1ESOA

Monomeric cu,zn superoxide dismutase from escherichia coli
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
154
structure length
154
Chain Sequence
b'ASEKVEMNLVTSQGVGQSIGSVTITETDKGLEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGPEGAGHLGDLPALVVNNDGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGGGERYACGVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CU, ZN SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Unique structural features of the monomeric Cu,Zn superoxide dismutase from Escherichia coli, revealed by X-ray crystallography.
pubmed doi rcsb
total genus 30
structure length 154
sequence length 154
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1esoA00
3ECVA 2VR8A 1SOSA 4OH2A 2WZ0A 3S0PA 3GTVA 1OALA 2K4WA 1BZOA 2AQRA 1N19A 1JK9B 1JCVA 2AF2A 1F1DA 2Z7YA 2AQPA 2AQQA 4U4IA 1JK9A 1P1VA 3F7LA 2V0AA 3KM2A 1DO5A 3QQDB 4L05A 1IBHA 1KMGA 5KBLA 3KH4A 3L9EA 2SODB 3QQDA 2R27A 3HW7A 1HL5A 2GBVA 1OEZW 3MNDA 2WWOA 2VR7A 1B4LA 2AEOA 1L3NA 1Q0EA 1SXNA 1UXMA 3HFFA 3ECUA 3KBEA 1BA9A 2WYZA 1XTMA 4N3TA 2C9SA 1SXAA 1PU0A 1U3NA 1E9QA 1S4IA 4FF9A 1SDAB 1EJ8A 3H2PA 5CU9A 3GQFA 2XJKA 1E9QB 4B3EA 2C9VA 5KBKA 4BD4A 1Z9NA 4A7QA 1CBJA 3MKGA 1F1AA 2WZ6A 1SDYA 4MCNA 2WYTA 2XJLA 1YAIA 3HOGA 4A7VA 1AZVA 1SXSA 2APSA 2WWNA 3ECWA 2ZKYA 4A7GF 1TO4A 4A7UA 2ZKXA 4BCZA 1DSWA 4MCMA 2AQSA 4A7TA 3GZOA 1E9OB 2LU5A 1E9PB 3KBFA 2VR6A 4A7SA 1FUNA 2WZ5A 3GZPA 3CQQA 1YSOA 1HL4A 1SXZA 1E9OA 3L9YA 1E9PA 1OZTG 1SRDA 2Z7WA 1RK7A 2NNXA 3CQPA 1N18A 3KM1A 1IBDA 1OZUA 2AQNA 1TO5A 2Q2LA 3LTVA 1IBFA 1PTZA 1CB4A 1IBBA 2JCWA 2WKOF 4BCYA 1UXLA 1F18A 3RE0A 3PU7A 3T5WA 1XTLA 5KBMA 3F7KA 1EQWA 3GZQA 1SPDA 1B4TA 3SODB 2AQTA 2E47A 2ZKWA 1QUPA 1SXCA 2Z7ZA 3K91A 3CE1A 4OJAA 1F1GA 2Z7UA 1ESOA 1SXBA 2E46A 2GBTA 1Z9PA 3H2QA 4A7GA 1YAZA 2GBUA 3KH3A 1XSOA 1COBA 2WKOA 4N3UA 3GTTA 2JLPA 1MFMA 1PZSA 1IB5A 2C9UA 2ZOWA 1OAJA
