1EQZB

X-ray structure of the nucleosome core particle at 2.5 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146 NUCLEOTIDES LONG DNA
publication title Asymmetries in the nucleosome core particle at 2.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein/dna
total genus 33
structure length 108
sequence length 108
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1eqzB00
5B2IA 1N1JB 4CSRA 1U35C 1M19A 5B0YA 5B24C 4KGCA 4ZUXA 1TZYA 3C1BA 1HQ3C 3KUYA 3MGPB 5GXQB 2JSSA 3AV2A 1ULYA 4YM6B 4YS3D 5GSUA 3MVDC 4EO5C 1BH9A 3AZMD 1WWIA 3AFAB 4QLCC 4R8PD 4WU8A 2YFVB 5CPKB 1TZYB 4H9NB 4KUDA 2YFWA 3X1TA 5B40D 5AY8D 4R8PC 5DNMA 4H9QA 4J8WB 4XZQB 3AV1A 1P3PC 4Z2MG 1P3BB 3AZLA 3AZGA 5DNNB 3MGQD 3TU4C 3AZJB 1P34B 3AZKA 4JJND 5B33B 5AV8C 1M1AD 3MGQC 3B6GA 1P3KA 3WAAB 3UTAC 3AZED 5B32A 1KU5A 4H9SA 3X1TB 3VH6W 4JJNC 1A7WA 5G49B 5CP6C 4J8VD 1M1AC 3O62D 3AZGB 1KX5B 5AVCC 4UUZB 5GT0B 3UT9C 2F8NB 1M18C 5CPJA 2PYOB 3O62C 1KX3C 3MGRB 2NZDD 3B0CW 3W98D 5JA4B 3AZIA 3LZ1A 5CPID 1S32A 1EQZD 3W97B 2NZDC 5GT3B 5B31B 4HGAC 4Z5TC 5B0ZA 1P3LA 3AZNB 3WTPD 5CPIC 3LZ0C 4NFTA 2F8NG 3AN2B 3MGSA 3KXBA 5AV5C 2NQBB 5AV6D 3W99D 1KX4D 5AVBD 3AZHB 1P3OC 2FJ7D 3WTPC 1M18A 3AZIB 4X23A 4Z66D 5FUGB 1P3GD 1F66A 4XUJD 4YS3B 1ZLAD 3REID 3A6NB 3AYWA 1KX4C 5AVBC 5B31G 3REHA 3AZFA 2FJ7C 2HIOC 5B1LD 1ID3D 1P3GC 4G91B 5F99B 3RELD 4XUJC 1P3AB 3VH5W 4Z5TA 5JRGD 5B2ID 4WU9C 2CV5B 5C3IB 3MGSB 4YM6C 3C1CA 3REKB 1JFIA 1M19D 5B0YD 4KGCD 4ZUXD 1ID3C 3LJAA 5B40B 3AFAC 5JRGC 5B2IC 3KWQB 1P3IA 1P3OA 1BFMA 2IO5C 3AYWB 1F1EA 1M19C 5B0YC 1BH8B 1P3FA 5BNVA 4KGCC 5GSUD 1N1JA 1TZYC 3C1BC 3AZFB 3KUYC 2BYMB 3AV2C 4XZQC 3C1CB 3MGPA 5GSUC 5GXQA 3AZEB 4WU8D 2AROA 4J8XB 3WA9D 5BO0B 1P34C 4YM6A 1U35D 4KHAB 5BT1D 5KDMB 3X1VB 5DNMD 4WU8C 5E5AB 3AV1D 1HQ3D 3AZLD 4KUDC 5BS7A 2YFVA 5BT1C 3X1TC 5CPKA 5DNMC 3MVDD 4H9NA 3AV1C 2HUEB 3AZLC 3AZGC 2AROB 1KX5C 4H9PB 4J8WA 4QLCD 3B6FA 4ZBJB 4E45A 4XZQA 5B32D 1EQZB 3AZKC 1P3BA 2PYOC 5DNNA 3NQUB 1AOIB 3AZJA 1P34A 1P3KC 3B6GC 3WKJB 5B32C 5B33A 3X1SB 4H9SC 3WAAA 1P3PD 5AV6B 5B31C 5CPJD 5B2JB 4J8UB 3TU4D 3V9RB 4G92C 4Z66B 5G49A 3B6FB 3X1UB 3REIB 5AV8D 5CPJC 1KX5A 1Q9CA 3UTAD 4UUZA 5GT0A 2F8NA 3LELB 5B0ZD 3REJA 1P3LD 3AZIC 2PYOA 3LZ1C 3RELB 3MGRA 5CP6D 3UTBB 1S32C 5JA4A 3A6NC 5B1MB 3KXBD 1B6WA 5AVCD 5B0ZC 1P3LC 3W96B 3UT9D 3W97A 1P3MB 5GT3A 3MNNB 1M18D 5B31A 4X23D 4H9OB 1KX3D 4CAYB 2CV5C 4LD9B 3MGSC 3KXBC 3REKC 3AZNA 3REHD 3AN2A 3REJB 4X23C 2NQBA 5AV9B 1F66C 3AZHA 4Z5TD 3AYWC 3WA9B 3REHC 5FUGA 3AZFC 2BYKB 3LZ0D 4YS3A 1U35B 3A6NA 5AV5D 5B24B 1P3ID 3B0DC 3C1CC 1HQ3B 1P3OD 5F99A 1P3AA 3LJAC 2CV5A 4AWLC 3REKA 1P3IC 4EO5B 4WNNB 5CHLB 4H9RB 5E5AC 2HIOD 5B40A 1P3FC 3KWQA 5GXQD 4QLCB 4WU9D 1BH8A 4YM6D 3AZMB 2HUEC 3MGPC 5GXQC 2AROC 1H3OB 2BYMA 3AFAD 4R8PB 2CWEA 1P3PB 3AZEA 5CPKD 4J8XA 5BO0A 3TU4B 1TZYD 3C1BD 3KUYD 5AY8B 4KHAA 3X1VA 5KDMA 4Z2MH 2F8NK 5BS7C 4J8WD 3AV2D 5CPKC 4XZQD 5E5AA 3MGQB 3R45B 3UTAB 1P3BD 4J8UC 5DNND 3AZJD 1P34D 4J8WC 4JJNB 3B6FC 5CP6B 3X1UC 1M1AB 1P3BC 5DNNC 3WAAD 4H9PA 5AVCB 3KSYA 3UT9B 3AZJC 1P3FB 1EQZA 4KUDD 4J8VB 3X1TD 3NQUA 3O62B 5B33C 3UTBC 1AOIA 3WAAC 3WKJA 4NE6A 3AZGD 1KX5D 3X1SA 5GT0D 2F8ND 5BNXB 2RVQC 3MNNC 5AV6A 3AZKD 5B2JA 4J8UA 2PYOD 3W98B 2NZDB 4HGAB 3MGRD 3V9RA 4Z66A 1P3KD 3B6GD 5GT0C 5CPIB 3X1UA 3LZ0B 3REJC 3REIA 3B0BA 5AV5B 3MGRC 5AV9C 5B31D 3LELA 5B1LA 3WTPE 3WTPB 3RELA 3AZND 1TAFB 3UTBA 3W97C 3AN2D 5B1MA 5GT3C 3W99B 1KX4B 2NQBD 3VH6T 5AVBB 3W96A 2FJ7B 3AZNC 2HIOB 3AZHD 1P3MA 3MNNA 4M6BA 3AZID 1P3GB 3LZ1D 4XUJB 4H9OA 4CAYA 3AN2C 1ZLAB 4WU9B 4LD9A 1S32D 2NQBC 1HTAA 3A6ND 3AZHC 5B1LB 3NQJB 1ID3B 4WV4B 3B0CT 4DRAA 5JRGB 5B2IB 5AV9A 5F99D 1P3AD 4CSRB 4YS3C 2CV5D 2IO5B 1M19B 3MGSD 3REKD 5B0YB 3WA9A 4KGCB 4ZUXB 2BYKA 3C1BB 3AZMC 3KUYB 1U35A 4G91C 5F99C 1P3AC 5B24A 3VH6A 3KWQD 3AV2B 5C3IC 1HQ3A 1F66D 5GSUB 3AYWD 1BH9B 3AZFD 5B40C 5AY8C 3KWQC 3MVDA 4WNNA 4WU8B 4H9RA 3C1CD 4QLCA 4J8XD 4KUDB 2YFWB 3LJAD 4WZSB 2L5AA 5DNMB 4H9QB 3X1VD 3AZMA 3AV1B 3VH5T 3AZEC 3AZLB 1H3OA 4J8XC 5E5AD 1P3FD 4R8PA 1P3PA 4J8VC 3AZKB 3X1VC 3MVDB 3TU4A 4DRBA 1P3KB 5AY8A 3B6GB 3MGPD 2AROD 5B32B 5AV8A 3MGQA 3R45A 1R4VA 3UTAA 3W98C 4G92B 1AOID 3WKJD 4JJNA 5CP6A 4ZBJC 4NE3A 1M1AA 1EQZC 3X1SD 3VH5A 5CPJB 5AVCA 5B2JD 4J8UD 1AOIC 3UT9A 3WKJC 1B67A 4J8VA 3LZ1B 1WWSA 3O62A 5B32G 1KX3A 3X1SC 3B6FD 5AV8B 1S32B 3X1UD 5AV6C 3W99C 5B2JC 5B0ZB 1P3LB 5BNXA 3LELD 4Z66C 2NZDA 2LY8A 3W98A 1ZLAC 3REIC 5B33D 3UTBD 3KXBB 5B1MD 5CPIA 3LELC 3LZ0A 5B1LC 3W96D 1M18B 3RELC 4X23B 5AV5A 2RVQD 1KX3B 1P3MD 3MNND 1F66B 4LD9D 5B1MC 3WTPA 4ZUXC 3REHB 3W96C 1TAFA 4NE5A 1P3MC 3REJD 3W99A 1KX4A 5AVBA 4Z5TB 5AV9D 2FJ7A 4LD9C 3B0DB 2HIOA 1JFIB 1P3GA 4XUJA 1ZLAA 4WU9A 3LJAB 4AWLB 3W97D 1P3IB 5GT3D 4E44A 5B24D 3NQJA 1P3OB 1ID3A 2F8NH 3WA9C 5BNVB 3AFAA 5JRGA
