 D;  4QLC B;  1M1A A;  4R8P C;  3W97 A;  3W96 C;  1TZY A;  1P3A B;  2F8N H;  1M1A B;  3MNN A;  3AZL A;  5BT1 C;  4WV4 B;  3W97 B;  4QLC C;  3WAA D;  1TZY B;  5GT0 D;  3AV1 D;  5JRG D;  1P3A C;  4YM6 D;  3MNN B;  5AVB B;  1M1A C;  4KGC D;  3W97 C;  5AV5 B;  5AV8 B;  1TZY C;  2FJ7 A;  5KDM B;  3MNN C;  3AZL C;  2G5H C;  5AVB C;  5JA4 A;  5B2J B;  5AV5 C;  2FJ7 B;  5AV8 C;  3KWQ A;  5CPJ D;  3AYW D;  3VH5 A;  3KWQ B;  2F8N D;  3REH D;  2BYK A;  4UUZ A;  2FJ7 C;  2JSS A;  4XUJ B;  2NQB B;  1P3K D;  5DNN D;  2BYK B;  4UUZ B;  3KWQ C;  2W8S A;  1P3O A;  3X1V A;  3W99 A;  3VH6 A;  5G49 A;  2PYO D;  2YFW A;  4DQY B;  4XUJ C;  1WWS A;  4LD9 D;  3A6N D;  3O62 A;  1P3I D;  4EO5 C;  2NZD B;  4WNN A;  4NFT A;  4J8V A;  3X1V C;  3W99 C;  5BS7 A;  5B1M D;  4WU8 A;  3NQU A;  1P3B D;  4J8V B;  3EG5 B;  3O62 C;  2DF4 C;  3H0L C;  3NQU B;  3UT9 A;  4KUD A;  3X1S D;  3B0D B;  4J8V C;  5AV9 A;  1P3M B;  4H9Q B;  3REK A;  2Y2N A;  4WU8 C;  4KUD B;  3H0M C;  3LZ0 B;  5B24 D;  3AZH B;  5B32 D;  3REL B;  3LJA A;  3B0D C;  4ZBJ B;  5GSU A;  2JCH A;  5BNV B;  3B6G B;  3WA9 A;  1HTA A;  4KUD C;  3LZ0 C;  1F66 D;  3REL C;  4ZBJ C;  4Z66 A;  2HIO A;  2Y2H A;  5GSU B;  5B1L A;  5B0Y A;  2F8N G;  1P3P D;  5CP6 D;  4X23 D;  3AZF D;  5GSU C;  3WA9 C;  2ZY3 A;  2Y2Q A;  1EQZ A;  5B0Z B;  3MGQ D;  5B1L C;  4J8X B;  5B0Y C;  1EQZ B;  2BYM B;  1ID3 D;  2IO5 B;  1KX4 D;  4WU9 B;  4J8X C;  3TU4 D;  1EQZ C;  3AFA B;  1AOI D;  2IO5 C;  1W2E A;  4KHA A;  4WU9 C;  3MGS D;  2FFF B;  1P34 D;  4KHA B;  2ARO B;  5CPK A;  3B6F A;  3WTP A;  3AZG A;  1KX3 A;  5GXQ A;  5B40 A;  5B31 A;  2DQN C;  3X1U A;  4XZQ D;  3B6F B;  2ARO C;  5AVC A;  3AV2 A;  3AZG B;  1F1E A;  1KX3 B;  5GXQ B;  4R8P D;  5B31 B;  5GT3 A;  1BFM A;  1S32 B;  3X1U B;  3VH5 W;  5AY8 B;  3MGP A;  3W96 D;  5CPI D;  5CPK C;  1R4V A;  5BNX A;  3B6F C;  3AZG C;  1U35 B;  1KX3 C;  5GXQ C;  5B31 C;  3X1U C;  5AY8 C;  1P3A D;  3R45 A;  3AV2 C;  1U35 C;  3AZK A;  3VH6 W;  1H3O A;  3MVD D;  1TZY D;  3R45 B;  3MNN D;  3AZL D;  4QLC A;  3AZK B;  1H3O B;  3NQJ A;  4AWL B;  3AZN A;  4Z5T A;  3NQJ B;  3H0R C;  1ULY A;  2ZM5 A;  3AZK C;  2ZY2 A;  3AZN B;  4YS3 B;  2FJ7 D;  4Z5T B;  5AVB A;  2ZY4 A;  5AV5 A;  5AV8 A;  3UTB A;  3AZN C;  4YS3 C;  3C1B A;  5FUG A;  3KWQ D;  5KDM A;  3KUY A;  3REI A;  1TAF