chains in the Genus database with same CATH superfamily
3K8MA 3ECVA 4M6NL 3RVXC 4B95C 2WLIA 2H3NA 3EYQD 4XCFH 4WWKA 2XOTA 4B3VA 2CUMA 3QBTB 4XPAH 3QZWG 3BKCH 3UH8A 1ANUA 3ZVVA 4FAAB 4PJIA 1IGCH 2VDQL 4RAUB 4YQXL 1RUML 3W9EB 4JREB 4HOMA 2N0KA 1THCA 4PLKC 4HWBA 4MX7B 1UOKA 3D25B 4UDUB 5DHVA 1MY5A 3GRGA 4HEME 4ISVB 3PE9A 4GSUA 3HLAA 1PY9A 5E4IA 4YVUA 3ZKMC 4OGQC 2WXGA 5F3FA 5CM1A 2XN0A 2AXJA 4NM8H 5DLLA 4ODHH 5AYTA 1D5MB 1OAUH 3MLZH 1TKWB 4M7JH 4M7ZC 2H32H 4M1CD 2D7MA 4QGYA 3T3MB 5A3IC 1QFUH 5D5MA 3TIDA 4QRBA 5ANMA 1MCOL 4WKZA 1SJHB 4V1DA 2Q3AA 1Y07A 2DDQH 3O4LD 4NQCB 1B0WA 1RUKL 4BEIA 1G7PB 2UZYB 3M1OA 2OL3H 3NIGE 5GGVH 4MXQC 3FFDA 4KVCH 4WHTA 1DBBL 3WHXB 3VG9C 2P28B 3HMXL 2AJ3B 3I6SA 3FHAA 2VAJA 1UWFA 1PX8A 5ISZB 1ONQB 4Y4FB 3D3VD 2QTEA 3NIDB 2B15A 3D2TA 2AK4E 3SCMD 4UT9A 5DEGA 5F7WC 3ZE1F 1A4JA 3FONB 4IMLA 1C5BH 1HE7A 4GQ9H 4OY9A 4M00A 3AREC 2K3HA 3ZTNH 4O5LH 1J9SA 4YH6A 1CFQB 4PRNB 5GGQH 1TZGH 4DPCX 5DTFA 5FOBA 1GYVA 4NZ8A 1WA2X 3OJDA 3WL9B 4LDOB 2ARJQ 3EBAA 3MLVL 2OAAA 1O6VA 4ONFH 4OZHA 4JFDA 4NPKA 2WZ5A 3VCLB 5AAWA 1AO7A 2CMRL 1YY9D 1ZDSA 5IESH 2H0FA 3O3DA 1FIEA 4Z7UA 3IF1B 1JFQL 1CG9A 3OGOE 1JZ7A 4PG2C 1N68A 1C7TA 3GSWB 1IAIH 5DJ8B 4LSVL 1JGVH 1UC6A 4OF6A 4GP8B 1A7RL 4I2XA 4ZUTA 5I82A 5C0EA 3CJJA 5A2AA 5BUAA 2J8UE 1GW6A 2QQNL 3FB5B 5HY9B 5FKAA 2JCCF 1JGLH 1QEWA 1OW0A 1S9YA 2FWOB 1BEYH 3D50A 3FQRB 4J28A 1A4CA 2CIKB 2CM5A 3BWSA 4P3CH 3VD4A 3MZTA 3NCEB 3RVWC 2G75B 5C7XH 5JOFA 3IDNA 4EIGB 2GABA 3FB8A 4LPTA 3SKJL 4W4NA 3KG5A 