1ESDA

The molecular mechanism of enantiorecognition by esterases
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
302
Chain Sequence
DPVPTVFFGDSYTANFGIAPVTNQDSERGWCFQAKENYPAVATRSLADKGITLDVQADVSCGGALIHHFWEKQELPFGAGELPPQQDALKQDTQLTVGSLGGNTLGFNRILKQCSDELRKPSLLPGDPVDGDEPAAKCGEFFGTGDGKQWLDDQFERVGAELEELLDRIGYFAPDAKRVLVGYPRLVPEDTTKCLTAAPGQTQLPFADIPQDALPVLDQIQKRLNDAMKKAAADGGADFVDLYAGTGANTACDGADRGIGGLLEDSQLELLGTKIPWYAHPNDKGRDIQAKQVADKIEEILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title A novel variant of the catalytic triad in the Streptomyces scabies esterase.
pubmed doi rcsb
molecule tags Hydrolase (serine esterase)
total genus 102
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 1994-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1esdA00
3DC7A 1VYHA 2Q0SA 4Q7QA 2HSJA 4M8KA 4K40A 1ESDA 4S1PA 3P94A 4OAOA 1ESEA 4JJ6A 4H08A 2WAAA 4HYQA 4JHLA 4Q9AA 3U37A 2APJA 3W7VA 5CD9A 1YZFA 3DT8A 1BWPA 1ZMBA 1U8UA 1ES9A 4TX1A 4PPYA 3DCIA 4IYJA 3C1UA 1ESCA 3HP4A 1Z8HA 4I8IA 5HOEA 4DEVA 3RJTA 4JJ4A 3PT5A 1FXWA 2WAOA 3DT9A 2Q0QA 2W9XA 1K7CA 4JKOA 2VPTA 1BWRA 1JRLA 3SLRA 3SKVA 4K9SA 5A4AA 4K3UA 4XVHA 1J00A 1V2GA 1VJGA 4NRDA 4OAPA 1IVNA 5BN1A 3BZWA 4RSHA 1DEXA 3DT6A 1DEOA 3MILA 4JGGA 1WABA 2WABA 5B5SA 4K7JA 4RW0A 2O14A 3KVNA 1PP4A 4HF7A 1FXWF 4LHSA 1BWQA 5JD3A
chains in the Genus database with same CATH superfamily
4OHXA 3FZGA 1P60A 3QU9A 2MJLA 5IBCA 2PJZA 1L3CA 1VSBA 4RHUA 1LDGA 4MUNA 4HAVA 1FDVA 1GFSA 5FQOA 4BEWA 1WVGA 3IVCA 3K1AB 3TKAA 3BFKA 1MTOA 4I46A 3BX1A 1F8FA 3A2NA 3EZXA 3HXTA 2WJAA 3NRCA 4R71A 3BUSA 4FJ2A 3S68A 2Q7XA 1XTTA 5DSTA 1I4TD 4UVIA 3RVKA 1I4DD 2XIQA 5CLIA 3CLUC 3DAYA 1ZNZA 2ZJZA 4GQBA 4N01A 3TLCA 4BRSA 2DAPA 4C06A 4HG2A 1V9CA 4ARCA 1YI8A 1Z34A 3L1VA 3R40A 4BEVA 5FOQA 5HHTA 5KWSA 2YHIA 2ASEA 4XLLA 2ZSBA 1YCHA 2CD7A 2WJWA 3KXIA 1NPDA 3ITNA 5BSVA 1ORHA 1FSGA 2Z43A 4LWPA 1OGJA 3H5TA 2PZLA 4PU0A 4BKOA 4LV6A 3TKYA 4R8LA 2GYUA 3AEQA 1IHDA 3MUFA 4XUGB 4Q34A 4FR2A 4IKOA 2IPLA 1JXAA 4YT2A 1ZG3A 2AMFA 2NU8B 1KH1A 2HLPA 4D9JA 2H8GA 4PPFA 1UJNA 2BM1A 4JFAA 2OV8A 2XBUA 3AI2A 4INOA 4M6WB 1WMFA 4PWYA 1CY4A 3VTKA 2ZBVA 1XA0A 3IAM1 4RZXA 3ULKA 1RZRD 3B53X 4GX5A 4PZDA 1AQIA 2WAOA 1M7HA 3GUUA 5I3CA 2FP4B 4XWAA 3WL6A 3UMBA 4MKIA 5JXIA 1XMOB 4AP5A 3VISA 1XTBA 3VR4A 4B3FX 4HVCA 4BMSA 5BWNA 3SLKA 1SVUA 1ZSVA 2FMKA 2I6TA 4F72A 1K7CA 1UMKA 4DIMA 2AOUB 4QUJA 3DLIA 3JQ7A 4GX1A 4PTYA 4CG0A 1E3EA 1XKTA 2YY7A 2VDLB 1OT3A 2O05A 1ZIOA 1JSCA 2VYVD 1MRSA 2ZU6A 4F5DA 2NTVA 4LK3A 5I5GA 4X5OA 1YK1A 5FJJA 2QTVA 4P53A 2J46A 4ARVA 1WY7A 4AY5A 4RMNA 1BCRB 2G63A 3PKZA 1IVNA 5IT4A 1SGWA 3ZXYA 1SULA 5BP7A 1Z83A 1Q74A 1Q7CA 4QBFA 3FSEA 5JS2A 1D09A 1ZUHA 3AERB 2ZT8A 1ODJA 1KQ3A 3H1GA 1PEAA 3KT0A 3B6IA 1FYEA 1XCGB 1S7GA 1WXXA 2D5LA 3MLBA 3RD5A 1CNEA 2H57A 3G1TA 4QOEA 4G41A 3UGQA 3UOWA 5CK4A 2NO5A 1J0CA 2GJ4A 2PPVA 3EIUA 3KIPA 1XQVA 4RH0A 1C7QA 4EY3A 4N3AA 3KD2A 1UADA 2C84A 4JQSA 1QGAA 3T3PB 5G0TA 4DIUA 1TT5B 4DKXA 4CM9D 4MR7B 2FUNB 3W9YA 2AXPA 3LVQE 4WVFA 5FA6A 5AQ1A 2BM0A 5AI9A 5LP6C 3W05A 1P19A 4IGFA 3MAGA 1E1YA 4FEYA 3FNFA 3NHAA 4X6LA 4E5VA 1OGYA 4UBMA 2C9ZA 2GYVA 3CLSC 4MWSA 4NG5A 3QV1A 1N8NA 4RX1A 4HEJA 2CVFA 1BWQA 2FSFA 3CMMA 3G7SA 4D26A 4YV7A 3EASA 1M6WA 2PVSA 4LJ7A 4D2IA 5L3SB 1BMTA 2OBFA 2OCLA 4HDMA 4Q9NA 1R8QA 4HNVA 4UOZA 3OE1A 1FMCA 2VRCD 4RVFA 1P0PA 3FYSA 4WCFB 2PX8A 3HDJA 3O21A 1GNTA 3E9RA 5D00A 2XZOA 1GYQA 4DY4A 2CEKA 2P5UA 3LC0A 4ALJA 3IE1A 3WLMA 4BVAA 5SZKB 1CEXA 4L5BA 1KWGA 3LDGA 3ENWA 5LMNB 3DLTA 5DX0A 3FYUB 4GRAA 4EYKA 2R44A 1JAZA 4KO1S 5HKAA 4C2UA 3HFSA 3PU6A 3ILHA 4JLJA 4MQ5A 2FTKE 2OXIA 4CMKA 5J63A 1RI5A 2IHTA 3PEYA 1E1NA 4F3YA 1KY2A 4MITA 3MMPA 1OASA 1OZFA 1G9SA 2VUTA 3KQWA 1LDMA 3GZ4A 1WPQA 3HA5A 3G2NA 1LXCA 2ZT6A 2OBYA 4KAFA 4YWHA 3WYCA 4OFXA 4IXDA 2BD0A 3O2SB 5B3JA 2GK7A 3WLRA 4XARA 5HPYB 4F1JA 1GARA 4RIGA 1RYBA 1R0KA 1ZI9A 2PUWA 4KE7A 1ZK3A 3BD6A 3CZAA 3OJFA 2HJGA 3RV4A 3W5UA 5BQ3A 1O6FA 3GP8A 3FTNA 1P7YA 1PHPA 2OG1A 4Z4FA 1ZNWA 4Z3OA 1Z36A 1E2HA 2CN1A 3KOMA 1LRKA 2VOJA 3C16C 5JH7A 4KRYA 1YAJA 1DLIA 2WJPA 4ZOLB 2AMVA 2CXXA 2LIPA 1ADGA 2AV6A 3BDVA 1AF4A 3C3EA 2SECE 4R3UC 4D9GA 4OLJA 2VSNA 16PKA 1G21E 2C4KA 4ABTA 2NYAA 2WRZA 1YDEA 4EVIA 3O83A 1SQFA 3CPSA 2LPMA 3GAZA 3QWAA 1CZOA 2XVXA 4JJIA 1NZJA 1PIWA 1FFEA 3U9TA 1I8TA 2WMNB 1J23A 2ZJOA 1H1LB 1SELA 4C6TB 3F8WA 3LWDA 1E0KA 3FSGD 1J8FA 3H2YA 3UWKA 1ZI6A 1Y33E 1VECA 1OJ7A 2P9GA 3ETHA 4UU7A 4IJWA 3IHLA 3OOHA 2BW0A 4U7HA 4O4HA 3WLSA 1XRSB 2OESA 3OIWA 4MQ4A 3B1YA 2WWTA 2QL5A 2YV2A 3BXGA 5AFSA 3DV9A 3T34A 4R1QA 5AWFC 5B3AA 3HYCA 1V26A 3A3OA 3H3FA 4PYNA 5TMPA 4QOHA 5EZQA 1GRCA 4JV5B 3O1LA 4LJ8A 3WIOA 5F7XA 1V25A 2WNIA 1CS0A 1G9XA 4P34A 4NCNA 4PLZA 2IOFA 2Q2OA 1AXEA 7AT1A 1JLSA 3CWZA 1DU4A 1XDUA 3FR7A 4IMIB 2QAGB 1X19A 2HA4A 3CM0A 4FE4A 2FR8C 4JL8A 5DKFA 4CV2A 5KQRA 4G0VA 4MKFA 1LBTA 5EHIA 2DQ4A 3BMNB 3QYPA 5FLKA 4DQ0A 1USWA 4MUHA 2REXB 3W2HA 5A5EA 3B1ZA 1IZ8A 3TW8B 3SZOA 3JRXA 3V97A 1ONNA 1CZKA 3FM9A 1AZSC 5CDUA 3NRBA 5FEMA 4LF6B 2O0JA 3F67A 1GV0A 1MF7A 2M6RA 2YWBA 3LNCA 2XQKA 3TD6A 2O8BA 4L3VA 4UARA 3V4RA 3AW8A 3GJ8A 2CF5A 