B;  4Z5T C;  3AZJ B;  5B2J A;  3UTB B;  3AZE A;  3LZ1 A;  5FUG B;  4NE5 A;  3KUY B;  3C1B B;  3REI B;  3C1C A;  1JFI B;  1B6W A;  4NE6 A;  3AZE B;  3LZ1 B;  3UTB C;  5C3I B;  3C1B C;  3KUY C;  3C1C B;  3REI C;  1P3O D;  3X1V D;  3W99 D;  4XUJ A;  5B2J C;  2NQB A;  3AZE C;  3LZ1 C;  4H9P B;  3AZI A;  5C3I C;  3O62 D;  3C1C C;  3W98 A;  5F99 B;  3AZI B;  3AZM B;  3W98 B;  4J8V D;  3KXB A;  2NZD A;  3B0C T;  1P3F D;  4WU8 D;  1M18 B;  2NQB C;  2J8P A;  4J8U A;  3AZI C;  3AZM C;  4H9O A;  3KXB B;  3W98 C;  3LEL A;  5DNM D;  1HQ3 A;  3UT9 D;  1M18 C;  4J8U B;  4H9O B;  4Z2M H;  5AV9 D;  3KXB C;  3LEL B;  1P3G A;  5GT0 B;  3AV1 B;  3WAA B;  5JRG B;  2NZD C;  3REK D;  1HQ3 B;  4YM6 B;  1T3U A;  4J8U C;  3LJA D;  4KGC B;  1P3G B;  4J8W A;  1P3M A;  3LEL C;  5GSU D;  4H9Q A;  5JRG C;  1HQ3 C;  3WA9 D;  4YM6 C;  3LZ0 A;  3EPJ A;  3AYW A;  3AZH A;  3REL A;  4E45 A;  4J8W B;  3AN2 A;  4KGC C;  1P3G C;  4Z66 D;  2HIO D;  5B1L D;  1PZR A;  5BNV A;  5B0Y D;  3AYW B;  3B6G A;  3AN2 B;  4J8W C;  1BH9 B;  1P3M C;  5DNN A;  3REH B;  2F2A C;  1A7W A;  2XD5 A;  3REJ A;  3FDD A;  3AZH C;  3AYW C;  1EQZ D;  3AN2 C;  5DNN B;  3REJ B;  3REH C;  3B6G C;  1ZLA D;  3MGR A;  2RVQ C;  2PYO B;  5B0Z A;  5DNN C;  4LD9 B;  1Q9C A;  3REJ C;  4J8X A;  3MGR B;  4G91 B;  2PYO C;  2BYM A;  1M19 D;  4LD9 C;  4WU9 A;  5B1M B;  3MGR C;  5B0Z C;  4G91 C;  3WKJ A;  3AFA A;  1KX5 D;  2F8N K;  5CPK D;  3WTP D;  1P3L A;  3WKJ B;  3AZG D;  1KX3 D;  5GXQ D;  2Y2K A;  5B40 D;  5B32 A;  5B31 D;  3X1S B;  3X1U D;  2ARO A;  3A1I A;  5AVC D;  3AV2 D;  1P3L B;  3IP4 C;  3WKJ C;  5GT3 D;  5B32 B;  2RIQ A;  3AFA C;  3MGP D;  3X1S C;  1P3L C;  1F66 B;  5B32 C;  1P3P A;  5AY8 A;  3UTA A;  1U35 A;  4HGA B;  1P3P B;  1F66 C;  3UTA B;  4Z2M G;  5BT1 D;  4QLC D;  4CAY B;  4HGA C;  2G5I C;  3AZN D;  1P3P C;  3UTA C;  3MGQ B;  4Z5T D;  1N1J B;  1M1A D;  3P5J B;  3W97 D;  5B33 A;  4NE3 A;  3MGQ C;  1AOI A;  5AVB D;  5B33 B;  3EPH A;  5AV5 D;  3VH6 T;  5AV8 D;  3UTB D;  4YS3 A;  3C1B D;  3KUY D;  3REI D;  1AOI B;  1S32 A;  5B2J D;  5B33 C;  4AWL C;  3MGS B;  3AZE D;  3LZ1 D;  2Y2J A;  3C1C D;  3AZJ A;  1AOI C;  1TAF A;  3X1T A; 
#chains in the Genus database with same CATH homology