2G30A 2VDML 4PBWD 4AG4H 4AH2A 5IB3A 1A7NH 4Z95H 4QHKI 2ZUUA 2QPDB 2F5BH 3F7VB 4H5SB 2ODIA 3II1A 1MHHB 5I1GH 1AI1L 3GSRA 2OBGA 5AKSA 4N0FB 5D7IB 2JTDA 5JW4Q 3SPCA 3FQTB 1W72A 4A39A 3DO7A 1UURA 4DEPC 5LGJB 3ML8A 5KVGE 3S48A 1HCFX 1JVOA 2OCCB 1U33A 1S8DB 3MRFA 1BF5A 3KH4A 2X4UA 2Y6SC 3BIKA 4ETQB 1XCQB 5FECB 2XQYA 4LGPB 3UOAB 3EGDA 4NKMB 1P53A 4NPYB 2L3BA 2NLJB 1UM4L 3S9DB 3TYGH 4LSPL 4LSVH 4UINL 1GYWA 3EHBB 2HP4A 3D4YA 1OF2B 4G1EA 3K2UL 3TNMA 4PAZA 2FR4B 1F11A 4X2UA 1BFVH 1DL7L 3HR6A 1H5BA 4W9LC 2DQTL 2MTAA 1MCFA 2DH3A 1SDDB 3PNRB 1LWHA 3QUXA 4ONFL 3KDPB 1JF1A 1I7RB 1DCEA 1CI3M 2M2DA 4NUJB 5FYJD 5MENB 1MCLA 3GXNA 2CK0L 3U79A 3FF8A 3MXWH 1CFMA 4QY8B 3TV3L 4W4OA 4X4YA 3C5ZC 4ZFOL 3ARBC 3KPSD 3L3OC 4PRBB 5JYLA 2YGPA 1SDYA 2FUTA 2NW3B 4KOCA 3RGVD 5IB2B 3BLPX 3DTDA 5T1LA 1DVFC 1R3LA 3KD4A 3L1GA 2X12A 4PG9A 2C26A 5D6DC 3HHRB 4IMKA 3EJYC 3MBEC 1X4YA 2LU4A 1MJUL 3ETBF 4U7MA 3SBQA 3UG4A 3DX7B 4ODUB 2B5IB 4M6OH 3HNTL 3F65A 4EUPH 4L8BA 3U0PB 3CHXA 2YMOA 1M7DB 6FABH 2Y07H 3DBXB 3N43B 1XTLA 3ZO0A 3U4AA 3B34A 4B9IA 1SPDA 4BZ2L 1MW2A 1WE5A 3VFSA 3DXAD 3WTXA 3NJIA 3CE1A 5JPMA 4JFXA 2VMEA 3N44F 4YHOL 1MHEB 5C07B 1WISA 1MCNA 4L29B 4WVRA 5T5FA 5AQ0A 4HWNA 3SGJC 2P43B 5SV4A 2X40A 2EP6A 2J1KA 4WJKB 4LSTH 4J39A 4M6NH 2Q0ZX 4JO8A 1HXMA 2XWBA 2HRLA 4K94L 3PLYA 3TJPA 1GRWA 5D2LA 2BCKB 4Y7OC 4OQTA 1CLYH 1ZS8B 2CA4A 1L5GA 4WQOA 4IDLA 3ZE1B 2BSTA 2BMKA 1W9XA 3JZ7A 5LGYA 3EF7A 3WFEH 4AYBA 3UIYA 3B3IB 1O7SA 3HG0A 2ZSWB 5BZZA 3KJ4B 2WQUA 3QWQB 3LX9A 1AZUA 1U91A 1T0MA 2O1AA 2A1WL 1L7IL 3ARGB 4Y19A 1WEJH 4OTXH 3GYRA 3PGDB 3HW7A 2YBRB 1FO0B 5E6IB 5L8JB 1OB0A 2WQWA 4L8SB 2G9KA 4OSUH 2FGWL 4RZKA 3VRJA 1AQHA 3MV7E 3QEGL 1GKEA 5ACLA 3V7AE 3CVHH 