1ERBA

The interaction of n-ethyl retinamide with plasma retinol-binding protein (rbp) and the crystal structure of the retinoid-rbp complex at 1.9 angstroms resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
173
structure length
173
Chain Sequence
b'RDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPEVQKIVRQRQEELCLARQYRLIPHNGYC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETINOL BINDING PROTEIN
publication title The interaction of N-ethyl retinamide with plasma retinol-binding protein (RBP) and the crystal structure of the retinoid-RBP complex at 1.9-A resolution.
pubmed rcsb
source organism Bos taurus
molecule tags Retinol transport
total genus 45
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 1993-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1erbA00
5B29A 4RUUA 4IB6A 2LBAA 1KT6A 1AVGI 1OEKA 3TF6A 1ML7A 2WR6A 4YDAA 2GTFX 1OPAA 3STMX 3BDRA 1SA8A 4I3DA 4ALBA 5HTDA 3P6GA 4OS3A 4ES7A 5B27A 5KICA 4ALOA 1KZXA 1FENA 2HZRA 1SY3A 2LB6A 1E06A 1QABE 5HZQA 1T0VA 5FENA 1IFCA 4XMGA 1TOWA 5HTEA 2MM3A 3RZYA 1B4MA 4LZUA 3BLGA 1ZNDA 1ERBA 2LKKA 1ZNLA 3D95A 3VG6A 1DZJA 5HA0A 4AZPA 1KXOA 4GNYA 3HWDA 3ZQ3A 1LIBA 1A57A 1YWDA 1E5PA 4YFPA 1KGLA 1E00A 2JU3A 4A8ZA 1I05A 4YCEA 5HZ8A 2QOSC 4BQUA 3B2JA 4NYRA 4ZHGA 4QAEA 5HBSA 3CBSA 4HFOA 1HMSA 2WWPA 3CQRA 3FA7A 2WEXA 2CZUA 4ZFXA 4GETA 5AQ6A 1XKIA 1R0UA 2HYSA 3I0AA 1EPAA 2OVDA 2AH7X 1MX8A 3PH5A 4Y0PA 1LNMA 3FW4A 4LKTA 5HA1A 4DQ3A 4N7CA 4M7MA 2IFBA 3K3LA 1OEJA 4QZTA 3WJGA 4YFQA 3B2HA 3WJCA 1BLRA 2WUTA 2JOZA 1LF7A 4AZMA 1EUOA 1ZNGA 4HPCA 4ZHHA 3APWA 1RBPA 4NLIA 1YWBA 1TXLA 4LKPA 4QYNA 2NNEA 1ACDA 4OS0A 3FIQA 3HK1A 4YKMA 5HWZA 4BVMA 1DV9A 5L8IA 3VG2A 3B2KA 3VG4A 3FR4A 4LZVA 1GX9A 4AYHA 2RA6A 1BEBA 1QY1A 1T8VA 2NP1A 1ICMA 1QFVA 4QZUA 1BWYA 4ARHA 5LKFA 3KQ0A 1VYFA 1ADLA 2MO5A 3TZSA 5H9AA 5H9KA 1O1VA 2LFOA 3BU9A 2FTBA 1BSQA 4NYQA 1CRBA 4RUNA 1BRPA 5LJGA 1HN2A 1EW3A 2A2UA 5LJCA 2A0AA 2QM9A 4YGHA 4MVIA 1GKAB 1T68X 1I06A 3C76X 5EEEA 3TGAA 3NR3A 4ORWA 1X89A 2A2GA 3APVA 3WBGA 2NNDA 1S2PA 1D3SA 2ALLX 2GC9A 1YIVA 1NGLA 1TVQA 4YMYA 2R56A 2WQAE 3WJFA 4WFUA 5L8OA 4TKJA 1MVGA 5EEDA 1EXSA 3D96A 4XMDA 3PP6A 2XSTA 3PEDA 4IB8A 1I04A 4QGVA 1QQSA 4GRJA 2AT0X 3UEWA 5L8NA 1GGLA 1OBPA 1AQBA 1H91A 4MVLA 1I4UA 1MUPA 1E02A 5FAZA 2FLJA 2Q39A 2ASNX 4A1YA 4R0BA 4TQ2A 1EIOA 1O1UA 3FEPA 3MVFA 2WEWA 5HZ9A 1HQPA 5HZ6A 1JJJA 2QO6A 1GXAA 3BSZE 2X45A 5EDBA 1ZNEA 1QWDA 3P6EA 2Q2MA 4I3BA 3T1DA 1B8EA 2RD7C 2NNQA 5LJHA 3BX8A 1HMTA 1LIDA 2JU8A 1JYDA 5D45A 5EZ2A 2HLVA 1EPBA 4Y0RA 4NLJA 2Q4NA 1B0OA 1DZPA 5HZ5A 2W2AA 5D4AA 5F6BA 2WQ9A 2AMMX 1EQDA 2X46A 4ZHFA 3FW5A 1OPBA 4ZH9A 4GE1A 1DZMA 1KQWA 1GT4A 2W2FA 3AKMA 3SAOA 1VPRA 3KFHA 1JYJA 2CZTA 3VG7A 5HCEC 3FR5A 4YBPA 5F6ZA 1IKEA 2HMBA 2PY1A 4IBAA 4TLJA 1VYGA 1ZNKA 1ICNA 5K06A 4AZRA 1G7NA 1QFTA 3D97A 4XMHA 2G78A 4HPDA 4AZQA 3IA8A 1G85A 1YP6A 3NX2A 4XMCA 1IW2A 2ANSA 3IFBA 3KFIA 1RLBE 3P6HA 3L4RA 3FA8A 2F73A 2R74A 3U03A 3NP1A 4HPAA 2A3FX 3DTQA 3I17A 1Z24A 1HMRA 1KT5A 2RCTA 4K19A 3O2YA 1X8UA 3KFGA 3NPOA 4QGWA 2G79A 2FS6A 1N0SA 1FDQA 3B2IA 1B56A 3S26A 2OFMX 2QO5A 1U0XA 2R73A 2Q9SA 1SXYA 3P6DA 2OVEA 3APXA 1IFBA 1NP1A 3JS1A 4TJZA 1G5WA 4QYPA 5F1EA 3VG5A 3PPTA 3STNA 3BU1A 2CM9A 1GKAA 4HPBA 4ZGUA 3B2LA 2DM5A 4GH7A 2Q2PA 4M6SA 1MDCA 3ELZA 3KFFA 4YH0A 2AT6X 4ZH6A 5HCDC 1JBHA 5D48A 3AKNA 1CJ5A 4UU2A 5F7GA 3MBTA 4D6BA 3FR2A 2P8GA 1KT3A 4A60A 1HBQA 1SY0A 5H8TA 1G74A 2RCQA 3UEVA 3JSQA 3UEXA 4ZR2A 5C0NA 3P6CA 5KHPA 2POAA 1YUPA 2L68A 4EEJA 5D47A 2FWVA 1BBPA 1TOUA 4NNTA 4N7DA 2E4JA 3G7XA 1X8NA 2AL0X 3GAQA 1DF3A 1OEEA 1PM1X 3ZUIA 2QO4A 1SXXA 5KIDA 2AT5X 3DSZA 2OVAA 1IKJA 2AT8X 3FA6A 1LICA 5JR8A 1A3YA 1SXUA 2O62A 3FENA 3WJBA 1IIUA 2N93A 3HWFA 3CR6A 4Y0QA 2CM4A 3O22A 3FLLA 3C78X 3F9DA 5DG4A 4ZJ0A 1BRQA 5BVSA 1FEMA 1JJXA 3WVMA 5LJBA 1LIFA 4OS8A 3PECA 4EXZA 4NP1A 1FE3A 1QG5A 2XKLA 4UU3A 4YCHA 1LFOA 4GKCA 4MVKA 3ZUOA 1KT7A 1X8PA 4CK4A 2FR2A 4IAWA 5HAEA 3PH6A 4YKOA 2GJ5A 1JV4A 4ORYA 2FT9A 5EDCA 4XMFA 3CQNA 3BRNA 3FELA 4A1HA 1CBRA 4YGGA 3VG3A 3RSWA 3EBWA 4PSQA 3WXQA 1CBIA 2FRSA 3BX7A 1JZUA 5LJDA 5IO5A 1BJ7A 2L9CA 4YFRA 4ZHDA 4IB9A 1HBPA 2KTDA 1A18A 3CBCA 1MX7A 1OBQA 5IO6A 1TW4A 4NNSA 2A13A 1GT1A 1GM6A 1KT4A 1NP4A 3EBKA 3STKA 4ORRA 3NQ3A 3EMMA 5F58A 2L67A 4TKBA 1U17A 3HWGA 5DPQA 3WJEA 3OJYC 4ODDA 3NQ9A 5IO7A 3APUA 2MJIA 1DZKA 2W2BA 5BVQA 5LJEA 2HZQA 1ZRYA 1LIEA 1DFVA 3UEUA 3EYCA 1S7DA 4YDBA 4YGZA 1P6PA 1SY2A 4WFVA 1PEEA 1FELA 1LKEA 2AT3X 1UZ2X 1D2UA 2RQ0A 3U0DA 3CMPA 4O9SA 2G7BA 3P6FA 1LPJA 5FFHA 1FTPA 2LBVA 2K23A 3QKGA 4I3CA 4IB7A 1CBQA 3CWKA 4DQ4A 4IMOA 1ZNHA 1X71A 4Y0SA 1U18A 4I9SA 3TGBA 4ORUA 1SY1A 4OMWA 5D8JA 1AELA 4EFGA 1KZWA 4OMXA 3NADA 2ACOA 4ZHCA 2OZQA 4IMNA 3HWEA 4ZCBA 1BSOA 2KT4B 3F8AA 1X8QA 3O19A 4AZOA 4YBUA 4TKHA 5CE4A 4QGXA 2EU7X 4TNNA 2FR3A 1GT5A 1DC9A 1O8VA 1ALBA 3FMZA 1ERXA 2ACPX 3EM0A 5HCCC 2FS7A 1GX8A 1BSYA 2BLGA 3FEKA 2JN3A 1EALA 2CBRA 2OFRX 5EPQA 4EDEA 3BS2A 1XCAA 1OBUA 3C77X 1QY0A 5H9NA 5H9LA 1L6MA 4I9RA 1YWAA 2JU7A 4AW8A 3ELXA 1BM5A 2CBSA 4XMEA 3WJDA 1QY2A 3Q6LA 4ORXA 1PMPA 3TGCA 1YWCA 5LKEA 1SXWA 1UREA 1EIIA 3KZAA 1S44A 2K62A 3U9PC 4AZNA 3BY0A 3FA9A 1PBOA 4GNWA 1AB0A 2YG2A 4D6AA 1YP7A 2WSJA 4KIIA 4ORSA 1KQXA 4WBKA 5LJKA 4IAXA 3NX1A 1KOIA 4BOEA 5BVTA 1CBSA 2HNXA 2L5PA 2AKQA 1X8OA 1A2DA 1GT3A
chains in the Genus database with same CATH superfamily