chains in the Genus database with same CATH superfamily
5B2IA 1N1JB 4CSRA 1U35C 1M19A 5B0YA 5B24C 4KGCA 4ZUXA 1TZYA 3C1BA 1HQ3C 3KUYA 3MGPB 5GXQB 2JSSA 3AV2A 1ULYA 3IP4C 4YM6B 4YS3D 5GSUA 3MVDC 4EO5C 3H0LC 1BH9A 3AZMD 1WWIA 3AFAB 4QLCC 1PZRA 4UPKA 4R8PD 4WU8A 2YFVB 5CPKB 1TZYB 4H9NB 4KUDA 2YFWA 3X1TA 5B40D 5AY8D 4R8PC 5DNMA 4H9QA 4J8WB 2DQNC 4XZQB 3AV1A 1P3PC 4Z2MG 1P3BB 3AZLA 3AZGA 5DNNB 3MGQD 3TU4C 3AZJB 1P34B 3AZKA 4JJND 5B33B 5AV8C 1M1AD 3MGQC 2ZM5A 1P3KA 3B6GA 3WAAB 3UTAC 3AZED 5B32A 1KU5A 4H9SA 3X1TB 3VH6W 4JJNC 1A7WA 2Y2OA 5G49B 5CP6C 4J8VD 1M1AC 3O62D 3AZGB 1KX5B 5AVCC 4UUZB 5GT0B 3UT9C 2F8NB 1M18C 5CPJA 2PYOB 3O62C 1KX3C 3MGRB 2NZDD 3B0CW 3W98D 5JA4B 3AZIA 3LZ1A 2XD1A 3EG5B 5CPID 1S32A 1EQZD 3W97B 2NZDC 5GT3B 5B31B 4HGAC 4Z5TC 5B0ZA 1P3LA 3AZNB 3WTPD 5CPIC 3LZ0C 4NFTA 2F8NG 3AN2B 3MGSA 3KXBA 5AV5C 2NQBB 3EPKA 5AV6D 3W99D 1KX4D 5AVBD 2JCHA 3AZHB 1P3OC 2FJ7D 3WTPC 1M18A 3AZIB 4X23A 4Z66D 5FUGB 1P3GD 1F66A 4XUJD 4YS3B 1ZLAD 3REID 3A6NB 3AYWA 1KX4C 5AVBC 5B31G 3REHA 3AZFA 2FJ7C 2HIOC 5B1LD 1ID3D 1P3GC 4G91B 5F99B 3RELD 4XUJC 1P3AB 3VH5W 4Z5TA 5JRGD 5B2ID 4WU9C 2CV5B 5C3IB 3MGSB 4YM6C 3C1CA 3REKB 1JFIA 1M19D 5B0YD 2Y2IA 4KGCD 4ZUXD 1ID3C 3LJAA 5B40B 3AFAC 5JRGC 5B2IC 3KWQB 1P3IA 1P3OA 1BFMA 2IO5C 3AYWB 1F1EA 1M19C 5B0YC 1BH8B 1P3FA 5BNVA 4KGCC 5GSUD 1N1JA 1TZYC 3C1BC 3AZFB 3KUYC 2BYMB 5JRGA 2RIQA 3AV2C 4XZQC 3C1CB 3MGPA 5GSUC 5GXQA 3AZEB 4WU8D 2AROA 4J8XB 3WA9D 5BO0B 1P34C 4DQYB 4YM6A 1U35D 4KHAB 5BT1D 5KDMB 3X1VB 5DNMD 4WU8C 5E5AB 3AV1D 1HQ3D 3AZLD 4KUDC 5BS7A 2YFVA 5BT1C 3X1TC 5CPKA 5DNMC 3MVDD 4H9NA 3AV1C 2HUEB 2Y2JA 3H0MC 3AZLC 3AZGC 2AROB 1KX5C 4H9PB 4J8WA 4QLCD 3B6FA 4ZBJB 4E45A 4XZQA 5B32D 1EQZB 3AZKC 1P3BA 2Y2HA 2PYOC 5DNNA 3NQUB 1AOIB 3AZJA 1P34A 1P3KC 3B6GC 3WKJB 5B32C 5B33A 3X1SB 2ZY3A 4H9SC 3WAAA 1P3PD 5AV6B 5B31C 5CPJD 5B2JB 4J8UB 3TU4D 3V9RB 4G92C 4Z66B 5G49A 3B6FB 3X1UB 3H0RC 3REIB 5AV8D 5CPJC 1KX5A 1Q9CA 2Y2PA 3UTAD 4UUZA 3FDDA 5GT0A 2F8NA 3LELB 5B0ZD 3REJA 1P3LD 3AZIC 2PYOA 3LZ1C 3RELB 3MGRA 5CP6D 3UTBB 1S32C 5JA4A 3A6NC 5B1MB 3KXBD 1B6WA 5AVCD 5B0ZC 1P3LC 3W96B 3UT9D 3W97A 1P3MB 5GT3A 3MNNB 1M18D 5B31A 4X23D 2G5IC 4H9OB 1KX3D 4CAYB 2CV5C 4LD9B 3MGSC 3KXBC 3REKC 3AZNA 2BG1A 3REHD 3AN2A 3REJB 4X23C 2NQBA 5AV9B 1F66C 3AZHA 4Z5TD 3AYWC 3WA9B 3REHC 5FUGA 3AZFC 2BYKB 3LZ0D 4YS3A 1U35B 3A6NA 2VQRA 5AV5D 5B24B 1P3ID 1T3UA 3B0DC 3C1CC 1HQ3B 1P3OD 5F99A 2G5HC 1P3AA 3LJAC 2CV5A 4AWLC 3REKA 1P3IC 4EO5B 4WNNB 5CHLB 3A1IA 4H9RB 2HIOD 5E5AC 5B40A 1P3FC 3EPHA 3KWQA 5GXQD 4QLCB 4WU9D 1BH8A 4YM6D 3AZMB 2HUEC 3MGPC 5GXQC 2AROC 1H3OB 2BYMA 3AFAD 4R8PB 2CWEA 1P3PB 3AZEA 2ZY2A 5CPKD 4J8XA 5BO0A 3F6TA 3TU4B 1TZYD 3C1BD 3KUYD 5AY8B 4KHAA 3X1VA 5KDMA 4Z2MH 2F8NK 5BS7C 4J8WD 3AV2D 5CPKC 4XZQD 5E5AA 3MGQB 3R45B 3UTAB 1P3BD 2Y2KA 4J8UC 5DNND 2W8SA 3AZJD 1P34D 4J8WC 4JJNB 3B6FC 5CP6B 3X1UC 1M1AB 1P3BC 5DNNC 3WAAD 4H9PA 5AVCB 3KSYA 3UT9B 3AZJC 1P3FB 1EQZA 4KUDD 2JE5A 4J8VB 3X1TD 3NQUA 3O62B 5B33C 3UTBC 1AOIA 3WAAC 3WKJA 4NE6A 3KFUG 3AZGD 1KX5D 2ZY5A 2Y2LA 3X1SA 5GT0D 2F8ND 5BNXB 2RVQC 3MNNC 5AV6A 3AZKD 5B2JA 4J8UA 2PYOD 3W98B 2NZDB 4HGAB 3MGRD 2XD5A 3P5JB 3V9RA 4Z66A 1P3KD 3B6GD 5GT0C 5CPIB 3X1UA 3LZ0B 2Y2GA 3REJC 3REIA 3B0BA 5AV5B 3MGRC 5AV9C 5B31D 3LELA 5B1LA 2Y2MA 3WTPE 3WTPB 3RELA 3AZND 1TAFB 3UTBA 3W97C 3AN2D 5B1MA 5GT3C 3W99B 1KX4B 2NQBD 3VH6T 5AVBB 3W96A 2FJ7B 4WJ3C 3AZNC 2HIOB 3AZHD 1P3MA 3MNNA 4M6BA 3AZID 2F2AC 1P3GB 3LZ1D 4XUJB 4H9OA 4CAYA 3AN2C 1ZLAB 4WU9B 4LD9A 1S32D 2NQBC 1HTAA 3A6ND 3AZHC 5B1LB 3NQJB 1ID3B 4WV4B 3B0CT 4DRAA 5JRGB 5B2IB 5AV9A 5F99D 1P3AD 2DF4C 4CSRB 4YS3C 2CV5D 2IO5B 1M19B 3MGSD 3REKD 5B0YB 3WA9A 4KGCB 4ZUXB 2BYKA 3C1BB 3EPLA 3AZMC 3KUYB 1U35A 4G91C 5F99C 1P3AC 5B24A 3VH6A 3KWQD 3AV2B 5C3IC 1HQ3A 1F66D 5GSUB 3AYWD 1BH9B 3AZFD 5B40C 5AY8C 3KWQC 3MVDA 4WNNA 4WU8B 2ZY4A 4H9RA 3C1CD 4QLCA 4J8XD 4KUDB 2YFWB 3LJAD 4WZSB 2L5AA 5DNMB 4H9QB 3X1VD 3AZMA 3AV1B 3VH5T 3AZEC 3AZLB 1H3OA 4J8XC 5E5AD 1P3FD 2J8PA 4R8PA 1P3PA 4J8VC 3AZKB 3X1VC 3MVDB 3TU4A 4DRBA 1P3KB 5AY8A 3B6GB 