1ESAA

Direct structure observation of an acyl-enzyme intermediate in the hydrolysis of an ester substrate by elastase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct structural observation of an acyl-enzyme intermediate in the hydrolysis of an ester substrate by elastase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase(serine proteinase)
molecule keywords PORCINE PANCREATIC ELASTASE
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1esaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1esaA01
4H42U 4Y7BA 3S7KB 1TRMA 4OS5A 1DICA 5T3HA 1FN6A 1WCZA 1NROH 3LPRA 3AW1A 4X2WA 4CRGA 5L30H 2UWOA 4YESB 2BLVA 5BPEA 2JKHA 1FN8A 1GGDC 1NPMA 3GY2A 3DT0H 1LPZB 3SI3H 2XYAA 1O3HA 3SU4A 1S85A 1J15A 1RGQA 1QA0A 3TH3H 1K2I1 4K60A 1HJ8A 3U8OH 3ZZ6A 1PPBH 3QLPH 2DE9A 3P70B 1HJAC 1WTGH 2P95A 3FAOA 1O2WA 2D8WA 3U8TH 1NTPA 2ZFSA 4UDWH 2ZU1A 1L2EA 1BTUA 3W94A 4JK6A 1C1QA 3VFEA 1GHYH 4WVPE 8GCHF 1YYY1 1HBTH 3MNXA 3QN7A 5JB8S 1EZXC 4NIYA 1PFXC 3MNSA 5I25A 3AW0A 1RIWB 3ZZ9A 1CGJE 1VCPA 5JBTA 3RXEA 4MQAA 2ZI2H 3A81A 1P10A 2O8MA 1H4WA 1LPKB 3RMOH 5DG6A 2FOHA 1H8DH 2BDYA 4AFSA 2ZFRH 3RLWH 2C8ZB 3TITA 1SOTA 5K0HA 2HNTC 1QRWA 1Y3YA 4ASHA 1ELDE 2G81E 2OTVA 3E0NB 1TNIA 1L1NA 4IN2A 1O2KA 3B8JA 2PSXA 2A5AA 3HGNA 2ZGHA 2ULLA 2YNBA 3ZYEA 4UEHH 3DD2H 2R2WU 3A7WA 1BITA 1O2YA 3PV4A 1C5MD 3UNSA 1SFIA 1GHAG 2AFQB 1W13U 5EXMA 1ZRKA 2BD5A 4WMFA 1L1JA 1S0RA 2BD9A 1GVKB 1O38A 4AB8A 1RJXB 3VB3A 3ZVFA 2HPQH 1C5YB 3RU4T 1P57B 1PPGE 1O3AA 2ZCLP 2ZHEH 3RC4A 4TPYA 4ABEA 4IGDA 1F2SE 1Y5UT 3A86A 2A5KA 4FUJA 3QGNB 1C9TA 1C5OH 5LGOA 4AB9A 2ODQA 2D1JA 1DPOA 1C1UH 1EAXA 1TOMH 1GCTB 1WAYB 5DGJA 4NSYA 1HCGA 1NFXA 3K65B 1TGNA 1QNJA 2FO9A 1MKXH 1E0FD 2B7DH 2H1UA 2R9PA 2TPIZ 3M3SA 4XFQA 3SGQE 4KTCA 3EA9A 2PW8H 1FUJA 1FJSA 4FUFA 1DY8A 1UTNA 1K1PA 1QIXB 2VWMA 2THFB 1QBNA 3KQBA 3LT3A 1GL0E 5T6FA 4WJG2 5HM9A 4IW4E 3SUDA 1KLJH 1O2PA 2VVVA 3LJOA 4LZ1H 1M9UA 1GJBB 4H6TA 4U30A 1O34A 2OLGA 1GI9B 2O9QA 1NN6A 2ZDNA 1LPGB 2BM2A 3A82A 5ABWA 2A1DB 2PUQH 3GYLB 4AFUA 3VB5A 1ARCA 1W8BH 2EA3A 3MTYA 5LPFA 1HRTH 3A7TA 3VEQB 5A2MH 1AKSA 3SJKA 3T2NA 4CBNA 1BDAA 1G3DA 1UTJA 1FAXA 1O2ZA 1SFQB 1W7XH 4FUIA 3S69A 1FMGA 4GCHG 1IQHA 1UK4A 1LCYA 1Y59T 2QV1A 1GVLA 4ZROA 1RTLA 4DY7B 1GPZA 1AVGH 1ZGVA 3BEIB 3RP2A 3QX5H 3UPEA 1CBWB 1TE0A 2EI8A 4BAKB 2Y7XA 4YM9A 2B0FA 1J9CH 1TQ0B 1TALA 4Q80A 1A2CH 2HPPH 1SGRE 1C4V2 1CO7E 1T8NA 4AN7A 5JBAS 2ZDKA 1QURH 2XTTB 1GBHA 1TX7A 2ZDVH 2HOBA 1VGCB 6GCHF 1IQFA 3SUFA 5F8XA 8LPRA 1YCPK 4X1RU 2FOGA 4I8HA 1NRSH 1JMOH 1KXFA 2CMYA 1BRUP 5G4BA 1QY6A 1C5SA 4Y71A 1TMTH 1F0TA 1QHRB 3NZIA 1F5KU 1MUEB 3IG6B 5FBEA 3KGPA 1CA0C 4TPIZ 4FUCA 3SQEE 2VVCA 1OWDA 5GCHG 2H6MA 1G3CA 2WPKS 4FUDA 3S7HB 3QO6A 3A84A 3ZVDA 1GCDA 4X1NU 3G01A 1SGEE 2FMJA 4A5TS 2Z9JA 2G4TA 1SQOA 1EOJA 2A32A 3NKKA 2Y82A 4UE7H 4GLYA 1FV9A 4Y8XA 2BQ6B 1TNGA 3QUMP 3RXJA 3RXAA 4INKA 2JETB 3Q77A 2GX4A 4ZHLU 4D76A 3R3GB 1TBRH 2OXSA 3SGBE 3NXPA 1CE5A 2PKSC 2ANKH 5HGGA 1LKBA 4NFFA 1A1RA 4K1SA 1C2DA 6ESTA 1QJ7B 1KDQB 2A4QA 3MH4A 5F6MA 3UQVA 1FPHH 1SC8U 1GI1A 3WY8A 1GHAF 1RFNA 4GHQA 1C1OA 1EPTB 2OQUA 1P01A 1HJAB 2ZDMA 4K1EA 2XNIA 1EZSC 1CHOG 2VWNA 2BMGB 2O8TA 1NT1A 3TU7H 1N6XA 1ZJDA 1DSUA 2AH4X 2NU0E 4Y10E 1XKAC 2SGFE 3ZZAA 1OP8A 3ZVEA 1EJMA 3KCGH 5FPSA 1HLTH 1VR1H 4KKDA 1INCA 4NCYA 5C1UA 1A3EH 2H9TH 1O5BB 2AGEX 2GV6A 2GZ8A 1ZJKA 1GJCB 4NWKA 3GDVA 1O3LA 1GJAB 2WINI 3BTQE 3SV8A 4NIXA 8ESTE 3E16B 3E91A 7ESTE 1HB0B 4OS2A 3SORA 5GJ4B 3DUXH 2BQ7B 1V2RT 3FZDA 4D7GA 1KLIH 1ZHMA 1DXPA 1GBIA 3A8CA 1OP2A 3A80A 3RC6A 2TGAA 1MTVA 1B5GH 1SOZA 5EGMA 1XXDA 3GCOA 2VH6A 1RTFB 3UIRA 2BYAX 5EQSA 3M7QA 4KELA 2P16A 3RXQA 2VGCC 2ILNA 3TK9A 1GMCG 1B0EA 5JDUB 5DP6A 2Q6DA 2QIQA 2AIPA 1Z8GA 1BBRH 3I29A 4Q7ZA 1MZAA 4Y11E 1P3EA 1EAWA 1V2WT 4MPVA 1JIRA 4OS1A 2FPZA 1AE8H 4B74A 3URDA 1SGTA 2ANYA 5C20A 4WF8A 1BTYA 2G00A 3SBKA 2FLRH 4FUBA 1E35B 4ABIA 3L33A 5EG4A 4B2BA 1SL3A 1EZQA 4XBCA 4BAMB 3EDXB 4K8BA 4Q7XA 1FY8E 5C5OA 2H2ZA 3E0PB 2GCTC 3K6YA 3LDXH 1GBKA 1GJ5H 4B73A 2FOEA 4E7NA 2OUAA 2W26A 2ZU5A 2CV3A 2TBSA 3SU6A 1Z7KA 4XSKU 3FFGA 3M3TA 2VIQA 3SOSA 1YLCA 4TYDA 1ELGA 3PO1B 1KXDA 1T31A 4NSVA 1TX6A 2IJOB 2QY0B 1FXYA 1JBUH 1EQ9A 2ZCKP 1P2KA 1T4VH 1LHGH 4CHAB 4U01A 2HWLB 2Y5FA 1ZSLA 4GCHF 2G8TA 3P17H 1OWJA 3I78A 6CHAC 1XUIA 3EQ0H 1SHYA 4JZEH 1TMUH 5JBCS 3S9BA 2A4RA 3JZ2B 4HFPB 2HLCA 1V2PT 5GPIB 4Y0YE 1A5GH 1WQVH 3PB1E 3VB6A 2IPHA 3BTEE 2R2MB 2ZPQA 1O3OA 1BTWA 2QXIA 1UMAH 3M7UA 1C1VH 2UWPA 1UVUH 3ZV9A 1QQ4A 2ODYB 5HMAA 2FYRA 4E05H 3JZ1B 4X1QU 3RM2H 3F68H 4D9RA 1C2JA 1NFUA 2BB4A 2Z3CA 4ZMAH 1AVWA 1DWBH 3V13A 1H9IE 4ZKRU 3RXSA 1F5LA 4A1VA 2ZP0H 1NM6A 3SU2A 1BIOA 4OS6A 4ESTE 4DT7B 3M35A 4CRFA 2CGAA 3T5FH 1TGBA 4MPXA 2I6QA 2SGDE 3D62A 2DE8A 5DP3A 1O3BA 5F8ZA 1P2QA 3MU4A 3HPTB 1GG6B 1ANCA 1UTMA 1IQMA 2D2DA 4IN1A 1ZMNA 3MH5A 3MO3A 4FU8A 4ABGA 4BTIB 1UCYK 1EKBB 3U98H 1ORFA 1AQ7A 4UFFH 5AFZH 4X6PA 3ZVGA 4O03A 4MNVA 3LIWA 2BDCA 1V2OT 4FXGH 3Q3KA 2VNTA 2J95A 4VGCC 2GT7A 1V3XA 1P9UA 2Q6FA 1Y3XA 4CRBA 1C2HA 1CSOE 4D7FA 2TIOA 1D3TB 4DCDA 5IDKA 1HGTH 2V0BA 4DW2U 4FUGA 4GSOA 3UY9A 