3ISWA 5C0BD 3WXVH 2UX6A 4MJJA 4WI8A 3X13B 5IHLB 4CJ0A 2BXYA 2VLKD 4YNYB 3Q8FA 5CINL 2NY0D 3ZL2A 4LIQH 5KSAB 2KPNA 1FRGL 4JHUA 4QHNB 4DGWC 3WN5A 2HG5B 1KFGA 3L5JA 1FE8L 1USQA 4M8UA 5DJ8A 1UXSB 3QJRB 5C09E 3SGEH 3I6GB 4MYPA 1DVYA 3BN3B 3PWUB 4MAYB 4EIBA 5C86A 1A4KB 5DLMH 3SYPA 3BPOC 3VFNA 5GZOA 5ILTH 1L6PA 2GITA 2Y1ZA 4Z7QB 1RK0B 2FEEI 1JHTB 5DYFA 3FUKA 3AADB 1MVUA 4TQPA 4PGZA 1ROCA 4ZUUA 1OOAA 3FAWA 4BCZA 1FDLL 4FFYL 3NRFA 4AVIA 6FABL 2D0HA 4M48L 2VLJD 1ZT4B 4H20L 1FUNA 1QR4A 1MCWM 1HJBC 4U1JB 4E0RA 1UA3A 3QR1A 3S37H 2B0SH 2PR4L 3NP3A 3TYFB 4PGJA 4PJFB 2GSGB 2QPFA 1QBAA 3UJIH 1KULA 3RJQB 3UBFA 5GRJL 2Q2LA 4JE4B 3D18A 1AZCA 3A6BL 1D7FA 1CB4A 2YO3A 1JZ3A 3BZ4B 1S9WA 3H7BA 2ADYA 5BZWB 3SD2A 2CUIA 2F74A 4TOYL 4Z3FA 2XU9A 3CDZA 5CBEB 5LHDA 1AHWB 4CA4A 5BV7C 3ZRSA 4XX1E 1XT5A 4D3CH 1GJIA 3LQAH 1T7XA 2FECL 4QCIB 3IU4L 5DJ2B 5A2CA 4NAQA 5EUOE 3B43A 1ORSA 3IFNH 3OJ2C 5FYKD 3VWJC 1NC2B 3OJMB 4NWUH 4RVBA 5D1ZC 1K4CB 3QDMB 3CAFA 3A47A 8FABA 2JJSC 4PD4K 2AXFB 1UKTA 4Z8FL 4Q6IB 3WKQA 1F11B 4IRZH 1EHLH 4HAFA 1SDDA 1U93A 2UY6B 2EEXA 4F15C 1M2OA 3N06B 4UDUA 3T09A 4N2AA 4MJ5B 4EUPB 4JS7A 2V9RA 3VXTA 4MD0B 3RJOA 2E56A 3N85L 1ZD6A 1KTCA 3U4KA 1FP5A 3OAZH 1T0PB 5KTEH 1NCDH 1VJSA 1UD8A 4N90E 1YY9C 3BPOB 4JG0L 2NY6C 5C3IA 3W38A 4X5PA 3LH2H 3ZE0E 2VZ1A 3LB6C 5L4MA 4O2CA 3O6FC 1OAQH 1SQMA 4CVXA 2NY0B 1NWOA 3L6FB 1BD2E 2ZXGA 4GAFB 4O02H 3B9VA 2DMBA 3V5KB 3NIGF 2VXSH 3RTQA 5HYSG 2EIKB 5IOPB 5TE6L 3VVWA 4JKMA 1XXDC 3O6LH 3GGWB 2GJ6E 4TXVB 4Y9EA 5HI3C 1QVOB 5DZOA 4ES8A 1CU4H 4M03A 3ZOAA 2ICCA 1XHHA 4HFWA 1J5HA 2A2QT 2XN9E 1NCHA 4Q74A 2PW2B 1WUNT 1I1YB 4LGSB 4NIYE 3O8XB 5JW3L 2ZUTA 4NQCA 4Q52A 1G7PA 4WW1B 4NJAH 3D3VB 3LNHA 3QJTB 4LEXL 