2FHNX 5B29A 1VWPB 4IB6A 1SWLA 4RUUA 2LBAA 2RTJA 1KT6A 2X32A 1AVGI 1OEKA 1LELA 4U8UN 3TF6A 5FQ6E 1ML7A 2WR6A 1PTSA 4I60A 4YDAA 3FYFA 2JW1A 2GTFX 3SLTA 3ZW1A 1OPAA 3STMX 3BDRA 1SLDB 3RWXA 1SA8A 4I3DA 4FBVA 4ALBA 3P6GA 5HTDA 4OS3A 1SWUA 4ES7A 1JMXA 4GDAA 5CYBA 5B27A 5KICA 4ALOA 1KZXA 4INNA 1FENA 1VWOB 3VHIA 2HZRA 1SY3A 3MG5A 2LB6A 4JGLA 4FBRA 4O3XB 1E06A 4ML7B 5IXGA 1QABE 4GDZA 5HZQA 1T0VA 5FENA 1IFCA 4XMGA 1TOWA 5HTEA 2MM3A 3RZYA 2IZKA 1B4MA 1VWGB 2OVSA 4LZUA 3BLGA 1ZNDA 1ERBA 2LKKA 4O4XA 1ZNLA 3D95A 3VG6A 2JGSA 1LCZA 2RTFB 1DZJA 2FGSA 2F09A 5HA0A 4AZPA 1KXOA 4GNYA 3HWDA 3ZQ3A 1LIBA 4HWMA 4KC7A 1A57A 1YWDA 4CDCA 1E5PA 3LV4A 4BX6A 4GUZA 4ON1A 2IZBA 1KL3A 1E00A 2JU3A 3LHNA 1I05A 4YCEA 4YFPA 4A8ZA 5HZ8A 2GTLN 2QOSC 4BQUA 1E2TA 3VHHA 3B2JA 3RDXA 4NYRA 4ZHGA 2JMBA 4QAEA 3S5XA 5HBSA 3CBSA 4HFOA 1HMSA 1SWEA 2WWPA 1Y9TA 1RXKA 3CQRA 3FA7A 2Y32A 2WEXA 2CZUA 4ZFXA 4GETA 5AQ6A 1N7YA 1XKIA 1R0UA 1NC9A 2HYSA 3PQSA 3EW1A 3I0AA 1EPAA 2OVDA 2MHDA 4U8UO 2AH7X 1MX8A 1RXJA 3PH5A 3HPEA 4BX7B 4Y0PA 4I95A 4IRWA 4GZVA 1LNMA 3FW4A 4LKTA 5IRAA 3RBYA 4MEEA 5HA1A 2RTOB 4N7CA 5FQ7E 4CPEA 4M7MA 4DQ3A 2IFBA 3K3LA 1OEJA 5FQ8E 3RKGA 4QZTA 3WJGA 4YFQA 3AEHA 1LDOA 3B2HA 2WUTA 2JOZA 5AJCA 1LF7A 3RDOA 3WJCA 4AZMA 1EUOA 1ZNGA 3P02A 3UAQA 4HPCA 4ZHHA 3APWA 3SZJA 1RBPA 4NLIA 1WBIA 1TXLA 1YWBA 2IZJA 4LKPA 3VPJE 2BT9A 4QYNA 2NNEA 1ACDA 4OS0A 3WZQA 4ZGFA 1HXLA 3FIQA 3HK1A 4GK9A 1MK5A 4YKMA 1LUQA 5HWZA 2VFBA 4BVMA 2A5CA 1DV9A 5L8IA 3VG2A 1VWNB 2RTKA 3B2KA 4I6SA 3VG4A 3FR4A 1SLGB 4LZVA 3V8UA 1GX9A 1WUBA 2BS6A 4AYHA 2RA6A 1BEBA 1QY1A 1T8VA 4CPHA 3KVNA 1HY2A 1STSB 1N9MA 2NP1A 1ICMA 1QFVA 4QZUA 1BWYA 4ARHA 1SREA 4QRLA 3KQ0A 4FGIB 5LKFA 1VYFA 1ADLA 2GTLO 2MO5A 3TZSA 1VWDB 5H9AA 2I5VO 3LTWA 5H9KA 1O1VA 2LFOA 3BU9A 2FTBA 1BSQA 4NYQA 1SMPI 3WZNA 1CRBA 5B10O 4RUNA 4CPFA 1BRPA 1UYOX 1N9YA 2Z4IA 1HN2A 3JQOA 5LJGA 1EW3A 2A2UA 3VE2A 5LJCA 2A0AA 1SRGA 2QM9A 4YGHA 2DJGA 4MVIA 1GKAB 1T68X 1I06A 4MIRA 3C76X 5EEEA 3TGAA 3NR3A 4ORWA 2Z4HA 3WYQA 5JD2A 1GX3A 4NV7A 2OY7A 2RTNB 1X89A 2A2GA 2I5ZO 3APVA 3WBGA 2NNDA 3OE3A 1I9HA 1D3SA 1NDJA 1S2PA 2ALLX 4DCBA 2GC9A 3P24A 4KT5A 3D4RA 1YIVA 2RTIB 1NGLA 1TVQA 4YMYA 3WZOA 2R56A 2WQAE 3EW2A 4WFUA 3WJFA 5L8OA 4TKJA 2C4IA 2OY5O 2RTPB 1MVGA 5EEDA 1EXSA 1W6FA 3D96A 4XMDA 5AJBA 3PP6A 2XSTA 2QCBA 3PEDA 1I04A 4IB8A 4PJ2A 4QGVA 1LDQA 4BJ8A 1QQSA 4FQBB 1SLFB 4GRJA 2AT0X 3UEWA 4Z27A 1VWRB 2IZLB 5L8NA 2X55A 1MEPA 1GGLA 1OBPA 1AQBA 1H91A 2M4LA 1VWKB 4MVLA 4NV8A 4JNJA 1I4UA 2RTMA 1MUPA 1E02A 1NBXA 5FAZA 2FLJA 5L3YA 2Q39A 1W5RA 2FKJA 2ASNX 4A1YA 4R0BA 4TQ2A 1EIOA 1O1UA 3FEPA 2OF9A 3MVFA 3ZZVA 2WEWA 5HZ9A 1HQPA 5HZ6A 2VFCA 4QNIA 2OF8A 1JJJA 2QO6A 1GXAA 3BSZE 2X45A 5EDBA 4OEMA 1ZNEA 5AEOA 1QWDA 3P6EA 2Q2MA 4I3BA 5CSEA 3T1DA 1B8EA 1SWPA 2RD7C 2NNQA 2RTDB 2HKDA 4O3WA 5LJHA 4Y59A 3BX8A 1HMTA 1LIDA 2JU8A 2Y3EA 4U46A 4BCSA 4U8UM 1JYDA 5D45A 2MF6A 3HOEA 5EZ2A 2HLVA 2X8FA 2OY1O 3PQUA 1EPBA 4U3QA 4Y0RA 4NLJA 2Q4NA 1B0OA 1DZPA 3RDUA 5HZ5A 2IZFB 1K24A 1IJ8A 2W2AA 5D4AA 5F6BA 2WQ9A 2AMMX 1EQDA 2X46A 4ZHFA 3FW5A 2C1SA 1OPBA 4ZH9A 4GE1A 1DZMA 1KQWA 1GT4A 4BX7A 2F01A 2W2FA 3AKMA 3SAOA 3RY1A 5IRUA 1VPRA 3KFHA 1MM9A 1JYJA 2CZTA 3D9WA 3RY2A 3VG7A 5HCEC 1SWFA 3FR5A 4GD9A 2RTAA 5F6ZA 4YBPA 3T6LA 1IKEA 2HMBA 2PY1A 4IBAA 4TLJA 1VYGA 1ZNKA 1ICNA 4Y5DA 3ZW2A 1G7NA 4AZRA 5K06A 1QFTA 3D97A 4XMHA 2G78A 2UZ2A 4HPDA 4AZQA 3OD9A 3IA8A 5CHKA 1G85A 1YP6A 1LCWA 1JMZA 1N43A 1SWRA 1IW2A 2ANSA 3NX2A 4XMCA 4EQAC 3PK2A 3IFBA 3KFIA 1RLBE 3AUMO 3P6HA 3L4RA 3FA8A 2BHVA 2F73A 2R74A 1N4JA 4OELA 3U03A 3NP1A 3OBLA 2A3FX 3DTQA 3I17A 1Z24A 1HMRA 1KT5A 1FJ1E 2RCTA 1RXHA 3O2YA 4K19A 1X8UA 3KFGA 3SLJA 3NPOA 3WOVA 2OFAA 4QGWA 2G79A 2X34A 1STRB 4JHQA 2FS6A 1N0SA 1FDQA 3B2IA 1B56A 1VWJB 3S26A 2OFMX 1I78A 2QO5A 1U0XA 2R73A 2Q9SA 1SXYA 3P6DA 4Z2OA 2OVEA 3APXA 3MX7A 5B2AO 1IFBA 1NP1A 1SWQA 3JS1A 1EI5A 4GGRA 4TJZA 1G5WA 4OKAA 4QYPA 5F1EA 4O4UA 3F6ZB 3VG5A 3PPTA 3STNA 3BU1A 2CM9A 2OYBO 1GKAA 4HPBA 4ZGUA 1JIWI 3B2LA 2DM5A 2MWHA 4GH7A 2Q2PA 3WYPA 4M6SA 1MDCA 3ELZA 3KFFA 4YH0A 2AT6X 5B11O 4ZH6A 5HCDC 2G8CO 1JBHA 2KD2A 3AKNA 5D48A 1SWTA 5B3MO 3FDCA 4BGFA 1SWKA 4UU2A 5F7GA 3MBTA 1CJ5A 4D6BA 1Y52X 3FR2A 2G5LA 5IRWA 2P8GA 1KT3A 4A60A 5BYPA 1HBQA 3EC5A 1SY0A 1SRIA 2RTLA 3HTYA 5H8TA 1G74A 2BC3A 2RCQA 3UEVA 1KFFA 3JSQA 3UEXA 4ZR2A 2RTHB 4Z28A 5C0NA 3P6CA 1RAVA 5KHPA 2POAA 1YUPA 2L68A 1KL4A 4EEJA 4LQZA 2X4MA 5D47A 2FWVA 1BBPA 1TOUA 3WZPA 4NNTA 4N7DA 2E4JA 3ZW0B 3G7XA 3NQKA 4EKVA 1X8NA 2AL0X 3GAQA 1DF3A 1OEEA 1LCVA 1PM1X 3ZUIA 2QO4A 1SXXA 1SWOA 2AT5X 5KIDA 1NQNA 3DSZA 2OVAA 3T6FA 1IKJA 1K3BA 2AT8X 3FA6A 1LICA 3ZWEA 1A3YA 1SXUA 5JR8A 1HQQA 1DF8A 2O62A 3FENA 4GJVA 1IIUA 3WJBA 4COTA 2N93A 2RTQB 3HWFA 3T2WA 1SWBA 2A8GA 3CR6A 4Y0QA 1VWBB 2CM4A 3O22A 3FLLA 3C78X 4IABA 1SRFA 2OY8A 2RTRB 1VYOA 5F2BA 3F9DA 5DG4A 3SZHA 1BRQA 5BVSA 4ZJ0A 1FEMA 1JJXA 3CKGA 2X56A 3WVMA 3S60A 1SWGA 5LJBA 3VHMA 3N91A 3T2XA 2AF5A 1LIFA 2C1QA 4OS8A 3PECA 2YMSA 4O4OA 4EXZA 2IZEB 4NP1A 3RDSA 1FE3A 1QG5A 2XKLA 4UU3A 1SWJA 3SOTA 4YCHA 1LFOA 4GKCA 4MVKA 3ZUOA 1STPA 1KT7A 1X8PA 4CK4A 2FR2A 4IAWA 5HAEA 3PH6A 4YKOA 2GJ5A 4KH8A 4CSBA 1JV4A 4ORYA 2FT9A 2A5BA 4B55A 2RTEB 5EDCA 4CDEA 1MOYA 4XMFA 2Y3FA 2ZAGA 1VWEB 3CQNA 3BRNA 3FELA 4A1HA 1CBRA 4YGGA 3VG3A 4GGZA 2IZDB 2WPUA 3RSWA 3EBWA 4PSQA 3SZIA 3WXQA 2RN4A 1CBIA 4GU8A 2FRSA 3BX7A 1JZUA 4BX5B 2OFBA 1Y0GA 5LJDA 5IO5A 1BJ7A 1VWFB 2BSZA 2L9CA 2RTCB 4YFRA 4ZHDA 1KGLA 1VWIB 4KCAA 4IB9A 1HBPA 1SWHA 2QMIA 2RTBB 1VWLB 2KTDA 3Q34A 3ZW1B 3RE5A 1A18A 3CBCA 1MX7A 1OBQA 5IO6A 4GGTA 2RTGB 1TW4A 4NNSA 1GT1A 2A13A 1GM6A 1AVEA 1KL5A 1KT4A 1NP4A 3EBKA 4O3YA 3VGWA 4O3ZA 2OL6O 3RE6A 4ORRA 1AVDA 2IZGB 3EMMA 3NQ3A 5F58A 