4Z6AH 3PMBB 1MTNC 1NRNH 2GTBA 1BJUA 4SGAE 3ELAH 1WV7H 2HRVA 1VJAU 4INHA 1XM1A 1C1NA 4OS4A 2D26C 2Y81A 1KXCA 1UTQA 2QF3A 1ZYOA 5AFYH 5L2ZH 1ZSJA 2BVSH 2JH6D 2GGVB 4I8KA 4NA9H 1O5CB 3CP7A 4ISIH 2J9NA 1BTHH 3L6PA 2QXGA 1O5AB 3ATIA 5I46H 2BD4A 1GI0A 4TY7A 1SG8B 3FP6E 4GAWA 2PWXA 3RXUA 1TA2A 2WPHS 9LPRA 1YPLH 5DPAA 1TBZH 5EW2H 3SNBA 1P0SH 1SB1H 4MTBA 2FIRH 1S0QA 2VWLA 4CR5A 1ELTA 2Q6GA 4DIHH 3SV9A 3BG4B 1BRCE 4CR9A 3ESTA 3D65E 4K2YA 3SQHE 2ZNKH 2XRCA 3H5CB 1ESAA 1SVPA 2BX4A 1W0ZU 4AFQA 1AUJA 1VITF 1ESTA 1GHBF 1OKXA 3I77A 4RKJB 2ZKSA 5EQRA 2AMDA 3TNTA 1HIAB 1FY3A 1HAVB 5E2OA 4B2AA 2ZU2A 1GJ7B 4A6LA 2FTLE 1ELCA 5L2YH 4ZHMU 2VIPA 2P8OC 2QAAA 1HAIH 1ACBE 4ABFA 4GHTA 1HFDA 2FWWA 1K1LA 1TNKA 1ZLRA 1SSXA 4K5ZA 1NS3A 2M5TA 1Q31A 3BEUA 5AVDA 4DG4A 1RIWC 1F0UA 1ZMLA 1IOEA 3TPIZ 1Z8IB 4YOGA 1BBRK 4IC5A 1TNLA 8GCHG 2PV9B 3ENSB 1WSSH 1XUGA 3RXDA 1V6DA 1LMWB 2GCTB 1C5ZB 1O31A 1C4Y2 1UTKA 1MTUA 4UONA 3GY6A 1GBCA 3NPSA 5ETXA 1HUTH 1T32A 5C2ZA 5DP9A 3ZZ5A 1T7CA 4AGKA 5H4IB 1DOJA 2ZGXH 3S0NA 1T8LA 2O8UA 2G5NA 5CMXH 1YPGH 1DT2A 3P8GA 2FDAA 2OCVB 3LGVA 1UVSH 4BAOB 2FS8A 1J14A 1XUHA 3QZQA 3OY5U 1C5RA 1GJ9B 1C1PA 2WYJA 2NWNA 3RDZA 2VWOA 4A92A 3ATLA 6GCHG 1GI5A 3TGKE 3QTVH 4D9QA 2HALA 3MHWU 4U2WA 2GKVE 3LC3A 3E1XB 1MKWH 2W3IA 5A8YA 2ANWA 1XXFA 2ZF0H 1QTFA 1JIMA 4I33A 1YCPH 3MNBA 4D8NA 1GGDB 2ZECA 1SGQE 2VIVA 2G52A 3MI4A 2ZPSA 1D6RA 4Y8YA 2ZQ1A 2O8WA 1A7SA 3M5NA 3NUMA 1FDPA 3UUZA 2Y5HA 1W0YH 4XOJA 1O2OA 2KAIA 5DO4H 1C2LA 1OYTH 1TBQH 5A0BA 3P95A 1BA8B 4LZ4B 1C1SA 2VH0A 2ZWLH 1O36A 1YKTA 3M37A 4GVUA 1A61H 2A7CA 5DP7A 4AORA 1O3DA 1KIGH 1FPCH 2BVRH 2GCHG 4BTTB 1HAGE 3LJJA 2GT8A 3BV9B 7KMEH 1V2JT 5C67A 3RU4D 1HYLA 1MQ5A 2AYWA 2PR3A 1W7GH 3MYWA 3O8RA 4LXBH 2B9LA 4X6OA 1D4PB 2V35A 4OGYA 1ZGIA 3A8AA 4B76A 2FOMB 2BY8X 2F3CE 1F0SA 2AGGX 2JH5D 3O8BA 1QRZA 1VITG 1OXGA 1DLEA 1ANEA 4THNH 1MTSA 1LDTT 1CA8B 4BTUB 2F83A 2BLQA 1TPOA 4WWYA 3S9CA 4X2VA 5JB9S 2BY5X 1IQGA 4WH8A 1QCPA 4UD9H 1G36A 2QGRA 3M5MA 3P8FA 1ELBA 3TJOA 1V2QT 1TLDA 1UK2A 4AGJA 1P04A 4XBBA 3ODDA 1UCYE 3KL6A 5AHGH 5EPYA 3RXLA 2BQWB 4BXWA 2PKAA 1UHBA 2HNTE 4INLA 2FX4A 1BMMH 1QBVH 2XBWA 1FQ3A 5GWZA 1PJPA 3OY6U 5FPYA 2ODPA 4I8JA 1V2NT 2STBE 1UHBB 5C1YA 3PLPA 1ZHPA 1QL7A 2ZGJA 1MH0A 2V3OH 3A8BA 1LVMA 3TJUA 3OTJE 1UO6A 2FI3E 4UFGH 9ESTA 1BT7A 2FLBH 4NG9H 4ABHA 1JRSA 1ID5H 5BRRE 1J16A 1HXEH 3CS0A 3SV7A 1OP0A 1SGPE 1UVPA 3BTHE 3RXCA 4J1YA 2XWBI 3SU3A 3ZZ3A 1O3PB 3EA8A 1NFWA 2VU8E 1W11U 2QA9E 3LKWA 4ZHAA 3SNDA 1EOLA 1JOUB 1WQSA 2P3FH 3MO6A 1ZMJA 1KXBA 2H5DA 5DJ7A 1ZTJA 4IMZA 1RRKA 4NA7A 2FODA 2ZPRA 1C5UA 3LGWA 1ELEE 1ABJH 1MAXA 1ZTKA 3DHKH 3KHVA 3MU0A 3PTBA 4RKOB 2BVXH 3SO3A 1UTOA 2J92A 3KQCA 1LTOA 1SQTA 2FOBA 2CHAC 3PTNA 3C27B 3HGPA 3ZV8A 1OS8A 2CXVA 3SJ8A 4JYVH 1TGTA 2P3UB 1WYKA 1YP9A 2C3SA 3MNCA 2XBVA 3UOUA 3PLBA 3EA7A 4ISNA 1W12U 1ZZZA 4O3TA 3U8RH 5ESBA 3PMAB 1YBWA 2Z3DA 2AEIH 1GBEA 2FZZA 3KEEA 1EP5A 3ZYDA 1BTPA 2TRMA 4YOIA 2SNWA 2JH0D 1QR3E 1OWHA 2A31A 4I7YH 2ZTYA 1YLDA 3IITA 3GCNA 3FANA 3SHCH 2C8YB 3LH3A 1SPJA 4Q2KA 3UTUH 1BB0B 1DX5M 1SGYE 4ZXXH 2DUCA 3BTTE 1QJ6B 1OWEA 1O5EH 1V2VT 4ISHH 2GZ9A 3UNQA 4O3UA 1A0LA 2STAE 2G51A 4DOQA 1O2QA 1THSH 2O8LA 5TJXA 1YF4A 2FM2A 2YOLA 4LOYH 1MQ6A 2ZU3A 2NU3E 1XUJA 5FPTA 5A0CA 1VITH 2OINA 1P9SA 3MMGA 4YLQH 2NU2E 2WPLS 4ZUHA 1MU6B 1AWFH 1GBMA 4TY6A 3SJOA 1FIZA 2FOAA 2ZHWH 1MKWK 3BTME 4BXSA 5J4QA 4UFDH 3QDZB 3PWBA 2TGTA 2BXTH 1K28D 3PM3A 3OYPA 4MVNA 1KXAA 2PSYA 2ZFFH 3M36A 2A2QH 2J2UA 3SU1A 1TMBH 1C2GA 1FONA 2FP7B 2ZGCA 1KY9A 1DLKB 2QXHA 2HVXA 2XBXA 5T6DA 1YGCH 1C5QA 1P2JA 2ANMH 3SU0A 4NFEA 1TPAE 4DURA 5HM2A 3E6PH 3ZZ4A 3GYMA 4YZUA 5C3NA 3KQDA 2WUCA 1G30B 2AERH 3T27A 4R0IA 1ELAA 1EPTC 1DWCH 1P05A 3Q3XA 1J8AA 2SGAA 4WY3A 1LHEH 2WPJS 4X8SH 3SUEA 1BTXA 1GMCF 1TFXA 4K8YA 4BAHB 1TQ7B 1BRBE 2VIOA 1GWAA 1WTHD 4CREA 2F9NA 2XBYA 1GBAA 1GHWH 3ODFA 4QT8C 1EUFA 3A8DA 4BAQB 1WUNH 1HAYB 1PYTC 4AOQA 2BY7X 3CS7A 1AGJA 4JZIA 4MNWA 1K1JA 2SGEE 3HATH 3SW2B 1SI5H 2W7SA 1THRH 3RM0H 1YPMH 4TWWA 1SLWB 2GV7A 2ZTXA 1NO9H 4CRCA 1O32A 1S84A 2ZGBH 4A7IB 1OPHB 4FUEA 3T26A 3AAUA 4IBLH 3QGJA 1BMLA 2FYQA 5HXFA 1MAYA 3K6ZA 2QXJA 4XDEA 5EPNA 3TK5A 1HXFH 3M5LA 4B2CA 1QQUA 1D3QB 1YC0A 1TOCB 1GI3A 4ZKSU 1P12E 1RTKA 4ZXYH 4H4FA 1L4ZA 1DITH 3VPKA 2EI6A 1ETSH 5F8TA 3RXOA 2BDAA 4X8VH 1MMJN 1G37A 4CRAA 3RXPA 2ALPA 5EOKA 2BZ6H 1V2TT 1EB1H 1GHBG 1GI7B 1EAUA 1LVYA 3VB4A 1Y3UA 5EODA 1KXEA 3A88A 1O2HA 1B7XB 1E37B 1DSTA 1Q2WA 1V2KT 5GDSH 5C1XA 1MZDA 1GHXH 1ZPBA 4ABBA 4CBOA 2ZEBA 3RXIA 2GCHF 1GHVH 1IHSH 1C4U2 4E7RG 3SGAE 5GCHF 1GVZA 1JRTA 3LGUA 2VIWA 5EXNA 3VXEH 1OWIA 3VXFH 2I6SA 2GP9B 1EB2A 3LC5A 5FX6A 3F9HA 5A8ZA 3ATWA 1O3MA 2R0LA 3UOPA 1LQDB 3U1IB 3KIDU 3PMHB 1MKXK 1EATA 1QA7A 3T28A 1D3PB 3TGIE 1BHXB 1Z8JB 1C5LH 1TA6A 4BOHA 1TGCA 1HJ9A 3FP7E 3UREA 1MD7A 2LNCA 1IHTH 2BY6X 1C2MA 1P2NA 1C2FA 3TJNA 3TJVA 1EP6A 1JWTA 3ZVBA 1Z6JH 2Z7FE 1O2LA 1L4DA 1K1MA 1KLTA 1O2NA 3SN8A 3CENA 4UFEH 1P09A 1O3KA 1BUIA 4FU7A 1A5IA 2XCNA 3GDUA 1D9IA 1EX3A 3SI4H 3PWCA 1CT4E 1O2RA 1RD3B 2V6NA 3M61U 3U69H 1K1IA 2IN2A 1IQLA 3SZNA 3NCLA 2XC0A 3TNSA 1OWKA 