3MGPD 3A1KA 2AROD 5B32B 5AV8A 3MGQA 3R45A 1R4VA 3UTAA 3W98C 1Z2CB 4G92B 1AOID 3WKJD 4JJNA 5CP6A 4ZBJC 4NE3A 3EPJA 1M1AA 1EQZC 3X1SD 3VH5A 5CPJB 5AVCA 5B2JD 4J8UD 1AOIC 3UT9A 3WKJC 1B67A 4J8VA 3LZ1B 1WWSA 3O62A 5B32G 1KX3A 3X1SC 3B6FD 5AV8B 1S32B 3X1UD 5AV6C 3W99C 5B2JC 1W2EA 5B0ZB 1P3LB 5BNXA 3LELD 4Z66C 2NZDA 2LY8A 3W98A 2Y2NA 1ZLAC 3REIC 5B33D 3UTBD 3KXBB 5B1MD 5CPIA 3LELC 3LZ0A 5B1LC 3AL0C 3W96D 1M18B 3RELC 4X23B 5AV5A 2RVQD 1KX3B 1P3MD 3MNND 1F66B 2Y2QA 4LD9D 5B1MC 3WTPA 2FFFB 4ZUXC 3REHB 3W96C 1TAFA 4NE5A 1P3MC 3REJD 3W99A 1KX4A 5AVBA 4Z5TB 5AV9D 2FJ7A 4LD9C 3B0DB 2HIOA 1JFIB 2UWXA 1P3GA 4XUJA 1ZLAA 4WU9A 3LJAB 4AWLB 3W97D 1P3IB 5GT3D 4E44A 5B24D 3NQJA 1P3OB 1ID3A 2F8NH 3WA9C 3AFAA 5BNVB
chains in the Genus database with same CATH topology
5B2IA 1N1JB 4CSRA 1U35C 1M19A 5B0YA 5B24C 4KGCA 4ZUXA 1TZYA 3C1BA 1HQ3C 3KUYA 3MGPB 5GXQB 2JSSA 3AV2A 1ULYA 3IP4C 4YM6B 4YS3D 5GSUA 3MVDC 4EO5C 3H0LC 1BH9A 3AZMD 1WWIA 3AFAB 4QLCC 1PZRA 4UPKA 4R8PD 4WU8A 2YFVB 5CPKB 1TZYB 4H9NB 4KUDA 2YFWA 3X1TA 5B40D 5AY8D 4R8PC 5DNMA 4H9QA 4J8WB 2DQNC 4XZQB 3AV1A 1P3PC 4Z2MG 1P3BB 3AZLA 3AZGA 5DNNB 3MGQD 3TU4C 3AZJB 1P34B 3AZKA 4JJND 5B33B 5AV8C 1M1AD 3MGQC 2ZM5A 1P3KA 3B6GA 3WAAB 3UTAC 3AZED 5B32A 1KU5A 4H9SA 3X1TB 3VH6W 4JJNC 1A7WA 2Y2OA 5G49B 5CP6C 4J8VD 1M1AC 3O62D 3AZGB 1KX5B 5AVCC 4UUZB 5GT0B 3UT9C 2F8NB 1M18C 5CPJA 2PYOB 3O62C 1KX3C 3MGRB 2NZDD 3B0CW 3W98D 5JA4B 3AZIA 3LZ1A 2XD1A 3EG5B 5CPID 1S32A 1EQZD 3W97B 2NZDC 5GT3B 5B31B 4HGAC 4Z5TC 5B0ZA 1P3LA 3AZNB 3WTPD 5CPIC 3LZ0C 4NFTA 2F8NG 3AN2B 3MGSA 3KXBA 5AV5C 2NQBB 3EPKA 5AV6D 3W99D 1KX4D 5AVBD 2JCHA 3AZHB 1P3OC 2FJ7D 3WTPC 1M18A 3AZIB 4X23A 4Z66D 5FUGB 1P3GD 1F66A 4XUJD 4YS3B 1ZLAD 3REID 3A6NB 3AYWA 1KX4C 5AVBC 5B31G 3REHA 3AZFA 2FJ7C 2HIOC 5B1LD 1ID3D 1P3GC 4G91B 5F99B 3RELD 4XUJC 1P3AB 3VH5W 4Z5TA 5JRGD 5B2ID 4WU9C 2CV5B 5C3IB 3MGSB 4YM6C 3C1CA 3REKB 1JFIA 1M19D 5B0YD 2Y2IA 4KGCD 4ZUXD 1ID3C 3LJAA 5B40B 3AFAC 5JRGC 5B2IC 3KWQB 1P3IA 1P3OA 1BFMA 2IO5C 3AYWB 1F1EA 1M19C 5B0YC 1BH8B 1P3FA 5BNVA 4KGCC 5GSUD 1N1JA 1TZYC 3C1BC 3AZFB 3KUYC 2BYMB 5JRGA 2RIQA 3AV2C 4XZQC 3C1CB 3MGPA 5GSUC 5GXQA 3AZEB 4WU8D 2AROA 4J8XB 3WA9D 5BO0B 1P34C 4DQYB 4YM6A 1U35D 4KHAB 5BT1D 5KDMB 3X1VB 5DNMD 4WU8C 5E5AB 3AV1D 1HQ3D 3AZLD 4KUDC 5BS7A 2YFVA 5BT1C 3X1TC 5CPKA 5DNMC 3MVDD 4H9NA 3AV1C 2HUEB 2Y2JA 3H0MC 3AZLC 3AZGC 2AROB 1KX5C 4H9PB 4J8WA 4QLCD 3B6FA 4ZBJB 4E45A 4XZQA 5B32D 1EQZB 3AZKC 1P3BA 2Y2HA 2PYOC 5DNNA 3NQUB 1AOIB 3AZJA 1P34A 1P3KC 3B6GC 3WKJB 5B32C 5B33A 3X1SB 2ZY3A 4H9SC 3WAAA 1P3PD 5AV6B 5B31C 5CPJD 5B2JB 4J8UB 3TU4D 3V9RB 4G92C 4Z66B 5G49A 3B6FB 3X1UB 3H0RC 3REIB 5AV8D 5CPJC 1KX5A 1Q9CA 2Y2PA 3UTAD 4UUZA 3FDDA 5GT0A 2F8NA 3LELB 5B0ZD 3REJA 1P3LD 3AZIC 2PYOA 3LZ1C 3RELB 3MGRA 5CP6D 3UTBB 1S32C 5JA4A 3A6NC 5B1MB 3KXBD 1B6WA 5AVCD 5B0ZC 1P3LC 3W96B 3UT9D 3W97A 1P3MB 5GT3A 3MNNB 1M18D 5B31A 4X23D 2G5IC 4H9OB 1KX3D 4CAYB 2CV5C 4LD9B 3MGSC 3KXBC 3REKC 3AZNA 2BG1A 3REHD 3AN2A 3REJB 4X23C 2NQBA 5AV9B 1F66C 3AZHA 4Z5TD 3AYWC 3WA9B 3REHC 5FUGA 3AZFC 2BYKB 3LZ0D 4YS3A 1U35B 3A6NA 2VQRA 5AV5D 5B24B 1P3ID 1T3UA 3B0DC 3C1CC 1HQ3B 1P3OD 5F99A 2G5HC 1P3AA 3LJAC 2CV5A 4AWLC 3REKA 1P3IC 4EO5B 4WNNB 5CHLB 3A1IA 4H9RB 2HIOD 5E5AC 5B40A 1P3FC 3EPHA 3KWQA 5GXQD 4QLCB 4WU9D 1BH8A 4YM6D 3AZMB 2HUEC 3MGPC 5GXQC 2AROC 1H3OB 2BYMA 3AFAD 4R8PB 2CWEA 1P3PB 3AZEA 2ZY2A 5CPKD 4J8XA 5BO0A 3F6TA 3TU4B 1TZYD 3C1BD 3KUYD 5AY8B 4KHAA 3X1VA 5KDMA 4Z2MH 2F8NK 5BS7C 4J8WD 3AV2D 5CPKC 4XZQD 5E5AA 3MGQB 3R45B 3UTAB 1P3BD 2Y2KA 4J8UC 5DNND 2W8SA 3AZJD 1P34D 4J8WC 4JJNB 3B6FC 5CP6B 3X1UC 1M1AB 1P3BC 5DNNC 3WAAD 4H9PA 5AVCB 3KSYA 3UT9B 3AZJC 1P3FB 1EQZA 4KUDD 2JE5A 4J8VB 3X1TD 3NQUA 3O62B 5B33C 3UTBC 1AOIA 3WAAC 3WKJA 4NE6A 3KFUG 3AZGD 1KX5D 2ZY5A 2Y2LA 3X1SA 5GT0D 2F8ND 5BNXB 2RVQC 3MNNC 5AV6A 3AZKD 5B2JA 4J8UA 2PYOD 3W98B 2NZDB 4HGAB 3MGRD 2XD5A 3P5JB 3V9RA 4Z66A 1P3KD 3B6GD 5GT0C 5CPIB 3X1UA 3LZ0B 2Y2GA 3REJC 3REIA 3B0BA 5AV5B 3MGRC 5AV9C 5B31D 3LELA 5B1LA 2Y2MA 3WTPE 3WTPB 3RELA 3AZND 1TAFB 3UTBA 3W97C 3AN2D 5B1MA 5GT3C 3W99B 1KX4B 2NQBD 3VH6T 5AVBB 3W96A 2FJ7B 4WJ3C 3AZNC 2HIOB 3AZHD 1P3MA 3MNNA 4M6BA 3AZID 2F2AC 1P3GB 3LZ1D 4XUJB 4H9OA 4CAYA 3AN2C 1ZLAB 4WU9B 4LD9A 1S32D 2NQBC 1HTAA 3A6ND 3AZHC 5B1LB 3NQJB 1ID3B 4WV4B 3B0CT 4DRAA 5JRGB 5B2IB 5AV9A 5F99D 1P3AD 2DF4C 4CSRB 4YS3C 2CV5D 2IO5B 1M19B 3MGSD 3REKD 5B0YB 3WA9A 4KGCB 4ZUXB 2BYKA 