1JE1A 4O4LF 3RB8A 4ETMA 2BY4A 5CD1A 4Q4AB 3C5EA 1DL5A 4Z8XA 4EG5A 3T3OA 3Q3CA 4EA8A 3DWIA 1MX3A 3NC1C 4GNKA 3SQNA 4ZIRB 3KLMX 2ODWA 1H3NA 2H1HA 1SBHA 1C81A 4X8LA 5E1OA 3OHMA 1AKQA 1C4WA 3RIGA 2QRVB 4B3RB 5AP9A 4ZU6X 5FR2A 2ZR0A 4ZYVA 2JPDA 3S44A 1D6SA 1T3SA 5DSXA 5TS3A 1FMLA 4UBLA 4ZWNA 3FHCB 3JAWA 1DO2A 3H1BA 3TQSA 2MOKA 4TTIA 1H8HA 1I1HA 3IIIA 4BKPA 4OHPA 1MJHA 2PUDA 1RCUA 1KAGA 3A2KA 1PJBA 1COZA 4OHKA 2BHSA 4RGVA 4D1YA 1TOAA 3JWGA 2IZOA 5FX2A 3QLEA 2AI1A 4WOJA 4KMSA 4ZVLA 3FTDA 3PQ3A 4J91A 1W5TA 1W5SA 2ECKA 3JTMA 3L0BA 4NBWA 2COEA 2RG7A 3O3OB 2ZEJA 3KXKA 3KQLA 1XZEA 4KPUB 3CIOA 1MC5A 4YCLA 2CHGA 2O0HA 2ZRFA 3ROXA 2Q3MA 3N7TA 3LPAA 4G5FA 2AQ8A 1EP3B 2CUZA 4I8IA 4ESEA 4FGJA 5FPPA 3N7UA 4CTMA 4OLAA 3FB1A 3O91A 5FD8A 4RWEA 4X8OA 2QM0A 3HEBA 5DM0A 5HK8A 1IB0A 3OM8A 4GMDA 4CTOA 1U7TA 1VHWA 4JNKA 4EY8A 2G9VA 3TW4A 3E3LA 2NU9B 3IBYA 3GELA 3R76A 2XRFA 4NZOA 4YJ2B 2V7PA 2NW6A 1CZRA 1Z08A 1GD1O 2RB4A 3PENA 4MUGA 3NX4A 3U3KA 5JISA 2RIPA 3L7AA 2J3QA 3I09A 4G1MB 4MROA 1H5QA 1W4ZA 4GL4A 4ZQCB 4DLVA 5JAMA 1FP1D 2H4YA 2JFGA 4B09A 1F1JA 1WBDA 2QUIA 3I2IA 3T1NA 1BWRA 3WRYC 4FB5A 1Z6GA 4KQFA 3R3JA 3TRHA 2Y0EA 4US0R 5COBA 2IHUA 3HBAA 3K09A 4RH3A 1QCZA 5EWMB 4AJIA 1N34B 2AFHB 1E6CA 2JEOA 2WJZB 1A7KA 4II2A 4AXXA 1AZLA 4O5OA 4YQYA 4H0NA 5BOSB 4WCDA 4YCBA 5JJBA 1H4QA 1ZWLA 3L9XA 3OTIA 5KYVA 3QE0A 5G4KA 4RE5A 4BRUA 4IVNA 5BWBA 5HA5A 3I9V1 5IFLA 1W6RA 1KI3A 3BZWA 1O95C 1LPMA 1UXGA 3PHJA 1PG5A 1IAVA 3SI7A 4DLBA 5AKLA 1XF1A 4L8YA 4O5AA 4R01A 3U3ZA 2BPOA 1MVOA 3VR3D 5IKPA 5U9CA 5CHYA 1CRLA 4J0CA 3G2LA 4MYRA 4YONB 2V7QA 5TVKA 4BUCA 2HMVA 1MZPA 3KLPX 5HKLA 3JV7A 4UTVA 4DM3A 3A1DA 5DWVA 3KWJA 4ZK6A 1OA1A 2LP4Y 3NWJA 2DM6A 2LIVA 5C34B 4D8VA 4YP6A 3DMYA 1T6ZA 5ENDA 1GG2A 1XEWY 3G68A 1SWWA 1HDZA 2XMDA 5DXJA 1SBTA 3TZBA 4IS2A 4CR7A 4ZZ3A 3B8HA 1BE8A 1NIPA 5KOHA 3F2IA 1ZVJA 1VL0A 2XYRA 1WV1A 3M1YA 2QE7A 2PKRA 5LYJA 3RU7A 2J0SA 1P80A 3H17A 2IIBA 2Q6OA 2QAJA 3QYAA 4RETA 4BNHA 3ISVA 1EBBA 2F64A 4FFOA 3H6GA 5TNXA 4OP2A 3ETLA 3FCEA 1U6JA 2OYSA 5AHRA 5DPMA 4DV1B 3DAGA 3ZJTA 3QMPA 4DL9A 1PNRA 1ZBQA 3TZHA 3KYCA 4AKTA 3NXKA 1VLZA 1Z35A 2P41A 3UEOA 4HNQA 2I2FA 1NG9A 1N0WA 4A8JB 1IEWA 1T34A 2V7GA 4IR7A 1XDDA 2QNIA 4TQ9A 3I6BA 1I0LA 3LVBA 3FWPA 4Q9JA 1NKVA 3TINA 3EW7A 3CVVA 2CMDA 4KL8S 1HWYA 3RC2A 2C77A 2P3QA 1ZITA 4HS9A 4BQRA 4ZI3A 2H1WA 4URHA 3USES 1KR2A 1WRBA 2B2CA 3AJRA 5FYQA 1F2DA 2EW8A 2P65A 3HDHA 1G98A 3KJIA 3O03A 1NBMA 1AUVA 4I9FA 4C0KA 4PVCA 4BFCA 3HO6A 4ND1A 3WSTA 4BMVA 1WPRA 2YVUA 3P96A 4YYZA 5B1IA 1P7CA 1ZD2P 1MP0A 3FRJA 1HTBA 1GTRA 2WJHA 1O96B 2OLKA 3C41J 1J2EA 1EFVA 2FWBA 2OGSA 2P2SA 2QPOA 2Y8EA 3FSJX 5DGCA 3CZ5A 4E2XA 3GIDA 4N9WA 3ZGVA 2JIRA 2EEZA 2AKYA 4WGGA 4J49A 1Y6QA 4NV1A 1GDHA 4JL6A 3RRBA 5CDTA 2EG9A 1QC5A 1XB2A 2BFOA 1N3BA 2BFFB 3FPEA 1BQ3A 1EWYA 3E9DA 2QQEA 1GU7A 1WCV1 3RC9A 1EH5A 4P7JA 1ECCA 4KUEA 4PSUA 4QRIA 1DELA 2B37A 3O94A 1J99A 2IXDA 4P7BA 4YI5A 1W1IA 3T7AA 2OP1A 1FFHA 1Z2DA 3PQFA 4FFVA 1WCIA 2C5GA 3OE5A 4G8CA 1JDBC 1RYEA 5LLDA 4MLDA 2PZFA 3G0DA 1SM4A 3PWTA 4X1OA 1KQFA 5FT9A 4IEEA 2W9XA 2H0AA 3M6UA 4KRGA 5K8CA 4E3WA 2M6SA 2I8AA 3AEYA 1HX7A 5I7VA 5EYPB 4Q9IA 3AUUA 2B78A 2PBLA 4G0XA 3X1KA 4DBZA 4ZI7F 2OZPA 4KLZA 2FRXA 4ZVRA 2QLFA 5IF9A 3SSNA 2JFHA 1IXYA 2OE2A 3EA4A 3MIZA 1N3LA 2BKLA 3I0ZA 2X9LA 1T9KA 3IKTA 4U0JA 4BGVA 4IGIA 3M6XA 1RQ2A 1HQKA 1M66A 4N65A 3ICWA 3WYDA 1TC2A 2BFPA 2XTNA 4MR8B 3FFBA 2X8BA 1GTJ1 5J1TB 1Z37A 3C3AA 2CDAA 5FPYA 5KNDH 1DEOA 1MKYA 1Z2AA 5DTJA 2I3AA 1QVAA 3SM9A 3T6KA 5BWLA 1YB2A 3RBAA 4UBKA 4MUBA 2C2YA 3NT2A 3T15A 4EMBA 3W77A 1SD2A 4MVJE 3ZJVA 1X1BA 3NONA 2PS9A 5DCUA 3F74A 3IDSA 2XJ9A 3RSHA 3ZI0A 4AJ2A 1T8SA 2Z3VA 3IVGA 3L92A 3MSCA 5CT4A 2VTDA 4BFSA 4LGCA 3NH9A 5I51A 3LQFA 1OIVA 5AVYA 2AUNA 2I4OA 3Q4GA 5JSZB 2ZBGA 2RAPA 5LA6A 5GONF 2J6CA 1FUYB 3NHLA 3MQFA 1DC6A 2BJVA 2GK4A 3GEHA 1A9PA 4LI3X 4LZLA 2JARA 3GCXA 2HJWA 3SJAA 4M1SA 3AVOA 1A76A 3OJXA 5G0SA 3TLEA 4AD8A 3W6PA 2Y3IA 4YY3B 4AJKA 2PM8A 1CHDA 2J7PD 1EUZA 3ZQUA 4E46A 3PKIA 1EGAA 4Q1CA 1EFCA 6YASA 2RHTA 1J0XO 3R0ZA 1AKMA 2CXPA 3K35A 4IEFB 3ZEIA 4EG7A 5KSOA 4G3XA 1JEEA 1H5NA 1IHYA 2LBPA 4FX5A 5KKNB 4BE9A 3EBPA 2Z2YA 3PRHA 5K03A 4PFSA 4Q4JA 5IASA 5K3FB 4JI6B 1B6TA 3QPWA 4WNAB 2HADA 3HJNA 2DY0A 4QTXA 3DV0B 2WLSA 3B3AA 5E6RB 3VQTA 2J9GA 2P4EA 4HJXA 4K6OA 1OBOA 2IEDA 4BO0A 1K2WA 5KUTA 1IWBB 3UCXA 1HE4A 1S8OA 1ID1A 3I12A 2BGUA 5D51S 3ZW7A 4HTAA 3O4HA 1DKUA 4GQIA 4QEZA 4YGYA 1JJBA 1TMYA 1VSTA 2GWHA 2HRQA 5KKCA 3GF4A 3GQBB 1CVLA 3UGTA 1QH9A 3HLTA 1MABA 3VKWA 2R6CA 4A2PA 4BC1A 1DRJA 2WZCA 3JXEA 4MYTA 1ZD8A 5EJEA 5ALWA 3NIWA 2Q5FA 3OJWA 3RS7A 2VTBA 1I4EB 2WSSD 1BMFD 4YDHB 3WQSB 3D6NB 1ZOLA 1P2UA 5EGSA 1E62A 2PNFA 3OLXA 3P9PA 3INGA 4E4TA 1HF3A 1XELA 1C4XA 3KKMA 3CISA 1FU7A 1YR6A 4QPZA 2QM8A 3OLVA 1VBFA 2Z8XA 1JLKA 1DKNA 1QONA 1ULBA 3AF2A 3MGKA 4HB2A 4RZ3A 3T5CA 3TSAA 4U9IS 1A7UA 4FK8A 4AWAA 2A0FA 1N2CB 4NWIA 5IM5A 4BTEA 1KK0A 4GOJA 1USUA 2ZIFA 1DV1A 1EVYA 1QGZA 3AI7A 1E4YA 3IOBA 4LJ6A 4U6SA 4AF6A 4CFZA 1U3UA 1WCYA 1ST3A 4U9UA 3A0UA 4PBTA 3UUFA 4JLNA 3E1SA 3LZDA 3UB2A 5ILOA 3DO8A 3ESZA 4CF6A 2RBEA 4EDFA 3OCVA 2NPFA 