1GI4A 1CA0B 1DWEH 1AY6H 1H8IH 1HV7A 3BG8A 3GOVB 1DWDH 3GCTG 2UUFB 1UTLM 4AYYB 3GY7A 3ZVCA 1GG6C 1FY1A 3SUGA 2GZ7A 1LHCH 1P11E 2P3TB 2QF0A 1SBWA 4ABAA 1G2MA 2Z3EA 2C90B 2Z9KA 1O2UA 1BHXF 1AUTC 1SGIB 3H7TA 1SGNE 2BZAA 5PTPA 4KGAA 5CHAB 1Y5AT 3F9GA 1XVMA 3QTOH 1NC6A 1O0DH 1PPZA 3T29A 3SV2H 3RMMH 2ZU4A 1PQ8A 2C8XB 3KF2A 1KTSB 1AI8H 4YTAA 2Y80A 4JCNA 4HI3A 4SGBE 1MBMA 1UK3A 4IS5A 1VZQH 1TRYA 1NU7B 4ZAEA 3A85A 4KTSA 3D23A 2GDDA 1QB9A 1XMNB 5B6OA 1PQ7A 2J34A 1BOQA 1MTNB 1TABE 1QRXA 3RC5A 1GMHG 3TVJB 1VCQA 1G32B 1K9OE 2GDEH 4K69A 4NZLA 5GIBA 4HZHA 3RMLH 2J4IA 1GMDG 1P2MA 1F5RA 1BMNH 3U9AH 1NY22 1KSNA 1O2MA 3KQEA 5TCAA 2FX6A 3BTKE 1V2LT 1Z1JA 1ANDA 3URCA 3A7VA 5E0JA 1MBQA 4ZKNU 3OX7U 1XKBC 2RCEA 1EJAA 3ZZDA 1XUKA 1S82A 2ASUB 2GD4B 2Y5GA 1W10U 1EZUC 2VJ1A 2OC1A 1GJ4H 2SGPE 2C93B 1WBGB 4RN6A 1IAUA 1DFPA 4CH2B 2GMTC 1W2KH 1C9PA 1ZRBA 1AFQB 2UUKB 1K21H 1O3FA 1GI6A 1O3CA 1ZPZA 2BD8A 3BTGE 1GJ6A 3C1KA 3TK6A 2LPRA 4Q7YA 3V0XA 1FZZA 5A09A 1SQAA 3DFJA 3HKIB 3V7TA 3BG4C 2OQ5A 2A2XH 3E8LA 1RS0A 1O3IA 3H7OA 3B23B 1S81A 1FAKH 5E0HA 2NU1E 2PFEA 1QL9A 1J17T 2J94A 1GCTC 1CHGA 4NIVA 3ITIA 2H5CA 2PLXA 3O8CA 4ABDA 5DP8A 2F91A 2VB0A 3GY4A 2BOHB 2P93A 1AFQC 2VIDA 4A1XA 2Y7ZA 2ZFTA 2PHBA 4BNRA 3P8OA 1C5NH 1HIAA 5L6NH 1C5VA 3BIUH 3EE0B 2ZG0H 2UUJB 1A5HA 2RA3A 3DFLA 2A0QB 2PUXB 3BTDE 3BSQA 1F92A 1HAOH 3F9FA 3W95A 2R3YA 4A1TA 3MU8A 2KAIB 1TPSA 1A4WH 2BD2A 3OU0A 4YOJA 1AWHB 3T25A 1O2VA 2Z6BD 2CF8H 2ZIQH 1E38B 3B9FH 1WU1A 4MNYA 1BMAA 1AMHA 1HPGA 1O2TA 3UNRA 5T6GA 1A46H 4XE4A 1GBDA 1D6WA 1TWXB 4YLUA 4YO9A 2IOTA 2XC5A 1Y3VA 4U32A 1K1NA 1AU8A 1WOFA 1TONA 2QYIA 1S6HA 3V12A 1TX8A 4J2YB 1C5XB 3ZZ7A 1BCUH 2CHAB 1P03A 1FY5A 3RXBA 1O30A 3TGJE 2ZC9H 1LKAA 1ETRH 4DIIH 1VJ9U 2BY9X 1HAZB 1QFKH 1NRPH 1NFYA 1CHOF 4H6SB 3O8DA 2AGIX 4HTCH 2WUBA 2WPIS 3FVFB 2BDIA 1GBFA 2BX3A 1B0FA 3GY8A 3A87A 3RU4E 3UR6A 3VB7A 2EC9H 1NU9A 1O2IA 1OSSA 4WH6A 4TWYA 1DM4B 2ZFQH 5K7RA 1BJVA 2BLWA 1C2EA 1UTPA 2OC8A 3DA9B 3SJIA 3BF6H 1SHHB 3STJA 3SV6A 3PLKA 1T4UH 1MD8A 1ZPCA 4KTUA 1Z6EA 2AS9A 4GUXA 5DK1A 3F1SB 4B75A 3AVZA 1QB6A 1OOKB 3STIA 3RMNH 1PPCE 1GDNA 4MG3A 1P8VC 3GCTF 1OYQA 4ZH8A 1XVOA 4AFZA 1SR5C 3SHAH 2Z9IA 5DKMA 3RLYH 3EYDA 2TGDA 5E0GA 1FLEE 3RXMA 1O3NA 3TLOA 4FUHA 1ETTH 5LPEA 4Y76A 1W3CA 1GBJA 4X0WU 5FX5A 3QK1A 1QBOA 4HGCA 1U6QA 3LGTA 1AE5A 2A4GA 1E34B 2H9HA 2BOKA 3VGCC 1TPPA 1O37A 1L0ZA 5IYTA 2BD7A 1O3EA 1AFEH 4VGCB 1C2IA 2SGQE 5A0AE 1DANH 4AG2A 3UWIA 3RXTA 1BTZA 3Q76A 2SNVA 4ABJA 1AB9B 1C5WB 2Y6TA 2ZA5A 2SFAA 3MOCA 1O2SA 2W3KA 2A7HA 3TIUA 3UFAA 2BDHA 3A89A 1PQAA 2FI4E 5DP4A 5SGAE 4MDSA 3A7XA 2ZDAH 3QWCH 1YPHC 5EXLA 1YPKH 3SNCA 4DGJA 1X7AC 1GMDF 3VGCB 1H9LB 4Z0KA 1GJ8B 4RSPA 4WMEA 1IQNA 2Q1JA 2FOCA 1O2JA 5JPMH 2PTCE 2XC4A 1NRQH 2JETC 5JBBS 2G4UA 1ESBA 4JYUH 3MH6A 1P02A 3GY3A 1XX9A 2F9VA 3MU5A 3EGKH 4Y8ZA 3FZZA 1C2KA 2WV4A 1MCTA 2RDLA 4I32A 1Z1IA 4DJZB 1AIXH 1DUAA 1F0RA 1NRRH 4ZKOU 1GL1A 5FXLA 1IQKA 1C5PA 3F9EA 2B8OH 1P2OA 2AMQA 1HAXB 1CQQA 3F6UH 2BD3A 2K1QA 1V2MT 3ATMA 2W7UA 3UWJH 1MU8B 3P92A 4X2XA 1L1GA 4CRDA 1UJ1A 2XWAA 3U1JB 1PQ5A 4AX9H 3P8NA 1E36B 4GPGA 1GBBA 2ESTE 2QC2A 4M7GA 1C5TA 1C1MA 4AYVB 2XXLA 5EU8A 3EAJA 1BZXE 1V2UT 1UVTH 2F9UA 1SLUB 2NU4E 1ELVA 2ZTZA 5JYIA 1GJDB 1AD8H 1NESE 4KP0A 3MFJA 1W14U 2BHGA 2ZHDA 4F49A 1TGSZ 1O5GH 1QJ1B 1GHZA 4WXVA 1O39A 1HAVA 1QGFA 1C1TA 1SGFA 3BTWE 1DUEA 1TB6H 3ZZ8A 6LPRA 1VCWA 4IC6A 3HKJB 1SGFG 4Y7AA 1TNHA 1LO6A 1BBRE 2A4OA 3AASA 2C4FH 3UR9A 3LH1A 2ZO3H 1GMHF 4ISLA 1FY4A 2A45B 2G55A 5EQQA 2UWLA 2OP9A 1F7ZA 3N7OA 4I8GA 4Y6DA 5CHAC 4R8TB 4CH8B 5E8EH 1AN1E 3RXHA 1CU1A 8KME2 5ESTE 1PPFE 2F9PA 3K9XB 5FAHA 1O2XA 3QZRA 1Z8RA 3MU1A 2PKSB 2ZDLA 1ZR0A 3RXKA 5EW1H 1LHDH 1EXFA 3SU5A 2Z94A 2R3UA 3TH4H 3V3MA 4B1TA 1VGCC 2BDGA 2ZZUH 4IMQA 4JMYA 1TNJA 1IQIA 2G5VA 3L3TA 4X8UH 4X2YA 2J38A 4OGXA 2EEKA 4X6MA 3BIVH 3BEFB 3GCHC 1CT0E 1N6YA 3GICB 2GVFA 3E90B 1SLVB 1YCPM 1YPJH 1SGCA 2TGPZ 3GISB 4F4OC 1HAHH 3M7TA 1S5SA 1S83A 1PPEE 1ELFA 2RG3A 1AZ8A 2WYGA 1MCVA 4YT7H 1PPHE 1D3DB 4LK4A 2W5EA 2WV5A 3LGIA 1S6FA 3PMJA 1H1BA 2ZHQH 6CHAB 2ZFPH 1TYNA 3MO9A 1Q3XA 2RA0A 1DY9A 1DE7H 1O5DH 1G2LA 1N1LA 4B71A 3Q00A 1O33A 1PYTD 1EASA 1TRNA 3MH7A 1GDQA 3ZVAA 4NIWA 2YNAA 2P94A 3FP8E 2ZHFH 1SLXB 2FEQH 2FXRA 4DVAU 1C1WH 1LVBA 4FU9A 3HK3B 1IQJA 4K3JA 5AF9H 3RXRA 4AZ2B 4FVDA 1G3EA 3TH2H 3RUOA 4JZFH 2FTMA 3SNEA 1T8OA 1G9IE 2Z9LA 1T8MA 2XCFA 3KN2A 4X1PU 4E06H 1P06A 1ANBA 2B5TB 3M5OA 2F9OA 1QB1A 4X6NA 1ARBA 3LONA 7GCHG 3PROA 4O97A 1THPB 1AB9C 2Z9GA 1O5FH 2ZQ2A 4BANB 3R0FA 1Y3WA 2ALVA 2CF9H 2C8WB 1ABIH 1LVOA 2BDBA 1K1OA 5HYOA 2V3HH 2VVUA 2WPMS 3KNXA 1EAIA 5GXPA 3A83A 1P2IA 5CE1A 4JYTA 3PO1C 1BQYA 3ZZCA 1AVXA 2OBOA 2BXUH 1YPHE 2CJIA 3GY5A 1K22H 2OC0A 2OBQA 2F9BH 3K2UA 2HGTH 4MPWA 1O3GA 3BN9A 3GDSA 2VGCB 5J4SA 3SJ9A 1C1RA 4I8LA 3RXVA 4WXIA 5F03A 2A5IA 2GMTB 4X1SU 1Y5BT 1UCYH 4AG1A 4X8TH 1MTWA 2P59A 4YT6H 1YM0A 1GDUA 2FI5E 2A7JA 2CN0H 1FI8A 1RXPA 3GCHB 1FNIA 3ZZBA 1HAPH 1CBWC 5FHTA 1AZZA 1A3BH 1CGIE 1NZQH 1BRAA 1TAWA 2BLOA 3HK6B 3RXGA 1JXPA 4NGAH 4Y0ZE 1QL8A 7LPRA 2QCYA 1EPTA 2PTNA 1P3CA 4ISOA 5TCCA 1N8OB 4NA8A 4JZ1A 1CVWH 1IQEA 1LHFH 3NWUA 1O3JA 3Q3YA 3LOXA 2PKAB 3D49H 4MLFB 5C5NA 1LQEA 4OS7A 1GI8B 1YPEH 3M3VA 4WMDA 4MPUA 4JZDH 5FBIA 3LU9B 3PYHA 2UUYA 1KDQA 4MNXA 4XBDA 3S9AA 1SGDE 4I31A 1O2GH 2VINA 3T62A 1V2ST 1DXWA 2BTCE 3IWMA 1TIOA 1ZSKA 4O9VA 1N8OC 1DVAH 1HNEE 2OC7A 1A0JA 1CGHA 3E3TA 5FCKA 1XUFA 2QN5T 3LGYA 3SNAA 1GI2A 2P8OB 5E2PA 1AHTH 4K1TA 1H9HE 1G3BA 3MWIU 3A7ZA 1DS2E 1KYNA 2FOFA 5LH8A 2AMPA 3P6ZB 3OSYA 5DP5A 2XW9A 1ZOMA 1Y8TA 1AO5A 1SMFE 3BTFE 3UQOA 1HDTH 2ZCHP 2FESH 1Z71A 1UVOA 1KTTB 1CT2E 4Y79A 2OD3B 1EJNA 1OX1A 4PROA 5FCRA 5A8XA 2R0KA 2EI7A 2H9EH 7GCHF 4JK5A 5LPRA 1A0HB 3A7YA 1GBTA 1FIWA 1DDJA 1O35A 3NK8A 4NZQA 3ATKA 3RXFA 2FS9A 1ZTLA 2PGQB 4CHAC 2HNTF 4NWLA 1ZHRA 1GBLA 2AIQA 4FVBA 2PGBB 1AKSB 3AAVA