5B5GA 3STKA 4FBOA 1PBYA 2L67A 4TKBA 1U17A 3HWGA 4CDFA 2BS5A 5DPQA 3WJEA 3OJYC 3FIDA 4ODDA 4GJSA 3NQ9A 3VU1A 2GH7A 5IO7A 2GTLM 2IZIA 3APUA 1BLRA 2MJIA 1DZKA 2W2BA 3MM0A 5BVQA 5LJEA 4Z2VA 2HZQA 1ZRYA 1SWAA 3NBXX 1LIEA 1DFVA 3UEUA 4BX6B 2ZSCA 1SRHA 1VWQB 1Y9LA 3EYCA 4Z6JA 1S7DA 2DJFA 4YDBA 4YGZA 1P6PA 1SY2A 4WFVA 1PEEA 4YVBA 1FELA 1LKEA 2AT3X 1UZ2X 1D2UA 2RQ0A 1NQMA 3U0DA 3CMPA 4O9SA 2G7BA 3CKFA 4O4SA 1SWNA 3P6FA 1LPJA 4O49A 5FFHA 1FTPA 2LBVA 2IZHB 2K23A 3QKGA 4I3CA 1VWHB 4IB7A 3QQ2A 1CBQA 1JJUA 3CWKA 4IMOA 1ZNHA 1X71A 4DQ4A 2KTSA 4Y0SA 1U18A 4I9SA 3TGBA 4MVEA 4ORUA 1SY1A 2AVIA 4OMWA 2OL8O 5D8JA 3VE1A 3PDFA 4EFGA 4CV7A 4OMXA 1AELA 1KZWA 2LA7A 2VDFA 1Y53X 2FKGA 3NADA 3RDQA 2ACOA 4ZHCA 1W4TA 2OZQA 2ZAIA 4IMNA 3HWEA 4KC8A 4ZCBA 1BSOA 5K68A 2KT4B 3F8AA 1X8QA 3O19A 4AZOA 4YBUA 4C5PA 4MISA 4TKHA 3SLOA 1JQPA 4QGXA 5CE4A 2KW1A 2EU7X 3ZW0A 2IZCB 1SRJA 4TNNA 2FR3A 3GE2A 1GT5A 1DC9A 1O8VA 1ALBA 3FMZA 1HXZA 3S5VA 1ERXA 5K67A 2ACPX 3EM0A 5HCCC 2FS7A 2X8TA 1SWCA 1GX8A 1BSYA 2BLGA 3FEKA 4U9CA 2JN3A 1EALA 4DNEA 2CBRA 4L1NA 2OFRX 3H3IA 1OSPO 4CPHB 2X8SA 4QQ1A 5EPQA 1RSTB 4EDEA 3BS2A 1XCAA 1OBUA 3C77X 1QY0A 1VWMB 5H9NA 5H9LA 1L6MA 4I9RA 1YWAA 2JU7A 1SWSA 4AW8A 2FHLA 3ELXA 1RSUB 1SLEB 2OL7A 3X00A 1BM5A 2CBSA 1SWDA 4HPAA 4ID2A 3HOLA 4WHIA 1UYNX 4XMEA 4JO6A 4L3RA 1QY2A 1VWAB 3E3CA 3Q6LA 4NW4A 4ORXA 3WJDA 1PMPA 3TGCA 1VWCB 1YWCA 2QOMA 5B5FA 5LKEA 3RDMA 1SXWA 1UREA 1EIIA 3KZAA 1S44A 2K62A 3U9PC 4AZNA 3BY0A 3FA9A 1PBOA 4GNWA 4CPIA 1AB0A 3ZI8A 2YG2A 4D6AA 1YP7A 2WSJA 4Z2PA 2PI3O 4KIIA 4ORSA 2IZAA 2CAMA 1KQXA 4WBKA 4CDDA 4IAXA 3NX1A 1KOIA 5LJKA 4BOEA 5BVTA 1CBSA 1Y55X 2HNXA 4BBOA 2AKQA 2L5PA 1X8OA 1A2DA 2UYWA 4BX5A 1GT3A
chains in the Genus database with same CATH topology
5B29A 4RUUA 4IB6A 2LBAA 4U8UN 1KT6A 1AVGI 1OEKA 3TF6A 5FQ6E 1ML7A 2WR6A 4YDAA 3FYFA 2JW1A 2GTFX 3ZW1A 1OPAA 3STMX 3BDRA 3RWXA 1SA8A 4I3DA 4FBVA 4ALBA 3P6GA 5HTDA 4OS3A 4ES7A 5CYBA 5B27A 5KICA 4ALOA 1KZXA 4INNA 1FENA 2HZRA 1SY3A 4FBRA 2LB6A 4JGLA 4O3XB 1E06A 4ML7B 1QABE 4GDZA 5HZQA 1T0VA 5FENA 1IFCA 4XMGA 1TOWA 5HTEA 2MM3A 3RZYA 1B4MA 2OVSA 4LZUA 3BLGA 1ZNDA 1ERBA 2LKKA 4O4XA 1ZNLA 3D95A 3VG6A 1DZJA 2F09A 5HA0A 4AZPA 1KXOA 4GNYA 3HWDA 3ZQ3A 1LIBA 4HWMA 4KC7A 1A57A 1YWDA 1E5PA 3LV4A 4ON1A 4YFPA 3LHNA 1E00A 2JU3A 4A8ZA 1I05A 4YCEA 1KGLA 5HZ8A 2GTLN 2QOSC 4BQUA 3B2JA 4NYRA 4ZHGA 2JMBA 4QAEA 3S5XA 5HBSA 3CBSA 4HFOA 1HMSA 2WWPA 1Y9TA 3CQRA 3FA7A 2WEXA 2CZUA 4ZFXA 4GETA 5AQ6A 1XKIA 1R0UA 2HYSA 3PQSA 3I0AA 1EPAA 2OVDA 2MHDA 4U8UO 2AH7X 1MX8A 3PH5A 4Y0PA 4I95A 4GZVA 1LNMA 3FW4A 4LKTA 3RBYA 5HA1A 5FQ7E 4N7CA 4DQ3A 4M7MA 2IFBA 3K3LA 1OEJA 5FQ8E 3RKGA 4QZTA 3WJGA 4YFQA 3B2HA 3WJCA 1BLRA 2WUTA 2JOZA 5AJCA 1LF7A 4AZMA 1EUOA 1ZNGA 3P02A 3UAQA 4HPCA 4ZHHA 3APWA 1RBPA 4NLIA 1YWBA 1TXLA 4LKPA 3VPJE 2BT9A 4QYNA 2NNEA 1ACDA 4OS0A 4ZGFA 3FIQA 3HK1A 4GK9A 4YKMA 5HWZA 4BVMA 1DV9A 5L8IA 3VG2A 3B2KA 4I6SA 3VG4A 3FR4A 4LZVA 3V8UA 1GX9A 2BS6A 4AYHA 2RA6A 1BEBA 1QY1A 1T8VA 2NP1A 1ICMA 1QFVA 4QZUA 1BWYA 4ARHA 5LKFA 4QRLA 3KQ0A 4FGIB 1VYFA 1ADLA 2GTLO 2MO5A 3TZSA 5H9AA 5H9KA 1O1VA 2LFOA 3BU9A 2FTBA 1BSQA 4NYQA 1SMPI 1CRBA 4RUNA 1BRPA 3JQOA 5LJGA 2Z4IA 1HN2A 1EW3A 2A2UA 3VE2A 5LJCA 2A0AA 2QM9A 4YGHA 4MVIA 1GKAB 1T68X 1I06A 4MIRA 3C76X 5EEEA 3TGAA 3NR3A 4ORWA 2Z4HA 1X89A 2A2GA 3APVA 3WBGA 2NNDA 3OE3A 1S2PA 1D3SA 2ALLX 2GC9A 3P24A 4KT5A 3D4RA 1YIVA 1NGLA 1TVQA 4YMYA 2R56A 2WQAE 3WJFA 4WFUA 5L8OA 4TKJA 1MVGA 5EEDA 1EXSA 5AJBA 3D96A 4XMDA 3PP6A 2XSTA 3PEDA 4IB8A 1I04A 4PJ2A 4QGVA 1QQSA 4FQBB 4GRJA 2AT0X 3UEWA 5L8NA 1GGLA 1OBPA 1AQBA 1H91A 2M4LA 4MVLA 1I4UA 1MUPA 1E02A 5FAZA 2FLJA 2Q39A 2ASNX 4A1YA 4R0BA 4TQ2A 1EIOA 1O1UA 3FEPA 3MVFA 3ZZVA 2WEWA 5HZ9A 1HQPA 5HZ6A 4QNIA 1JJJA 2QO6A 1GXAA 3BSZE 2X45A 5EDBA 1ZNEA 5AEOA 1QWDA 3P6EA 2Q2MA 4I3BA 3T1DA 1B8EA 2RD7C 2NNQA 4O3WA 5LJHA 3BX8A 1HMTA 1LIDA 2JU8A 4U8UM 1JYDA 5D45A 5EZ2A 3HOEA 2HLVA 2X8FA 3PQUA 1EPBA 4U3QA 4Y0RA 4NLJA 2Q4NA 1B0OA 1DZPA 5HZ5A 2W2AA 5D4AA 5F6BA 2WQ9A 2AMMX 1EQDA 2X46A 4ZHFA 3FW5A 1OPBA 4ZH9A 4GE1A 1DZMA 1KQWA 1GT4A 2W2FA 3AKMA 3SAOA 1VPRA 3KFHA 1JYJA 2CZTA 3VG7A 5HCEC 3FR5A 4YBPA 5F6ZA 1IKEA 2HMBA 2PY1A 4IBAA 4TLJA 1VYGA 1ZNKA 1ICNA 3ZW2A 4AZRA 1G7NA 5K06A 1QFTA 3D97A 4XMHA 2G78A 4HPDA 4AZQA 3OD9A 3IA8A 1G85A 1YP6A 3NX2A 4XMCA 1IW2A 2ANSA 4EQAC 3IFBA 3KFIA 1RLBE 3P6HA 3L4RA 3FA8A 2BHVA 2F73A 2R74A 3U03A 3NP1A 3OBLA 2A3FX 3DTQA 3I17A 1Z24A 1HMRA 1KT5A 2RCTA 4HPAA 3O2YA 4K19A 3WOVA 1X8UA 3KFGA 3NPOA 4QGWA 2G79A 2FS6A 1N0SA 1FDQA 3B2IA 1B56A 3S26A 2OFMX 2QO5A 1U0XA 2R73A 2Q9SA 1SXYA 3P6DA 2OVEA 3APXA 3MX7A 1IFBA 1NP1A 3JS1A 4TJZA 1EI5A 1G5WA 4QYPA 5F1EA 4O4UA 3F6ZB 3VG5A 3PPTA 3STNA 3BU1A 2CM9A 1GKAA 4HPBA 4ZGUA 1JIWI 3B2LA 2DM5A 2MWHA 4GH7A 2Q2PA 4M6SA 1MDCA 3ELZA 3KFFA 4YH0A 2AT6X 4ZH6A 5HCDC 1JBHA 2KD2A 3AKNA 5D48A 1CJ5A 4UU2A 5F7GA 3MBTA 4D6BA 3FR2A 2P8GA 1KT3A 4A60A 5BYPA 1HBQA 1SY0A 3HTYA 5H8TA 1G74A 2RCQA 3UEVA 3JSQA 3UEXA 4ZR2A 5C0NA 3P6CA 5KHPA 2POAA 1YUPA 2L68A 4EEJA 4LQZA 5D47A 2FWVA 1BBPA 1TOUA 4NNTA 4N7DA 2E4JA 3ZW0B 3G7XA 3NQKA 1X8NA 2AL0X 3GAQA 1DF3A 1OEEA 1PM1X 3ZUIA 2QO4A 1SXXA 5KIDA 2AT5X 3DSZA 2OVAA 1IKJA 2AT8X 3FA6A 1LICA 3ZWEA 1A3YA 1SXUA 5JR8A 2O62A 3FENA 3WJBA 1IIUA 4COTA 2N93A 3HWFA 3CR6A 4Y0QA 2CM4A 3O22A 3FLLA 3C78X 4IABA 3F9DA 5DG4A 4ZJ0A 1BRQA 5BVSA 1FEMA 1JJXA 3WVMA 3S60A 5LJBA 3N91A 1LIFA 4OS8A 3PECA 2YMSA 4O4OA 4EXZA 4NP1A 1FE3A 1QG5A 2XKLA 4UU3A 3SOTA 4YCHA 1LFOA 4GKCA 4MVKA 3ZUOA 1KT7A 1X8PA 4CK4A 2FR2A 4IAWA 5HAEA 3PH6A 4YKOA 2GJ5A 4KH8A 4CSBA 1JV4A 