3C1BB 3EPLA 3AZMC 3KUYB 1U35A 4G91C 5F99C 1P3AC 5B24A 3VH6A 3KWQD 3AV2B 5C3IC 1HQ3A 1F66D 5GSUB 3AYWD 1BH9B 3AZFD 5B40C 5AY8C 3KWQC 3MVDA 4WNNA 4WU8B 2ZY4A 4H9RA 3C1CD 4QLCA 4J8XD 4KUDB 2YFWB 3LJAD 4WZSB 2L5AA 5DNMB 4H9QB 3X1VD 3AZMA 3AV1B 3VH5T 3AZEC 3AZLB 1H3OA 4J8XC 5E5AD 1P3FD 2J8PA 4R8PA 1P3PA 4J8VC 3AZKB 3X1VC 3MVDB 3TU4A 4DRBA 1P3KB 5AY8A 3B6GB 3MGPD 3A1KA 2AROD 5B32B 5AV8A 3MGQA 3R45A 1R4VA 3UTAA 3W98C 1Z2CB 4G92B 1AOID 3WKJD 4JJNA 5CP6A 4ZBJC 4NE3A 3EPJA 1M1AA 1EQZC 3X1SD 3VH5A 5CPJB 5AVCA 5B2JD 4J8UD 1AOIC 3UT9A 3WKJC 1B67A 4J8VA 3LZ1B 1WWSA 3O62A 5B32G 1KX3A 3X1SC 3B6FD 5AV8B 1S32B 3X1UD 5AV6C 3W99C 5B2JC 1W2EA 5B0ZB 1P3LB 5BNXA 3LELD 4Z66C 2NZDA 2LY8A 3W98A 2Y2NA 1ZLAC 3REIC 5B33D 3UTBD 3KXBB 5B1MD 5CPIA 3LELC 3LZ0A 5B1LC 3AL0C 3W96D 1M18B 3RELC 4X23B 5AV5A 2RVQD 1KX3B 1P3MD 3MNND 1F66B 2Y2QA 4LD9D 5B1MC 3WTPA 2FFFB 4ZUXC 3REHB 3W96C 1TAFA 4NE5A 1P3MC 3REJD 3W99A 1KX4A 5AVBA 4Z5TB 5AV9D 2FJ7A 4LD9C 3B0DB 2HIOA 1JFIB 2UWXA 1P3GA 4XUJA 1ZLAA 4WU9A 3LJAB 4AWLB 3W97D 1P3IB 5GT3D 4E44A 5B24D 3NQJA 1P3OB 1ID3A 2F8NH 3WA9C 3AFAA 5BNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2I A;  1N1J B;  4CSR A;  1U35 C;  1M19 A;  5B0Y A;  5B24 C;  4KGC A;  4ZUX A;  1TZY A;  3C1B A;  1HQ3 C;  3KUY A;  3MGP B;  5GXQ B;  2JSS A;  3AV2 A;  1ULY A;  4YM6 B;  4YS3 D;  5GSU A;  3MVD C;  4EO5 C;  1BH9 A;  3AZM D;  1WWI A;  3AFA B;  4QLC C;  4R8P D;  4WU8 A;  2YFV B;  5CPK B;  1TZY B;  4H9N B;  4KUD A;  2YFW A;  3X1T A;  5B40 D;  5AY8 D;  4R8P C;  5DNM A;  4H9Q A;  4J8W B;  4XZQ B;  3AV1 A;  1P3P C;  4Z2M G;  1P3B B;  3AZL A;  3AZG A;  5DNN B;  3MGQ D;  3TU4 C;  3AZJ B;  1P34 B;  3AZK A;  4JJN D;  5B33 B;  5AV8 C;  1M1A D;  3MGQ C;  3B6G A;  1P3K A;  3WAA B;  3UTA C;  3AZE D;  5B32 A;  1KU5 A;  4H9S A;  3X1T B;  3VH6 W;  4JJN C;  1A7W A;  5G49 B;  5CP6 C;  4J8V D;  1M1A C;  3O62 D;  3AZG B;  1KX5 B;  5AVC C;  4UUZ B;  5GT0 B;  3UT9 C;  2F8N B;  1M18 C;  5CPJ A;  2PYO B;  3O62 C;  1KX3 C;  3MGR B;  2NZD D;  3B0C W;  3W98 D;  5JA4 B;  3AZI A;  3LZ1 A;  5CPI D;  1S32 A;  1EQZ D;  3W97 B;  2NZD C;  5GT3 B;  5B31 B;  4HGA C;  4Z5T C;  5B0Z A;  1P3L A;  3AZN B;  3WTP D;  5CPI C;  3LZ0 C;  4NFT A;  2F8N G;  3AN2 B;  3MGS A;  3KXB A;  5AV5 C;  2NQB B;  5AV6 D;  3W99 D;  1KX4 D;  5AVB D;  3AZH B;  1P3O C;  2FJ7 D;  3WTP C;  1M18 A;  3AZI B;  4X23 A;  4Z66 D;  5FUG B;  1P3G D;  1F66 A;  4XUJ D;  4YS3 B;  1ZLA D;  3REI D;  3A6N B;  3AYW A;  1KX4 C;  5AVB C;  5B31 G;  3REH A;  3AZF A;  2FJ7 C;  2HIO C;  5B1L D;  1ID3 D;  1P3G C;  4G91 B;  5F99 B;  3REL D;  4XUJ C;  1P3A B;  3VH5 W;  4Z5T A;  5JRG D;  5B2I D;  4WU9 C;  2CV5 B;  5C3I B;  3MGS B;  4YM6 C;  3C1C A;  3REK B;  1JFI A;  1M19 D;  5B0Y D;  4KGC D;  4ZUX D;  1ID3 C;  3LJA A;  5B40 B;  3AFA C;  5JRG C;  5B2I C;  3KWQ B;  1P3I A;  1P3O A;  1BFM A;  2IO5 C;  3AYW B;  1F1E A;  1M19 C;  5B0Y C;  1BH8 B;  1P3F A;  5BNV A;  4KGC C;  5GSU D;  1N1J A;  1TZY C;  3C1B C;  3AZF B;  3KUY C;  2BYM B;  3AV2 C;  4XZQ C;  3C1C B;  3MGP A;  5GSU C;  5GXQ A;  3AZE B;  4WU8 D;  2ARO A;  4J8X B;  3WA9 D;  5BO0 B;  1P34 C;  4YM6 A;  1U35 D;  4KHA B;  5BT1 D;  5KDM B;  3X1V B;  5DNM D;  4WU8 C;  5E5A B;  3AV1 D;  1HQ3 D;  3AZL D;  4KUD C;  5BS7 A;  2YFV A;  5BT1 C;  3X1T C;  5CPK A;  5DNM C;  3MVD D;  4H9N A;  3AV1 C;  2HUE B;  3AZL C;  3AZG C;  2ARO B;  1KX5 C;  4H9P B;  4J8W A;  4QLC D;  3B6F A;  4ZBJ B;  4E45 A;  4XZQ A;  5B32 D;  1EQZ B;  3AZK C;  1P3B A;  2PYO C;  5DNN A;  3NQU B;  1AOI B;  3AZJ A;  1P34 A;  1P3K C;  3B6G C;  3WKJ B;  5B32 C;  5B33 A;  3X1S B;  4H9S C;  3WAA A;  1P3P D;  5AV6 B;  5B31 C;  5CPJ D;  5B2J B;  4J8U B;  3TU4 D;  3V9R B;  4G92 C;  4Z66 B;  5G49 A;  3B6F B;  3X1U B;  3REI B;  5AV8 D;  5CPJ C;  1KX5 A;  1Q9C A;  3UTA D;  4UUZ A;  5GT0 A;  2F8N A;  3LEL B;  5B0Z D;  3REJ A;  1P3L D;  3AZI C;  2PYO A;  3LZ1 C;  3REL B;  3MGR A;  5CP6 D;  3UTB B;  1S32 C;  5JA4 A;  3A6N C;  5B1M B;  3KXB D;  1B6W A;  5AVC D;  5B0Z C;  1P3L C;  3W96 B;  3UT9 D;  3W97 A;  1P3M B;  5GT3 A;  3MNN B;  1M18 D;  5B31 A;  4X23 D;  4H9O B;  1KX3 D;  4CAY B;  2CV5 C;  4LD9 B;  3MGS C;  3KXB C;  3REK C;  3AZN A;  3REH D;  3AN2 A;  3REJ B;  4X23 C;  2NQB A;  5AV9 B;  1F66 C;  3AZH A;  4Z5T D;  3AYW C;  3WA9 B;  3REH C;  5FUG A;  3AZF C;  2BYK B;  3LZ0 D;  4YS3 A;  1U35 B;  3A6N A;  5AV5 D;  5B24 B;  1P3I D;  3B0D