chains in the Genus database with same CATH superfamily
4H42U 4Y7BA 3S7KB 1TRMA 4OS5A 1DICA 5T3HA 1FN6A 1WCZA 2F43B 1NROH 3LPRA 3AW1A 4X2WA 4CRGA 5L30H 2UWOA 4YESB 2BLVA 5BPEA 2JKHA 1FN8A 1GGDC 1NPMA 3GY2A 3DT0H 1LPZB 3SI3H 2XYAA 1O3HA 3SU4A 1S85A 1J15A 1RGQA 1QA0A 3TH3H 1K2I1 4K60A 1HJ8A 3U8OH 3ZZ6A 1K0HA 1PPBH 3QLPH 2DE9A 3P70B 1HJAC 1WTGH 2P95A 3FAOA 1O2WA 2D8WA 3U8TH 1NTPA 2ZFSA 4UDWH 2ZU1A 1L2EA 1BTUA 3W94A 3OAAD 4JK6A 1C1QA 3VFEA 1GHYH 4WVPE 8GCHF 1YYY1 1EFRD 1HBTH 3MNXA 3QN7A 5JB8S 1EZXC 4NIYA 5EJ1A 1PFXC 3MNSA 5I25A 3AW0A 1RIWB 3ZZ9A 1CGJE 1VCPA 5JBTA 3RXEA 4MQAA 2ZI2H 3A81A 1P10A 2O8MA 1H4WA 1LPKB 3RMOH 5DG6A 2FOHA 1H8DH 2BDYA 4AFSA 2ZFRH 3RLWH 2C8ZB 3TITA 1SOTA 5K0HA 2HNTC 1QRWA 1Y3YA 4ASHA 1ELDE 2G81E 2OTVA 3E0NB 1TNIA 1L1NA 4IN2A 1O2KA 3B8JA 2PSXA 2A5AA 3HGNA 2ZGHA 2ULLA 2YNBA 3ZYEA 4UEHH 3DD2H 2R2WU 3A7WA 1BITA 1O2YA 3PV4A 1C5MD 3UNSA 1SFIA 1GHAG 2AFQB 4FETA 1W13U 5EXMA 1ZRKA 2BD5A 4I86A 4WMFA 1L1JA 1S0RA 2BD9A 1GVKB 1O38A 4AB8A 1RJXB 3VB3A 3ZVFA 2HPQH 1C5YB 3RU4T 1P57B 1PPGE 1O3AA 2ZCLP 2ZHEH 3RC4A 4TPYA 4ABEA 4IGDA 1F2SE 1Y5UT 3A86A 2A5KA 4FUJA 3QGNB 1C9TA 1C5OH 5LGOA 4AB9A 2ODQA 2D1JA 1DPOA 1C1UH 1EAXA 1TOMH 1GCTB 1WAYB 5DGJA 4NSYA 1HCGA 1NFXA 4F48B 3K65B 1TGNA 1QNJA 2FO9A 1MKXH 1E0FD 2B7DH 2H1UA 2R9PA 2TPIZ 3M3SA 4XFQA 3SGQE 4KTCA 3EA9A 2PW8H 1FUJA 1FJSA 4FUFA 1DY8A 1UTNA 1K1PA 1QIXB 2VWMA 2THFB 1QBNA 3KQBA 3LT3A 1GL0E 5T6FA 4WJG2 5HM9A 4IW4E 3SUDA 1KLJH 1O2PA 2VVVA 3LJOA 4LZ1H 1M9UA 1GJBB 4H6TA 4U30A 1O34A 2OLGA 1GI9B 2O9QA 1NN6A 2ZDNA 1LPGB 2BM2A 3A82A 5ABWA 2A1DB 2PUQH 3GYLB 4AFUA 3VB5A 1ARCA 1W8BH 2EA3A 3MTYA 5LPFA 1HRTH 3A7TA 3VEQB 5A2MH 1AKSA 3SJKA 3T2NA 4CBNA 1BDAA 1G3DA 1UTJA 1FAXA 1O2ZA 1SFQB 1W7XH 4FUIA 3S69A 1FMGA 4GCHG 1IQHA 1UK4A 3F0PA 1LCYA 1Y59T 2QV1A 1GVLA 4ZROA 1RTLA 4DY7B 1GPZA 1AVGH 1ZGVA 3BEIB 3RP2A 3QX5H 2J98B 1CBWB 3UPEA 1TE0A 2EI8A 4BAKB 2Y7XA 4YM9A 2B0FA 1J9CH 1TQ0B 1TALA 4Q80A 1A2CH 2HPPH 1SGRE 1C4V2 1CO7E 1T8NA 4AN7A 5JBAS 2ZDKA 2QE7D 1QURH 2XTTB 2CK3D 1GBHA 1TX7A 2ZDVH 3PRDA 2HOBA 1VGCB 6GCHF 1IQFA 1SQRA 3SUFA 5F8XA 8LPRA 1YCPK 4X1RU 2FOGA 4I8HA 1NRSH 1JMOH 1KXFA 2CMYA 1BRUP 5G4BA 1QY6A 1C5SA 3F2GA 1H8ED 4Y71A 1TMTH 1F0TA 1QHRB 3NZIA 1F5KU 1MUEB 3IG6B 5F53A 5FBEA 3KGPA 1CA0C 4TPIZ 4FUCA 3SQEE 1NBME 2VVCA 1OWDA 5GCHG 2H6MA 1G3CA 2WPKS 4FUDA 3S7HB 3QO6A 3A84A 3ZVDA 1GCDA 4X1NU 3G01A 1SGEE 2FMJA 4A5TS 2Z9JA 2G4TA 1SQOA 1EOJA 2A32A 3NKKA 2Y82A 4UE7H 4GLYA 1FV9A 4Y8XA 2BQ6B 1TNGA 3QUMP 3RXJA 3RXAA 4INKA 2JETB 3Q77A 2GX4A 4ZHLU 4D76A 3R3GB 1TBRH 2OXSA 3SGBE 3NXPA 1CE5A 2PKSC 2ANKH 5HGGA 1LKBA 4NFFA 1A1RA 4K1SA 1C2DA 6ESTA 1QJ7B 1KDQB 2A4QA 3MH4A 5F6MA 3UQVA 1FPHH 1SC8U 1GI1A 3WY8A 1GHAF 1RFNA 4GHQA 1C1OA 1EPTB 2OQUA 1P01A 1HJAB 1YLNA 2ZDMA 2XNIA 4K1EA 1EZSC 1CHOG 2VWNA 2BMGB 2O8TA 1NT1A 3TU7H 1N6XA 2IJD1 1ZJDA 1DSUA 2AH4X 2NU0E 1WDIA 4Y10E 1XKAC 2SGFE 3ZZAA 1OP8A 3ZVEA 1EJMA 3KCGH 5FPSA 1HLTH 1VR1H 4KKDA 1INCA 4NCYA 5C1UA 1A3EH 2H9TH 1O5BB 2AGEX 2GV6A 2GZ8A 1ZJKA 1GJCB 4NWKA 3GDVA 1O3LA 1GJAB 2WINI 3BTQE 3SV8A 4NIXA 8ESTE 3E16B 5C0UA 3E91A 7ESTE 1HB0B 4OS2A 3NRLA 3SORA 5GJ4B 3DUXH 2BQ7B 1V2RT 3FZDA 4D7GA 1KLIH 1ZHMA 1DXPA 1GBIA 3A8CA 1OP2A 3A80A 3RC6A 2TGAA 1MTVA 1B5GH 1SOZA 5EGMA 1XXDA 3GCOA 1RTFB 2VH6A 3UIRA 2BYAX 5EQSA 3M7QA 4KELA 2P16A 3RXQA 5HIZA 3H09A 2VGCC 2ILNA 3TK9A 1GMCG 1B0EA 5JDUB 5DP6A 2Q6DA 2QIQA 2AIPA 1Z8GA 1BBRH 3I29A 4Q7ZA 1MZAA 4Y11E 1P3EA 1EAWA 1V2WT 4MPVA 1JIRA 4OS1A 2FPZA 1AE8H 4B74A 3URDA 1SGTA 2ANYA 5C20A 4WF8A 1BTYA 2G00A 3SBKA 2FLRH 4FUBA 1E35B 4ABIA 3L33A 5EG4A 4B2BA 1SL3A 1EZQA 3OTPA 4XBCA 4BAMB 3EDXB 4K8BA 4Z1MD 4Q7XA 1FY8E 5C5OA 2H2ZA 3E0PB 5EJZA 3WW7A 2GCTC 3K6YA 3LDXH 1GBKA 1GJ5H 2YMSB 4B73A 2FOEA 4E7NA 2OUAA 2W26A 2ZU5A 2CV3A 2TBSA 3SU6A 1Z7KA 4XSKU 3FFGA 5FL7D 3M3TA 2K0QA 2VIQA 4M9FA 3SOSA 1YLCA 4TYDA 1ELGA 3PO1B 1KXDA 1T31A 4NSVA 1TX6A 2IJOB 2QY0B 1FXYA 1JBUH 1QZ8A 1EQ9A 2ZCKP 1P2KA 1T4VH 1LHGH 4CHAB 4U01A 2HWLB 2Y5FA 4RT1A 1ZSLA 4GCHF 2G8TA 3DCLA 3P17H 1OWJA 3I78A 6CHAC 1XUIA 3EQ0H 1SHYA 4JZEH 1TMUH 5JBCS 3S9BA 2A4RA 3JZ2B 4HFPB 2HLCA 1V2PT 5GPIB 4Y0YE 1A5GH 1WQVH 3PB1E 3VB6A 2IPHA 3BTEE 2R2MB 4OM9A 2ZPQA 1O3OA 1BTWA 2QXIA 1UMAH 3M7UA 1C1VH 2UWPA 1UVUH 3ZV9A 1QQ4A 2ODYB 5HMAA 2FYRA 4E05H 3JZ1B 4X1QU 3RM2H 3F68H 4D9RA 1C2JA 1NFUA 2BB4A 2Z3CA 4ZMAH 