4EHLA 3SQWA 4ZJZA 1I2MA 1XVLA 2FZVA 1HTWA 1BOFA 4M1TA 4BNKA 4YLGA 4EABA 1ORVA 2LGJA 1JNYA 1Y3CE 3ZVNA 1W4CA 3IEKA 1W2WB 3DDHA 5FNVB 4CDGA 7ADHA 4R2LA 1BQEA 1LV7A 3HACA 4LN1A 4F2DA 3T1TA 3TNYA 2AZXA 2PQ2A 1XPJA 3JCZA 1A9TA 4QL3A 4BJ6A 1VHLA 4G5HA 4JN6B 1W19A 2FSHA 2PBRA 4J16A 4MAMA 4X20A 1L8OA 2D7CA 5DASA 5U4QA 3I4LA 5JECA 3NJ4A 3EVZA 4GR5A 4MIYA 3Q7SA 4MR9B 1E1CA 3IUNA 4MW4A 2R4QA 1TLTA 1VG1A 4L75A 3RK0A 1RRVA 2YOGA 2FW7A 4JT8A 2AJDA 1YE5A 3MZ0A 1NSYA 3KETA 2PZAA 2D13A 2HJHA 4MV1A 1WUYA 2CNOA 3ORSA 1I1NA 2K4MA 4BQEA 2QMZA 1I9GA 4L8VA 4N41A 4FONA 2CC2A 3QXSA 4X0EA 5AIAA 4EF4A 5KYNA 3M6AA 1G38A 1NN0A 1KPGA 2W0MA 3T3NA 1OXBB 2CY0A 2RGRA 2AE2A 1SUEA 1V9LA 1ZJYA 2ZTMA 1WSDA 3G2HA 1NBWB 1FFGA 2Z1DA 3ND8A 4KW7A 3SJZA 1SUPA 1ZVQA 1IN1A 1ZUNA 2WIDA 7ABPA 2UXDB 1JDSA 1IN8A 1TCAA 2B20A 4KR2A 2BBSA 3FCSB 3EQ8A 3LDUA 4MJ3A 1I3CA 1XCMA 2RGGA 1UT6A 4XB2A 5ITZA 1XZNA 4YRJA 1CV2A 4D79A 3IHKA 3JASB 4CCYA 1A8SA 2CHEA 2G9ZA 1E5TA 1Q0ZA 1SC3A 2VBGA 2RI1A 1HLDA 4AF8A 2Y1GA 3MMNA 4TTRA 2HCBA 2YWJA 5I9IA 2QD4A 1IHPA 4E5DA 3PIIA 1CWUA 1GL9B 1D9XA 4BX9A 1ZJJA 4ZK2A 4LOHA 4B17A 3ELYA 3OEWA 4I5EA 2Q9CA 2Q9AA 2QRHA 4DNQA 1V37A 1VL1A 2HCFA 4NZNA 1K88A 3N8KA 1G7SA 1VG0B 4JIMA 3PQ7A 1L1QA 2O2DA 3A26A 1PE0A 3C3MA 4DLZA 1GPKA 1GAJA 1XWIA 1U4NA 1T3TA 3NOOA 4UCFA 5B37A 5BNWA 1CB7A 4Q5IA 3HKBA 4YQZA 1I14A 4RHFA 2DKFA 2J3DA 3G8BA 3RS2A 4EGFA 3DCNA 2GJAA 5IAEA 4CN8A 1NW4A 4ZHQF 5C5DA 1T9DA 3SR4A 3TD2A 3V8NA 4BWYA 1TYAE 1DCMA 1YZVA 1WW2A 9ABPA 4AECA 4MEAA 1W36D 3BK7A 3FAZA 1NGSA 1GRQA 1AKTA 4U9HS 1LKZA 2HSEA 3FR8A 1YA8A 5LD2C 2YMLA 4W8HA 5IC5A 1CCWA 2UZ1A 2EQ5A 3N07A 1DIHA 4MVCA 4NENA 4B71A 2AFIB 2AMLA 3C3KA 3OBIA 3T3IA 2Y76A 1DS6A 3OEYA 3JZMA 4W6QA 2FVXA 5ER6A 3S70A 2JVIA 1R6XA 3TNLA 3TLGA 4FEGA 2QRZA 5JDCA 5JYCA 5DXFA 1CQJB 3OCUA 3NGMA 3FKSA 5BN1A 1PDOA 1YZGA 4RU1A 5IWCA 1UR5A 5IW8A 4MKZA 3EG9B 1L0BA 1MB0A 3FNRA 4KYIB 4FMDF 2IF0A 4HC4A 4R7GA 1B2RA 2CMHA 1Y4AE 2CL6X 3BIXA 3KU4A 1J0EA 1D8AA 2C3MA 4NKRA 4BNDB 4OSPA 4Z7QB 1N6HA 2E89A 1U9ZA 2EQBA 5IG2A 4ZDKA 3D43A 2Q6IA 3UF0A 3GEDA 2GGSA 2NYRA 3BGWA 3ELDA 2L0XA 4GOMD 4P3OA 4KOEC 1XTZA 3V2IA 3KJGA 3T5GA 1PZEA 4B87A 3OZSA 4Y3UA 1FYXA 3D7SA 4PZYA 4BE7B 3TUJC 1T5HX 1C7RA 4UHCA 3I8SA 1V6SA 1AO3A 1EP2B 1NJGA 5AIBA 1Z74A 4DLRA 3A1SA 4G07A 3GGDA 1K27A 2I66A 4O2AB 5JC8A 4AX4A 2AW3A 3MXOA 3CKLA 1H0SA 1N2EA 1BXGB 2UYQA 3BWCA 3NB0A 3N5KA 4PIPA 3TFOA 1NMSA 2CV0A 4K1LA 1MHTA 3EAFA 3GFQA 4JYAB 2GM5A 2Q4BA 3U44A 4J4TA 1MX9A 2GWRA 1KXJA 3M33A 3EC2A 2BBOA 5GGXA 1A4IA 2AG0A 3E0QA 3HBLA 3VMMA 3NM6B 1HQYE 5IDVA 5LZ8A 4OH7A 4KREA 2X7XA 3THYB 4XUEA 4GOND 2BUCA 2IDZA 3NHRA 2Q6LA 1KAHA 3NWPA 4JEHA 2IOHA 3D59A 3OMWA 1QRDA 5F2KA 1XTSA 4G1CA 5DYGA 4ZKEA 4EO9A 2Z8YA 1UP4A 2AC7A 1Q50A 3SJBA 3WADA 2R5FA 4AZTA 1DBWA 3INNA 1LA2A 1XQXA 3JRWA 3MIIA 1TZMA 2R60A 3OY2A 1GGNA 3QEMA 2IXEA 2WF5A 3HKCA 3QKSA 4MQUA 2A5FA 4PAOA 1JQ5A 2R65A 3JD0A 1W5FA 3K0FA 3GRCA 1ODLA 1HSOA 4UUMA 1UPXA 2WWGA 1WU7A 3SFVA 3IPRA 4QULA 3V4VB 2UVDA 1T2NA 4BNWA 5IK2D 4CEHA 3ZOKA 3KQKA 4B0PA 4EBBA 3CRNA 1RKVA 3PL5A 4NMLA 1IY1A 3EPPA 2YWXA 3RT9A 1JJFA 4M83A 4Q1AA 2W42A 1ZP6A 3TI7A 2AQIA 1T8UA 4A2CA 1R0ZA 1Q12A 2DBYA 4QDJA 1PCXA 3L02A 1FMFA 5BR8B 1CRPA 4BZPA 3VR6A 5KNDD 1ZCBA 4KFCA 3PX7A 1E66A 3EXG1 4Q18A 3Q7PA 2OBBA 2XZDA 3LBYA 5H7XA 3HM9A 3VO1A 4IICA 3OTWA 3RS0A 5FFNA 4E4YA 1DV2A 1Y81A 1OZ0A 2X5XA 3SEAA 1QGDA 5TF0A 3EIFA 1PWHA 1UPUA 2P4HX 2X76A 3CNQS 3OZXA 3OSUA 5T8KA 4IX1A 3L8YA 2OCDA 1TTPB 2RKBA 1T2FA 4J1TA 5FOUA 1K5PA 3TNDA 1QANA 2DPXA 3QEAZ 1QRTA 3SHOA 3F3MA 3L8MA 3TLKA 3T7RA 3TECE 2GVZC 2YMMA 4LSMA 3PTZA 2XZLA 4L57A 3DE5X 4HDRA 3VNBA 3K70D 4P54A 2WT9A 2Q0HA 3M4NA 3PWSA 1D0SA 2X4GA 4B33A 1N6OA 3IBFA 4XJTA 3H4VA 2Q4RA 3WXBA 4LOIA 3EGCA 1B2LA 1AHIA 2CDCA 5EP4A 3X1ZA 4ARBA 2XODA 1D9ZA 2O0MA 3B3FA 4LY9A 1I5OA 3ZHBA 3LD9A 4F4IA 1RI3A 1H2BA 1SK8A 1XP8A 2OC4A 1KF0A 5KWIA 1UJCA 1Z8FA 3N8IA 3GEMA 2GYYA 4CM4B 5EMKA 1GL3A 3HCOA 4GZ5A 1R16A 2X6QA 3GCDA 1TPYA 1BD3A 1E6UA 2DUNA 3PIRA 1FOEB 4HWPA 4B6JA 5DTIA 1KR5A 3HGTA 3KTAA 4IFBA 4Q48A 4MX8A 2QTHA 3MJCA 1AUPA 3CB4A 2A7QA 3JATA 3JQ7B 3UMRA 3WMGA 4MA0A 3FUVA 1EB9A 2QJWA 4BMPB 2WWIA 4RK4A 1C9JA 5IM4A 4DDHA 3RUIA 1HM5A 2QTVB 3DZFA 4OMDA 4YJ3A 5ALOA 1BMQA 4EITA 1QE0A 1RBYA 2BEWA 2NQ2C 3VPHA 3FWKA 4FFDA 2PIAA 2WIGA 3TQFA 4EJ0A 5GIPE 1EHYA 2ARKA 1PN3A 1U3WA 1OX4A 3BD8A 3DYVA 5HW0A 4G9BA 3TAHA 2C4UA 3EC7A 2DWUA 3PWZA 9MHTA 5EEHA 1XTRA 1YJXA 3IKVA 5EZSA 5IH3A 4FT2A 4BFWA 4BX8A 1WHSA 1GFZA 2PZEA 4LDPA 4G4IA 3OWXA 4B40A 2OENG 4EFNA 2J09A 4ZEOA 4BC0A 4DR2B 5SZJA 3E35A 1JBQA 3Q7IA 1YSCA 2UYHA 1MEOA 1IZ7A 3DTVA 1ONOA 2D8MA 1N0HA 1PL7A 1B74A 2ZYRA 3IBSA 4YASA 1FE8A 1KIFA 1GQFA 2PL1A 2X5NA 4FHEA 5DWQA 1E0DA 1OF1A 3LIPA 2VRBA 3GW8A 4I5DA 4M54A 1DC3A 2CLHB 4GKVA 2P3OA 2R7MA 1QB7A 1WOMA 2HX1A 3RTBA 4ENPA 3TFWA 1Q1EA 2HZBA 2PWZA 1V39A 4EPYA 4Z4QA 1KVQA 2FFBA 3HU1A 3BGOS 2JGIA 2Q3FA 3AEXA 1W48A 4JXKA 1JPNA 5I48A 2W43A 2VK2A 1LRLA 2GERA 2QNRA 2XH8A 1OHHD 1IOWA 3DCIA 5CXQA 3WV5A 1POWA 3DMHA 4B0OA 1M1UA 1ITZA 1SIWA 3PJGA 4E3ZA 4RTSA 1DADA 1XRMA 4MPDA 4UEWA 2J1LA 4UUOA 4UU1A 1VQ1A 2YZKA 1JFTA 4HDMB 