C;  3C1C C;  1HQ3 B;  1P3O D;  5F99 A;  1P3A A;  3LJA C;  2CV5 A;  4AWL C;  3REK A;  1P3I C;  4EO5 B;  4WNN B;  5CHL B;  4H9R B;  5E5A C;  2HIO D;  5B40 A;  1P3F C;  3KWQ A;  5GXQ D;  4QLC B;  4WU9 D;  1BH8 A;  4YM6 D;  3AZM B;  2HUE C;  3MGP C;  5GXQ C;  2ARO C;  1H3O B;  2BYM A;  3AFA D;  4R8P B;  2CWE A;  1P3P B;  3AZE A;  5CPK D;  4J8X A;  5BO0 A;  3TU4 B;  1TZY D;  3C1B D;  3KUY D;  5AY8 B;  4KHA A;  3X1V A;  5KDM A;  4Z2M H;  2F8N K;  5BS7 C;  4J8W D;  3AV2 D;  5CPK C;  4XZQ D;  5E5A A;  3MGQ B;  3R45 B;  3UTA B;  1P3B D;  4J8U C;  5DNN D;  3AZJ D;  1P34 D;  4J8W C;  4JJN B;  3B6F C;  5CP6 B;  3X1U C;  1M1A B;  1P3B C;  5DNN C;  3WAA D;  4H9P A;  5AVC B;  3KSY A;  3UT9 B;  3AZJ C;  1P3F B;  1EQZ A;  4KUD D;  4J8V B;  3X1T D;  3NQU A;  3O62 B;  5B33 C;  3UTB C;  1AOI A;  3WAA C;  3WKJ A;  4NE6 A;  3AZG D;  1KX5 D;  3X1S A;  5GT0 D;  2F8N D;  5BNX B;  2RVQ C;  3MNN C;  5AV6 A;  3AZK D;  5B2J A;  4J8U A;  2PYO D;  3W98 B;  2NZD B;  4HGA B;  3MGR D;  3V9R A;  4Z66 A;  1P3K D;  3B6G D;  5GT0 C;  5CPI B;  3X1U A;  3LZ0 B;  3REJ C;  3REI A;  3B0B A;  5AV5 B;  3MGR C;  5AV9 C;  5B31 D;  3LEL A;  5B1L A;  3WTP E;  3WTP B;  3REL A;  3AZN D;  1TAF B;  3UTB A;  3W97 C;  3AN2 D;  5B1M A;  5GT3 C;  3W99 B;  1KX4 B;  2NQB D;  3VH6 T;  5AVB B;  3W96 A;  2FJ7 B;  3AZN C;  2HIO B;  3AZH D;  1P3M A;  3MNN A;  4M6B A;  3AZI D;  1P3G B;  3LZ1 D;  4XUJ B;  4H9O A;  4CAY A;  3AN2 C;  1ZLA B;  4WU9 B;  4LD9 A;  1S32 D;  2NQB C;  1HTA A;  3A6N D;  3AZH C;  5B1L B;  3NQJ B;  1ID3 B;  4WV4 B;  3B0C T;  4DRA A;  5JRG B;  5B2I B;  5AV9 A;  5F99 D;  1P3A D;  4CSR B;  4YS3 C;  2CV5 D;  2IO5 B;  1M19 B;  3MGS D;  3REK D;  5B0Y B;  3WA9 A;  4KGC B;  4ZUX B;  2BYK A;  3C1B B;  3AZM C;  3KUY B;  1U35 A;  4G91 C;  5F99 C;  1P3A C;  5B24 A;  3VH6 A;  3KWQ D;  3AV2 B;  5C3I C;  1HQ3 A;  1F66 D;  5GSU B;  3AYW D;  1BH9 B;  3AZF D;  5B40 C;  5AY8 C;  3KWQ C;  3MVD A;  4WNN A;  4WU8 B;  4H9R A;  3C1C D;  4QLC A;  4J8X D;  4KUD B;  2YFW B;  3LJA D;  4WZS B;  2L5A A;  5DNM B;  4H9Q B;  3X1V D;  3AZM A;  3AV1 B;  3VH5 T;  3AZE C;  3AZL B;  1H3O A;  4J8X C;  5E5A D;  1P3F D;  4R8P A;  1P3P A;  4J8V C;  3AZK B;  3X1V C;  3MVD B;  3TU4 A;  4DRB A;  1P3K B;  5AY8 A;  3B6G B;  3MGP D;  2ARO D;  5B32 B;  5AV8 A;  3MGQ A;  3R45 A;  1R4V A;  3UTA A;  3W98 C;  4G92 B;  1AOI D;  3WKJ D;  4JJN A;  5CP6 A;  4ZBJ C;  4NE3 A;  1M1A A;  1EQZ C;  3X1S D;  3VH5 A;  5CPJ B;  5AVC A;  5B2J D;  4J8U D;  1AOI C;  3UT9 A;  3WKJ C;  1B67 A;  4J8V A;  3LZ1 B;  1WWS A;  3O62 A;  5B32 G;  1KX3 A;  3X1S C;  3B6F D;  5AV8 B;  1S32 B;  3X1U D;  5AV6 C;  3W99 C;  5B2J C;  5B0Z B;  1P3L B;  5BNX A;  3LEL D;  4Z66 C;  2NZD A;  2LY8 A;  3W98 A;  1ZLA C;  3REI C;  5B33 D;  3UTB D;  3KXB B;  5B1M D;  5CPI A;  3LEL C;  3LZ0 A;  5B1L C;  3W96 D;  1M18 B;  3REL C;  4X23 B;  5AV5 A;  2RVQ D;  1KX3 B;  1P3M D;  3MNN D;  1F66 B;  4LD9 D;  5B1M C;  3WTP A;  4ZUX C;  3REH B;  3W96 C;  1TAF A;  4NE5 A;  1P3M C;  3REJ D;  3W99 A;  1KX4 A;  5AVB A;  4Z5T B;  5AV9 D;  2FJ7 A;  4LD9 C;  3B0D B;  2HIO A;  1JFI B;  1P3G A;  4XUJ A;  1ZLA A;  4WU9 A;  3LJA B;  4AWL B;  3W97 D;  1P3I B;  5GT3 D;  4E44 A;  5B24 D;  3NQJ A;  1P3O B;  1ID3 A;  2F8N H;  3WA9 C;  5BNV B;  3AFA A;  5JRG A; 
#chains in the Genus database with same CATH topology
 5B2I A;  1N1J B;  4CSR A;  1U35 C;  1M19 A;  5B0Y A;  5B24 C;  4KGC A;  4ZUX A;  1TZY A;  3C1B A;  1HQ3 C;  3KUY A;  3MGP B;  5GXQ B;  2JSS A;  3AV2 A;  1ULY A;  3IP4 C;  4YM6 B;  4YS3 D;  5GSU A;  3MVD C;  4EO5 C;  3H0L C;  1BH9 A;  3AZM D;  1WWI A;  3AFA B;  4QLC C;  1PZR A;  4UPK A;  4R8P D;  4WU8 A;  2YFV B;  5CPK B;  1TZY B;  4H9N B;  4KUD A;  2YFW A;  3X1T A;  5B40 D;  5AY8 D;  4R8P C;  5DNM A;  4H9Q A;  4J8W B;  2DQN C;  4XZQ B;  3AV1 A;  1P3P C;  4Z2M G;  1P3B B;  3AZL A;  3AZG A;  5DNN B;  3MGQ D;  3TU4 C;  3AZJ B;  1P34 B;  3AZK A;  4JJN D;  5B33 B;  5AV8 C;  1M1A D;  3MGQ C;  2ZM5 A;  1P3K A;  3B6G A;  3WAA B;  3UTA C;  3AZE D;  5B32 A;  1KU5 A;  4H9S A;  3X1T B;  3VH6 W;  4JJN C;  1A7W A;  2Y2O A;  5G49 B;  5CP6 C;  4J8V D;  1M1A C;  3O62 D;  3AZG B;  1KX5 B;  5AVC C;  4UUZ B;  5GT0 B;  3UT9 C;  2F8N B;  1M18 C;  5CPJ A;  2PYO B;  3O62 C;  1KX3 C;  3MGR B;  2NZD D;  3B0C W;  3W98 D;  5JA4 B;  3AZI A;  3LZ1 A;  2XD1 A;  3EG5 B;  5CPI D;  1S32 A;  1EQZ D;  3W97 B;  2NZD