4ORYA 2FT9A 5EDCA 4XMFA 2ZAGA 3CQNA 3BRNA 3FELA 4A1HA 1CBRA 4YGGA 3VG3A 3RSWA 3EBWA 4PSQA 3WXQA 2RN4A 1CBIA 4GU8A 2FRSA 3BX7A 1JZUA 5LJDA 5IO5A 1BJ7A 2L9CA 4YFRA 4ZHDA 4KCAA 4IB9A 1HBPA 2QMIA 2KTDA 3ZW1B 1A18A 3CBCA 1MX7A 1OBQA 5IO6A 1TW4A 4NNSA 2A13A 1GT1A 1GM6A 1KT4A 1NP4A 3EBKA 4O3YA 4O3ZA 3STKA 4ORRA 3NQ3A 3EMMA 5F58A 4FBOA 2L67A 4TKBA 1U17A 3HWGA 2BS5A 5DPQA 3WJEA 3OJYC 4ODDA 3NQ9A 3VU1A 5IO7A 2GTLM 3APUA 2MJIA 1DZKA 2W2BA 5BVQA 5LJEA 2HZQA 1ZRYA 3NBXX 1LIEA 1DFVA 3UEUA 1Y9LA 3EYCA 1S7DA 4YDBA 4YGZA 1P6PA 1SY2A 4WFVA 1PEEA 1FELA 1LKEA 2AT3X 1UZ2X 1D2UA 2RQ0A 3U0DA 3CMPA 4O9SA 2G7BA 4O4SA 3P6FA 1LPJA 4O49A 5FFHA 1FTPA 2LBVA 2K23A 3QKGA 4I3CA 4IB7A 1CBQA 3CWKA 4DQ4A 4IMOA 1ZNHA 1X71A 2KTSA 4Y0SA 1U18A 4I9SA 3TGBA 4MVEA 4ORUA 1SY1A 4OMWA 5D8JA 3VE1A 4CV7A 1AELA 4EFGA 1KZWA 4OMXA 2LA7A 3NADA 2ACOA 4ZHCA 2OZQA 2ZAIA 4IMNA 3HWEA 4KC8A 4ZCBA 1BSOA 2KT4B 3F8AA 1X8QA 3O19A 4AZOA 4YBUA 4MISA 4TKHA 5CE4A 4QGXA 2KW1A 2EU7X 3ZW0A 4TNNA 2FR3A 3GE2A 1GT5A 1DC9A 1O8VA 1ALBA 3FMZA 3S5VA 1ERXA 2ACPX 3EM0A 5HCCC 2FS7A 2X8TA 1GX8A 1BSYA 2BLGA 3FEKA 4U9CA 2JN3A 1EALA 2CBRA 4L1NA 2OFRX 3H3IA 2X8SA 4QQ1A 5EPQA 4EDEA 3BS2A 1XCAA 1OBUA 3C77X 1QY0A 5H9NA 5H9LA 1L6MA 4I9RA 1YWAA 2JU7A 4AW8A 3ELXA 1BM5A 2CBSA 4ID2A 3HOLA 4WHIA 4XMEA 4NW4A 4L3RA 1QY2A 3E3CA 3Q6LA 4ORXA 3WJDA 1PMPA 3TGCA 1YWCA 5LKEA 1SXWA 1UREA 1EIIA 3KZAA 1S44A 2K62A 3U9PC 4AZNA 3BY0A 3FA9A 1PBOA 4GNWA 1AB0A 3ZI8A 2YG2A 4D6AA 1YP7A 2WSJA 4KIIA 4ORSA 1KQXA 4WBKA 5LJKA 4IAXA 3NX1A 1KOIA 4BOEA 5BVTA 1CBSA 2HNXA 2L5PA 2AKQA 1X8OA 1A2DA 1GT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B29 A;  4RUU A;  4IB6 A;  2LBA A;  1KT6 A;  1AVG I;  1OEK A;  3TF6 A;  1ML7 A;  2WR6 A;  4YDA A;  2GTF X;  1OPA A;  3STM X;  3BDR A;  1SA8 A;  4I3D A;  4ALB A;  5HTD A;  3P6G A;  4OS3 A;  4ES7 A;  5B27 A;  5KIC A;  4ALO A;  1KZX A;  1FEN A;  2HZR A;  1SY3 A;  2LB6 A;  1E06 A;  1QAB E;  5HZQ A;  1T0V A;  5FEN A;  1IFC A;  4XMG A;  1TOW A;  5HTE A;  2MM3 A;  3RZY A;  1B4M A;  4LZU A;  3BLG A;  1ZND A;  1ERB A;  2LKK A;  1ZNL A;  3D95 A;  3VG6 A;  1DZJ A;  5HA0 A;  4AZP A;  1KXO A;  4GNY A;  3HWD A;  3ZQ3 A;  1LIB A;  1A57 A;  1YWD A;  1E5P A;  4YFP A;  1KGL A;  1E00 A;  2JU3 A;  4A8Z A;  1I05 A;  4YCE A;  5HZ8 A;  2QOS C;  4BQU A;  3B2J A;  4NYR A;  4ZHG A;  4QAE A;  5HBS A;  3CBS A;  4HFO A;  1HMS A;  2WWP A;  3CQR A;  3FA7 A;  2WEX A;  2CZU A;  4ZFX A;  4GET A;  5AQ6 A;  1XKI A;  1R0U A;  2HYS A;  3I0A A;  1EPA A;  2OVD A;  2AH7 X;  1MX8 A;  3PH5 A;  4Y0P A;  1LNM A;  3FW4 A;  4LKT A;  5HA1 A;  4DQ3 A;  4N7C A;  4M7M A;  2IFB A;  3K3L A;  1OEJ A;  4QZT A;  3WJG A;  4YFQ A;  3B2H A;  3WJC A;  1BLR A;  2WUT A;  2JOZ A;  1LF7 A;  4AZM A;  1EUO A;  1ZNG A;  4HPC A;  4ZHH A;  3APW A;  1RBP A;  4NLI A;  1YWB A;  1TXL A;  4LKP A;  4QYN A;  2NNE A;  1ACD A;  4OS0 A;  3FIQ A;  3HK1 A;  4YKM A;  5HWZ A;  4BVM A;  1DV9 A;  5L8I A;  3VG2 A;  3B2K A;  3VG4 A;  3FR4 A;  4LZV A;  1GX9 A;  4AYH A;  2RA6 A;  1BEB A;  1QY1 A;  1T8V A;  2NP1 A;  1ICM A;  1QFV A;  4QZU A;  1BWY A;  4ARH A;  5LKF A;  3KQ0 A;  1VYF A;  1ADL A;  2MO5 A;  3TZS A;  5H9A A;  5H9K A;  1O1V A;  2LFO A;  3BU9 A;  2FTB A;  1BSQ A;  4NYQ A;  1CRB A;  4RUN A;  1BRP A;  5LJG A;  1HN2 A;  1EW3 A;  2A2U A;  5LJC A;  2A0A A;  2QM9 A;  4YGH A;  4MVI A;  1GKA B;  1T68 X;  1I06 A;  3C76 X;  5EEE A;  3TGA A;  3NR3 A;  4ORW A;  1X89 A;  2A2G A;  3APV A;  3WBG A;  2NND A;  1S2P A;  1D3S A;  2ALL X;  2GC9 A;  1YIV A;  1NGL A;  1TVQ A;  4YMY A;  2R56 A;  2WQA E;  3WJF A;  4WFU A;  5L8O A;  4TKJ A;  1MVG A;  5EED A;  1EXS A;  3D96 A;  4XMD A;  3PP6 A;  2XST A;  3PED A;  4IB8 A;  1I04 A;  4QGV A;  1QQS A;  4GRJ A;  2AT0 X;  3UEW A;  5L8N A;  1GGL A;  1OBP A;  1AQB A;  1H91 A;  4MVL A;  1I4U A;  1MUP A;  1E02 A;  5FAZ A;  2FLJ A;  2Q39 A;  2ASN X;  4A1Y A;  4R0B A;  4TQ2 A;  1EIO A;  1O1U A;  3FEP A;  3MVF A;  2WEW A;  5HZ9 A;  1HQP A;  5HZ6 A;  1JJJ A;  2QO6 A;  1GXA A;  3BSZ E;  2X45 A;  5EDB A;  1ZNE A;  1QWD A;  3P6E A;  2Q2M A;  4I3B A;  3T1D A;  1B8E A;  2RD7 C;  2NNQ A;  5LJH A;  3BX8 A;  1HMT A;  1LID A;  2JU8 A;  1JYD A;  5D45 A;  5EZ2 A;  2HLV A;  1EPB A;  4Y0R A;  4NLJ A;  2Q4N A;  1B0O A;  1DZP A;  5HZ5 A;  2W2A A;  5D4A A;  5F6B A;  2WQ9 A;  2AMM X;  1EQD A;  2X46 A;  4ZHF A;  3FW5 A;  1OPB A;  4ZH9 A;  4GE1 A;  1DZM A;  1KQW A;  1GT4 A;  2W2F A;  3AKM A;  3SAO A;  1VPR A;  3KFH A;  1JYJ A;  2CZT A;  3VG7 A;  5HCE C;  3FR5 A;  4YBP A;  5F6Z A;  1IKE A;  2HMB A;  2PY1 A;  4IBA A;  4TLJ A;  1VYG A;  1ZNK A;  1ICN A;  5K06 A;  4AZR A;  1G7N A;  1QFT A;  3D97 A;  4XMH A;  2G78 A;  4HPD A;  4AZQ A;  3IA8 A;  1G85 A;  1YP6 A;  3NX2 A;  4XMC A;  1IW2 A;  2ANS A;  3IFB A;  3KFI A;  1RLB E;  3P6H A;  3L4R A;  3FA8 A;  2F73 A;  2R74 A;  3U03 A;  3NP1 A;  4HPA A;  2A3F X;  3DTQ A;  3I17 A;  1Z24 A;  1HMR A;  1KT5 A;  2RCT A;  4K19 A;  3O2Y A;  1X8U A;  3KFG A;  3NPO A;  4QGW A;  2G79 A;  2FS6 A;  1N0S A;  1FDQ A;  3B2I A;  1B56 A;  3S26 A;  2OFM X;  2QO5 A;  1U0X A;  2R73 A;  2Q9S A;  1SXY A;  3P6D A;  2OVE A;  3APX A;  1IFB A;  1NP1 A;  3JS1 A;  4TJZ A;  1G5W A;  4QYP A;  5F1E A;  3VG5 A;  3PPT A;  3STN A;  3BU1 A;  2CM9 A;  1GKA A;  4HPB A;  4ZGU A;  3B2L A;  2DM5 A;  4GH7 A;  2Q2P A;  4M6S A;  1MDC A;  3ELZ A;  3KFF A;  4YH0 A;  2AT6 X;  4ZH6 A;  5HCD C;  1JBH A;  5D48 A;  3AKN A;  1CJ5 A;  4UU2 A;  5F7G A;  3MBT A;  4D6B A;  3FR2 A;  2P8G A;  1KT3 A;  4A60 A;  1HBQ A;  1SY0 