3C6QA 3U9LA 3KQUA 5DNUA 1X9HA 4RD6A 3ND9A 4IO1A 1TL7C 2ZU0C 1ADJA 1J56A 1SIUA 1FLVA 4JLBA 3TG2A 2XNSA 1EM8A 4NARA 3LBHA 1CLEA 2C20A 3VOAA 4B74A 1I6LA 3D3EA 2WM8A 1E4VA 3L1IA 4H0CA 1YS1X 2OK7A 5TB5A 2FSGA 4C0HA 5GZ1A 4BASA 2CBGA 4BNUA 2PWYA 4NBSA 5F2EA 3HZHA 3MBIA 1B73A 1JXMA 1YVEI 4OH1A 1H2RS 1SURA 1PZMA 1WDKA 1N2IA 3D6UA 4J7UA 5TPZD 3BJRA 2PQ0A 3ANYB 1JG7A 2C4WA 1KI6A 5H3CA 3V7WA 1K06A 4B4DA 4ER3A 1IUNA 1NBIA 1U2DC 5DB4A 2X7JA 2G8NA 3QE9Y 3MJEA 4KR7A 3BAFA 2NIPA 5FDFA 2WD8A 4ILEA 4NE7A 5F7OA 5KSZA 4JI0B 1QYCA 5JUWA 2WKWA 4HTFA 2OO5A 1QBGA 1MPXA 4K2AA 4DWOA 4YRLA 3UUGA 2VT6A 3MTJA 1L4BA 1QP8A 3A3PA 4MCHA 2VYVA 4ZQGA 4RZQA 2WA2A 2GN9A 2P40A 3A14A 3EWAA 1CK4A 1L9XA 2JIPA 3NHSA 4OJQA 2ZE7A 1YA4A 3O31A 5DH9A 2PU7A 4W5HA 3HUTA 1KY3A 4HGPA 1PQWA 1Z47A 4KCGA 4S1WA 3PXXA 3ZD8A 5JH7B 1E9VA 5DBIA 3DEZA 2QUZA 3R5SA 1YDFA 1MNQA 4FNMA 1D8TA 1SK9A 4R1LA 4X65B 2R8EA 4F4FA 2ZJ1A 3EXHA 3HA7A 2B4QA 2OORC 2FJ0A 2QRGA 1SKBA 3ESBA 3PR2B 4MRVA 4RAOA 5C1OA 4LZOA 4DUGD 1GZ3A 4ZP1A 4GKJB 1JHYA 2CBZA 6LDHA 2FFRA 2IEYA 4MUEA 3QBJA 4OUDA 3DMNA 3GLGE 4E5SA 4KTVE 2RBGA 2CLDX 5K0SA 3OQIA 1ZLXA 1QK5A 2R8RA 4JT2A 4CM9A 1HV8A 4MV9A 4O4HB 3IVMA 5FBLB 1BTOA 5IMBA 1QYDA 1R6VA 3IB6A 3HY3A 4TLCA 3WAJA 1XJCA 5A5DA 1PGQA 1UFOA 3C48A 1AN9A 3R24A 1GAQA 3RQSA 3H1TA 3ZNQA 2H4HA 1JG4A 2VSFA 3LC1O 3M5WA 4ACAA 3DQQA 2GCEA 4JEUA 3IP6A 1DVRA 3L7DA 4MQFA 1CDOA 1CS0B 1UK9A 2PYDA 4M1OA 4GE3A 4M9UA 4Z99A 1XNJA 1AH2A 3PC8C 1RPJA 3O4VA 4DNOA 5EIEA 4IJ6A 1XTQA 1YCFA 4Y2RA 4O33A 4IINA 1C80A 4EX6A 5EJ9A 4ZQEA 3FCCA 5KJEA 1H5UA 1L4YA 1W25A 1YI0A 3NHWA 4L6CA 1BC5A 3QMWA 3O8DA 4P80A 5BSWA 4OLBA 3STWA 1RXVA 1RJWA 1D6NA 1E5QA 4DILA 3JQAD 1NA5A 1G3IA 1RABA 1GPMA 2XWSA 1MU0A 5EJ4A 5M34A 2WTUA 3L7KA 4UMFA 2DHCA 2A9RA 3JARA 1WR8A 3LT2A 2VUHB 5JAQA 4BPBA 3COYA 4U5XA 4MDEA 2A9VA 5F4BA 2L82A 4RTMA 3KVYA 4XH9B 3HVKA 3HCNA 3EH2A 3COSA 1QR6A 2XOEA 5EZ6B 1XL1A 1EP9A 3NHJA 1X14A 3AKEA 3IQIX 3DXXA 3LX8A 5JYEA 4YDSA 2H00A 1RLUA 5BUSA 2V45A 1FIUA 1XO1A 2GD2A 1EVIA 4KQIA 4CDMA 4DRYA 2IKQA 1D6JA 1VL8A 3HU3A 4ZCSA 4M0LA 2OXEA 2ZJ2A 5A5FA 3OY7A 1UMBB 2DH6A 2FF5A 3WK6A 1AK2A 2VQ6A 4E5MA 1K2VN 1L3IA 4DV2B 3F90A 3JAWB 1G3QA 4KO8A 4AJ9A 5IABA 4E07A 2CJXA 2YZNA 1ZGJA 1V6CA 2GAJA 2OAEA 4OQPA 4PFJA 1ABBA 3PUYA 3ZCQA 1W1WA 2E18A 2W2OA 3AM3A 2ID8A 1GYPA 4CWAA 1R74A 2NP7A 2NZWA 1OR8A 3GX1A 4RE6A 1LF5A 4I3GA 1LBHA 1AM4D 4B83A 3JQFA 3SYTA 1Y1SA 3U3JA 4QVGA 1ZGBA 3WLQA 3DP7A 1U0SY 3PRYA 5DYTA 4D9FA 4XWGA 1Z6QA 5LZ5A 1KQOA 3BGDA 4XJVA 2H85A 2ZUWA 3E7XA 4A4DA 1EWKA 2XD9A 3KUXA 2Q28A 3CJTA 3C4JA 3CNEA 3CZRA 3ORFA 3DCJA 4XEUA 5HBGA 1RWXA 2PLRA 4ZOLF 2I2XB 3FBGA 4OHZA 5U4XA 1FBNA 4E11A 3L5OA 3MT8A 1JWBB 2FX3A 4WASA 3OJLA 5CT8A 4O1IA 1HYHA 3KE8A 2ZUCA 4IDHA 3GUCA 1KFCB 1IB6A 3P9ZA 4IDBA 5LQKA 3X2EA 1UKZA 1NJSA 1OOEA 1YR2A 3RNOA 1BS9A 2KYRA 5UKDA 4MI9A 4NMWA 3KZVA 1OBCA 1W2HA 2MSKA 1YR7A 2PT6A 3FFWA 4V02A 2XGMA 5EPEA 3A06A 5AK6A 5F7JA 4I9HA 2LE0A 4L4ZA 4DYHA 1O0BA 1GN9A 5GJVC 4DLSA 3EIXA 4E1BA 3GVHA 3RCBA 3JW8A 3TTYA 4TQUS 5H9WA 4MH0R 3ROFA 4BGEA 1ZXBA 3AYZB 3FOCA 2OMEA 3NS7A 3MWLA 2AMJA 1TUEA 1IN5A 1P6QA 2V74B 4OGWA 1PR5A 3B7WA 2HFKA 2HUPA 3WLEA 4Y2PA 2Y66A 3ZHXA 1PUJA 2FZLA 2FWMX 1VOTA 1KOJA 1XQYA 3DZDA 1K89A 4XYEA 2BEVA 1UBCA 3OZEA 1RZVA 3ICOA 3KOZA 1P45A 3R6WA 3S6JA 5FUQA 3S1SA 2J33A 1UC8A 4M9CA 1SHJA 1T6XA 1AHNA 4UM9D 2XI4A 2ZRBA 5B7QA 3WGJA 1GXSA 4YV1A 3M9XA 1OFIA 3WGQA 3GJ4A 4QGAA 3KS9A 2KE5A 3LBNA 5HXAA 2O2ZA 4IDDA 4Q9AA 1X94A 1YZTA 4ARAA 4M55A 1WMSA 3WRXA 3AHIA 3DBRB 4Z3DA 3T7TA 2UYCA 5A0TA 1MMFB 5TDHA 1U0FA 2NTEA 3TI9A 3C8MA 4OI0A 5KOHB 4GW3A 1YC2A 2CFOA 2VFAA 3O93A 4I14A 4V0RA 821PA 3SDBA 2X1VA 4P0TA 1O6CA 4GMKA 2QN3A 5F4ZA 4PZAA 1JSZA 1P9LA 3AVPA 3NBQA 1TFUA 4TX1A 1L7EA 5LYJB 2CHFA 4HPXB 3WIBA 3G2JA 3G6KA 1YB6A 3WRVA 1QZZA 2FGKA 4H7HA 4WACA 4BB0A 2ZUSA 2VATA 4ND5A 4JBIA 4EUKA 4ON9A 5GAJA 5JS7A 4ZU1X 2AA3A 3UYLA 2KWIA 1H2WA 1TO2E 3KYCB 1WUKS 3ANMA 4RJJA 2ZCVA 4FR5A 4U7PB 1JNXX 3RS4A 3Q3HA 5IVHA 1K68A 1R0XA 4FW8A 4TZTA 4RQTA 5DYWA 5E4FA 1JKXA 3IIKA 1A0OA 2P0EA 2QR2A 4MAAA 4GNRA 3EXAA 2WSBA 5LQAA 3RE1A 1N3IA 5JAZA 1Q92A 1EWTA 2WW8A 3PFFA 4L6IA 4LXIA 2C5LA 5T4EA 4JB8A 1PQ4A 4YCMA 2XUOA 5FLXA 2WAXA 2TS1A 2PXCA 4QUDA 4QWMA 1OUMA 1GPH1 1ZWKA 3GLIE 2XRMA 1PZHA 4B3MB 3B5IA 1Q0PA 3QELA 3L1HA 1XL0A 1X15A 2ZYWX 5BUZA 2AQHA 1UOPA 1N6RA 4MNTA 3H83A 4C7VA 5B36A 4YCNA 3UB4A 1LSSA 4GM1A 4V2IA 1YBHA 4QYIA 4XPIA 4YJ2F 1QC5B 3OOYA 4EUFA 1AZWA 2XBMA 3KSUA 4LG1A 1J25A 2NN3C 2VCYA 1E1QA 1NY5A 4MI6A 3SR0A 2EXXA 3JU3A 4MHTA 1OXUA 2B7BA 2IYPA 4TN1A 5K45A 2J9YB 3OICA 3ZGLA 5C53B 5EKSA 3LCRA 3AFHA 3RS3A 4CBVA 1W0JD 2X2OA 1GAEO 3U62A 4AJ4A 1L5RA 4CIAA 4TZ6A 4EY5A 1H93A 2X3YA 2R6FA 2XGJA 3OLZA 4INZA 4HRXA 4KMRA 2ZZMA 2FZEA 1PGPA 1KNQA 2NO4A 4H4EA 1RKUA 5AKJA 3VR3A 3KOWA 4DV4B 1A5SB 2FQYA 1Q6YA 3PQDA 4ZT5A 5L3RA 2FWPA 3QWHA 4DADA 5A4MS 3ROMA 4DRZA 1V5FA 5K0EA 5LWHA 5JS1A 3O6VA 2QYTA 3ZDRA 2QRMA 3QG5A 1LCIA 3LV8A 5G40A 4BAZA 1K3TA 3CN7A 1E2MA 3C70A 1LPAB 2BRUC 4M1EA 2FDRA 5JARA 2Z3ZA 5CH3A 1CUAA 2FWJA 4TKUA 4TTPA 2HMYB 3KOXA 1KZ7B 4B4UA 1YDGA 4S04A 1BDBA 3VZCA 5CP8A 3WK4A 2NZJA 1YDWA 