C;  5GT3 B;  5B31 B;  4HGA C;  4Z5T C;  5B0Z A;  1P3L A;  3AZN B;  3WTP D;  5CPI C;  3LZ0 C;  4NFT A;  2F8N G;  3AN2 B;  3MGS A;  3KXB A;  5AV5 C;  2NQB B;  3EPK A;  5AV6 D;  3W99 D;  1KX4 D;  5AVB D;  2JCH A;  3AZH B;  1P3O C;  2FJ7 D;  3WTP C;  1M18 A;  3AZI B;  4X23 A;  4Z66 D;  5FUG B;  1P3G D;  1F66 A;  4XUJ D;  4YS3 B;  1ZLA D;  3REI D;  3A6N B;  3AYW A;  1KX4 C;  5AVB C;  5B31 G;  3REH A;  3AZF A;  2FJ7 C;  2HIO C;  5B1L D;  1ID3 D;  1P3G C;  4G91 B;  5F99 B;  3REL D;  4XUJ C;  1P3A B;  3VH5 W;  4Z5T A;  5JRG D;  5B2I D;  4WU9 C;  2CV5 B;  5C3I B;  3MGS B;  4YM6 C;  3C1C A;  3REK B;  1JFI A;  1M19 D;  5B0Y D;  2Y2I A;  4KGC D;  4ZUX D;  1ID3 C;  3LJA A;  5B40 B;  3AFA C;  5JRG C;  5B2I C;  3KWQ B;  1P3I A;  1P3O A;  1BFM A;  2IO5 C;  3AYW B;  1F1E A;  1M19 C;  5B0Y C;  1BH8 B;  1P3F A;  5BNV A;  4KGC C;  5GSU D;  1N1J A;  1TZY C;  3C1B C;  3AZF B;  3KUY C;  2BYM B;  5JRG A;  2RIQ A;  3AV2 C;  4XZQ C;  3C1C B;  3MGP A;  5GSU C;  5GXQ A;  3AZE B;  4WU8 D;  2ARO A;  4J8X B;  3WA9 D;  5BO0 B;  1P34 C;  4DQY B;  4YM6 A;  1U35 D;  4KHA B;  5BT1 D;  5KDM B;  3X1V B;  5DNM D;  4WU8 C;  5E5A B;  3AV1 D;  1HQ3 D;  3AZL D;  4KUD C;  5BS7 A;  2YFV A;  5BT1 C;  3X1T C;  5CPK A;  5DNM C;  3MVD D;  4H9N A;  3AV1 C;  2HUE B;  2Y2J A;  3H0M C;  3AZL C;  3AZG C;  2ARO B;  1KX5 C;  4H9P B;  4J8W A;  4QLC D;  3B6F A;  4ZBJ B;  4E45 A;  4XZQ A;  5B32 D;  1EQZ B;  3AZK C;  1P3B A;  2Y2H A;  2PYO C;  5DNN A;  3NQU B;  1AOI B;  3AZJ A;  1P34 A;  1P3K C;  3B6G C;  3WKJ B;  5B32 C;  5B33 A;  3X1S B;  2ZY3 A;  4H9S C;  3WAA A;  1P3P D;  5AV6 B;  5B31 C;  5CPJ D;  5B2J B;  4J8U B;  3TU4 D;  3V9R B;  4G92 C;  4Z66 B;  5G49 A;  3B6F B;  3X1U B;  3H0R C;  3REI B;  5AV8 D;  5CPJ C;  1KX5 A;  1Q9C A;  2Y2P A;  3UTA D;  4UUZ A;  3FDD A;  5GT0 A;  2F8N A;  3LEL B;  5B0Z D;  3REJ A;  1P3L D;  3AZI C;  2PYO A;  3LZ1 C;  3REL B;  3MGR A;  5CP6 D;  3UTB B;  1S32 C;  5JA4 A;  3A6N C;  5B1M B;  3KXB D;  1B6W A;  5AVC D;  5B0Z C;  1P3L C;  3W96 B;  3UT9 D;  3W97 A;  1P3M B;  5GT3 A;  3MNN B;  1M18 D;  5B31 A;  4X23 D;  2G5I C;  4H9O B;  1KX3 D;  4CAY B;  2CV5 C;  4LD9 B;  3MGS C;  3KXB C;  3REK C;  3AZN A;  2BG1 A;  3REH D;  3AN2 A;  3REJ B;  4X23 C;  2NQB A;  5AV9 B;  1F66 C;  3AZH A;  4Z5T D;  3AYW C;  3WA9 B;  3REH C;  5FUG A;  3AZF C;  2BYK B;  3LZ0 D;  4YS3 A;  1U35 B;  3A6N A;  2VQR A;  5AV5 D;  5B24 B;  1P3I D;  1T3U A;  3B0D C;  3C1C C;  1HQ3 B;  1P3O D;  5F99 A;  2G5H C;  1P3A A;  3LJA C;  2CV5 A;  4AWL C;  3REK A;  1P3I C;  4EO5 B;  4WNN B;  5CHL B;  3A1I A;  4H9R B;  2HIO D;  5E5A C;  5B40 A;  1P3F C;  3EPH A;  3KWQ A;  5GXQ D;  4QLC B;  4WU9 D;  1BH8 A;  4YM6 D;  3AZM B;  2HUE C;  3MGP C;  5GXQ C;  2ARO C;  1H3O B;  2BYM A;  3AFA D;  4R8P B;  2CWE A;  1P3P B;  3AZE A;  2ZY2 A;  5CPK D;  4J8X A;  5BO0 A;  3F6T A;  3TU4 B;  1TZY D;  3C1B D;  3KUY D;  5AY8 B;  4KHA A;  3X1V A;  5KDM A;  4Z2M H;  2F8N K;  5BS7 C;  4J8W D;  3AV2 D;  5CPK C;  4XZQ D;  5E5A A;  3MGQ B;  3R45 B;  3UTA B;  1P3B D;  2Y2K A;  4J8U C;  5DNN D;  2W8S A;  3AZJ D;  1P34 D;  4J8W C;  4JJN B;  3B6F C;  5CP6 B;  3X1U C;  1M1A B;  1P3B C;  5DNN C;  3WAA D;  4H9P A;  5AVC B;  3KSY A;  3UT9 B;  3AZJ C;  1P3F B;  1EQZ A;  4KUD D;  2JE5 A;  4J8V B;  3X1T D;  3NQU A;  3O62 B;  5B33 C;  3UTB C;  1AOI A;  3WAA C;  3WKJ A;  4NE6 A;  3KFU G;  3AZG D;  1KX5 D;  2ZY5 A;  2Y2L A;  3X1S A;  5GT0 D;  2F8N D;  5BNX B;  2RVQ C;  3MNN C;  5AV6 A;  3AZK D;  5B2J A;  4J8U A;  2PYO D;  3W98 B;  2NZD B;  4HGA B;  3MGR D;  2XD5 A;  3P5J B;  3V9R A;  4Z66 A;  1P3K D;  3B6G D;  5GT0 C;  5CPI B;  3X1U A;  3LZ0 B;  2Y2G A;  3REJ C;  3REI A;  3B0B A;  5AV5 B;  3MGR C;  5AV9 C;  5B31 D;  3LEL A;  5B1L A;  2Y2M A;  3WTP E;  3WTP B;  3REL A;  3AZN D;  1TAF B;  3UTB A;  3W97 C;  3AN2 D;  5B1M A;  5GT3 C;  3W99 B;  1KX4 B;  2NQB D;  3VH6 T;  5AVB B;  3W96 A;  2FJ7 B;  4WJ3 C;  3AZN C;  2HIO B;  3AZH D;  1P3M A;  3MNN A;  4M6B A;  3AZI D;  2F2A C;  1P3G B;  3LZ1 D;  4XUJ B;  4H9O A;  4CAY A;  3AN2 C;  1ZLA B;  4WU9 B;  4LD9 A;  1S32 D;  2NQB C;  1HTA A;  3A6N D;  3AZH C;  5B1L B;  3NQJ B;  1ID3 B;  4WV4 B;  3B0C T;  4DRA A;  5JRG B;  5B2I B;  5AV9 A;  5F99 D;  1P3A D;  2DF4 C;  4CSR B;  4YS3 C;  2CV5 D;  2IO5 B;  1M19 B;  3MGS D;  3REK D;  5B0Y B;  3WA9 A;  4KGC B;  4ZUX B;  2BYK A;  3C1B B;  3EPL A;  3AZM C;  3KUY