 1P34 B;  5B31 G;  1WWI A;  2Y2O A;  3X1T B;  1JFI A;  2CV5 A;  1S32 C;  4XZQ B;  4XUJ D;  2NQB D;  3AZI D;  3AZJ C;  2CV5 B;  5E5A A;  3X1T C;  5CPI B;  4XZQ C;  3V9R A;  3F6T A;  4H9P A;  4CSR B;  3KXB D;  5E5A B;  2NZD D;  2CV5 C;  5F99 A;  2Y2G A;  3MVD A;  2XD1 A;  5CPI C;  3V9R B;  4JJN A;  4ZUX A;  4J8U D;  2YFV A;  3AZM A;  3MVD B;  5E5A C;  3LEL D;  4WZS B;  5B2I A;  1M18 A;  1HQ3 D;  5AV6 A;  4JJN B;  4ZUX B;  2YFV B;  3AZL B;  3B0B A;  1P3G D;  5B2I B;  5F99 C;  3MVD C;  5AV6 B;  4JJN C;  4ZUX C;  3WAA A;  4J8W D;  1P3M D;  5GT0 A;  3AV1 A;  5B2I C;  5JRG A;  3KFU G;  4KUD D;  5AV6 C;  4YM6 A;  3LZ0 D;  3EPK A;  3AZH D;  5JA4 B;  3REL D;  4KGC A;  3AN2 D;  3B6G D;  2Y2M A;  3B0C W;  4H9R A;  2RVQ D;  4M6B A;  3WAA C;  2Y2I A;  4DRB A;  5GT0 C;  3AV1 C;  4H9R B;  4EO5 B;  3REJ D;  5CPJ A;  1BH9 A;  2F8N A;  3REH A;  1P3O B;  3X1V B;  5CPJ B;  3W99 B;  2Y2P A;  5G49 B;  3MGR D;  5B0Z D;  4E44 A;  2YFW B;  1P3K A;  2F8N B;  3O62 B;  4J8X D;  1P3O C;  5CPJ C;  2PYO A;  1P3F A;  1P3K B;  4DRA A;  4WNN B;  4LD9 A;  3A6N A;  3A1K A;  1P3I A;  4WU9 D;  1P3F B;  4WU8 B;  5DNM A;  1P3K C;  3WKJ D;  3A6N B;  3AFA D;  1P3I B;  2VQR A;  5B1M A;  5BS7 C;  1P3F C;  2BG1 A;  5DNM B;  1P3L D;  3UT9 B;  2HUE B;  1P3B A;  3A6N C;  5AV9 B;  1P3I C;  2ARO D;  3REK B;  5DNM C;  1P3B B;  3UT9 C;  2HUE C;  3X1S A;  3LJA B;  5AV9 C;  3B6F D;  5B1M C;  3REK C;  1B67 A;  4H9S A;  3WA9 B;  5B24 A;  1P3B C;  2UWX A;  5AY8 D;  3LJA C;  3UTA D;  4Z66 B;  2HIO B;  4G92 B;  5B1L B;  4H9N A;  5B0Y B;  5B24 B;  1U35 D;  2CWE A;  1F66 A;  4Z66 C;  2HIO C;  4H9N B;  4G92 C;  4H9S C;  1BH8 A;  5B24 C;  1ZLA A;  2ZY5 A;  5CP6 A;  4X23 A;  3AZF A;  1BH8 B;  3AZK D;  4CAY A;  1ZLA B;  5B33 D;  3MGQ A;  5BO0 A;  5CP6 B;  4X23 B;  3EPL A;  3AZF B;  1M19 A;  1N1J A;  1ZLA C;  3VH5 T;  5BO0 B;  4YS3 D;  1M19 B;  1ID3 A;  5CP6 C;  4X23 C;  3AZF C;  1KX4 A;  1KX5 A;  1S32 D;  3TU4 A;  3AL0 C;  1ID3 B;  2LY8 A;  1M19 C;  3AZJ D;  1KX4 B;  1KX5 B;  3X1T D;  3TU4 B;  5CPK B;  5CHL B;  5B32 G;  3WTP B;  3MGS A;  1ID3 C;  5B40 B;  1KX5 C;  3KSY A;  1KX4 C;  2CV5 D;  1P34 A;  4WJ3 C;  3TU4 C;  4UPK A;  5AVC B;  3AV2 B;  1Z2C B;  3WTP C;  1KU5 A;  5GT3 B;  3MGP B;  5E5A D;  5B40 C;  4XZQ A;  2Y2L A;  5BNX B;  5AVC C;  3MGS C;  4R8P A;  2L5A A;  2JE5 A;  5GT3 C;  5F99 D;  3W96 A;  3MGP C;  1P34 C;  5CPI A;  4JJN D;  4ZUX D;  