3AP2A 4RVHA 1W85A 2V4ZA 1GGHA 3N8GA 1GWNA 2LXNA 4JL5A 4DA7A 1T8PA 3EDMA 3AF6A 2Q5JA 2B99A 2FUKA 1H2XA 5H8WA 5FPSA 2PUVA 2WF7A 1R15A 4G0QA 4EJ2A 1CZLA 3BXZA 4GM0A 2ZBDA 3F6EX 4JLUA 1KS2A 2OB1A 4DLKA 4JYZA 3U37A 4CT5A 2P3SA 1GKLA 1V16A 4N0DA 3UKOA 1U0BB 4R41A 1JHDA 2XTAA 3D3WA 4AMYA 3OF3A 4BZWA 5M7EA 5LA6B 5TQ0A 1O3YA 4X60A 1NTRA 3RYHA 3R20A 5JZVA 1KE2A 2AXNA 2FN8A 4YBRA 4FP9A 1LDBA 4ND7A 1WMDA 5A7FA 1NVFA 3HXQA 1C4OA 3OUUA 1JDTA 1T6YA 2DETA 4GWKA 3WFIA 2VP4A 1WSWA 5C1PA 1CP3A 1ZZGA 1B6GA 3B48A 4NYJR 2E4YA 1GUYA 4O6VA 1Y9AA 4H6XA 4WBXC 4LX0A 3WX0A 1ADFA 3E9QA 4Q3EA 4KXNA 1ZU4A 2H7YA 3QLUA 1DWOA 3AR4A 1H2ZA 2PSJA 1P81A 2QYHA 2CNBA 5HF9A 2NM0A 2ANCA 2PH3A 4Q4JB 3KQNA 4UD6A 1QCYA 4WINA 1WUTA 2IUFA 4IFEA 4ABYA 2HF2A 1D0IA 3FOFC 3HS3A 5P8WA 3RSSA 1O95D 2BGTA 4OREX 2NZYA 1AN0A 3BEDA 3SCZA 4KVFA 3X44A 4FYVA 3A6LA 3EQZA 5BOVA 1IOZA 4O3MA 5I7AA 1WM1A 1ZMTA 4ODIA 3TPCA 3GFGA 3T7CA 1UINA 4MLCA 3TMAA 4A23A 3RS5A 2AC2A 1XFDA 3K8QA 3DR5A 3IOMA 1VG9B 1OT5A 4JB3A 4WHMA 2ZRMA 1G64A 2J08A 4JR2A 1MABB 5HCIA 5ALGA 4D9EA 2VUUA 2VTBB 2HK9A 5KOIA 3U7GA 4WXRA 3TL6A 3V4SA 1Y5RA 1IFXA 2I1LA 3CG0A 5AVJA 4YC7A 3VV2A 3U6KA 3AP1A 2IQIA 3EZ9A 1RI1A 2HBRA 3A6DA 3DXYA 4O2RA 5HF6A 5TIIA 4KIFA 1WQ4A 1CD5A 3DMTA 1JR2A 4NMMA 1T2VA 3UAOA 3IEPA 5I7WA 1T1GA 1VIMA 1RXUA 1SCDA 4I50A 4FOSA 1DARA 2FMUA 1KJJA 3GUVA 3RANA 3X2FA 1Y34E 2ORED 2V6JA 3F97A 1VKHA 3EXFA 3ZVKA 2POQX 4JIGA 3FRHA 5H3LA 3ROPA 1M2JA 3H1FA 1RYNA 3Q2KA 2HNBA 3TR0A 2HJVA 3NTQA 2GPYA 1DC8A 2DY1A 3M2PA 3Q9SA 4FEEA 4KTTE 2QPLA 3JZIA 1HDGO 3AKDA 3WNCA 4I1YA 5KTPA 4JDUA 5J4HA 3BZUA 3PC6A 1SBCA 5L6MB 3R9XA 2FN4A 4MB6A 3NNSA 2MU1A 5DE3A 3ZWPA 1OH6A 4GZLA 3QVKA 3VYSB 2E21A 3FPFA 5D1HA 1XRJA 2J85A 4JYBA 3RVQA 3TZCA 2QMOA 3WP0A 4AY6A 1YVRA 5KDOA 1RQ7A 1E3MA 4DCCA 2UUPA 2JJ1A 3L4BA 3NT5A 1JIKA 2QLTA 4Y98A 4DARA 1U3TA 1JI0A 4X20B 3ZY4A 2ZIAA 2H31A 3E9EA 2DUJA 2GCOA 3UIEA 3GD5A 4JGBA 4L5JA 4KQKA 5K51A 3SK0A 3PZBA 3ST7A 2VAPA 4PZPA 1E1CB 2O3QA 1XG5A 1FYFA 1PX0A 1F4LA 2YOHA 3IUQA 1VMKA 1SXJE 4QG7A 4V0OA 4I3HA 1KY5A 1Q5PA 2R3SA 3DLPX 4G5RA 4KWCA 4TKMA 1ISHA 1KYTA 1DRVA 1ESZA 3K4QA 4D4HA 5KOYA 2YIMA 1EFRA 5EHQA 3H87A 1FEZA 3CCFA 4H0FA 4L50A 2JFVA 2NG1A 5EAIA 3CX7A 4Z2YA 3Q8MA 3DO6A 1YTLA 4INAA 1Z26A 3SSAA 4HNUA 2G09A 3R6TA 4PYKA 3PVCA 1V48A 3ZV4A 2W4QA 1XRNA 2VDVE 1RLMA 1U9CA 4OXXA 3T52A 3ZOZA 3F6BX 3PFWO 3QIAA 4NAHA 4E2ZA 4BAUA 4OA8A 2CXRA 5ITZB 4L3WA 5MN5A 3OU2A 5DOZA 4OB6A 1KA9H 1BMFA 4CCYB 3EEBA 4P98A 2RHMA 2FE4A 2OQIA 4R2XA 3LHKA 1EI9A 1RC1A 2F62A 3I62A 5ESDA 2FY8A 4MVWA 2ZTHA 1A04A 2XGOA 4P3XA 3HR7A 2QK4A 1EFHA 1QV6A 1PG0A 2JIDA 1P7VA 4G0ZA 3MD9A 2CL0X 3LP6A 4E7OA 3N39C 4UU0A 3FHTA 1HFJA 3N53A 1SVWA 1FZTA 4I99A 5TR9A 5C5CA 3RVBA 5IWAB 3WTBA 1NQOA 2EKLA 5KHAA 2NMVA 3TLZA 3HDVA 1K1EA 1N2GA 1FVOA 1GR0A 4IIGA 3OFJA 3TB6A 4G89A 1CSEE 5D5PA 4PC6A 3VYUB 2IH5A 2GB4A 1KBQA 1XXHE 3HFJA 1FP6A 4AKSA 2IS4A 4RV9A 4D8UA 4DDMA 2JD2A 3C3DA 2AH5A 1XV5A 2PMCA 2OK8A 3BRSA 3PEFA 4RA9A 4DV0B 3CEJA 1BH2A 2QEQA 4OQNA 4PO1A 4QUBA 1F0PA 1WVIA 4K9QA 3F5SA 5J4LA 2HRBA 2QMYA 1RHRA 3INYA 1AOXA 2O1SA 2W4MA 3G7UA 3MPUA 1QGUA 1SBZA 2WJIA 4TXHA 3MJFA 4PZ9A 4QKQA 4J9VA 1A9XA 4HB3A 1W6UA 4CR6A 2FSPA 2C2MA 3NUQA 1F14A 4FDLA 4MOWA 5KAPA 1Q0LA 3VDXA 1KI4A 3VDMA 1T0IA 5IARA 4TTJA 2EKQA 3UMVA 2FZ5A 3DEYX 4UAVA 3ZWMA 1W581 4D3SA 3K30A 3TJRA 2XMRA 1KO1A 2A0XA 3FPJA 3GP5A 3K20A 3LUJA 3TPFA 2R6R1 4EGSA 3HN6A 1BKYA 1T9BA 5K99A 1J5XA 3BCUA 4OMUA 3B2QA 2VDQB 4ZCIA 1WXIA 2UDPA 2VJKA 3QF4A 2CMGA 1TD1A 4GMXA 4ENTA 3K9FC 2BMDA 2QZPA 1T1EA 4I3FA 5F64A 2R00A 1L4LA 2CLEB 4ROSA 2DFPA 3EZ7A 1XLUA 2WUVA 3IA2A 4FZRA 2GPNA 4TVOA 4XQEA 3ETGA 1BEZA 3VHRA 4C43A 2UXCB 2FN3A 3I5AA 1KL7A 1N57A 1JKJB 4WY8A 2XQJA 3U4CA 1AK9A 2FEAA 3D7RA 4H7DA 1KK1A 4JC5A 1QIIA 4PBRA 1WDLA 5IDWA 4AJJA 1LSJA 1U1GA 4P84A 4WBSA 4EJSC 2EV9A 1Q3HA 4ZVKA 1H9BA 4CE6A 4XM1A 4DR4B 2V8OA 5CITA 3U7HB 4KXXA 3P2OA 4ZEMA 5KYTA 1KPHA 3CZ4A 1QUFA 2WDPA 2B3DA 5IYZF 2CJFA 4E2YA 1NR7A 1UXJA 2ZATA 3B7PA 1JYFA 3U44B 4LJ9A 2YWCA 4N8DA 1U8XX 3D6VA 1Z7EA 3V48A 1KZ6A 2J0UA 4MV5A 4A5OA 2XYGA 3IRUA 4E12A 4EUEA 5J43A 5JJIA 1BZYA 3L8CA 5BYJA 5F3WB 2H3EA 1OB2A 3X43A 3UM9A 4K3VA 2RH5A 3CXRA 3SHTA 3VUFA 3M1IA 1A9OA 3B6EA 5JQGA 1PNVA 4PG4A 4WDQA 3R9KA 3AKCA 3AVUA 4A36A 1RCFA 4MUFA 1P29A 4LF9B 2FR0A 5EKDA 2JGFA 2A5YB 4QO7A 4DF3A 1XZAA 1Z13A 2PMWB 2VHUA 3AW9A 3MYYA 3QEMB 4XCVA 3ASZA 3HKCB 3QKSB 1B7GO 2UXBB 5DJ5A 4NK5A 5BVHA 4MHOA 3KSRA 2YS7A 3HYNA 1I51A 3B2NA 2BTOA 3QX3A 1V95A 2LW7A 4I7EA 3ERCA 2IUEA 8AT1A 4HWRA 3RIEA 1MO6A 1VA5A 4P5PA 3H5WA 1N4DA 1X38A 2HT6A 4MB2A 4Q3KA 2VSOA 5BW5A 1Z7GA 4OI4A 2DQZA 2LKCA 1VHTA 2VTVA 3LBIA 5LLTA 3KCQA 4OXIA 1J2RA 2IYXA 2TRSB 3RHTA 4JI5B 3ZHRA 3KDPA 4I5FA 1Y42X 3E18A 4JCCA 4CM5A 4M0UA 4N1AA 1DX6A 4EWLA 3BFPA 5EIXA 1OTHA 1S02A 3GFSA 2WB2A 4LECA 4MINA 5JEEA 1RWKA 3AZQA 5J2TA 4FYHA 1F5SA 4R84A 4C3VA 4IDCA 4RPHA 4WEOA 2B36A 3JYPA 2EHJA 3ZBQA 1U81A 5JXJA 1P8AA 2YXPX 1FQKA 2QDKA 3HABA 4JVLA 5DNDA 3HK2A 4PLTA 1DIAA 3RYFA 4YMTA 3JQPA 1N7GA 3L6DA 5K1ZA 5ABPA 3TRJA 5ISMA 2WJVA 3S2FA 2I80A 4L02A 1YULA 4WK0B 5D01A 3RAJA 5LUAA 1L5WA 4IMRA 3E4DA 