A;  5H8T A;  1G74 A;  2RCQ A;  3UEV A;  3JSQ A;  3UEX A;  4ZR2 A;  5C0N A;  3P6C A;  5KHP A;  2POA A;  1YUP A;  2L68 A;  4EEJ A;  5D47 A;  2FWV A;  1BBP A;  1TOU A;  4NNT A;  4N7D A;  2E4J A;  3G7X A;  1X8N A;  2AL0 X;  3GAQ A;  1DF3 A;  1OEE A;  1PM1 X;  3ZUI A;  2QO4 A;  1SXX A;  5KID A;  2AT5 X;  3DSZ A;  2OVA A;  1IKJ A;  2AT8 X;  3FA6 A;  1LIC A;  5JR8 A;  1A3Y A;  1SXU A;  2O62 A;  3FEN A;  3WJB A;  1IIU A;  2N93 A;  3HWF A;  3CR6 A;  4Y0Q A;  2CM4 A;  3O22 A;  3FLL A;  3C78 X;  3F9D A;  5DG4 A;  4ZJ0 A;  1BRQ A;  5BVS A;  1FEM A;  1JJX A;  3WVM A;  5LJB A;  1LIF A;  4OS8 A;  3PEC A;  4EXZ A;  4NP1 A;  1FE3 A;  1QG5 A;  2XKL A;  4UU3 A;  4YCH A;  1LFO A;  4GKC A;  4MVK A;  3ZUO A;  1KT7 A;  1X8P A;  4CK4 A;  2FR2 A;  4IAW A;  5HAE A;  3PH6 A;  4YKO A;  2GJ5 A;  1JV4 A;  4ORY A;  2FT9 A;  5EDC A;  4XMF A;  3CQN A;  3BRN A;  3FEL A;  4A1H A;  1CBR A;  4YGG A;  3VG3 A;  3RSW A;  3EBW A;  4PSQ A;  3WXQ A;  1CBI A;  2FRS A;  3BX7 A;  1JZU A;  5LJD A;  5IO5 A;  1BJ7 A;  2L9C A;  4YFR A;  4ZHD A;  4IB9 A;  1HBP A;  2KTD A;  1A18 A;  3CBC A;  1MX7 A;  1OBQ A;  5IO6 A;  1TW4 A;  4NNS A;  2A13 A;  1GT1 A;  1GM6 A;  1KT4 A;  1NP4 A;  3EBK A;  3STK A;  4ORR A;  3NQ3 A;  3EMM A;  5F58 A;  2L67 A;  4TKB A;  1U17 A;  3HWG A;  5DPQ A;  3WJE A;  3OJY C;  4ODD A;  3NQ9 A;  5IO7 A;  3APU A;  2MJI A;  1DZK A;  2W2B A;  5BVQ A;  5LJE A;  2HZQ A;  1ZRY A;  1LIE A;  1DFV A;  3UEU A;  3EYC A;  1S7D A;  4YDB A;  4YGZ A;  1P6P A;  1SY2 A;  4WFV A;  1PEE A;  1FEL A;  1LKE A;  2AT3 X;  1UZ2 X;  1D2U A;  2RQ0 A;  3U0D A;  3CMP A;  4O9S A;  2G7B A;  3P6F A;  1LPJ A;  5FFH A;  1FTP A;  2LBV A;  2K23 A;  3QKG A;  4I3C A;  4IB7 A;  1CBQ A;  3CWK A;  4DQ4 A;  4IMO A;  1ZNH A;  1X71 A;  4Y0S A;  1U18 A;  4I9S A;  3TGB A;  4ORU A;  1SY1 A;  4OMW A;  5D8J A;  1AEL A;  4EFG A;  1KZW A;  4OMX A;  3NAD A;  2ACO A;  4ZHC A;  2OZQ A;  4IMN A;  3HWE A;  4ZCB A;  1BSO A;  2KT4 B;  3F8A A;  1X8Q A;  3O19 A;  4AZO A;  4YBU A;  4TKH A;  5CE4 A;  4QGX A;  2EU7 X;  4TNN A;  2FR3 A;  1GT5 A;  1DC9 A;  1O8V A;  1ALB A;  3FMZ A;  1ERX A;  2ACP X;  3EM0 A;  5HCC C;  2FS7 A;  1GX8 A;  1BSY A;  2BLG A;  3FEK A;  2JN3 A;  1EAL A;  2CBR A;  2OFR X;  5EPQ A;  4EDE A;  3BS2 A;  1XCA A;  1OBU A;  3C77 X;  1QY0 A;  5H9N A;  5H9L A;  1L6M A;  4I9R A;  1YWA A;  2JU7 A;  4AW8 A;  3ELX A;  1BM5 A;  2CBS A;  4XME A;  3WJD A;  1QY2 A;  3Q6L A;  4ORX A;  1PMP A;  3TGC A;  1YWC A;  5LKE A;  1SXW A;  1URE A;  1EII A;  3KZA A;  1S44 A;  2K62 A;  3U9P C;  4AZN A;  3BY0 A;  3FA9 A;  1PBO A;  4GNW A;  1AB0 A;  2YG2 A;  4D6A A;  1YP7 A;  2WSJ A;  4KII A;  4ORS A;  1KQX A;  4WBK A;  5LJK A;  4IAX A;  3NX1 A;  1KOI A;  4BOE A;  5BVT A;  1CBS A;  2HNX A;  2L5P A;  2AKQ A;  1X8O A;  1A2D A;  1GT3 A; 
#chains in the Genus database with same CATH topology
 2FHN X;  5B29 A;  1VWP B;  4IB6 A;  1SWL A;  4RUU A;  2LBA A;  2RTJ A;  1KT6 A;  2X32 A;  1AVG I;  1OEK A;  1LEL A;  4U8U N;  3TF6 A;  5FQ6 E;  1ML7 A;  2WR6 A;  1PTS A;  4I60 A;  4YDA A;  3FYF A;  2JW1 A;  2GTF X;  3SLT A;  3ZW1 A;  1OPA A;  3STM X;  3BDR A;  1SLD B;  3RWX A;  1SA8 A;  4I3D A;  4FBV A;  4ALB A;  3P6G A;  5HTD A;  4OS3 A;  1SWU A;  4ES7 A;  1JMX A;  4GDA A;  5CYB A;  5B27 A;  5KIC A;  4ALO A;  1KZX A;  4INN A;  1FEN A;  1VWO B;  3VHI A;  2HZR A;  1SY3 A;  3MG5 A;  2LB6 A;  4JGL A;  4FBR A;  4O3X B;  1E06 A;  4ML7 B;  5IXG A;  1QAB E;  4GDZ A;  5HZQ A;  1T0V A;  5FEN A;  1IFC A;  4XMG A;  1TOW A;  5HTE A;  2MM3 A;  3RZY A;  2IZK A;  1B4M A;  1VWG B;  2OVS A;  4LZU A;  3BLG A;  1ZND A;  1ERB A;  2LKK A;  4O4X A;  1ZNL A;  3D95 A;  3VG6 A;  2JGS A;  1LCZ A;  2RTF B;  1DZJ A;  2FGS A;  2F09 A;  5HA0 A;  4AZP A;  1KXO A;  4GNY A;  3HWD A;  3ZQ3 A;  1LIB A;  4HWM A;  4KC7 A;  1A57 A;  1YWD A;  4CDC A;  1E5P A;  3LV4 A;  4BX6 A;  4GUZ A;  4ON1 A;  2IZB A;  1KL3 A;  1E00 A;  2JU3 A;  3LHN A;  1I05 A;  4YCE A;  4YFP A;  4A8Z A;  5HZ8 A;  2GTL N;  2QOS C;  4BQU A;  1E2T A;  3VHH A;  3B2J A;  3RDX A;  4NYR A;  4ZHG A;  2JMB A;  4QAE A;  3S5X A;  5HBS A;  3CBS A;  4HFO A;  1HMS A;  1SWE A;  2WWP A;  1Y9T A;  1RXK A;  3CQR A;  3FA7 A;  2Y32 A;  2WEX A;  2CZU A;  4ZFX A;  4GET A;  5AQ6 A;  1N7Y A;  1XKI A;  1R0U A;  1NC9 A;  2HYS A;  3PQS A;  3EW1 A;  3I0A A;  1EPA A;  2OVD A;  2MHD A;  4U8U O;  2AH7 X;  1MX8 A;  1RXJ A;  3PH5 A;  3HPE A;  4BX7 B;  4Y0P A;  4I95 A;  4IRW A;  4GZV A;  1LNM A;  3FW4 A;  4LKT A;  5IRA A;  3RBY A;  4MEE A;  5HA1 A;  2RTO B;  4N7C A;  5FQ7 E;  4CPE A;  4M7M A;  4DQ3 A;  2IFB A;  3K3L A;  1OEJ A;  5FQ8 E;  3RKG A;  4QZT A;  3WJG A;  4YFQ A;  3AEH A;  1LDO A;  3B2H A;  2WUT A;  2JOZ A;  5AJC A;  1LF7 A;  3RDO A;  3WJC A;  4AZM A;  1EUO A;  1ZNG A;  3P02 A;  3UAQ A;  4HPC A;  4ZHH A;  3APW A;  3SZJ A;  1RBP A;  4NLI A;  1WBI A;  1TXL A;  1YWB A;  2IZJ A;  4LKP A;  3VPJ E;  2BT9 A;  4QYN A;  2NNE A;  1ACD A;  4OS0 A;  3WZQ A;  4ZGF A;  1HXL A;  3FIQ A;  3HK1 A;  4GK9 A;  1MK5 A;  4YKM A;  1LUQ A;  5HWZ A;  2VFB A;  4BVM A;  2A5C A;  1DV9 A;  5L8I A;  3VG2 A;  1VWN B;  2RTK A;  3B2K A;  4I6S A;  3VG4 A;  3FR4 A;  1SLG B;  4LZV A;  3V8U A;  1GX9 A;  1WUB A;  2BS6 A;  4AYH A;  2RA6 A;  1BEB A;  1QY1 A;  1T8V A;  4CPH A;  3KVN A;  1HY2 A;  1STS B;  1N9M A;  2NP1 A;  1ICM A;  1QFV A;  4QZU A;  1BWY A;  4ARH A;  1SRE A;  4QRL A;  3KQ0 A;  4FGI B;  5LKF A;  1VYF A;  1ADL A;  2GTL O;  2MO5 A;  3TZS A;  1VWD B;  5H9A A;  2I5V O;  3LTW A;  5H9K A;  1O1V