4R8P B;  3AZM D;  4CSR A;  3W98 D;  3WTP E;  3W96 B;  5B2I D;  1P3A A;  1M18 D;  5AV6 D;  4QLC B;  1M1A A;  4R8P C;  3W97 A;  3W96 C;  1TZY A;  1P3A B;  2F8N H;  1M1A B;  3MNN A;  3AZL A;  5BT1 C;  4WV4 B;  3W97 B;  4QLC C;  3WAA D;  1TZY B;  5GT0 D;  3AV1 D;  5JRG D;  1P3A C;  4YM6 D;  3MNN B;  5AVB B;  1M1A C;  4KGC D;  3W97 C;  5AV5 B;  5AV8 B;  1TZY C;  2FJ7 A;  5KDM B;  3MNN C;  3AZL C;  2G5H C;  5AVB C;  5JA4 A;  5B2J B;  5AV5 C;  2FJ7 B;  5AV8 C;  3KWQ A;  5CPJ D;  3AYW D;  3VH5 A;  3KWQ B;  2F8N D;  3REH D;  2BYK A;  4UUZ A;  2FJ7 C;  2JSS A;  4XUJ B;  2NQB B;  1P3K D;  5DNN D;  2BYK B;  4UUZ B;  3KWQ C;  2W8S A;  1P3O A;  3X1V A;  3W99 A;  3VH6 A;  5G49 A;  2PYO D;  2YFW A;  4DQY B;  4XUJ C;  1WWS A;  4LD9 D;  3A6N D;  3O62 A;  1P3I D;  4EO5 C;  2NZD B;  4WNN A;  4NFT A;  4J8V A;  3X1V C;  3W99 C;  5BS7 A;  5B1M D;  4WU8 A;  3NQU A;  1P3B D;  4J8V B;  3EG5 B;  3O62 C;  2DF4 C;  3H0L C;  3NQU B;  3UT9 A;  4KUD A;  3X1S D;  3B0D B;  4J8V C;  5AV9 A;  1P3M B;  4H9Q B;  3REK A;  2Y2N A;  4WU8 C;  4KUD B;  3H0M C;  3LZ0 B;  5B24 D;  3AZH B;  5B32 D;  3REL B;  3LJA A;  3B0D C;  4ZBJ B;  5GSU A;  2JCH A;  5BNV B;  3B6G B;  3WA9 A;  1HTA A;  4KUD C;  3LZ0 C;  1F66 D;  3REL C;  4ZBJ C;  4Z66 A;  2HIO A;  2Y2H A;  5GSU B;  5B1L A;  5B0Y A;  2F8N G;  1P3P D;  5CP6 D;  4X23 D;  3AZF D;  5GSU C;  3WA9 C;  2ZY3 A;  2Y2Q A;  1EQZ A;  5B0Z B;  3MGQ D;  5B1L C;  4J8X B;  5B0Y C;  1EQZ B;  2BYM B;  1ID3 D;  2IO5 B;  1KX4 D;  4WU9 B;  4J8X C;  3TU4 D;  1EQZ C;  3AFA B;  1AOI D;  2IO5 C;  1W2E A;  4KHA A;  4WU9 C;  3MGS D;  2FFF B;  1P34 D;  4KHA B;  2ARO B;  5CPK A;  3B6F A;  3WTP A;  3AZG A;  1KX3 A;  5GXQ A;  5B40 A;  5B31 A;  2DQN C;  3X1U A;  4XZQ D;  3B6F B;  2ARO C;  5AVC A;  3AV2 A;  3AZG B;  1F1E A;  1KX3 B;  5GXQ B;  4R8P D;  5B31 B;  5GT3 A;  1BFM A;  1S32 B;  3X1U B;  3VH5 W;  5AY8 B;  3MGP A;  3W96 D;  5CPI D;  5CPK C;  1R4V A;  5BNX A;  3B6F C;  3AZG C;  1U35 B;  1KX3 C;  5GXQ C;  5B31 C;  3X1U C;  5AY8 C;  1P3A D;  3R45 A;  3AV2 C;  1U35 C;  3AZK A;  3VH6 W;  1H3O A;  3MVD D;  1TZY D;  3R45 B;  3MNN D;  3AZL D;  4QLC A;  3AZK B;  1H3O B;  3NQJ A;  4AWL B;  3AZN A;  4Z5T A;  3NQJ B;  3H0R C;  1ULY A;  2ZM5 A;  3AZK C;  2ZY2 A;  3AZN B;  4YS3 B;  2FJ7 D;  4Z5T B;  5AVB A;  2ZY4 A;  5AV5 A;  5AV8 