4OJFL 5KW9H 2YMTA 5A7BA 1YPZF 1RZJH 1UYWL 1WRFA 4L4VA 2H1PH 4FKHA 5SX5K 3MKGA 1IGTA 2CO6A 1A0QL 5C9KA 4MAYD 1S3KL 4I0PC 2FIRT 2JKTM 3UZEC 4FADA 2CDGB 3NYKA 4GG8B 4NHUA 2FYYA 4WSJA 4E41B 1A4JB 1HC1A 1A7RH 1A21A 1MRCL 4PBDA 1VSCA 4FE9A 3CH1A 1N64L 4C4KO 2DY2A 4QPEA 1ZT1A 1T6BX 1KIPA 1UG9A 1FYTE 2DQMA 4KTDL 1IFGA 5IESL 5GISH 5DUML 5CFAA 4MMXC 5DEFB 1GKOA 3P3SA 2VN5A 2AQNA 3P4NB 1CI5A 4L9LA 4N5ED 1IBBA 1IBGL 4ZAKD 1HQRA 2HRGA 1U8NA 1CLVA 4EI0A 3AXLB 1TNMA 2UYLB 3PU7A 3QYNA 3HZVA 3CU7A 1O75A 1P7QD 1IX2A 1J88A 1RZKH 4MBRA 4AGOA 4DQOH 5IMLB 2E47A 3Q2LA 2AQ2A 3QT2A 2JKRM 5CZXD 5FUZH 4OF7A 4PJ8D 5T5FH 2F6AA 4ETYA 5KG9A 3R19A 2YRZA 2YZ8A 4KC3B 4GXFA 5H8DA 2B39A 2ENPA 3I3EA 2AVGA 5AAMA 3ESVF 1AQKL 4BWTA 2JJTA 3O41B 3KNBB 4WI7A 4EEEA 3OL2A 1UENA 2C7UB 3FFCA 2Z31D 1KLUA 3KVDD 4CC4C 1QO3A 4KROB 4AE0A 5BJTB 2F5AL 3C60A 2GSIB 3DURB 4IW4C 5GGSY 1DTUA 4KJYA 4ODHL 3FSOA 5EN3A 4AM0A 5CD5C 1OGAE 2KLTA 3IBEA 4I0PB 5FEBA 3FO1A 1XF5A 3T6ZA 4XX5A 4PJAB 2Q3ZA 1MFCL 1JNLH 1U8HA 3US1A 1MVUB 3EYVA 3VFRB 2NRDA 3CFKA 4G8EA 3FT3B 5DD3L 1SQ2N 2OL3A 4P2QE 4KK8D 1WZKA 5EZOH 4JHAH 2H3NB 3L17A 3DWTA 1EH9A 3O0RL 3HN5A 4MD5B 2P8MB 4X0KA 4E9XA 2Q6WB 2FB4L 4AMXA 2YC1B 1FNEB 2BVOA 4PP2A 5IROC 2DQFA 4HUKB 4M8VA 4Z7VB 2RB8A 3CSFA 1ZVSA 2C7FA 1Q8MA 1D6EB 1J9RA 4ELMB 4KO6A 2BNQA 1U8CB 1ETJA 3HE6B 2ZNWA 4P4KA 4ZS7L 5F21B 5IEHA 4FRWA 4WTQA 2NY0C 1RZIA 3TBCA 1IT9L 4N2IA 4QY8A 4ZW8A 1NMAL 2BERA 1GOFA 3QEHB 4HK0B 2XJLA 3H56A 1SBBA 2GJPA 2FSEA 4MA3B 1BVNP 1DZ0A 1ID2A 1PZAA 3VQ1C 3V55A 4IS6A 2BOCB 4ODUA 2NZ9C 3TIDB 3V6OA 4XP4H 4N28A 1TQUA 1FQ9C 3A21A 1XF1A 3BLBA 3VGDA 5F7LB 1P1ZA 4DEUA 4AL8L 3FPYA 5I8CB 1E3XA 3DTXA 3WJLA 1YEKH 5GSRA 3N9GH 3UTQB 1F4YL 5AW5B 