A;  2LFO A;  3BU9 A;  2FTB A;  1BSQ A;  4NYQ A;  1SMP I;  3WZN A;  1CRB A;  5B10 O;  4RUN A;  4CPF A;  1BRP A;  1UYO X;  1N9Y A;  2Z4I A;  1HN2 A;  3JQO A;  5LJG A;  1EW3 A;  2A2U A;  3VE2 A;  5LJC A;  2A0A A;  1SRG A;  2QM9 A;  4YGH A;  2DJG A;  4MVI A;  1GKA B;  1T68 X;  1I06 A;  4MIR A;  3C76 X;  5EEE A;  3TGA A;  3NR3 A;  4ORW A;  2Z4H A;  3WYQ A;  5JD2 A;  1GX3 A;  4NV7 A;  2OY7 A;  2RTN B;  1X89 A;  2A2G A;  2I5Z O;  3APV A;  3WBG A;  2NND A;  3OE3 A;  1I9H A;  1D3S A;  1NDJ A;  1S2P A;  2ALL X;  4DCB A;  2GC9 A;  3P24 A;  4KT5 A;  3D4R A;  1YIV A;  2RTI B;  1NGL A;  1TVQ A;  4YMY A;  3WZO A;  2R56 A;  2WQA E;  3EW2 A;  4WFU A;  3WJF A;  5L8O A;  4TKJ A;  2C4I A;  2OY5 O;  2RTP B;  1MVG A;  5EED A;  1EXS A;  1W6F A;  3D96 A;  4XMD A;  5AJB A;  3PP6 A;  2XST A;  2QCB A;  3PED A;  1I04 A;  4IB8 A;  4PJ2 A;  4QGV A;  1LDQ A;  4BJ8 A;  1QQS A;  4FQB B;  1SLF B;  4GRJ A;  2AT0 X;  3UEW A;  4Z27 A;  1VWR B;  2IZL B;  5L8N A;  2X55 A;  1MEP A;  1GGL A;  1OBP A;  1AQB A;  1H91 A;  2M4L A;  1VWK B;  4MVL A;  4NV8 A;  4JNJ A;  1I4U A;  2RTM A;  1MUP A;  1E02 A;  1NBX A;  5FAZ A;  2FLJ A;  5L3Y A;  2Q39 A;  1W5R A;  2FKJ A;  2ASN X;  4A1Y A;  4R0B A;  4TQ2 A;  1EIO A;  1O1U A;  3FEP A;  2OF9 A;  3MVF A;  3ZZV A;  2WEW A;  5HZ9 A;  1HQP A;  5HZ6 A;  2VFC A;  4QNI A;  2OF8 A;  1JJJ A;  2QO6 A;  1GXA A;  3BSZ E;  2X45 A;  5EDB A;  4OEM A;  1ZNE A;  5AEO A;  1QWD A;  3P6E A;  2Q2M A;  4I3B A;  5CSE A;  3T1D A;  1B8E A;  1SWP A;  2RD7 C;  2NNQ A;  2RTD B;  2HKD A;  4O3W A;  5LJH A;  4Y59 A;  3BX8 A;  1HMT A;  1LID A;  2JU8 A;  2Y3E A;  4U46 A;  4BCS A;  4U8U M;  1JYD A;  5D45 A;  2MF6 A;  3HOE A;  5EZ2 A;  2HLV A;  2X8F A;  2OY1 O;  3PQU A;  1EPB A;  4U3Q A;  4Y0R A;  4NLJ A;  2Q4N A;  1B0O A;  1DZP A;  3RDU A;  5HZ5 A;  2IZF B;  1K24 A;  1IJ8 A;  2W2A A;  5D4A A;  5F6B A;  2WQ9 A;  2AMM X;  1EQD A;  2X46 A;  4ZHF A;  3FW5 A;  2C1S A;  1OPB A;  4ZH9 A;  4GE1 A;  1DZM A;  1KQW A;  1GT4 A;  4BX7 A;  2F01 A;  2W2F A;  3AKM A;  3SAO A;  3RY1 A;  5IRU A;  1VPR A;  3KFH A;  1MM9 A;  1JYJ A;  2CZT A;  3D9W A;  3RY2 A;  3VG7 A;  5HCE C;  1SWF A;  3FR5 A;  4GD9 A;  2RTA A;  5F6Z A;  4YBP A;  3T6L A;  1IKE A;  2HMB A;  2PY1 A;  4IBA A;  4TLJ A;  1VYG A;  1ZNK A;  1ICN A;  4Y5D A;  3ZW2 A;  1G7N A;  4AZR A;  5K06 A;  1QFT A;  3D97 A;  4XMH A;  2G78 A;  2UZ2 A;  4HPD A;  4AZQ A;  3OD9 A;  3IA8 A;  5CHK A;  1G85 A;  1YP6 A;  1LCW A;  1JMZ A;  1N43 A;  1SWR A;  1IW2 A;  2ANS A;  3NX2 A;  4XMC A;  4EQA C;  3PK2 A;  3IFB A;  3KFI A;  1RLB E;  3AUM O;  3P6H A;  3L4R A;  3FA8 A;  2BHV A;  2F73 A;  2R74 A;  1N4J A;  4OEL A;  3U03 A;  3NP1 A;  3OBL A;  2A3F X;  3DTQ A;  3I17 A;  1Z24 A;  1HMR A;  1KT5 A;  1FJ1 E;  2RCT A;  1RXH A;  3O2Y A;  4K19 A;  1X8U A;  3KFG A;  3SLJ A;  3NPO A;  3WOV A;  2OFA A;  4QGW A;  2G79 A;  2X34 A;  1STR B;  4JHQ A;  2FS6 A;  1N0S A;  1FDQ A;  3B2I A;  1B56 A;  1VWJ B;  3S26 A;  2OFM X;  1I78 A;  2QO5 A;  1U0X A;  2R73 A;  2Q9S A;  1SXY A;  3P6D A;  4Z2O A;  2OVE A;  3APX A;  3MX7 A;  5B2A O;  1IFB A;  1NP1 A;  1SWQ A;  3JS1 A;  1EI5 A;  4GGR A;  4TJZ A;  1G5W A;  4OKA A;  4QYP A;  5F1E A;  4O4U A;  3F6Z B;  3VG5 A;  3PPT A;  3STN A;  3BU1 A;  2CM9 A;  2OYB O;  1GKA A;  4HPB A;  4ZGU A;  1JIW I;  3B2L A;  2DM5 A;  2MWH A;  4GH7 A;  2Q2P A;  3WYP A;  4M6S A;  1MDC A;  3ELZ A;  3KFF A;  4YH0 A;  2AT6 X;  5B11 O;  4ZH6 A;  5HCD C;  2G8C O;  1JBH A;  2KD2 A;  3AKN A;  5D48 A;  1SWT A;  5B3M O;  3FDC A;  4BGF A;  1SWK A;  4UU2 A;  5F7G A;  3MBT A;  1CJ5 A;  4D6B A;  1Y52 X;  3FR2 A;  2G5L A;  5IRW A;  2P8G A;  1KT3 A;  4A60 A;  5BYP A;  1HBQ A;  3EC5 A;  1SY0 A;  1SRI A;  2RTL A;  3HTY A;  5H8T A;  1G74 A;  2BC3 A;  2RCQ A;  3UEV A;  1KFF A;  3JSQ A;  3UEX A;  4ZR2 A;  2RTH B;  4Z28 A;  5C0N A;  3P6C A;  1RAV A;  5KHP A;  2POA A;  1YUP A;  2L68 A;  1KL4 A;  4EEJ A;  4LQZ A;  2X4M A;  5D47 A;  2FWV A;  1BBP A;  1TOU A;  3WZP A;  4NNT A;  4N7D A;  2E4J A;  3ZW0 B;  3G7X A;  3NQK A;  4EKV A;  1X8N A;  2AL0 X;  3GAQ A;  1DF3 A;  1OEE A;  1LCV A;  1PM1 X;  3ZUI A;  2QO4 A;  1SXX A;  1SWO A;  2AT5 X;  5KID A;  1NQN A;  3DSZ A;  2OVA A;  3T6F A;  1IKJ A;  1K3B A;  2AT8 X;  3FA6 A;  1LIC A;  3ZWE A;  1A3Y A;  1SXU A;  5JR8 A;  1HQQ A;  1DF8 A;  2O62 A;  3FEN A;  4GJV A;  1IIU A;  3WJB A;  4COT A;  2N93 A;  2RTQ B;  3HWF A;  3T2W A;  1SWB A;  2A8G A;  3CR6 A;  4Y0Q A;  1VWB B;  2CM4 A;  3O22 A;  3FLL A;  3C78 X;  4IAB A;  1SRF A;  2OY8 A;  2RTR B;  1VYO A;  5F2B A;  3F9D A;  5DG4 A;  3SZH A;  1BRQ A;  5BVS A;  4ZJ0 A;  1FEM A;  1JJX A;  3CKG A;  2X56 A;  3WVM A;  3S60 A;  1SWG A;  5LJB A;  3VHM A;  3N91 A;  3T2X A;  2AF5 A;  1LIF A;  2C1Q A;  4OS8 A;  3PEC A;  2YMS A;  4O4O A;  4EXZ A;  2IZE B;  4NP1 A;  3RDS A;  1FE3 A;  1QG5 A;  2XKL A;  4UU3 A;  1SWJ A;  3SOT A;  4YCH A;  1LFO A;  4GKC A;  4MVK A;  3ZUO A;  1STP A;  1KT7 A;  1X8P A;  4CK4 A;  2FR2 A;  4IAW A;  5HAE A;  3PH6 A;  4YKO A;  2GJ5 A;  4KH8 A;  4CSB A;  1JV4 A;  4ORY A;  2FT9 A;  2A5B A;  4B55 A;  2RTE B;  5EDC A;  4CDE A;  1MOY A;  4XMF A;  2Y3F A;  2ZAG A;  1VWE B;  3CQN A;  3BRN A;  3FEL A;  4A1H A;  1CBR A;  4YGG A;  3VG3 A;  4GGZ A;  2IZD B;  2WPU A;  3RSW A;  3EBW A;  4PSQ A;  3SZI A;  3WXQ A;  2RN4 A;  1CBI A;  4GU8 A;  2FRS A;  3BX7 A;  1JZU A;  4BX5 B;  2OFB A;  1Y0G A;  5LJD A;  5IO5 A;  1BJ7 A;  1VWF B;  2BSZ A;  2L9C A;  2RTC B;  4YFR A;  4ZHD A;  1KGL A;  1VWI B;  4KCA A;  4IB9 A;  