A;  3UTB A;  3AZN C;  4YS3 C;  3C1B A;  5FUG A;  3KWQ D;  5KDM A;  3KUY A;  3REI A;  1TAF B;  4Z5T C;  3AZJ B;  5B2J A;  3UTB B;  3AZE A;  3LZ1 A;  5FUG B;  4NE5 A;  3KUY B;  3C1B B;  3REI B;  3C1C A;  1JFI B;  1B6W A;  4NE6 A;  3AZE B;  3LZ1 B;  3UTB C;  5C3I B;  3C1B C;  3KUY C;  3C1C B;  3REI C;  1P3O D;  3X1V D;  3W99 D;  4XUJ A;  5B2J C;  2NQB A;  3AZE C;  3LZ1 C;  4H9P B;  3AZI A;  5C3I C;  3O62 D;  3C1C C;  3W98 A;  5F99 B;  3AZI B;  3AZM B;  3W98 B;  4J8V D;  3KXB A;  2NZD A;  3B0C T;  1P3F D;  4WU8 D;  1M18 B;  2NQB C;  2J8P A;  4J8U A;  3AZI C;  3AZM C;  4H9O A;  3KXB B;  3W98 C;  3LEL A;  5DNM D;  1HQ3 A;  3UT9 D;  1M18 C;  4J8U B;  4H9O B;  4Z2M H;  5AV9 D;  3KXB C;  3LEL B;  1P3G A;  5GT0 B;  3AV1 B;  3WAA B;  5JRG B;  2NZD C;  3REK D;  1HQ3 B;  4YM6 B;  1T3U A;  4J8U C;  3LJA D;  4KGC B;  1P3G B;  4J8W A;  1P3M A;  3LEL C;  5GSU D;  4H9Q A;  5JRG C;  1HQ3 C;  3WA9 D;  4YM6 C;  3LZ0 A;  3EPJ A;  3AYW A;  3AZH A;  3REL A;  4E45 A;  4J8W B;  3AN2 A;  4KGC C;  1P3G C;  4Z66 D;  2HIO D;  5B1L D;  1PZR A;  5BNV A;  5B0Y D;  3AYW B;  3B6G A;  3AN2 B;  4J8W C;  1BH9 B;  1P3M C;  5DNN A;  3REH B;  2F2A C;  1A7W A;  2XD5 A;  3REJ A;  3FDD A;  3AZH C;  3AYW C;  1EQZ D;  3AN2 C;  5DNN B;  3REJ B;  3REH C;  3B6G C;  1ZLA D;  3MGR A;  2RVQ C;  2PYO B;  5B0Z A;  5DNN C;  4LD9 B;  1Q9C A;  3REJ C;  4J8X A;  3MGR B;  4G91 B;  2PYO C;  2BYM A;  1M19 D;  4LD9 C;  4WU9 A;  5B1M B;  3MGR C;  5B0Z C;  4G91 C;  3WKJ A;  3AFA A;  1KX5 D;  2F8N K;  5CPK D;  3WTP D;  1P3L A;  3WKJ B;  3AZG D;  1KX3 D;  5GXQ D;  2Y2K A;  5B40 D;  5B32 A;  5B31 D;  3X1S B;  3X1U D;  2ARO A;  3A1I A;  5AVC D;  3AV2 D;  1P3L B;  3IP4 C;  3WKJ C;  5GT3 D;  5B32 B;  2RIQ A;  3AFA C;  3MGP D;  3X1S C;  1P3L C;  1F66 B;  5B32 C;  1P3P A;  5AY8 A;  3UTA A;  1U35 A;  4HGA B;  1P3P B;  1F66 C;  3UTA B;  4Z2M G;  5BT1 D;  4QLC D;  4CAY B;  4HGA C;  2G5I C;  3AZN D;  1P3P C;  3UTA C;  3MGQ B;  4Z5T D;  1N1J B;  1M1A D;  3P5J B;  3W97 D;  5B33 A;  4NE3 A;  3MGQ C;  1AOI A;  5AVB D;  5B33 B;  3EPH A;  5AV5 D;  3VH6 T;  5AV8 D;  3UTB D;  4YS3 A;  3C1B D;  3KUY D;  3REI D;  1AOI B;  1S32 A;  5B2J D;  5B33 C;  4AWL C;  3MGS B;  3AZE D;  3LZ1 D;  2Y2J A;  3C1C D;  3AZJ A;  1AOI C;  1TAF A;  3X1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...