2O4UX 4KQ9A 1BG6A 1EVEA 2XAUA 2ZRPA 4W8GA 3QHPA 1GPJA 3PR1A 3TLAA 4EFLA 5B55A 3CVXA 1U2GA 2JBWA 3FKQA 3JAKA 3R5JA 5AM2A 1RYHA 4NU5A 2CV2A 4HDRB 2FPMA 1TZCA 4WT7A 4M4SA 1U3VA 4ZJYA 1FNNA 3UWSA 3PQ2A 5AW6A 2JLXA 1Q17A 5D3QA 3EGWA 4M8SA 4JQYA 3LUHA 2IYWA 2G4VA 3PXUA 4B9EA 4ZYZA 1QTQA 5KQSA 5TEVA 3W0LB 4CT4B 4KXQA 1VI5A 4KSCA 1J8QA 1SXHA 4BMCA 2E37A 2JJ2A 2MTBA 4YPOA 5JHHB 4H59A 5C8DA 4REQA 3QLTA 1KMQA 5EI5A 3RFUA 4DSNA 4EB3A 3S99A 4DNPA 4KB5A 1F8UA 2FQWA 5AM4A 5ECDA 4Q93A 3QU2A 2WTBA 1DXYA 1P0IA 1UBHS 4JC8A 4O2AF 4PNZA 1Z22A 2PRKA 3NVKI 1YQXA 4MARA 2ZWMA 4QVKA 3KTAB 4EKDA 2IL1A 4U7GA 4A16A 2P91A 4JH0A 3ZN2A 4PYIA 4PINA 4C4OA 1C14A 1DAGA 2OBNA 3PK0A 2PD4A 5IZ4A 2IYYA 1D1TA 3O8LA 5GVRA 3E3NA 4AM8A 1VE3A 3PNKA 1OX5A 1T8YA 5E1BA 3ONDA 1AS3A 3I2JA 3AEZA 4HQNA 4M88A 3V4PB 4A7PA 4YJ3B 3RVMA 2BEWB 1OD6A 2V9CA 1CLUA 3VPFA 4DV7B 3DB1A 2AJLI 3JD1A 4OL9A 3ZWOA 4W5QA 3GCZA 1N1EA 2CFSA 3I1JA 1NW8A 1ZL2A 2QT1A 3LVRE 5IK2A 4ZANA 3F5FA 5F35A 1QLJA 1U9IC 3IELA 5FH9A 2B9EA 1WHSB 2O8EB 5MN6A 2HRZA 1XK7A 1LPPA 4BQQA 3FZNA 4V1CA 1ENPA 1ULTA 1AKEA 3WB0A 4A27A 1ID8A 3GY0A 3DTVB 4DV5B 1ZJZA 2BLNA 2DZDA 4MYDA 4KVGA 2AJBA 4ZC1A 1OWLA 3TQTA 1UKEA 1YONA 3U7IA 2VPYA 1Y1KE 4DHEA 4WZ6A 1C8KA 3O82A 1INLA 2EP7A 4YCJA 4F4UA 2VHZA 3WTCA 2C54A 1V1RB 1I13A 2GN4A 3HXPA 5IF3A 1NQWA 2XDQA 2VSQA 4FX2A 3OC6A 2O2IA 4J6EA 1V5WA 1CY8A 1LFDB 3M3HA 4KQMA 3TQQA 4QFDA 1MOZA 1YMUA 4P5DA 2RKOA 4NSNA 4C0AC 2NXJA 5EQFA 1LW6E 3TLYA 2IHVA 4FGLA 3CURA 4Q12A 2Y99A 1JQEA 2BKAA 1M0SA 4YALA 4YLEA 4F91B 3O1JC 2K2WA 1Y89A 4IGEA 4H9GA 5JAIA 3F98A 5JNSA 2WE7A 4OHRA 2VC2B 2VP5A 1IATA 3VU8A 4IVRA 4HNSA 1A82A 4I4NA 4JMLA 3Q0TA 2VHYA 3AM5A 3MXTA 2GZAA 5EVCA 4GDFA 4WESA 1KYYA 1QG2A 1FVFA 1EM8B 4Q03A 1BHO1 5MFZA 2B8WA 3OZAA 5L9AA 4FKMA 1BKSB 1MJ5A 4LMRA 3WYBA 3HM2A 4RMJA 1G5FA 2YJ4A 4BLOA 2ONYA 1PNQA 2WMOB 3PX3A 2O7NA 2OV6A 2Y0BA 1M6VA 2B94A 3K72B 1TJNA 1ZEJA 2WFZA 3AMVA 3WWEA 1W4LA 4C03A 3GDFA 1YIAA 4KXFB 4TWJA 2EW1A 1KI6B 2HMSA 1GR1A 3Q6NA 4N54A 3DPUA 4R8SA 5EOVA 3WDMA 3P4YA 4V0SA 4EGAA 1QCDA 4B3IA 1ADBA 5EIAA 5AKZA 2IPAB 5CFPA 3U4MA 2DBVO 4TS4A 1WHTA 4HTFB 4Q7MB 2VK8A 3LHDA 3DC7A 2OUIA 3VI3B 1YHNA 5B57C 1RTTA 2E4XA 1QK3A 1RAHA 3TSYA 2G3YA 1S8NA 3VGJA 2W48A 4BRWA 3A6GA 5CEEA 3OFND 1RQRA 1JHAA 5CNIA 4IQ0A 4GPBA 5DRYA 3TZQA 3BL8A 4D8XA 4NXNB 3RC3A 1GQYA 2RHBA 4W1QA 2VDRB 2HJSA 3MSXA 2YFQA 3BBPA 3WJ1A 5JI2E 2OO3A 1GTVA 3CC8A 4L8WB 4PXAA 1WKBA 3EXHB 4R68A 5EMLA 5FEUA 3MWFA 4ZVUA 4B3SB 4EI2A 3K6KA 1DZIA 3N2EA 4GI5A 1B15A 1V5GA 4D4IA 5IBPA 3COJA 1VJRA 1URPA 3CLRD 3EGDA 2REBA 2DBRA 1A97A 4WKPA 1N4AA 5LQJA 3TDNA 4CLHA 4OUDB 3RWOA 3N2GA 1IPEA 3F6YA 3NVMB 2VJDA 2B2NA 3OQIB 5ALXA 3UANA 5ED4A 2GF2A 4W99A 1N7HA 4QPPA 5K3CA 1N32B 1R00A 5HM8A 4X9XA 3SKYA 1JXQA 2VQFB 3C1OA 2YIJA 1EJ2A 2I4RA 3OLWA 1OPXA 1SXJC 1YBFA 2AYZA 3GVPA 4ZD6A 4Z5XA 5HX7A 4EY7A 3IE0A 2ILTA 4K9RA 3TXYA 5CDFE 1K5DA 2QJOA 4FTWA 3JYHA 1UEXC 2VQDA 1NXVA 1J20A 1UBTS 3D5EA 1OHHA 1SCAA 1GSIA 2OAGA 3L4JA 2BYTA 5CYFA 4MQFB 1GY8A 2H63A 2MINA 4BV3A 3BAZA 3UMYA 3WLIA 1TM2A 4IYRA 5IZCA 3IILA 3PQ5A 4C6HA 4B46A 1M0EA 1EAYA 5DCWA 3L1JA 1XDGA 2J3HA 1OQAA 1LBIA 3AWDA 3DZHA 3L6CA 1M6HA 5AW3A 4L15A 3VNRA 3ZWDA 3VHQA 5FNZA 1UMDA 3B70A 2BLLA 4EHKA 4OYRA 4W9NC 3WWDA 3JARB 4CM7A 4EB0A 4L0DA 1PK7A 2GBIA 1BDJA 2JH8A 3NCTA 4EHIA 2HCTA 2V7WA 1RFLA 3NUGA 3VR2D 3O9MA 4RELA 2O7RA 3CGGA 3LUFA 4WKCA 3WRWA 1SUBA 2SKCA 4Q66C 1NWHA 3B8EA 2YJTD 3JX9A 5TPZA 2XQIA 4N8SA 1G5RA 3E9MA 3RI3A 2R8XA 2FRDC 1H69A 1DQNA 1WNFA 3EHDA 4R4JA 1PR4A 4RSGA 3E7WA 2XHZA 1HT2E 1QO9A 2PTGA 3AG5A 4LXGA 4ME6A 5A4DA 1JDVA 2QYSA 2J59A 3FNBA 5HDBB 2CKDA 3T41A 1JR4A 1EUCA 1PDVA 5GGYA 5TY0A 1JAXA 2XPCA 2JHCA 3OZTA 1XDSA 1VHJA 3U1BA 1D4AA 1XZCA 1CR2A 3FCUB 3T1OA 3C6ZA 2NU7A 1TD9A 1QM5A 3D8RA 1CZNA 2JL1A 2N42A 4G37A 4R9NA 3IPCA 4QUHA 5J9FA 5JMPA 3WGGA 4K28A 4PSAA 3GGCA 1LVHA 2JAUA 5KVQA 2ZM5A 3IQHX 4C4YA 1J42A 4ZAFA 4WEQA 2A2ZA 5GOZA 3W9BA 1CULC 2B6HA 1PYOA 4CZ2A 3W4IA 1TZ2A 2QVXX 3EYWA 3OP1A 4E6PA 2A3RA 1PR6A 2FHSA 4PX5A 4XQ0A 1KOLA 2ADFA 3UW3A 1X7HA 4HUQA 1UWKA 5H5JA 5JH7F 4XFKA 4C08A 3F8TA 4IJKA 3V9AA 1C30A 4BCBA 4KMOA 5HJ2A 4BO3A 3MB8A 1N9KA 4XWWA 2HDWA 5HK9A 3L8ZA 4UUAA 4KXYA 2UV8A 1E1DA 2FPXA 3W34A 1PS8A 1YZKA 5EHXA 5JXGA 2IUTA 4C7KA 1BYIA 2IY9A 5BR7A 2R85A 1NKTA 3IJ5A 2EARA 1NE2A 1VSQA 4QAJA 3ZYCA 4DJ5X 2HDHA 4JELA 4G5YA 2PRZA 1OILA 2EW2A 3KHTA 3WLHA 3TR6A 4U8GA 3WZLA 1HRDA 1ZD5A 1E6WA 2OHHA 3BD9A 4RABA 4YRNA 3VM6A 2VDJA 1DFGA 1I3LA 2BEJA 1FFWA 1MGPA 4KFRA 1KS9A 5C4IA 1GUAA 1E9BA 5CBPA 4K0KB 1X8LA 3NHUA 2XYPA 4WZBA 4BWFB 3A3KA 4L73A 2LV8A 1CVRA 5H9VA 1G0NA 2I1WA 1XMSA 1EA5A 2QQFA 2GNPA 3DDCA 4IUYA 2NYUA 4QARA 4RY8A 5A06A 2CNWD 5HOEA 1M33A 1DTSA 2DU8A 1IMJA 2BEVB 2F3RA 1GILA 1N0IA 2QTRA 4RF2A 4YH1A 2O2SA 2J4FA 2AFHE 2H29A 2O50A 3C7TA 3M4JA 3R7FA 2FRVA 3DONA 2IHKA 1QDEA 1M2GA 3ZWNA 1GXSB 3CJRA 4FGKA 3KWLA 2BELA 2RCYA 2C8KA 4EJMA 5J3JA 3A1CA 2Q3DA 1NFFA 1NJ5A 3UTCA 2QM7A 2BKUA 4JYPA 1UFQA 1QHGA 3PHIA 2IIQA 2G0TA 4CIWA 4XJSA 3CR3C 3GYGA 1ZR4A 5LXTA 3RARA 3C6XA 2HHCA 5JO9A 1M2NA 3V1TC 3P9XA 4LHXA 4MVJM 1GZ4A 1A96A 5JPDA 1NULA 2DFLA 3FLBA 