1HBP A;  1SWH A;  2QMI A;  2RTB B;  1VWL B;  2KTD A;  3Q34 A;  3ZW1 B;  3RE5 A;  1A18 A;  3CBC A;  1MX7 A;  1OBQ A;  5IO6 A;  4GGT A;  2RTG B;  1TW4 A;  4NNS A;  1GT1 A;  2A13 A;  1GM6 A;  1AVE A;  1KL5 A;  1KT4 A;  1NP4 A;  3EBK A;  4O3Y A;  3VGW A;  4O3Z A;  2OL6 O;  3RE6 A;  4ORR A;  1AVD A;  2IZG B;  3EMM A;  3NQ3 A;  5F58 A;  5B5G A;  3STK A;  4FBO A;  1PBY A;  2L67 A;  4TKB A;  1U17 A;  3HWG A;  4CDF A;  2BS5 A;  5DPQ A;  3WJE A;  3OJY C;  3FID A;  4ODD A;  4GJS A;  3NQ9 A;  3VU1 A;  2GH7 A;  5IO7 A;  2GTL M;  2IZI A;  3APU A;  1BLR A;  2MJI A;  1DZK A;  2W2B A;  3MM0 A;  5BVQ A;  5LJE A;  4Z2V A;  2HZQ A;  1ZRY A;  1SWA A;  3NBX X;  1LIE A;  1DFV A;  3UEU A;  4BX6 B;  2ZSC A;  1SRH A;  1VWQ B;  1Y9L A;  3EYC A;  4Z6J A;  1S7D A;  2DJF A;  4YDB A;  4YGZ A;  1P6P A;  1SY2 A;  4WFV A;  1PEE A;  4YVB A;  1FEL A;  1LKE A;  2AT3 X;  1UZ2 X;  1D2U A;  2RQ0 A;  1NQM A;  3U0D A;  3CMP A;  4O9S A;  2G7B A;  3CKF A;  4O4S A;  1SWN A;  3P6F A;  1LPJ A;  4O49 A;  5FFH A;  1FTP A;  2LBV A;  2IZH B;  2K23 A;  3QKG A;  4I3C A;  1VWH B;  4IB7 A;  3QQ2 A;  1CBQ A;  1JJU A;  3CWK A;  4IMO A;  1ZNH A;  1X71 A;  4DQ4 A;  2KTS A;  4Y0S A;  1U18 A;  4I9S A;  3TGB A;  4MVE A;  4ORU A;  1SY1 A;  2AVI A;  4OMW A;  2OL8 O;  5D8J A;  3VE1 A;  3PDF A;  4EFG A;  4CV7 A;  4OMX A;  1AEL A;  1KZW A;  2LA7 A;  2VDF A;  1Y53 X;  2FKG A;  3NAD A;  3RDQ A;  2ACO A;  4ZHC A;  1W4T A;  2OZQ A;  2ZAI A;  4IMN A;  3HWE A;  4KC8 A;  4ZCB A;  1BSO A;  5K68 A;  2KT4 B;  3F8A A;  1X8Q A;  3O19 A;  4AZO A;  4YBU A;  4C5P A;  4MIS A;  4TKH A;  3SLO A;  1JQP A;  4QGX A;  5CE4 A;  2KW1 A;  2EU7 X;  3ZW0 A;  2IZC B;  1SRJ A;  4TNN A;  2FR3 A;  3GE2 A;  1GT5 A;  1DC9 A;  1O8V A;  1ALB A;  3FMZ A;  1HXZ A;  3S5V A;  1ERX A;  5K67 A;  2ACP X;  3EM0 A;  5HCC C;  2FS7 A;  2X8T A;  1SWC A;  1GX8 A;  1BSY A;  2BLG A;  3FEK A;  4U9C A;  2JN3 A;  1EAL A;  4DNE A;  2CBR A;  4L1N A;  2OFR X;  3H3I A;  1OSP O;  4CPH B;  2X8S A;  4QQ1 A;  5EPQ A;  1RST B;  4EDE A;  3BS2 A;  1XCA A;  1OBU A;  3C77 X;  1QY0 A;  1VWM B;  5H9N A;  5H9L A;  1L6M A;  4I9R A;  1YWA A;  2JU7 A;  1SWS A;  4AW8 A;  2FHL A;  3ELX A;  1RSU B;  1SLE B;  2OL7 A;  3X00 A;  1BM5 A;  2CBS A;  1SWD A;  4HPA A;  4ID2 A;  3HOL A;  4WHI A;  1UYN X;  4XME A;  4JO6 A;  4L3R A;  1QY2 A;  1VWA B;  3E3C A;  3Q6L A;  4NW4 A;  4ORX A;  3WJD A;  1PMP A;  3TGC A;  1VWC B;  1YWC A;  2QOM A;  5B5F A;  5LKE A;  3RDM A;  1SXW A;  1URE A;  1EII A;  3KZA A;  1S44 A;  2K62 A;  3U9P C;  4AZN A;  3BY0 A;  3FA9 A;  1PBO A;  4GNW A;  4CPI A;  1AB0 A;  3ZI8 A;  2YG2 A;  4D6A A;  1YP7 A;  2WSJ A;  4Z2P A;  2PI3 O;  4KII A;  4ORS A;  2IZA A;  2CAM A;  1KQX A;  4WBK A;  4CDD A;  4IAX A;  3NX1 A;  1KOI A;  5LJK A;  4BOE A;  5BVT A;  1CBS A;  1Y55 X;  2HNX A;  4BBO A;  2AKQ A;  2L5P A;  1X8O A;  1A2D A;  2UYW A;  4BX5 A;  1GT3 A; 
#chains in the Genus database with same CATH homology
 5B29 A;  4RUU A;  4IB6 A;  2LBA A;  4U8U N;  1KT6 A;  1AVG I;  1OEK A;  3TF6 A;  5FQ6 E;  1ML7 A;  2WR6 A;  4YDA A;  3FYF A;  2JW1 A;  2GTF X;  3ZW1 A;  1OPA A;  3STM X;  3BDR A;  3RWX A;  1SA8 A;  4I3D A;  4FBV A;  4ALB A;  3P6G A;  5HTD A;  4OS3 A;  4ES7 A;  5CYB A;  5B27 A;  5KIC A;  4ALO A;  1KZX A;  4INN A;  1FEN A;  2HZR A;  1SY3 A;  4FBR A;  2LB6 A;  4JGL A;  4O3X B;  1E06 A;  4ML7 B;  1QAB E;  4GDZ A;  5HZQ A;  1T0V A;  5FEN A;  1IFC A;  4XMG A;  1TOW A;  5HTE A;  2MM3 A;  3RZY A;  1B4M A;  2OVS A;  4LZU A;  3BLG A;  1ZND A;  1ERB A;  2LKK A;  4O4X A;  1ZNL A;  3D95 A;  3VG6 A;  1DZJ A;  2F09 A;  5HA0 A;  4AZP A;  1KXO A;  4GNY A;  3HWD A;  3ZQ3 A;  1LIB A;  4HWM A;  4KC7 A;  1A57 A;  1YWD A;  1E5P A;  3LV4 A;  4ON1 A;  4YFP A;  3LHN A;  1E00 A;  2JU3 A;  4A8Z A;  1I05 A;  4YCE A;  1KGL A;  5HZ8 A;  2GTL N;  2QOS C;  4BQU A;  3B2J A;  4NYR A;  4ZHG A;  2JMB A;  4QAE A;  3S5X A;  5HBS A;  3CBS A;  4HFO A;  1HMS A;  2WWP A;  1Y9T A;  3CQR A;  3FA7 A;  2WEX A;  2CZU A;  4ZFX A;  4GET A;  5AQ6 A;  1XKI A;  1R0U A;  2HYS A;  3PQS A;  3I0A A;  1EPA A;  2OVD A;  2MHD A;  4U8U O;  2AH7 X;  1MX8 A;  3PH5 A;  4Y0P A;  4I95 A;  4GZV A;  1LNM A;  3FW4 A;  4LKT A;  3RBY A;  5HA1 A;  5FQ7 E;  4N7C A;  4DQ3 A;  4M7M A;  2IFB A;  3K3L A;  1OEJ A;  5FQ8 E;  3RKG A;  4QZT A;  3WJG A;  4YFQ A;  3B2H A;  3WJC A;  1BLR A;  2WUT A;  2JOZ A;  5AJC A;  1LF7 A;  4AZM A;  1EUO A;  1ZNG A;  3P02 A;  3UAQ A;  4HPC A;  4ZHH A;  3APW A;  1RBP A;  4NLI A;  1YWB A;  1TXL A;  4LKP A;  3VPJ E;  2BT9 A;  4QYN A;  2NNE A;  1ACD A;  4OS0 A;  4ZGF A;  3FIQ A;  3HK1 A;  4GK9 A;  4YKM A;  5HWZ A;  4BVM A;  1DV9 A;  5L8I A;  3VG2 A;  3B2K A;  4I6S A;  3VG4 A;  3FR4 A;  4LZV A;  3V8U A;  1GX9 A;  2BS6 A;  4AYH A;  2RA6 A;  1BEB A;  1QY1 A;  1T8V A;  2NP1 A;  1ICM A;  1QFV A;  4QZU A;  1BWY A;  4ARH A;  5LKF A;  4QRL A;  3KQ0 A;  4FGI B;  1VYF A;  1ADL A;  2GTL O;  2MO5 A;  3TZS A;  5H9A A;  5H9K A;  1O1V A;  2LFO A;  3BU9 A;  2FTB A;  1BSQ A;  4NYQ A;  1SMP I;  1CRB A;  4RUN A;  1BRP A;  3JQO A;  5LJG A;  2Z4I A;  1HN2 A;  1EW3 A;  2A2U A;  3VE2 A;  5LJC A;  2A0A A;  2QM9 A;  4YGH A;  4MVI A;  1GKA B;  1T68 X;  1I06 A;  4MIR A;  3C76 X;  5EEE A;  3TGA A;  3NR3 A;  4ORW A;  2Z4H A;  1X89 A;  2A2G A;  3APV A;  3WBG A;  2NND A;  3OE3 A;  1S2P A;  1D3S A;  2ALL X;  2GC9 A;  3P24 A;  4KT5 A;  3D4R A;  1YIV A;  1NGL A;  1TVQ A;  4YMY A;  2R56 A;  2WQA E;  3WJF A;  4WFU A;  5L8O A;  4TKJ A;  1MVG A;  5EED A;  1EXS A;  5AJB A;  