1AVWA 1DWBH 3V13A 1H9IE 4ZKRU 3RXSA 1F5LA 4A1VA 2ZP0H 1NM6A 2JJ2D 3SU2A 1BIOA 4OS6A 4ESTE 4DT7B 3M35A 4CRFA 2CGAA 3T5FH 1TGBA 4MPXA 2I6QA 2SGDE 3D62A 2DE8A 5DP3A 1O3BA 5F8ZA 1P2QA 3MU4A 3OE7D 3HPTB 1GG6B 1ANCA 1UTMA 1IQMA 2D2DA 4IN1A 1ZMNA 3MH5A 3MO3A 4FU8A 4ABGA 4BTIB 1UCYK 1EKBB 3U98H 1ORFA 1AQ7A 4UFFH 5AFZH 2JDID 4X6PA 3ZVGA 4O03A 4MNVA 3LIWA 2BDCA 1V2OT 4FXGH 3Q3KA 2VNTA 2J95A 4VGCC 2GT7A 1V3XA 1P9UA 2Q6FA 1Y3XA 4CRBA 1C2HA 1CSOE 4D7FA 2TIOA 1D3TB 4DCDA 5IDKA 1HGTH 2V0BA 4DW2U 4FUGA 4GSOA 3UY9A 4Z6AH 3PMBB 1MTNC 1NRNH 2GTBA 1BJUA 4SGAE 3ELAH 2JJ1D 1WV7H 2HRVA 1VJAU 4INHA 1XM1A 1C1NA 4OS4A 2D26C 2Y81A 1KXCA 1UTQA 3PRBA 5GNDA 2QF3A 1ZYOA 5AFYH 5L2ZH 1ZSJA 2BVSH 2JH6D 2GGVB 4I8KA 4NA9H 1O5CB 3CP7A 4ISIH 2J9NA 1BTHH 3L6PA 2QXGA 1O5AB 3ATIA 5I46H 2BD4A 1GI0A 4TY7A 1SG8B 3FP6E 4GAWA 2PWXA 3RXUA 3F0OA 1TA2A 2WPHS 9LPRA 1YPLH 5DPAA 1TBZH 5EW2H 3SNBA 1P0SH 1SB1H 4MTBA 2FIRH 1S0QA 2VWLA 4CR5A 1ELTA 2Q6GA 4DIHH 3SV9A 1W0KD 3BG4B 1BRCE 4CR9A 3ESTA 3D65E 4K2YA 3SQHE 2ZNKH 2XRCA 3H5CB 1ESAA 1SVPA 2BX4A 1W0ZU 4AFQA 1AUJA 1VITF 1ESTA 1GHBF 1OKXA 3I77A 4RKJB 2ZKSA 5EQRA 2AMDA 3TNTA 1HIAB 1FY3A 1HAVB 5E2OA 4B2AA 2ZU2A 1GJ7B 4A6LA 2FTLE 1ELCA 5L2YH 4ZHMU 2VIPA 2P8OC 2QAAA 4TSFD 1HAIH 1ACBE 4ABFA 4GHTA 1HFDA 2FWWA 1K1LA 1TNKA 1ZLRA 1SSXA 1VKYA 4K5ZA 4RI0A 1NS3A 2M5TA 1Q31A 3KQ5A 3BEUA 2KCYA 5AVDA 4DG4A 1RIWC 1F0UA 1ZMLA 1IOEA 3TPIZ 1Z8IB 4YOGA 2L74A 1OHHD 1BBRK 4IC5A 1TNLA 8GCHG 2M2AA 2PV9B 3ENSB 1WSSH 1XUGA 3RXDA 2F4LA 1V6DA 5T1VA 1LMWB 2GCTB 1C5ZB 1O31A 1C4Y2 1UTKA 1MTUA 4UONA 3DSPA 3GY6A 1GBCA 3NPSA 5ETXA 3EE7A 1HUTH 1T32A 5C2ZA 5DP9A 3ZZ5A 1T7CA 4AGKA 5H4IB 2KFWA 1DOJA 2ZGXH 3S0NA 1T8LA 2O8UA 2G5NA 5CMXH 1YPGH 3UB0A 1DT2A 2OK5A 3F3BA 3P8GA 2FDAA 2OCVB 3LGVA 1UVSH 4BAOB 2FS8A 1J14A 1XUHA 3QZQA 3OY5U 1C5RA 1GJ9B 1C1PA 2WYJA 2NWNA 3RDZA 2VWOA 4A92A 3ATLA 6GCHG 1GI5A 3TGKE 3FN8A 3QTVH 4D9QA 2HALA 3MHWU 4U2WA 2GKVE 3LC3A 3E1XB 1MKWH 2W3IA 5A8YA 2WPDD 2ANWA 1XXFA 2ZF0H 1QTFA 1JIMA 4I33A 1YCPH 3MNBA 4D8NA 1GGDB 2ZECA 1SGQE 2VIVA 2G52A 3MI4A 2ZPSA 1D6RA 4Y8YA 2ZQ1A 5C0TA 2O8WA 1A7SA 3M5NA 3NUMA 1FDPA 3UUZA 2Y5HA 1W0YH 4XOJA 2V7QD 1O2OA 2KAIA 5DO4H 1C2LA 1H8HD 1OYTH 1TBQH 5A0BA 3P95A 1BA8B 4LZ4B 1C1SA 2RDEA 2VH0A 2ZWLH 1O36A 1YKTA 3M37A 4GVUA 1A61H 2A7CA 5DP7A 4AORA 1O3DA 1KIGH 1FPCH 2BVRH 2GCHG 2KCOA 4BTTB 1HAGE 3LJJA 2GT8A 3BV9B 7KMEH 1V2JT 5C67A 3RU4D 1HYLA 1MQ5A 2AYWA 2PR3A 1W7GH 3MYWA 3O8RA 4LXBH 2B9LA 4X6OA 1D4PB 2V35A 4OGYA 4ZCNA 2EQNA 1ZGIA 3A8AA 4B76A 2FOMB 3KYFA 2BY8X 2F3CE 1F0SA 2XNDD 2AGGX 2LELA 2JH5D 3O8BA 1QRZA 1VITG 1OXGA 1DLEA 1ANEA 4THNH 1MTSA 1LDTT 1CA8B 4BTUB 2F83A 2BLQA 1TPOA 4WWYA 3S9CA 4X2VA 5JB9S 5CHBA 2BY5X 1IQGA 4WH8A 1QCPA 4UD9H 1G36A 2QGRA 3M5MA 3P8FA 1ELBA 3TJOA 1V2QT 1TLDA 1UK2A 2K8IA 4AGJA 1P04A 5CDFE 4XBBA 3ODDA 1UCYE 3KL6A 5AHGH 5EPYA 3RXLA 2BQWB 4BXWA 2PKAA 1UHBA 2HNTE 4INLA 2FX4A 1BMMH 1QBVH 2XBWA 1FQ3A 5GWZA 1PJPA 3OY6U 5FPYA 2ODPA 4I8JA 2KCAA 1V2NT 2STBE 1UHBB 5C1YA 3PLPA 1ZHPA 1QL7A 2ZGJA 1MH0A 2V3OH 3A8BA 1LVMA 3TJUA 3OTJE 1UO6A 2FI3E 4UFGH 9ESTA 1BT7A 2FLBH 4NG9H 4ABHA 1JRSA 1ID5H 5BRRE 1J16A 1HXEH 3CS0A 3SV7A 1OP0A 1SGPE 1UVPA 3BTHE 3RXCA 4J1YA 2XWBI 3SU3A 3ZZ3A 1O3PB 3OFND 3EA8A 1NFWA 2VU8E 1W11U 2QA9E 3N99A 3LKWA 4ZHAA 3SNDA 1EOLA 1JOUB 1WQSA 2P3FH 3MO6A 1ZMJA 1KXBA 2H5DA 5DJ7A 1ZTJA 4IMZA 1RRKA 4NA7A 2FODA 2ZPRA 1C5UA 3LGWA 1ELEE 1ABJH 1MAXA 1ZTKA 3DHKH 3KHVA 3MU0A 3PTBA 4RKOB 2BVXH 3SO3A 1UTOA 2J92A 3KQCA 1LTOA 1SQTA 2FOBA 2CHAC 3PTNA 1W0JD 3C27B 3HGPA 3ZV8A 1OS8A 2CXVA 3SJ8A 4JYVH 1TGTA 2P3UB 1WYKA 1YP9A 2C3SA 3MNCA 2XBVA 3UOUA 3PLBA 3EA7A 4ISNA 1W12U 1ZZZA 4O3TA 3U8RH 5ESBA 3PMAB 1YBWA 2Z3DA 2AEIH 1GBEA 2FZZA 3KEEA 1EP5A 3ZYDA 1BTPA 2TRMA 4YOIA 2SNWA 2JH0D 1QR3E 1OWHA 2A31A 4I7YH 2ZTYA 1YLDA 3IITA 3GCNA 3FANA 3SHCH 2C8YB 3LH3A 1SPJA 4Q2KA 3UTUH 1BB0B 1DX5M 1SGYE 4ZXXH 2DUCA 3BTTE 1QJ6B 1OWEA 1O5EH 1V2VT 4ISHH 2GZ9A 3UNQA 4O3UA 1A0LA 2STAE 2G51A 4DOQA 1O2QA 1THSH 2O8LA 5TJXA 1YF4A 2FM2A 2YOLA 4LOYH 1MQ6A 2ZU3A 2NU3E 1XUJA 5FPTA 5A0CA 1VITH 2OINA 2LP6A 2J5UA 1P9SA 3MMGA 4YLQH 2NU2E 2WPLS 4ZUHA 1MU6B 1AWFH 1GBMA 4TY6A 3SJOA 1FIZA 2FOAA 2ZHWH 1MKWK 2KCPA 2L6OA 3BTME 4BXSA 5J4QA 4UFDH 3QDZB 3PWBA 2TGTA 2BXTH 1K28D 3PM3A 3OYPA 4MVNA 1KXAA 2PSYA 2ZFFH 3M36A 2A2QH 2J2UA 3SU1A 1TMBH 1C2GA 1FONA 2FP7B 2ZGCA 1KY9A 4P02A 1DLKB 2QXHA 2HVXA 2XBXA 5T6DA 1YGCH 1C5QA 1P2JA 2ANMH 3SU0A 3GS9A 4NFEA 1TPAE 4DURA 5HM2A 3E6PH 3ZZ4A 3GYMA 4YZUA 5C3NA 3KQDA 2WUCA 1G30B 1E79D 2AERH 3T27A 4R0IA 1ELAA 1EPTC 1DWCH 5EJLA 1P05A 3Q3XA 1J8AA 2SGAA 4WY3A 1LHEH 2WPJS 4X8SH 3SUEA 1BTXA 4YXWD 1GMCF 1TFXA 4K8YA 4BAHB 1TQ7B 1BRBE 2VIOA 1GWAA 1WTHD 4CREA 2F9NA 2XBYA 1GBAA 1GHWH 3ODFA 4QT8C 4F55A 1EUFA 3A8DA 4BAQB 1WUNH 1HAYB 1PYTC 4AOQA 2BY7X 3CS7A 1AGJA 4JZIA 4MNWA 1K1JA 2SGEE 3HATH 3SW2B 1SI5H 2W7SA 5IK2D 1THRH 3RM0H 1YPMH 4TWWA 1SLWB 2GV7A 2ZTXA 1NO9H 1UW7A 4CRCA 1O32A 1S84A 2ZGBH 4A7IB 1OPHB 4FUEA 3T26A 3AAUA 4IBLH 3QGJA 1BMLA 2FYQA 5HXFA 1MAYA 5HKKD 3K6ZA 2QXJA 4XDEA 5EPNA 3TK5A 1HXFH 3M5LA 4ACAA 4B2CA 1QQUA 1D3QB 1YC0A 1TOCB 1GI3A 4ZKSU 