B;  1U35 A;  4G91 C;  5F99 C;  1P3A C;  5B24 A;  3VH6 A;  3KWQ D;  3AV2 B;  5C3I C;  1HQ3 A;  1F66 D;  5GSU B;  3AYW D;  1BH9 B;  3AZF D;  5B40 C;  5AY8 C;  3KWQ C;  3MVD A;  4WNN A;  4WU8 B;  2ZY4 A;  4H9R A;  3C1C D;  4QLC A;  4J8X D;  4KUD B;  2YFW B;  3LJA D;  4WZS B;  2L5A A;  5DNM B;  4H9Q B;  3X1V D;  3AZM A;  3AV1 B;  3VH5 T;  3AZE C;  3AZL B;  1H3O A;  4J8X C;  5E5A D;  1P3F D;  2J8P A;  4R8P A;  1P3P A;  4J8V C;  3AZK B;  3X1V C;  3MVD B;  3TU4 A;  4DRB A;  1P3K B;  5AY8 A;  3B6G B;  3MGP D;  3A1K A;  2ARO D;  5B32 B;  5AV8 A;  3MGQ A;  3R45 A;  1R4V A;  3UTA A;  3W98 C;  1Z2C B;  4G92 B;  1AOI D;  3WKJ D;  4JJN A;  5CP6 A;  4ZBJ C;  4NE3 A;  3EPJ A;  1M1A A;  1EQZ C;  3X1S D;  3VH5 A;  5CPJ B;  5AVC A;  5B2J D;  4J8U D;  1AOI C;  3UT9 A;  3WKJ C;  1B67 A;  4J8V A;  3LZ1 B;  1WWS A;  3O62 A;  5B32 G;  1KX3 A;  3X1S C;  3B6F D;  5AV8 B;  1S32 B;  3X1U D;  5AV6 C;  3W99 C;  5B2J C;  1W2E A;  5B0Z B;  1P3L B;  5BNX A;  3LEL D;  4Z66 C;  2NZD A;  2LY8 A;  3W98 A;  2Y2N A;  1ZLA C;  3REI C;  5B33 D;  3UTB D;  3KXB B;  5B1M D;  5CPI A;  3LEL C;  3LZ0 A;  5B1L C;  3AL0 C;  3W96 D;  1M18 B;  3REL C;  4X23 B;  5AV5 A;  2RVQ D;  1KX3 B;  1P3M D;  3MNN D;  1F66 B;  2Y2Q A;  4LD9 D;  5B1M C;  3WTP A;  2FFF B;  4ZUX C;  3REH B;  3W96 C;  1TAF A;  4NE5 A;  1P3M C;  3REJ D;  3W99 A;  1KX4 A;  5AVB A;  4Z5T B;  5AV9 D;  2FJ7 A;  4LD9 C;  3B0D B;  2HIO A;  1JFI B;  2UWX A;  1P3G A;  4XUJ A;  1ZLA A;  4WU9 A;  3LJA B;  4AWL B;  3W97 D;  1P3I B;  5GT3 D;  4E44 A;  5B24 D;  3NQJ A;  1P3O B;  1ID3 A;  2F8N H;  3WA9 C;  3AFA A;  5BNV B; 
#chains in the Genus database with same CATH homology
 5B2I A;  1N1J B;  4CSR A;  1U35 C;  1M19 A;  5B0Y A;  5B24 C;  4KGC A;  4ZUX A;  1TZY A;  3C1B A;  1HQ3 C;  3KUY A;  3MGP B;  5GXQ B;  2JSS A;  3AV2 A;  1ULY A;  3IP4 C;  4YM6 B;  4YS3 D;  5GSU A;  3MVD C;  4EO5 C;  3H0L C;  1BH9 A;  3AZM D;  1WWI A;  3AFA B;  4QLC C;  1PZR A;  4UPK A;  4R8P D;  4WU8 A;  2YFV B;  5CPK B;  1TZY B;  4H9N B;  4KUD A;  2YFW A;  3X1T A;  5B40 D;  5AY8 D;  4R8P C;  5DNM A;  4H9Q A;  4J8W B;  2DQN C;  4XZQ B;  3AV1 A;  1P3P C;  4Z2M G;  1P3B B;  3AZL A;  3AZG A;  5DNN B;  3MGQ D;  3TU4 C;  3AZJ B;  1P34 B;  3AZK A;  4JJN D;  5B33 B;  5AV8 C;  1M1A D;  3MGQ C;  2ZM5 A;  1P3K A;  3B6G A;  3WAA B;  3UTA C;  3AZE D;  5B32 A;  1KU5 A;  4H9S A;  3X1T B;  3VH6 W;  4JJN C;  1A7W A;  2Y2O A;  5G49 B;  5CP6 C;  4J8V D;  1M1A C;  3O62 D;  3AZG B;  1KX5 B;  5AVC C;  4UUZ B;  5GT0 B;  3UT9 C;  2F8N B;  1M18 C;  5CPJ A;  2PYO B;  3O62 C;  1KX3 C;  3MGR B;  2NZD D;  3B0C W;  3W98 D;  5JA4 B;  3AZI A;  3LZ1 A;  2XD1 A;  3EG5 B;  5CPI D;  1S32 A;  1EQZ D;  3W97 B;  2NZD C;  5GT3 B;  5B31 B;  4HGA C;  4Z5T C;  5B0Z A;  1P3L A;  3AZN B;  3WTP D;  5CPI C;  3LZ0 C;  4NFT A;  2F8N G;  3AN2 B;  3MGS A;  3KXB A;  5AV5 C;  2NQB B;  3EPK A;  5AV6 D;  3W99 D;  1KX4 D;  5AVB D;  2JCH A;  3AZH B;  1P3O C;  2FJ7 D;  3WTP C;  1M18 A;  3AZI B;  4X23 A;  4Z66 D;  5FUG B;  1P3G D;  1F66 A;  4XUJ D;  4YS3 B;  1ZLA D;  3REI D;  3A6N B;  3AYW A;  1KX4 C;  5AVB C;  5B31 G;  3REH A;  3AZF A;  2FJ7 C;  2HIO C;  5B1L D;  1ID3 D;  1P3G C;  4G91 B;  5F99 B;  3REL D;  4XUJ C;  1P3A B;  3VH5 W;  4Z5T A;  5JRG D;  5B2I D;  4WU9 C;  2CV5 B;  5C3I B;  3MGS B;  4YM6 C;  3C1C A;  3REK B;  1JFI A;  1M19 D;  5B0Y D;  2Y2I A;  4KGC D;  4ZUX D;  1ID3 C;  3LJA A;  5B40 B;  3AFA C;  5JRG C;  5B2I C;  3KWQ B;  1P3I A;  1P3O A;  1BFM A;  2IO5 C;  3AYW B;  1F1E A;  1M19 C;  5B0Y C;  1BH8 B;  1P3F A;  5BNV A;  4KGC C;  5GSU D;  1N1J A;  1TZY C;  3C1B C;  3AZF B;  3KUY C;  2BYM B;  5JRG A;  2RIQ A;  3AV2 C;  4XZQ C;  3C1C B;  3MGP A;  5GSU C;  5GXQ A;  3AZE B;  4WU8 D;  2ARO A;  4J8X B;  3WA9 D;  5BO0 B;  1P34 C;  4DQY B;  4YM6 A;  1U35 D;  4KHA B;  5BT1 D;  5KDM B;  3X1V B;  5DNM D;  4WU8 C;  5E5A B;  3AV1 D;  1HQ3 D;  3AZL D;  4KUD C;  5BS7 A;  2YFV A;  5BT1 C;  3X1T C;  5CPK A;  5DNM C;  3MVD D;  4H9N A;  3AV1 C;  2HUE B;  2Y2J A;  3H0M C;  3AZL C;  3AZG C;  2ARO B;  1KX5 C;  4H9P B;  4J8W A;  4QLC D;  3B6F A;  4ZBJ B;  4E45 A;  4XZQ A;  5B32 D;  1EQZ B;  3AZK C;  1P3B A;  2Y2H A;  2PYO C;  5DNN A;  3NQU B;  1AOI B;  3AZJ A;  1P34 A;  1P3K C;  3B6G C;  3WKJ B;  5B32 C;  5B33 A;  3X1S B;  2ZY3 A;  4H9S C;  3WAA A;  1P3P D;  5AV6 B;  5B31 C;  5CPJ D;  5B2J B;  4J8U B;  3TU4 D;  3V9R