3D96 A;  4XMD A;  3PP6 A;  2XST A;  3PED A;  4IB8 A;  1I04 A;  4PJ2 A;  4QGV A;  1QQS A;  4FQB B;  4GRJ A;  2AT0 X;  3UEW A;  5L8N A;  1GGL A;  1OBP A;  1AQB A;  1H91 A;  2M4L A;  4MVL A;  1I4U A;  1MUP A;  1E02 A;  5FAZ A;  2FLJ A;  2Q39 A;  2ASN X;  4A1Y A;  4R0B A;  4TQ2 A;  1EIO A;  1O1U A;  3FEP A;  3MVF A;  3ZZV A;  2WEW A;  5HZ9 A;  1HQP A;  5HZ6 A;  4QNI A;  1JJJ A;  2QO6 A;  1GXA A;  3BSZ E;  2X45 A;  5EDB A;  1ZNE A;  5AEO A;  1QWD A;  3P6E A;  2Q2M A;  4I3B A;  3T1D A;  1B8E A;  2RD7 C;  2NNQ A;  4O3W A;  5LJH A;  3BX8 A;  1HMT A;  1LID A;  2JU8 A;  4U8U M;  1JYD A;  5D45 A;  5EZ2 A;  3HOE A;  2HLV A;  2X8F A;  3PQU A;  1EPB A;  4U3Q A;  4Y0R A;  4NLJ A;  2Q4N A;  1B0O A;  1DZP A;  5HZ5 A;  2W2A A;  5D4A A;  5F6B A;  2WQ9 A;  2AMM X;  1EQD A;  2X46 A;  4ZHF A;  3FW5 A;  1OPB A;  4ZH9 A;  4GE1 A;  1DZM A;  1KQW A;  1GT4 A;  2W2F A;  3AKM A;  3SAO A;  1VPR A;  3KFH A;  1JYJ A;  2CZT A;  3VG7 A;  5HCE C;  3FR5 A;  4YBP A;  5F6Z A;  1IKE A;  2HMB A;  2PY1 A;  4IBA A;  4TLJ A;  1VYG A;  1ZNK A;  1ICN A;  3ZW2 A;  4AZR A;  1G7N A;  5K06 A;  1QFT A;  3D97 A;  4XMH A;  2G78 A;  4HPD A;  4AZQ A;  3OD9 A;  3IA8 A;  1G85 A;  1YP6 A;  3NX2 A;  4XMC A;  1IW2 A;  2ANS A;  4EQA C;  3IFB A;  3KFI A;  1RLB E;  3P6H A;  3L4R A;  3FA8 A;  2BHV A;  2F73 A;  2R74 A;  3U03 A;  3NP1 A;  3OBL A;  2A3F X;  3DTQ A;  3I17 A;  1Z24 A;  1HMR A;  1KT5 A;  2RCT A;  4HPA A;  3O2Y A;  4K19 A;  3WOV A;  1X8U A;  3KFG A;  3NPO A;  4QGW A;  2G79 A;  2FS6 A;  1N0S A;  1FDQ A;  3B2I A;  1B56 A;  3S26 A;  2OFM X;  2QO5 A;  1U0X A;  2R73 A;  2Q9S A;  1SXY A;  3P6D A;  2OVE A;  3APX A;  3MX7 A;  1IFB A;  1NP1 A;  3JS1 A;  4TJZ A;  1EI5 A;  1G5W A;  4QYP A;  5F1E A;  4O4U A;  3F6Z B;  3VG5 A;  3PPT A;  3STN A;  3BU1 A;  2CM9 A;  1GKA A;  4HPB A;  4ZGU A;  1JIW I;  3B2L A;  2DM5 A;  2MWH A;  4GH7 A;  2Q2P A;  4M6S A;  1MDC A;  3ELZ A;  3KFF A;  4YH0 A;  2AT6 X;  4ZH6 A;  5HCD C;  1JBH A;  2KD2 A;  3AKN A;  5D48 A;  1CJ5 A;  4UU2 A;  5F7G A;  3MBT A;  4D6B A;  3FR2 A;  2P8G A;  1KT3 A;  4A60 A;  5BYP A;  1HBQ A;  1SY0 A;  3HTY A;  5H8T A;  1G74 A;  2RCQ A;  3UEV A;  3JSQ A;  3UEX A;  4ZR2 A;  5C0N A;  3P6C A;  5KHP A;  2POA A;  1YUP A;  2L68 A;  4EEJ A;  4LQZ A;  5D47 A;  2FWV A;  1BBP A;  1TOU A;  4NNT A;  4N7D A;  2E4J A;  3ZW0 B;  3G7X A;  3NQK A;  1X8N A;  2AL0 X;  3GAQ A;  1DF3 A;  1OEE A;  1PM1 X;  3ZUI A;  2QO4 A;  1SXX A;  5KID A;  2AT5 X;  3DSZ A;  2OVA A;  1IKJ A;  2AT8 X;  3FA6 A;  1LIC A;  3ZWE A;  1A3Y A;  1SXU A;  5JR8 A;  2O62 A;  3FEN A;  3WJB A;  1IIU A;  4COT A;  2N93 A;  3HWF A;  3CR6 A;  4Y0Q A;  2CM4 A;  3O22 A;  3FLL A;  3C78 X;  4IAB A;  3F9D A;  5DG4 A;  4ZJ0 A;  1BRQ A;  5BVS A;  1FEM A;  1JJX A;  3WVM A;  3S60 A;  5LJB A;  3N91 A;  1LIF A;  4OS8 A;  3PEC A;  2YMS A;  4O4O A;  4EXZ A;  4NP1 A;  1FE3 A;  1QG5 A;  2XKL A;  4UU3 A;  3SOT A;  4YCH A;  1LFO A;  4GKC A;  4MVK A;  3ZUO A;  1KT7 A;  1X8P A;  4CK4 A;  2FR2 A;  4IAW A;  5HAE A;  3PH6 A;  4YKO A;  2GJ5 A;  4KH8 A;  4CSB A;  1JV4 A;  4ORY A;  2FT9 A;  5EDC A;  4XMF A;  2ZAG A;  3CQN A;  3BRN A;  3FEL A;  4A1H A;  1CBR A;  4YGG A;  3VG3 A;  3RSW A;  3EBW A;  4PSQ A;  3WXQ A;  2RN4 A;  1CBI A;  4GU8 A;  2FRS A;  3BX7 A;  1JZU A;  5LJD A;  5IO5 A;  1BJ7 A;  2L9C A;  4YFR A;  4ZHD A;  4KCA A;  4IB9 A;  1HBP A;  2QMI A;  2KTD A;  3ZW1 B;  1A18 A;  3CBC A;  1MX7 A;  1OBQ A;  5IO6 A;  1TW4 A;  4NNS A;  2A13 A;  1GT1 A;  1GM6 A;  1KT4 A;  1NP4 A;  3EBK A;  4O3Y A;  4O3Z A;  3STK A;  4ORR A;  3NQ3 A;  3EMM A;  5F58 A;  4FBO A;  2L67 A;  4TKB A;  1U17 A;  3HWG A;  2BS5 A;  5DPQ A;  3WJE A;  3OJY C;  4ODD A;  3NQ9 A;  3VU1 A;  5IO7 A;  2GTL M;  3APU A;  2MJI A;  1DZK A;  2W2B A;  5BVQ A;  5LJE A;  2HZQ A;  1ZRY A;  3NBX X;  1LIE A;  1DFV A;  3UEU A;  1Y9L A;  3EYC A;  1S7D A;  4YDB A;  4YGZ A;  1P6P A;  1SY2 A;  4WFV A;  1PEE A;  1FEL A;  1LKE A;  2AT3 X;  1UZ2 X;  1D2U A;  2RQ0 A;  3U0D A;  3CMP A;  4O9S A;  2G7B A;  4O4S A;  3P6F A;  1LPJ A;  4O49 A;  5FFH A;  1FTP A;  2LBV A;  2K23 A;  3QKG A;  4I3C A;  4IB7 A;  1CBQ A;  3CWK A;  4DQ4 A;  4IMO A;  1ZNH A;  1X71 A;  2KTS A;  4Y0S A;  1U18 A;  4I9S A;  3TGB A;  4MVE A;  4ORU A;  1SY1 A;  4OMW A;  5D8J A;  3VE1 A;  4CV7 A;  1AEL A;  4EFG A;  1KZW A;  4OMX A;  2LA7 A;  3NAD A;  2ACO A;  4ZHC A;  2OZQ A;  2ZAI A;  4IMN A;  3HWE A;  4KC8 A;  4ZCB A;  1BSO A;  2KT4 B;  3F8A A;  1X8Q A;  3O19 A;  4AZO A;  4YBU A;  4MIS A;  4TKH A;  5CE4 A;  4QGX A;  2KW1 A;  2EU7 X;  3ZW0 A;  4TNN A;  2FR3 A;  3GE2 A;  1GT5 A;  1DC9 A;  1O8V A;  1ALB A;  3FMZ A;  3S5V A;  1ERX A;  2ACP X;  3EM0 A;  5HCC C;  2FS7 A;  2X8T A;  1GX8 A;  1BSY A;  2BLG A;  3FEK A;  4U9C A;  2JN3 A;  1EAL A;  2CBR A;  4L1N A;  2OFR X;  3H3I A;  2X8S A;  4QQ1 A;  5EPQ A;  4EDE A;  3BS2 A;  1XCA A;  1OBU A;  3C77 X;  1QY0 A;  5H9N A;  5H9L A;  1L6M A;  4I9R A;  1YWA A;  2JU7 A;  4AW8 A;  3ELX A;  1BM5 A;  2CBS A;  4ID2 A;  3HOL A;  4WHI A;  4XME A;  4NW4 A;  4L3R A;  1QY2 A;  3E3C A;  3Q6L A;  4ORX A;  3WJD A;  1PMP A;  3TGC A;  1YWC A;  5LKE A;  1SXW A;  1URE A;  1EII A;  3KZA A;  1S44 A;  2K62 A;  3U9P C;  4AZN A;  3BY0 A;  3FA9 A;  1PBO A;  4GNW A;  1AB0 A;  3ZI8 A;  2YG2 A;  4D6A A;  1YP7 A;  2WSJ A;  4KII A;  4ORS A;  1KQX A;  4WBK A;  5LJK A;  4IAX A;  3NX1 A;  1KOI A;  4BOE A;  5BVT A;  1CBS A;  2HNX A;  2L5P A;  2AKQ A;  1X8O A;  1A2D A;  1GT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...