1R37A 4TRJA 4XVRA 2ORIA 5J2UB 2GRAA 5AQEA 3JYQA 1EUDA 1O0SA 4QBGB 5K5EA 3U4IA 1OLXA 4FWIB 3MCTA 3N2NA 4NTZA 1QLHA 2ZI9A 3W1EA 1A7JA 1FRFS 1MA0A 2A9QA 3ODGA 3STXA 3UYKA 1E7YA 4J0IA 2DULA 3A25A 4LC1A 4YECA 3HZRA 2ABWA 1NYQA 2WTEA 5DYYA 5I8PA 2FFJA 4K8OA 1Q3KA 3ON5A 4Q7LA 1F5NA 5MHTA 4QYSA 3VJRA 1E3JA 3UB3A 1P5RA 3NEAA 1DEKA 1R4AA 4YAEA 2B8NA 4ZOCA 4F4CA 4YWJA 4YUAA 5JD5A 1HT3A 3EMDA 3UUEA 3I52A 4BO2A 2R6DA 2Q1XA 2HI0A 2H52A 1PL8A 1IY2A 3OFVA 4U7WA 2WHEA 2JGJA 5LP6A 1IM2A 1MW9X 2IHYA 4N5NA 4ZOBA 3G8DA 4HWGA 5LCXA 1FDWA 3PXDA 1JBKA 1R0SA 4B1FA 2C98A 2RHJA 3D6JA 3IEVA 3A9UA 3IIJA 3QELB 1OYOA 1VSVA 4ZAXA 5T57A 3SC3A 1QGED 4P31A 4JWTA 3T1VA 3VXKA 1U9JA 3JPWA 1KJWA 4LWZA 1GDTA 1FL9A 2ZJ8A 4ZCPA 4LVCA 1Z7WA 1Q14A 1JIQA 4QYIB 3WISA 3MK31 2ODEA 3D4PA 4IY1A 3RSLA 1YFJA 1AV7A 3HVRA 1CUBA 4LF8B 2ZS9A 4BUZA 4IBOA 1FMTA 1DPGA 5HMLA 3E1KA 3Q7EA 3EWSA 5KJCA 3CZ9A 5TMDA 2A0KA 1WKVA 4RVGA 2OR3A 3DW1X 3Q9NA 5IBRA 5L7WA 3QOWA 1L1EA 1NW6A 4CV3A 2D5IA 4DVJA 4RHYA 3MMXA 4RM3A 1XMPA 1VMAA 1JTFA 3ZJYA 1LZLA 3KTOA 3B6ZA 5FWXA 1U0JA 4D9MA 1KJNA 3R0XA 4PXSA 1TADA 1U28C 2AD1A 2X41A 4BMXA 4EL0A 2VHXA 1NY6A 1IEVA 3FVVA 3O4GA 4RFVA 2BDUA 4DBLE 1VE9A 4IXWA 3LK7A 3DMRA 5BUCA 3FWYA 4EB8A 1ND5A 5LKRA 1SD5A 2FJPA 3GARA 4M0DA 4U4AA 3TEMA 5PNTA 4YRBA 2J3EA 5I9NA 3RC7A 4EECA 2CFCA 4EVSA 1TQ8A 3A31A 4NG4A 4ZFNA 2RK4A 1T0BA 3AOEA 4D56A 1DKPA 1YGPA 3BHJA 4RZUA 1D03A 4TKUB 2H1VA 1TJ4A 1K8XB 2B5OA 2XEDA 3VOTA 4EZIA 2H92A 3KKEA 3KOOA 3MN1A 1IDN1 1V4VA 2QUHA 1XZMA 4PQYA 3KFLA 4RACA 5F9MA 1A8UA 1JYSA 1P1BA 1QFZA 4I1PA 2HBQA 2I9KA 3PFBA 5DNWA 1W85B 2BCGY 3DBHA 1MH1A 3IA7A 1C5KA 5K2MA 4HZUA 1C8VB 4F9EA 1IN4A 4NPCA 5DM70 1A88A 1P5ZB 5L8VA 1R5JA 5MF6A 3TBKA 2FR1A 1EAMA 3AB3A 3SR3A 4PRZA 5JE8A 1E9CA 3H4IA 4FPXA 5DYNA 5ALEA 5DW0A 4QHTA 3ED1A 1DUSA 3LXXA 5AESA 2IK8A 3LZCA 3S2GA 2W2LA 1NF2A 1V16B 1YCGA 4HKTA 3DKRA 3FUCA 4F6RA 4HYEA 5LYJF 1K98A 2G08A 3D3WB 4OYLA 2NXWA 4B47A 3NQ41 5TQ0B 2W8ZA 4R2MA 5B58C 1EBFA 2BWJA 1UAGA 4NVRA 4QPCA 2YWHA 3RYHB 4QUAA 4YP7A 4LRWA 3RK4A 1E9RA 3NAGA 4KC0A 1NI5A 4NBUA 3ENVA 2VF5X 5H70A 1PYDA 3Q41A 1LY1A 1ML3A 1Y3FE 1AUOA 2F9LA 4UUQA 1TVCA 4IFIA 4M46A 4WFIA 3PA6A 3WMXA 4KNYA 5GJBA 2WYVA 4I9UA 2B4KA 5EA2A 1OX6A 4Q4LA 2DMRA 2RCNA 3PUZA 1PD1A 2V59A 1ZZEA 4BVLA 4D6XA 2JHAA 2IYQA 1NN1A 4RKWA 1SVNA 1H2FA 4QPJC 2WMDA 4UJ5A 3ZGYA 1H2HA 1QFYA 3A6FA 1C29B 4LDNA 3CWCA 1N2BA 4MVJG 4POOA 3QTLA 5IN4A 5HRUA 1CW2B 4CMHA 3PRJA 4FUTA 4LRYA 3F7NA 5KPJA 2P6NA 3LI2A 3OI7A 3SXPA 2B1JA 2WM2A 2FWRA 5F2OA 4S0ZA 5CH5A 1GA4A 3IQWA 2ZJ5A 2NUAA 1SKMA 2VJYA 3GAMA 3PF8A 3M89A 4H2DA 4MK4A 1MNAA 3M9LA 4LGMA 4KSYA 4C30A 1IONA 2G4LA 2FKNA 4DQUA 2QLBA 2ZQ5A 3I01M 4AWBA 3I83A 4R7TA 1EHCA 1GPAA 1GVHA 1KFKB 2XT6A 2IOYA 2RAUA 1RZUA 4C5AA 3OZDA 1ZD4A 2FEWB 4PLCA 3UWPA 4PZLA 4MGYR 1EVZA 1SCJA 1I3KA 4J8PA 4R3NA 3RODA 3OOWA 5DK6A 1UOEA 4DG5A 3ZJUA 1RNLA 1E7QA 2YV4A 2VUSA 3A4VA 4ONEA 4Z0NA 1RWVA 1XLTC 1SWVA 3M81A 5FUXA 4EEKA 1UIRA 4OD0A 4RQAA 2I0FA 4C7BA 3L40A 1YIDA 2XMGA 4I50B 5I7FA 3DVAA 3FUUA 3NBYC 3H0KA 5FBKA 1IC6A 3T61A 1XD8A 3LQKA 2XMPA 3RF6A 4CIDA 5K3AA 1VGVA 5AW2A 5C7YA 1SO8A 3C5VA 3TDKA 2C03A 5CT5A 5HNKA 4G0PA 4DMKA 1HEYA 2CF6A 1Z8DA 4N6OA 5DMXA 2IS2A 2RHHA 3AF1A 4MIOA 2SHKA 1QTRA 2MSWA 1MOPA 4F04A 4LCBA 1OA0A 2O2GA 4JOSA 3HJUA 2XX3A 2JW5A 1J4AA 5EL0A 1YU9A 3EOAI 1CE8A 4ERXA 3PFGA 4N0QA 1Z9BA 1U2PA 4HDCA 3D8SA 2HSZA 2WM3A 4S3MA 3IEMA 4RZSA 4QFCA 3HWX1 3NHYA 3RR2A 2Q6KA 3JSXA 1VJTA 2PH1A 4NPHA 5D7NA 1N2CE 4ZRDA 1G2QA 4UEKA 4UMVA 5HCUA 2CB9A 5BSRA 4ZGGA 2DECA 2A58A 3K1JA 5TPWA 2HV9A 3H4MA 4B5LA 4WADA 1LZKA 4FBGA 4JUIA 4PNPA 4F3CA 3G9ZA 1IXRC 4RBNA 4AKIA 3WIEA 4BYMA 2XXAA 2A0YA 3G8YA 4AKGA 5DTMA 3V4ZA 3I2KA 5KDDA 1M67A 1VXOA 4CLOA 4HLNA 3DBLA 3D0OA 2H07A 2RH4A 2QP9X 2RGEA 2GCOB 4GHWA 4PCVA 4QC2A 4TS9A 1GEGA 5LA6F 3WRYA 4D6PA 4PQEA 2PPLA 5AVXA 2PXXA 2DSNA 4I81A 3WNBA 1NL3A 4WTOA 3GPLA 5F1YA 5A3SA 3ZUPA 1GKKA 1N2OA 3RAPR 4BBZA 1OKKA 4R0MA 1TYZA 3BQ9A 4G56A 4XIYA 2V5UA 4BVJA 5J4YA 5KNCA 4CXMA 3HYSA 5DHUA 3LX5A 4CG1A 1XQWA 2RGCA 2XYHA 1X92A 4R2IA 2YOFA 3KQHA 1PL0A 1IM8A 1O95A 2AJCA 3FXAA 1CZUA 5HVNA 1ODIA 3EMVA 1J39A 1VPVA 1X8JA 1I2DA 2C04A 2GM9A 2QVYX 2Z5FA 3PHHA 3TO5A 4BNGA 1AURA 4CGZA 2Z9DA 3I30X 3O1IC 2N0SA 4KLNA 2JJQA 4X7RA 6REQA 2NSYA 2IZ1A 3CTPA 4JKIA 4NH4A 4ER5A 1XBTA 1M34A 3ET5A 4F4JA 3F6PA 2A92A 4JBGA 4BFXA 4G4JA 4M49A 5JW6A 5LJLA 2YJ5A 3N2IA 4X6YA 3V7UA 4ZTUB 2YCLA 2JANA 3JR3A 4E6EA 4MRMA 3MC1A 1UT5A 2H0RA 5B5SA 1ZUIA 2QAGC 1YS4A 3ZU6A 4AP6A 5ELLA 5GOTA 3RS8A 3OVMA 4O1HA 3L82B 1IBCA 2CHUA 4ZRNA 5IVDA 3LX6A 2IZ6A 4RKQA 5HIJA 2CSUA 2QW8A 3EA5A 3T06B 4I8DA 3UZUA 3O4RA 4E0BA 3DD1A 1EE1A 2PS3A 1ABEA 1NMYA 1YT5A 4GP9A 4BRZA 3ABRB 3NGLA 1A5TA 2DWCA 2P0YA 1Y6ZA 1NQ5A 3EDCA 4Z9BA 3S1AB 4DLXA 1O0CA 1UBUS 3ZDDA 1IAQA 1BJTA 3THSA 3SX2A 1R0RE 1HE1C 1GSOA 4BPRA 1VFPA 4TWRA 4LNHA 1YVPA 1W87A 3H2SA 4CMEC 5C1IA 1FTYA 4W4TA 2X6RA 1TW2A 1QO0A 3F0TA 1PI3A 3U4AA 5EJ5A 1WEKA 3LYAA 4QGBA 3U0VA 4QM7A 1IULA 4RA9B 1DO0A 1JA9A 1VYTA 4EYOA 4QTYA 3L7NA 2QUBA 1IIBA 4HBZA 3CBGA 5CCDA 3S2ZA 2ZB3A 4N9QA 1NR5A 3VJLA 5JSKA 1QGUB 4DG8A 5TQ2A 1QQ7A 4BCDA 4OGFA 