B;  4G92 C;  4Z66 B;  5G49 A;  3B6F B;  3X1U B;  3H0R C;  3REI B;  5AV8 D;  5CPJ C;  1KX5 A;  1Q9C A;  2Y2P A;  3UTA D;  4UUZ A;  3FDD A;  5GT0 A;  2F8N A;  3LEL B;  5B0Z D;  3REJ A;  1P3L D;  3AZI C;  2PYO A;  3LZ1 C;  3REL B;  3MGR A;  5CP6 D;  3UTB B;  1S32 C;  5JA4 A;  3A6N C;  5B1M B;  3KXB D;  1B6W A;  5AVC D;  5B0Z C;  1P3L C;  3W96 B;  3UT9 D;  3W97 A;  1P3M B;  5GT3 A;  3MNN B;  1M18 D;  5B31 A;  4X23 D;  2G5I C;  4H9O B;  1KX3 D;  4CAY B;  2CV5 C;  4LD9 B;  3MGS C;  3KXB C;  3REK C;  3AZN A;  2BG1 A;  3REH D;  3AN2 A;  3REJ B;  4X23 C;  2NQB A;  5AV9 B;  1F66 C;  3AZH A;  4Z5T D;  3AYW C;  3WA9 B;  3REH C;  5FUG A;  3AZF C;  2BYK B;  3LZ0 D;  4YS3 A;  1U35 B;  3A6N A;  2VQR A;  5AV5 D;  5B24 B;  1P3I D;  1T3U A;  3B0D C;  3C1C C;  1HQ3 B;  1P3O D;  5F99 A;  2G5H C;  1P3A A;  3LJA C;  2CV5 A;  4AWL C;  3REK A;  1P3I C;  4EO5 B;  4WNN B;  5CHL B;  3A1I A;  4H9R B;  2HIO D;  5E5A C;  5B40 A;  1P3F C;  3EPH A;  3KWQ A;  5GXQ D;  4QLC B;  4WU9 D;  1BH8 A;  4YM6 D;  3AZM B;  2HUE C;  3MGP C;  5GXQ C;  2ARO C;  1H3O B;  2BYM A;  3AFA D;  4R8P B;  2CWE A;  1P3P B;  3AZE A;  2ZY2 A;  5CPK D;  4J8X A;  5BO0 A;  3F6T A;  3TU4 B;  1TZY D;  3C1B D;  3KUY D;  5AY8 B;  4KHA A;  3X1V A;  5KDM A;  4Z2M H;  2F8N K;  5BS7 C;  4J8W D;  3AV2 D;  5CPK C;  4XZQ D;  5E5A A;  3MGQ B;  3R45 B;  3UTA B;  1P3B D;  2Y2K A;  4J8U C;  5DNN D;  2W8S A;  3AZJ D;  1P34 D;  4J8W C;  4JJN B;  3B6F C;  5CP6 B;  3X1U C;  1M1A B;  1P3B C;  5DNN C;  3WAA D;  4H9P A;  5AVC B;  3KSY A;  3UT9 B;  3AZJ C;  1P3F B;  1EQZ A;  4KUD D;  2JE5 A;  4J8V B;  3X1T D;  3NQU A;  3O62 B;  5B33 C;  3UTB C;  1AOI A;  3WAA C;  3WKJ A;  4NE6 A;  3KFU G;  3AZG D;  1KX5 D;  2ZY5 A;  2Y2L A;  3X1S A;  5GT0 D;  2F8N D;  5BNX B;  2RVQ C;  3MNN C;  5AV6 A;  3AZK D;  5B2J A;  4J8U A;  2PYO D;  3W98 B;  2NZD B;  4HGA B;  3MGR D;  2XD5 A;  3P5J B;  3V9R A;  4Z66 A;  1P3K D;  3B6G D;  5GT0 C;  5CPI B;  3X1U A;  3LZ0 B;  2Y2G A;  3REJ C;  3REI A;  3B0B A;  5AV5 B;  3MGR C;  5AV9 C;  5B31 D;  3LEL A;  5B1L A;  2Y2M A;  3WTP E;  3WTP B;  3REL A;  3AZN D;  1TAF B;  3UTB A;  3W97 C;  3AN2 D;  5B1M A;  5GT3 C;  3W99 B;  1KX4 B;  2NQB D;  3VH6 T;  5AVB B;  3W96 A;  2FJ7 B;  4WJ3 C;  3AZN C;  2HIO B;  3AZH D;  1P3M A;  3MNN A;  4M6B A;  3AZI D;  2F2A C;  1P3G B;  3LZ1 D;  4XUJ B;  4H9O A;  4CAY A;  3AN2 C;  1ZLA B;  4WU9 B;  4LD9 A;  1S32 D;  2NQB C;  1HTA A;  3A6N D;  3AZH C;  5B1L B;  3NQJ B;  1ID3 B;  4WV4 B;  3B0C T;  4DRA A;  5JRG B;  5B2I B;  5AV9 A;  5F99 D;  1P3A D;  2DF4 C;  4CSR B;  4YS3 C;  2CV5 D;  2IO5 B;  1M19 B;  3MGS D;  3REK D;  5B0Y B;  3WA9 A;  4KGC B;  4ZUX B;  2BYK A;  3C1B B;  3EPL A;  3AZM C;  3KUY B;  1U35 A;  4G91 C;  5F99 C;  1P3A C;  5B24 A;  3VH6 A;  3KWQ D;  3AV2 B;  5C3I C;  1HQ3 A;  1F66 D;  5GSU B;  3AYW D;  1BH9 B;  3AZF D;  5B40 C;  5AY8 C;  3KWQ C;  3MVD A;  4WNN A;  4WU8 B;  2ZY4 A;  4H9R A;  3C1C D;  4QLC A;  4J8X D;  4KUD B;  2YFW B;  3LJA D;  4WZS B;  2L5A A;  5DNM B;  4H9Q B;  3X1V D;  3AZM A;  3AV1 B;  3VH5 T;  3AZE C;  3AZL B;  1H3O A;  4J8X C;  5E5A D;  1P3F D;  2J8P A;  4R8P A;  1P3P A;  4J8V C;  3AZK B;  3X1V C;  3MVD B;  3TU4 A;  4DRB A;  1P3K B;  5AY8 A;  3B6G B;  3MGP D;  3A1K A;  2ARO D;  5B32 B;  5AV8 A;  3MGQ A;  3R45 A;  1R4V A;  3UTA A;  3W98 C;  1Z2C B;  4G92 B;  1AOI D;  3WKJ D;  4JJN A;  5CP6 A;  4ZBJ C;  4NE3 A;  3EPJ A;  1M1A A;  1EQZ C;  3X1S D;  3VH5 A;  5CPJ B;  5AVC A;  5B2J D;  4J8U D;  1AOI C;  3UT9 A;  3WKJ C;  1B67 A;  4J8V A;  3LZ1 B;  1WWS A;  3O62 A;  5B32 G;  1KX3 A;  3X1S C;  3B6F D;  5AV8 B;  1S32 B;  3X1U D;  5AV6 C;  3W99 C;  5B2J C;  1W2E A;  5B0Z B;  1P3L B;  5BNX A;  3LEL D;  4Z66 C;  2NZD A;  2LY8 A;  3W98 A;  2Y2N A;  1ZLA C;  3REI C;  5B33 D;  3UTB D;  3KXB B;  5B1M D;  5CPI A;  3LEL C;  3LZ0 A;  5B1L C;  3AL0 C;  3W96 D;  1M18 B;  3REL C;  4X23 B;  5AV5 A;  2RVQ D;  1KX3 B;  1P3M D;  3MNN D;  1F66 B;  2Y2Q A;  4LD9 D;  5B1M C;  3WTP A;  2FFF B;  4ZUX C;  3REH B;  3W96 C;  1TAF A;  4NE5 A;  1P3M C;  3REJ D;  3W99 A;  1KX4 A;  5AVB A;  4Z5T B;  5AV9 D;  2FJ7 A;  4LD9 C;  3B0D B;  2HIO A;  1JFI B;  2UWX A;  1P3G A;  4XUJ A;  1ZLA A;  4WU9 A;  3LJA B;  4AWL B;  3W97 D;  1P3I B;  5GT3 D;  4E44 A;  5B24 D;  3NQJ A;  1P3O B;  1ID3 A;  2F8N H;  3WA9 C;  3AFA A;  5BNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...