1P12E 1RTKA 4ZXYH 4H4FA 1L4ZA 1DITH 3VPKA 2EI6A 1ETSH 2WV9A 5F8TA 3RXOA 1YY3A 2BDAA 4X8VH 1MMJN 1G37A 4CRAA 3RXPA 2ALPA 5EOKA 2BZ6H 1V2TT 1EB1H 1GHBG 1GI7B 1EAUA 1LVYA 3VB4A 1Y3UA 5EODA 1KXEA 3A88A 1O2HA 1B7XB 1E37B 1DSTA 1Q2WA 1V2KT 5GDSH 5C1XA 3VG8A 1MZDA 1GHXH 1ZPBA 2QF4A 4ABBA 4CBOA 2ZEBA 3RXIA 2GCHF 1GHVH 1IHSH 1C4U2 4E7RG 4RT0A 3SGAE 5GCHF 1GVZA 1JRTA 3LGUA 2VIWA 5EXNA 3VXEH 1OWIA 3VXFH 2I6SA 2GP9B 1EB2A 3LC5A 5FX6A 3F9HA 5A8ZA 3ATWA 1O3MA 2R0LA 3UOPA 1LQDB 4P00A 3U1IB 3KIDU 3PMHB 1MKXK 1EATA 4XRNA 1QA7A 3T28A 1D3PB 3TGIE 1BHXB 1Z8JB 1C5LH 1TA6A 4BOHA 1TGCA 1HJ9A 3FP7E 3FKSD 3UREA 1MD7A 2LNCA 1IHTH 2BY6X 1C2MA 1P2NA 1C2FA 3TJNA 3TJVA 1EP6A 1JWTA 3ZVBA 1Z6JH 2Z7FE 1O2LA 1L4DA 1K1MA 1KLTA 1O2NA 3SN8A 3CENA 4UFEH 1P09A 1O3KA 1BUIA 4FU7A 1A5IA 2XCNA 3GDUA 1D9IA 4FOUC 1EX3A 3SI4H 3PWCA 1CT4E 1O2RA 1RD3B 2V6NA 3M61U 3U69H 1K1IA 2IN2A 1IQLA 3SZNA 3NCLA 2XC0A 3TNSA 1E1RD 1OWKA 1GI4A 1CA0B 1DWEH 1AY6H 1H8IH 1HV7A 3BG8A 3GOVB 1SKYE 1DWDH 3GCTG 2UUFB 1UTLM 4AYYB 3GY7A 3ZVCA 1GG6C 1FY1A 3SUGA 2GZ7A 1LHCH 1P11E 2P3TB 2QF0A 1SBWA 4ABAA 1G2MA 2Z3EA 2C90B 2Z9KA 3AK5A 1O2UA 1BHXF 1AUTC 1SGIB 3H7TA 1SGNE 2BZAA 5PTPA 4KGAA 5CHAB 1Y5AT 3F9GA 1XVMA 3QTOH 1NC6A 1O0DH 1PPZA 3T29A 3SV2H 3RMMH 2ZU4A 1PQ8A 2C8XB 3KF2A 1KTSB 1AI8H 4YTAA 2Y80A 4JCNA 4HI3A 4SGBE 1MBMA 3SYJA 1UK3A 4IS5A 1VZQH 1TRYA 1NU7B 4ZAEA 4B6EA 3A85A 4KTSA 1YWUA 3D23A 1KMHB 1QB9A 2GDDA 1XMNB 3FOAA 2WHXA 5B6OA 1PQ7A 2J34A 1BOQA 1MTNB 1TABE 1QRXA 3RC5A 1GMHG 3TVJB 1VCQA 1G32B 1K9OE 2GDEH 4K69A 4NZLA 5GIBA 4HZHA 3RMLH 2J4IA 1GMDG 1P2MA 1F5RA 1BMNH 3U9AH 2KM0A 1KSNA 1NY22 1O2MA 3KQEA 5TCAA 2FX6A 3BTKE 1V2LT 1Z1JA 1ANDA 3URCA 3A7VA 5E0JA 1MBQA 4ZKNU 3OX7U 1XKBC 2RCEA 1EJAA 3ZZDA 1XUKA 3WWFA 1S82A 2ASUB 2GD4B 2Y5GA 1W10U 1EZUC 2VJ1A 2WZQA 2OC1A 1GJ4H 2SGPE 2C93B 1WBGB 4RN6A 1IAUA 1DFPA 4CH2B 2GMTC 1W2KH 3N7DA 1C9PA 1ZRBA 1AFQB 2UUKB 1K21H 1O3FA 1GI6A 1O3CA 1ZPZA 2BD8A 3BTGE 1GJ6A 3C1KA 3TK6A 2LPRA 4Q7YA 3V0XA 1FZZA 5A09A 1SQAA 3DFJA 3HKIB 3V7TA 3BG4C 2OQ5A 2A2XH 3E8LA 1RS0A 1O3IA 1WXRA 3H7OA 3B23B 1S81A 1FAKH 5E0HA 2NU1E 2PFEA 1QL9A 1J17T 2J94A 1GCTC 1CHGA 3DSOA 4NIVA 3ITIA 2H5CA 2PLXA 3O8CA 4ABDA 5DP8A 2F91A 2VB0A 3GY4A 2BOHB 2P93A 1AFQC 2VIDA 4A1XA 2Y7ZA 2ZFTA 2PHBA 4BNRA 3P8OA 1C5NH 1HIAA 5L6NH 1C5VA 3BIUH 3EE0B 2ZG0H 2UUJB 1A5HA 2RA3A 3DFLA 2A0QB 2PUXB 3BTDE 3BSQA 1F92A 1HAOH 3F9FA 3W95A 2R3YA 4A1TA 3MU8A 2KZ4A 2KAIB 4AC9A 1TPSA 1A4WH 2BD2A 3OU0A 4YOJA 1AWHB 3T25A 1O2VA 2Z6BD 2CF8H 2ZIQH 1E38B 3B9FH 1WU1A 4MNYA 1BMAA 1AMHA 1HPGA 1O2TA 3UNRA 5T6GA 2WSSD 1A46H 4XE4A 1GBDA 1D6WA 1TWXB 4YLUA 4YO9A 2IOTA 2XC5A 1Y3VA 4U32A 1K1NA 1AU8A 1WOFA 1TONA 1MABB 2QYIA 1S6HA 3V12A 1TX8A 4J2YB 1C5XB 3ZZ7A 1BCUH 2CHAB 1P03A 1FY5A 3RXBA 1O30A 3TGJE 2ZC9H 1LKAA 1ETRH 4DIIH 1VJ9U 2BY9X 1HAZB 1QFKH 1NRPH 5DN6D 1NFYA 1CHOF 4H6SB 3O8DA 2AGIX 4HTCH 2WUBA 2WPIS 3FVFB 2BDIA 1GBFA 2BX3A 1B0FA 3GY8A 3A87A 3RU4E 3UR6A 3VB7A 2EC9H 1NU9A 3OEED 1O2IA 1OSSA 4WH6A 4TWYA 1DM4B 2ZFQH 5K7RA 1BJVA 2BLWA 1C2EA 1UTPA 2OC8A 3DA9B 5DSFA 3SJIA 3BF6H 1SHHB 3STJA 3SV6A 3PLKA 1T4UH 1MD8A 1ZPCA 4KTUA 1Z6EA 2AS9A 4GUXA 5DK1A 3F1SB 4B75A 2J98A 3AVZA 1QB6A 2J97A 1OOKB 3STIA 3RMNH 1PPCE 1GDNA 4MG3A 2EY4C 1P8VC 3GCTF 1OYQA 4ZH8A 1XVOA 4AFZA 1SR5C 3SHAH 2Z9IA 5DKMA 3RLYH 3EYDA 2TGDA 5E0GA 1FLEE 3RXMA 1O3NA 3TLOA 4FUHA 1ETTH 5LPEA 4Y76A 1W3CA 1GBJA 4X0WU 5FX5A 3QK1A 1QBOA 4HGCA 1U6QA 3LGTA 1AE5A 2A4GA 5KEDA 1E34B 2H9HA 2BOKA 3VGCC 1TPPA 1O37A 1L0ZA 5IYTA 2BD7A 1O3EA 1AFEH 4VGCB 1C2IA 2SGQE 5A0AE 1DANH 4AG2A 3UWIA 3RXTA 1S6LA 1BTZA 3Q76A 3ZIAD 2SNVA 4ABJA 1AB9B 1C5WB 2Y6TA 2ZA5A 2HLDD 2SFAA 3MOCA 1O2SA 2W3KA 2A7HA 3TIUA 3UFAA 2BDHA 3A89A 1PQAA 2FI4E 5DP4A 5SGAE 4MDSA 3A7XA 2ZDAH 3QWCH 1YPHC 5EXLA 1YPKH 3SNCA 4DGJA 1X7AC 1GMDF 2YMSD 3VGCB 1H9LB 4Z0KA 1GJ8B 4RSPA 4WMEA 1IQNA 2Q1JA 2FOCA 1O2JA 5JPMH 2PTCE 2XC4A 1NRQH 2JETC 5JBBS 3F2FA 2G4UA 1ESBA 4JYUH 3MH6A 1P02A 3GY3A 1XX9A 2F9VA 3MU5A 3EGKH 4Y8ZA 3FZZA 1C2KA 2WV4A 1MCTA 2RDLA 4I32A 1Z1IA 4DJZB 1AIXH 1DUAA 1F0RA 1NRRH 4ZKOU 4ACBA 1GL1A 5FXLA 1IQKA 1C5PA 3F9EA 2B8OH 1P2OA 2AMQA 1HAXB 1CQQA 3F6UH 2BD3A 2K1QA 3DSGA 1V2MT 3ATMA 2W7UA 3UWJH 1MU8B 3P92A 4X2XA 1L1GA 4CRDA 1UJ1A 2XWAA 3U1JB 1PQ5A 4AX9H 3P8NA 1E36B 2RFKC 4GPGA 1GBBA 2ESTE 2QC2A 4M7GA 1C5TA 1C1MA 4AYVB 1NBMD 4Q63A 2XXLA 5EU8A 3EAJA 1BZXE 1V2UT 2IPQX 1UVTH 2F9UA 1SLUB 2NU4E 1ELVA 2ZTZA 5JYIA 1GJDB 1AD8H 1NESE 4KP0A 3MFJA 1W14U 2BHGA 2ZHDA 5C94A 4F49A 1TGSZ 1O5GH 1QJ1B 1GHZA 4WXVA 1O39A 1HAVA 4HG6A 1QGFA 1C1TA 1SGFA 3BTWE 1DUEA 1TB6H 3ZZ8A 6LPRA 3PV2A 1VCWA 5EIYA 4IC6A 3HKJB 1SGFG 4Y7AA 1TNHA 1LO6A 1BBRE 2A4OA 3AASA 2C4FH 3UR9A 3LH1A 2ZO3H 3PV5A 1GMHF 4ISLA 1FY4A 2A45B 2G55A 5EQQA 3FO8D 2UWLA 2OP9A 1F7ZA 3N7OA 3N7EA 4I8GA 4Y6DA 5CHAC 1FX0B 4R8TB 4CH8B 5E8EH 1AN1E 3RXHA 1CU1A 8KME2 5ESTE 1PPFE 2F9PA 3K9XB 5FAHA 1O2XA 3QZRA 1Z8RA 3MU1A 2PKSB 2ZDLA 1ZR0A 3RXKA 3OEHD 5EW1H 1LHDH 1EXFA 3SU5A 2Z94A 2R3UA 3TH4H 3V3MA 4B1TA 1VGCC 2BDGA 2ZZUH 4IMQA 4JMYA 1TNJA 1IQIA 2G5VA 5KGOA 3L3TA 4X8UH 4X2YA 2J38A 4OGXA 2EEKA 4X6MA 3SZEA 3BIVH 3BEFB 3GCHC 1BMFD 