4Y1EA 4C0WA 4DJDC 1A9XB 1B8PA 3W79A 2JCBA 1RSZA 4OATA 4E33A 3F73A 1NURA 4S12A 2HA2A 1A8HA 1G20E 1G5QA 2R6AA 2YV5A 4OJMX 3SOZA 3CYFA 3DF7A 1AC5A 4QDKA 5AVUA 3FOBA 3Q1KA 5D6NA 2QR3A 3KQQA 1I36A 2VTKA 2JHFA 4BVKA 4B2PA 5JNRA 5BW8A 4GSKA 1VCOA 2V4UA 3MELA 1GPLA 1RE1A 1E96A 1OW3B 2GF9A 2HA0A 2Q3EA 3LY5A 1MAVA 2Z6UA 5FF9A 3QF4B 3P9NA 4Y2JA 1G291 2QTGA 1SBYA 3CF4G 4MV4A 4J0DA 1HDOA 3F7MA 3ZLBA 3M4YA 4EG8A 3L0OA 1KJ9A 2AX3A 4WOCA 4S24A 3Q72A 3KPYA 3NKLA 1FNCA 3SGLA 5AVTA 1SRQA 3V55A 4TYYA 2JAWA 5CYPA 1W35A 3CCCA 2H16A 3V3KA 5JNUA 1CUEA 5HKOA 5CW1A 4JI4B 3GDHA 4K3UA 1IE3A 2UAGA 1NRXA 1PW5A 5E8JA 3GA7A 4N4AA 3BIWA 1GUDA 10MHA 1VIAA 2F4VB 3GPBA 3IHTA 4CG2A 1Z4NA 3L4KA 2PD6A 1X1RA 3SY8A 1RQPA 3UK1A 4L9SA 421PA 1EFPA 4CW7A 2QTBA 3UK0A 3MWDB 3Q5GA 4B76A 3BCHA 4ZT6A 4BUJA 2J0UB 1LRJA 1ZOPA 2J07A 4KV9A 1QHSA 3T3DA 1L1RA 1IEXA 2V1UA 4M9QA 1HGXA 2X0KA 1WF3A 2R11A 1YAHA 1XEXA 3HWRA 1X2BA 5JQGB 3KELA 5FTLA 5G1NA 3ENNA 1M54A 3P0EA 1E6KA 4NV0A 4AQDA 3GVIA 3TUZC 1ZA1A 2XGSA 3II6X 2HRCA 4DKJA 2H7VA 5C0OE 5I45A 1TIKA 3ANTA 3EOZA 2OV2A 4BU0A 3BMOA 1WE2A 1X9GA 4NEHB 1M1YE 3R4CA 3RWBA 5BVHB 1U8FO 4RTOA 5AHXA 3LMKA 4B45A 1PFUA 2W6IA 2HMAA 2WAYA 1D1PA 3N2YA 3QJ5A 4MMYB 1ZN8A 1JDJA 1LS6A 1XE3A 3LDAA 4QXRA 2JFOA 2VEOA 5FR1A 5F33A 5I3ZA 1BJRE 1JR3E 1K7SN 1ZK1A 5DEOA 5LQNA 2Z57A 2ISCA 1R9MA 2CXHA 1W36B 3ROKA 2IODA 1JHXA 3N70A 3BXFA 3KO8A 1MGOA 1EK6A 5IHXA 4YVFA 5J2TB 1Z0AA 4Q4HA 1ISIA 2QX4A 4Q39A 4Q7QA 2ZBEA 5K05A 1PT6A 1HDYA 1GGKA 2QN1A 4M1WA 2ODNA 3CVWA 1WP4A 3QPDA 1VDMA 1V11A 1YNSA 3RYFB 2YL2A 1M8JA 2W6PA 3O0DA 5T41A 5B64A 2PDAA 3RS9A 5B3LA 2ZAOA 5CFZA 2BMWA 1D5CA 1KC3A 2FX5A 2Q1SA 4LCEA 3RVJA 2HQ1A 3ZWWA 1NMQA 3CRMA 4X91A 4J7XA 3ZDAA 2PTHA 1Z0UA 2NO9A 1NE7A 3GN1A 2QLNA 3JAKB 3GRUA 3K32A 4NYMQ 1UPTA 1P75A 1PTKA 2ES4A 3KTDA 3NYIA 3DGEC 1AA6A 5ECYA 2GJKA 2ZTLA 3L7IA 4LJSA 4TSRA 2EHDA 4IXTA 4IKEA 1Y6GA 1E8DA 1PYGA 4TPKA 2W98A 4FGSA 1TM1E 4LHYA 1FP4A 1YZQA 3AR9A 2GXSA 5FLEX 2ZETA 4Q7JB 4Q9HA 4CG3A 3E9YA 1S2GA 1NIJA 2CZGA 4F2PA 2JIOA 4CV0A 1ZD1A 1GLVA 4DBLC 3AV0B 1NBAA 3JD4A 4Z4EA 2RARA 3LYUA 5DIZA 1ZINA 4REQB 2AKAB 3D31A 3RJZA 4D3ZA 1EQUA 4LTMA 5EKUA 4CQMD 4BO6A 3BFVA 4K6HA 1QZTA 1WJGA 2FAXA 1Q44A 1LLFA 3B5EA 1JFFA 4A15A 2CVQA 2IX9A 1DUIA 4LBVA 1L4NA 4AJHA 1KMMA 2GEDA 3Q88A 5IN5A 4F86A 2CXNA 2ZI3A 1FS5A 1E0AA 5I9TA 1RPZA 2DT5A 3IH5A 4OCZA 5DT9A 1KNXA 3CUWA 3WBFA 4ARIA 3C1AA 2YWDA 4F7DA 1E3LA 1XFAA 2LCFA 1RLIA 2MYPA 3W5VA 5JI3E 3L93A 2X9VA 4HP8A 3VSCA 1PGNA 3UG7A 3WV4A 5JD6A 3TTTA 2ZSIA 2QV0A 1M2WA 2VXYA 3NDBB 1R7RA 4DA6A 3QEBZ 3CPEA 4XPZA 2VPZA 4CI0B 2A9FA 1G8HA 4I6GA 4OHOA 4QUIA 2Y0CA 4R5MA 3DE7X 1TEZA 3HPQA 4UBIA 2R4TA 2C0QA 1YR8A 2E4WA 3IDZA 2QS9A 3H3XA 3M5CA 3ZBTA 1I3NA 3ZWVA 4CR8A 1BVYF 1SC9A 1LBQA 1DPFA 2HPVA 3IOEA 5IJZA 1H42A 2ADOA 3B85A 3LPMA 4V1CB 2YW9A 1BFKA 2A9JA 4QHYA 5KCMA 4ZYUA 1C9DB 1AHPA 4G1FA 1QF9A 3TB4A 3G0HA 1A27A 2CLCX 3ZWQA 4EHHA 3WGMA 4LAFA 3L01A 1ATIA 1HEIA 2JZOA 2VQSA 5KTMA 1UDXA 5FI5A 1YUNA 2FEOA 4HLDA 2ZE5A 2QL9A 5LQCA 2UUBB 4ZAZA 2WIFA 2BFDA 3IAXA 4RD2A 1NASA 1JQ3A 2XDQB 3MEQA 3O8CA 1TAQA 3DOFA 3UFXA 5IFKA 1DMRA 3QRWA 2PO5A 4FUQA 4Y6LA 2NADA 3SEQA 5IH7A 3FGPA 3V8QA 3VI4B 5BNIA 5E0OA 2IP1A 5G3ZA 2ZAGA 3AL0C 1IUKA 3I0NA 4H77A 1ZGAA 3PGLA 1OZGA 1QKIA 1TQ2A 5CUQA 3QXJA 1SZJG 1ZRMA 4BLVA 1NVTA 5B30A 5HE9A 3FJOA 5H83A 1TTTA 1BAPA 3K70B 1TW3A 1NJ8A 2B30A 2WIBA 3DXFA 3EFOA 3N8NA 1ZC3A 2F67A 2HGSA 4I1UA 4WESB 1SJ9A 5A2GA 1LLDA 3OTQA 3PXEA 4TMYA 2ZKIA 5EE3A 5C1DA 4US1R 1IJBA 1H8EA 4DR1B 1CZHA 4MJ7A 1CNMA 1VB5A 4OAOA 4EMUA 2XZTA 4GVPA 5HDQA 2OD7A 2QMHA 2IVFA 2BHLA 2X2PA 4YMGA 1BVHA 2I6GA 2BISA 2WTXA 1M6VB 2YYSA 2XXJA 4RLQA 4UBNA 3I2FA 3ZD9A 2QOEA 4PTZA 4RSRA 4WK2B 1GNQA 1P1CA 4WA7A 3A6KA 4ZZ1A 4EP1A 2QZJA 1JFRA 4LE2A 4RK0A 3UHAA 4M76B 3OEHA 3BCRA 4KP7A 2XD4A 4LSWA 2PL5A 4OUKX 3T7JA 4AWXA 1W0KD 2HBYA 1ETUA 2NSJA 4GLBA 2P27A 2G77B 2F1JA 2X2EA 2ZB2A 4KXLA 2SICE 4RL4A 5L4SA 5EWLA 1YMQA 5HE8A 3VBEA 4EHJA 1N6LA 1E79A 2C4TA 3IVXA 4B7XA 2ZRGA 3R3WA 3KAPA 3I92A 4J0HA 3QSYA 1Y82A 5FYDA 5D8DA 1V3VA 2YXEA 3WK7A 3U6BA 2AVDA 1TF2A 3I23A 4NU6A 1XZQA 2DKOA 3SDSA 1GLNA 4B6SA 5IXJA 1G42A 1ZDMA 3W9SA 1F0KA 4PLPA 3H3JA 4F60A 1SHLA 3WYAA 4R6XA 5B1HA 6Q21A 1NQUA 2DPMA 5A3VA 1FTNA 3UK6A 1K6IA 1XMQB 3W2GA 1HTTA 4EI7A 5IM4F 1L4MA 2XE6A 3I2YX 4N8EA 3UO8B 1KZ1A 2WWHA 3KQSA 3Q0IA 3KK0A 4OKNA 4EW3A 4LF7B 4OU4A 4YT8A 4YJ3F 1HT0A 1SAYA 1AF7A 1EXVA 2Z83A 1VCMA 4YAKA 4G9EA 1VCHA 1E2FA 2C9CA 3EGDB 5DN6A 5JV5A 2B1QA 4A0HA 5EMJA 4QRDA 4A2QA 4URXR 2R96A 3N2GB 4P2BA 3CRQA 1UODA 4AMZA 2P3LA 5AJWA 3VBCA 1ARZA 4CFSA 4J1NA 1XZIA 1U90A 1VE5A 2JB9A 1Q1ZA 2QX7A 3ELBA 2QL6A 2NTJA 3PI6A 3X3HA 1EJBA 1GSHA 4DSZA 2ZUFA 4AUNA 3KBOA 4PIMA 4LF4B 1LTHR 4UUNA 1EZ1A 1RRCA 2JEYA 5ALQA 3QVOA 1YTUA 1KYZA 3LW7A 3HSSA 3TLMA 4F21A 1EFUA 1T4CB 1ZM7A 5FOWA 3SOPA 4YRFA 2M2IA 4BVHA 2XUZA 2CEAA 3C3BA 3D4IA 3R6LA 3GGOA 2MINB 1PJAA 2GBGA 3EJ6A 3VU9A 4QSMA 2M1ZA 1A2BA 3I9FA 1P0CA 2OKCA 3BREA 4DREA 5CVCA 2L19A 2VXBA 4KQXA 4KACA 4EJFA 2O8DA 1IPHA 1M7BA 1TCVA 3DZKA 3PGA1 4QX6A 1DWQA 1RYFA 4Q1VA 5T4FA 2ZYIA 5BMOA 4FJ1A 1UMDB 5KPDA 1OMOA 2AZ4A 2ETXA