1CT0E 1N6YA 4B6FA 3GICB 2GVFA 4XD7D 3E90B 1SLVB 1YCPM 1YPJH 1SGCA 2TGPZ 3GISB 2HVYB 4F4OC 1HAHH 3M7TA 1S5SA 4ASUD 1S83A 2KR7A 1PPEE 1ELFA 2RG3A 1AZ8A 2WYGA 1MCVA 4DT4A 4YT7H 1PPHE 1D3DB 4LK4A 2W5EA 2WV5A 3LGIA 1S6FA 3PMJA 1H1BA 2ZHQH 6CHAB 2ZFPH 1TYNA 3MO9A 2V3MA 1Q3XA 2RA0A 1DY9A 1DE7H 1O5DH 1G2LA 1N1LA 4B71A 3Q00A 1O33A 1PYTD 1EASA 1TRNA 3MH7A 1GDQA 3ZVAA 4NIWA 2YNAA 2P94A 3FP8E 2ZHFH 1SLXB 2FEQH 2FXRA 4DVAU 1C1WH 1E1QD 2PP6A 1LVBA 4FU9A 3HK3B 1IQJA 3WWBA 4K3JA 5AF9H 3RXRA 4AZ2B 4FVDA 1G3EA 3TH2H 3RUOA 3F2HA 4JZFH 3W1EA 2FTMA 3SNEA 1T8OA 1G9IE 2Z9LA 1T8MA 2XCFA 3KN2A 4X1PU 4E06H 1P06A 1ANBA 2B5TB 3M5OA 2F9OA 1QB1A 4X6NA 1ARBA 3LONA 7GCHG 3PROA 4O97A 1THPB 1AB9C 2Z9GA 1O5FH 2ZQ2A 4BANB 3R0FA 1Y3WA 2ALVA 2CF9H 5B6LA 2C8WB 1ABIH 1LVOA 2BDBA 1K1OA 2JIZD 5HYOA 2V3HH 2VVUA 2WPMS 3KNXA 1EAIA 5GXPA 3A83A 1P2IA 3KYGA 5CE1A 4JYTA 3PO1C 2W6ID 1BQYA 3ZZCA 1AVXA 2OBOA 2BXUH 1YPHE 2CJIA 5C17A 3GY5A 1K22H 2OC0A 2OBQA 3UAIC 2F9BH 3K2UA 2HGTH 4MPWA 1O3GA 3BN9A 3GDSA 2VGCB 5J4SA 3SJ9A 1C1RA 4I8LA 3RXVA 4WXIA 5F03A 2A5IA 2GMTB 2GJGA 4X1SU 1Y5BT 1UCYH 4AG1A 5HIYA 4X8TH 1MTWA 2P59A 4YT6H 1YM0A 1GDUA 2FI5E 2A7JA 2QF5A 2CN0H 1FI8A 1RXPA 3CNRA 3GCHB 1FNIA 3ZZBA 1HAPH 1CBWC 5FHTA 1AZZA 1A3BH 1CGIE 1NZQH 1BRAA 1TAWA 2BLOA 3HK6B 3RXGA 3MQKC 1JXPA 4NGAH 4Y0ZE 1QL8A 7LPRA 2QCYA 1EPTA 2PTNA 1P3CA 4ISOA 5TCCA 1N8OB 4NA8A 4JZ1A 1CVWH 1IQEA 1LHFH 2YMSC 1O3JA 3NWUA 3LOXA 2PKAB 3Q3YA 3D49H 4MLFB 5C5NA 2W6JD 1LQEA 4OS7A 1GI8B 1YPEH 3M3VA 4WMDA 4MPUA 4JZDH 5FBIA 3LU9B 3PYHA 2UUYA 1KDQA 4MNXA 4XBDA 3S9AA 1SGDE 4I31A 1O2GH 2VINA 3T62A 1V2ST 1DXWA 2BTCE 3IWMA 1TIOA 1ZSKA 4O9VA 1N8OC 2KX4A 1DVAH 1COWD 1HNEE 2OC7A 1A0JA 1CGHA 3E3TA 5FCKA 1XUFA 2QN5T 3LGYA 3SNAA 1GI2A 2P8OB 5E2PA 1AHTH 4K1TA 1H9HE 1G3BA 3MWIU 3A7ZA 1DS2E 1KYNA 2FOFA 5LH8A 5KECA 2AMPA 3P6ZB 3OSYA 5DP5A 1ZOMA 2XW9A 1Y8TA 1AO5A 1SMFE 3BTFE 3UQOA 1HDTH 2ZCHP 2FESH 1Z71A 1UVOA 1KTTB 1CT2E 4Y79A 2OD3B 4Q4LA 1EJNA 1OX1A 4PROA 3U28C 5FCRA 5A8XA 2R0KA 2VBCA 2EI7A 2H9EH 7GCHF 4JK5A 5LPRA 1A0HB 3A7YA 2XOKD 1GBTA 1FIWA 1DDJA 1O35A 3NK8A 4NZQA 3ATKA 4TT3D 3RXFA 2FS9A 1ZTLA 2PGQB 4CHAC 2HNTF 2AHME 4NWLA 1ZHRA 1GBLA 2AIQA 4FVBA 2PGBB 1AKSB 3AAVA
chains in the Genus database with same CATH topology
4H42U 4Y7BA 3S7KB 1TRMA 4OS5A 1DICA 5T3HA 1FN6A 1WCZA 1NROH 3LPRA 3AW1A 4X2WA 4CRGA 5L30H 2UWOA 4YESB 2BLVA 5BPEA 2JKHA 1FN8A 1GGDC 1NPMA 3GY2A 3DT0H 1LPZB 3SI3H 2XYAA 1O3HA 3SU4A 1S85A 1J15A 1RGQA 1QA0A 3TH3H 1K2I1 4K60A 1HJ8A 3U8OH 3ZZ6A 1PPBH 3QLPH 2DE9A 3P70B 1HJAC 1WTGH 2P95A 3FAOA 1O2WA 2D8WA 3U8TH 1NTPA 2ZFSA 4UDWH 2ZU1A 1L2EA 1BTUA 3W94A 4JK6A 1C1QA 3VFEA 1GHYH 4WVPE 8GCHF 1YYY1 1HBTH 3MNXA 3QN7A 5JB8S 1EZXC 4NIYA 1PFXC 3MNSA 5I25A 3AW0A 1RIWB 3ZZ9A 1CGJE 1VCPA 5JBTA 3RXEA 4MQAA 2ZI2H 3A81A 1P10A 2O8MA 1H4WA 1LPKB 3RMOH 5DG6A 2FOHA 1H8DH 2BDYA 4AFSA 2ZFRH 3RLWH 2C8ZB 3TITA 1SOTA 5K0HA 2HNTC 1QRWA 1Y3YA 4ASHA 1ELDE 2G81E 2OTVA 3E0NB 1TNIA 1L1NA 4IN2A 1O2KA 3B8JA 2PSXA 2A5AA 3HGNA 2ZGHA 2ULLA 2YNBA 3ZYEA 4UEHH 3DD2H 2R2WU 3A7WA 1BITA 1O2YA 3PV4A 1C5MD 3UNSA 1SFIA 1GHAG 2AFQB 1W13U 5EXMA 1ZRKA 2BD5A 4WMFA 1L1JA 1S0RA 2BD9A 1GVKB 1O38A 4AB8A 1RJXB 3VB3A 3ZVFA 2HPQH 1C5YB 3RU4T 1P57B 1PPGE 1O3AA 2ZCLP 2ZHEH 3RC4A 4TPYA 4ABEA 4IGDA 1F2SE 1Y5UT 3A86A 2A5KA 4FUJA 3QGNB 1C9TA 1C5OH 5LGOA 4AB9A 2ODQA 2D1JA 1DPOA 1C1UH 1EAXA 1TOMH 1GCTB 1WAYB 5DGJA 4NSYA 1HCGA 1NFXA 3K65B 1TGNA 1QNJA 2FO9A 1MKXH 1E0FD 2B7DH 2H1UA 2R9PA 2TPIZ 3M3SA 4XFQA 3SGQE 4KTCA 3EA9A 2PW8H 1FUJA 1FJSA 4FUFA 1DY8A 1UTNA 1K1PA 1QIXB 2VWMA 2THFB 1QBNA 3KQBA 3LT3A 1GL0E 5T6FA 4WJG2 5HM9A 4IW4E 3SUDA 1KLJH 1O2PA 2VVVA 3LJOA 4LZ1H 1M9UA 1GJBB 4H6TA 4U30A 1O34A 2OLGA 1GI9B 2O9QA 1NN6A 2ZDNA 1LPGB 2BM2A 3A82A 5ABWA 2A1DB 2PUQH 3GYLB 4AFUA 3VB5A 1ARCA 1W8BH 2EA3A 3MTYA 5LPFA 1HRTH 3A7TA 3VEQB 5A2MH 1AKSA 3SJKA 3T2NA 4CBNA 1BDAA 1G3DA 1UTJA 1FAXA 1O2ZA 1SFQB 1W7XH 4FUIA 3S69A 1FMGA 4GCHG 1IQHA 1UK4A 1LCYA 1Y59T 2QV1A 1GVLA 4ZROA 1RTLA 4DY7B 1GPZA 1AVGH 1ZGVA 3BEIB 3RP2A 3QX5H 3UPEA 1CBWB 1TE0A 2EI8A 4BAKB 2Y7XA 4YM9A 2B0FA 1J9CH 1TQ0B 1TALA 4Q80A 1A2CH 2HPPH 1SGRE 1C4V2 1CO7E 1T8NA 4AN7A 5JBAS 2ZDKA 1QURH 2XTTB 1GBHA 1TX7A 2ZDVH 2HOBA 1VGCB 6GCHF 1IQFA 3SUFA 5F8XA 8LPRA 1YCPK 4X1RU 2FOGA 4I8HA 1NRSH 1JMOH 1KXFA 2CMYA 1BRUP 5G4BA 1QY6A 1C5SA 4Y71A 1TMTH 1F0TA 1QHRB 3NZIA 1F5KU 1MUEB 3IG6B 5FBEA 3KGPA 1CA0C 4TPIZ 4FUCA 3SQEE 2VVCA 1OWDA 5GCHG 2H6MA 1G3CA 2WPKS 4FUDA 3S7HB 3QO6A 3A84A 3ZVDA 1GCDA 4X1NU 3G01A 1SGEE 2FMJA 4A5TS 2Z9JA 2G4TA 1SQOA 1EOJA 2A32A 3NKKA 2Y82A 4UE7H 4GLYA 1FV9A 4Y8XA 2BQ6B 1TNGA 3QUMP 3RXJA 3RXAA 4INKA 2JETB 3Q77A 2GX4A 4ZHLU 4D76A 3R3GB 1TBRH 2OXSA 3SGBE 3NXPA 1CE5A 2PKSC 2ANKH 5HGGA 1LKBA 4NFFA 1A1RA 4K1SA 1C2DA 6ESTA 1QJ7B 1KDQB 2A4QA 3MH4A 5F6MA 3UQVA 1FPHH 1SC8U 1GI1A 3WY8A 1GHAF 1RFNA 4GHQA 1C1OA 1EPTB 2OQUA 1P01A 1HJAB 2ZDMA 4K1EA 2XNIA 1EZSC 1CHOG 2VWNA 2BMGB 2O8TA 1NT1A 3TU7H 1N6XA 1ZJDA 1DSUA 2AH4X 2NU0E 4Y10E 1XKAC 2SGFE 3ZZAA 1OP8A 3ZVEA 1EJMA 3KCGH 5FPSA 1HLTH 1VR1H 4KKDA 1INCA 4NCYA 5C1UA 1A3EH 2H9TH 1O5BB 2AGEX 2GV6A 2GZ8A 1ZJKA 1GJCB 4NWKA 3GDVA 1O3LA 1GJAB 2WINI 3BTQE 3SV8A 4NIXA 8ESTE 3E16B 3E91A 7ESTE 1HB0B 4OS2A 3SORA 5GJ4B 3DUXH 2BQ7B 1V2RT 3FZDA 4D7GA 1KLIH 1ZHMA 1DXPA 1GBIA 3A8CA 1OP2A 3A80A 3RC6A 2TGAA 1MTVA 1B5GH 1SOZA 5EGMA 1XXDA 3GCOA 2VH6A 1RTFB 3UIRA 2BYAX 5EQSA 3M7QA 4KELA 2P16A 3RXQA 2VGCC 2ILNA 3TK9A 1GMCG 1B0EA 5JDUB 5DP6A 2Q6DA 2QIQA 2AIPA 1Z8GA 1BBRH 3I29A 4Q7ZA 1MZAA 4Y11E 1P3EA 1EAWA 1V2WT 4MPVA 1JIRA 4OS1A 2FPZA 1AE8H 4B74A 3URDA 1SGTA 2ANYA 5C20A 4WF8A 1BTYA 2G00A 3SBKA 2FLRH 4FUBA 1E35B 4ABIA 3L33A 5EG4A 4B2BA 1SL3A 1EZQA 4XBCA 4BAMB 3EDXB 4K8BA 4Q7XA 1FY8E 5C5OA 2H2ZA 3E0PB 2GCTC 3K6YA 3LDXH 1GBKA 1GJ5H 4B73A 2FOEA 4E7NA 2OUAA 2W26A 2ZU5A 2CV3A 2TBSA 3SU6A 1Z7KA 4XSKU 3FFGA 3M3TA 2VIQA 3SOSA 1YLCA 4TYDA 1ELGA 3PO1B 1KXDA 1T31A 4NSVA 1TX6A 2IJOB 2QY0B 1FXYA 1JBUH 1EQ9A 2ZCKP 1P2KA 1T4VH 1LHGH 4CHAB 4U01A 2HWLB 2Y5FA 1ZSLA 4GCHF 2G8TA 3P17H 1OWJA 3I78A 6CHAC 1XUIA 3EQ0H 1SHYA 4JZEH 1TMUH 5JBCS 3S9BA 2A4RA 3JZ2B 4HFPB 2HLCA 1V2PT 5GPIB 4Y0YE 1A5GH 1WQVH 3PB1E 3VB6A 2IPHA 3BTEE 2R2MB 2ZPQA 1O3OA 1BTWA 2QXIA 1UMAH 3M7UA 1C1VH 2UWPA 1UVUH 3ZV9A 1QQ4A 2ODYB 5HMAA 2FYRA 4E05H 3JZ1B 4X1QU 3RM2H 3F68H 4D9RA 1C2JA 1NFUA 2BB4A 2Z3CA 4ZMAH 1AVWA 1DWBH 3V13A 1H9IE 4ZKRU 3RXSA 1F5LA 4A1VA 2ZP0H 1NM6A 3SU2A 1BIOA 4OS6A 4ESTE 4DT7B 3M35A 4CRFA 2CGAA 3T5FH 1TGBA 4MPXA 2I6QA 2SGDE 3D62A 2DE8A 5DP3A 1O3BA 5F8ZA 1P2QA 3MU4A 3HPTB 1GG6B 1ANCA 1UTMA 1IQMA 2D2DA 4IN1A 1ZMNA 3MH5A 3MO3A 4FU8A 4ABGA 4BTIB 1UCYK 1EKBB 3U98H 1ORFA 1AQ7A 4UFFH 5AFZH 4X6PA 3ZVGA 4O03A 4MNVA 3LIWA 2BDCA 1V2OT 4FXGH 3Q3KA 2VNTA 2J95A 4VGCC 2GT7A 1V3XA 1P9UA 2Q6FA 1Y3XA 4CRBA 1C2HA 1CSOE 4D7FA 2TIOA 1D3TB 4DCDA 5IDKA 1HGTH 2V0BA 4DW2U 4FUGA 4GSOA 3UY9A 4Z6AH 3PMBB 1MTNC 1NRNH 2GTBA 1BJUA 4SGAE 3ELAH 1WV7H 2HRVA 1VJAU 4INHA 1XM1A 1C1NA 4OS4A 2D26C 2Y81A 1KXCA 1UTQA 2QF3A 1ZYOA 5AFYH 5L2ZH 1ZSJA 2BVSH 2JH6D 2GGVB 4I8KA 4NA9H 1O5CB 3CP7A 4ISIH 2J9NA 1BTHH 3L6PA 2QXGA 1O5AB 3ATIA 5I46H 2BD4A 1GI0A 4TY7A 1SG8B 3FP6E 4GAWA 2PWXA 3RXUA 1TA2A 2WPHS 9LPRA 1YPLH 5DPAA 1TBZH 5EW2H 3SNBA 1P0SH 1SB1H 4MTBA 2FIRH 1S0QA 2VWLA 4CR5A 1ELTA 2Q6GA 4DIHH 3SV9A 3BG4B 1BRCE 4CR9A 3ESTA 3D65E 4K2YA 3SQHE 2ZNKH 2XRCA 3H5CB 1ESAA 1SVPA 2BX4A 1W0ZU 4AFQA 1AUJA 1VITF 1ESTA 1GHBF 1OKXA 3I77A 4RKJB 2ZKSA 5EQRA 2AMDA 3TNTA 1HIAB 1FY3A 1HAVB 5E2OA 4B2AA 2ZU2A 1GJ7B 4A6LA 2FTLE 1ELCA 5L2YH 4ZHMU 2VIPA 2P8OC 2QAAA 1HAIH 1ACBE 4ABFA 4GHTA 1HFDA 2FWWA 1K1LA 1TNKA 1ZLRA 1SSXA 4K5ZA 1NS3A 2M5TA 1Q31A 3BEUA 5AVDA 4DG4A 1RIWC 1F0UA 1ZMLA 1IOEA 3TPIZ 1Z8IB 4YOGA 1BBRK 4IC5A 1TNLA 8GCHG 2PV9B 3ENSB 1WSSH 1XUGA 3RXDA 1V6DA 1LMWB 2GCTB 1C5ZB 1O31A 1C4Y2 1UTKA 1MTUA 4UONA 3GY6A 1GBCA 3NPSA 5ETXA 1HUTH 1T32A 5C2ZA 5DP9A 3ZZ5A 1T7CA 4AGKA 5H4IB 1DOJA 2ZGXH 3S0NA 1T8LA 2O8UA 2G5NA 5CMXH 1YPGH 1DT2A 3P8GA 2FDAA 2OCVB 3LGVA 1UVSH 4BAOB 2FS8A 1J14A 1XUHA 3QZQA 3OY5U 1C5RA 1GJ9B 1C1PA 2WYJA 2NWNA 3RDZA 2VWOA 4A92A 3ATLA 6GCHG 1GI5A 3TGKE 3QTVH 4D9QA 2HALA 3MHWU 4U2WA 2GKVE 3LC3A 3E1XB 1MKWH 2W3IA 5A8YA 2ANWA 1XXFA 2ZF0H 1QTFA 1JIMA 4I33A 1YCPH 3MNBA 4D8NA 1GGDB 2ZECA 1SGQE 2VIVA 2G52A 3MI4A 2ZPSA 1D6RA 4Y8YA 2ZQ1A 2O8WA 1A7SA 3M5NA 3NUMA 1FDPA 3UUZA 2Y5HA 1W0YH 4XOJA 1O2OA 2KAIA 5DO4H 1C2LA 1OYTH 1TBQH 5A0BA 3P95A 1BA8B 4LZ4B 1C1SA 2VH0A 2ZWLH 1O36A 1YKTA 3M37A 4GVUA 1A61H 2A7CA 5DP7A 4AORA 1O3DA 1KIGH 1FPCH 2BVRH 2GCHG 4BTTB 1HAGE 3LJJA 2GT8A 3BV9B 7KMEH 1V2JT 5C67A 3RU4D 1HYLA 1MQ5A 2AYWA 2PR3A 1W7GH 3MYWA 3O8RA 4LXBH 2B9LA 4X6OA 1D4PB 2V35A 4OGYA 1ZGIA 3A8AA 4B76A 2FOMB 2BY8X 2F3CE 1F0SA 2AGGX 2JH5D 3O8BA 1QRZA 1VITG 1OXGA 1DLEA 1ANEA 4THNH 1MTSA 1LDTT 1CA8B 4BTUB 2F83A 2BLQA 1TPOA 4WWYA 3S9CA 4X2VA 5JB9S 2BY5X 1IQGA 4WH8A 1QCPA 4UD9H 1G36A 2QGRA 3M5MA 3P8FA 1ELBA 3TJOA 1V2QT 1TLDA 1UK2A 4AGJA 1P04A 4XBBA 3ODDA 1UCYE 3KL6A 5AHGH 5EPYA 3RXLA 2BQWB 4BXWA 2PKAA 1UHBA 2HNTE 4INLA 2FX4A 1BMMH 1QBVH 2XBWA 1FQ3A 5GWZA 1PJPA 3OY6U 5FPYA 2ODPA 4I8JA 1V2NT 2STBE 1UHBB 5C1YA 3PLPA 1ZHPA 1QL7A 2ZGJA 1MH0A 2V3OH 3A8BA 1LVMA 3TJUA 3OTJE 1UO6A 2FI3E 4UFGH 9ESTA 1BT7A 2FLBH 4NG9H 4ABHA 1JRSA 1ID5H 5BRRE 1J16A 1HXEH 3CS0A 3SV7A 1OP0A 1SGPE 1UVPA 3BTHE 3RXCA 4J1YA 2XWBI 3SU3A 3ZZ3A 1O3PB 3EA8A 1NFWA 2VU8E 1W11U 2QA9E 3LKWA 4ZHAA 3SNDA 1EOLA 1JOUB 1WQSA 2P3FH 3MO6A 1ZMJA 1KXBA 2H5DA 5DJ7A 1ZTJA 4IMZA 1RRKA 4NA7A 2FODA 2ZPRA 1C5UA 3LGWA 1ELEE 1ABJH 1MAXA 1ZTKA 3DHKH 3KHVA 3MU0A 3PTBA 4RKOB 2BVXH 3SO3A 1UTOA 2J92A 3KQCA 1LTOA 1SQTA 2FOBA 2CHAC 3PTNA 3C27B 3HGPA 3ZV8A 1OS8A 2CXVA 3SJ8A 4JYVH 1TGTA 2P3UB 1WYKA 1YP9A 2C3SA 3MNCA 2XBVA 3UOUA 3PLBA 3EA7A 4ISNA 1W12U 1ZZZA 4O3TA 3U8RH 5ESBA 3PMAB 1YBWA 2Z3DA 2AEIH 1GBEA 2FZZA 3KEEA 1EP5A 3ZYDA 1BTPA 2TRMA 4YOIA 2SNWA 2JH0D 1QR3E 1OWHA 2A31A 4I7YH 2ZTYA 1YLDA 3IITA 3GCNA 3FANA 3SHCH 2C8YB 3LH3A 1SPJA 4Q2KA 3UTUH 1BB0B 1DX5M 1SGYE 4ZXXH 2DUCA 3BTTE 1QJ6B 1OWEA 1O5EH 1V2VT 4ISHH 2GZ9A 3UNQA 4O3UA 1A0LA 2STAE 2G51A 4DOQA 1O2QA 1THSH 2O8LA 5TJXA 1YF4A 2FM2A 2YOLA 4LOYH 1MQ6A 2ZU3A 2NU3E 1XUJA 5FPTA 5A0CA 1VITH 2OINA 1P9SA 3MMGA 4YLQH 2NU2E 2WPLS 4ZUHA 1MU6B 1AWFH 1GBMA 4TY6A 3SJOA 1FIZA 2FOAA 2ZHWH 1MKWK