5K9OB 4PJEA 2W1NA 1LE9B 2C4XA 4ATTA 3JWNE 2VKXA 4JJ5B 1FO0H 3P4OA 4QOKE 2JE8A 4TL4A 1D2OA 1XMWA 3B8YA 3PGFH 5E2UH 3U0PA 1BAFL 1UM6H 2RFXA 1E0OB 2X4SB 3O2DA 3OVUB 4XPBH 4OM0L 2CO1A 4X42A 2BVTA 3ZZQA 4GUPB 1CMOA 3CN4A 3W5NA 4HC1A 4B97A 2NPLX 4RWHA 5HBBA 2ZYRA 4M61A 4UQBA 3WO4B 1MHEA 5C07A 4ZAKC 1M6OA 1AO7B 4DPRA 5HYJB 5M7QA 3NA4A 1V7NL 2WN2A 3P4MA 5BVPL 2OMTB 5F1NB 2ORBL 2NY4D 4U3HA 1OD9A 1YPZB 4HP5A 3IDMA 2YA0A 4J23A 4QAWA 3WHE0 4HPYL 5DF0A 2ITFA 3KLKA 4PYGA 4PB9H 1U3HB 3FULA 2IFFH 2OLDA 2JV6A 1GS8A 2N7SA 4G43A 3TFBA 2ALAA 5FKAB 2BNRA 1FPTH 2DI8A 3CFUA 5CGYD 3L3DB 3JWNH 1R24A 1A47A 4GBXC 3ES6B 3L7EA 2G3MA 3Q9PA 2DJSA 1NA8A 3V2AR 3MXVL 4OIFA 3NDZE 4Y4FC 2B4CC 4MAYC 4JM4L 3M7OA 4UQ3A 2VLJE 1B6UA 1D3CA 2E8YA 4XB7A 3CBKB 1WSST 2VOTA 1TTAA 3MREA 2YUWA 4AZ8A 1ZGLP 1WIPA 2NY6B 3ARBA 5GS3A 1RUQH 5E2VH 2QPSA 5KUMA 5LB1A 3WO4C 5JQ6L 4TN9A 4XN9A 2EUZA 5E99L 4K5LA 3UYRL 2YWZA 1NCBL 4GXVH 2FBOJ 1TJIL 4N68A 1GPOH 5B7FA 2XTJD 1E30A 2X4NB 2W60B 1PFOA 2IADA 1HEZB 1RJLB 2VW6A 3WG7B 1MFBH 3GRBA 4WHYG 4NZTH 4AQAA 3O3BA 4DKFH 3DSNA 3BDXA 5EF3A 2Q87A 2JI1A 3P4LA 3A6OA 1G9MC 1KLFB 2W91A 1T4KA 3NJKA 1F13A 3QZMA 5L9DL 4LSQH 1CXKA 1JHTA 4L5FL 1KJ3L 4ES9A 5DVLA 4G5ZL 3GBDA 3SPVB 2VSKB 3GSNL 3BKYH 3WY1A 4OB5L 4IU3B 3I6GA 4V33A 4ZMLA 4NQUA 2ZYHA 3AITA 2F15A 1NBYA 3GSVB 4ZUWB 1ORQB 4MS8D 4DGUA 2GSGA 4LCUA 2WQSA 3HEIB 4PJXA 1CTMA 4TNGA 1RURL 5FWRA 3KHOA 4YBQD 1OP3H 1U8LA 4AUUA 4QHMB 4ZG1A 3ZPDA 1XCWA 3FT9A 2Y1YA 4FZEL 3ULUC 1A6VH 2FL5A 1YA5A 2ZOUA 4X4KA 3BPNC 3LZNA 5JPNC 3B2DC 5E1AB 1GS7A 3CK0H 1HNGA 3RWGB 5KVEL 3RLSA 1HOCB 2IDFA 2EDFA 3IDGA 3GMLB 3D33A 4TQIA 2GSIA 3WU1A 3NAAL 2QADB 2ZCHH 3DXAB 3G5ZA 3P2TA 2BNUA 4OCYH 3VD3A 3RWCB 2FX9L 2VL5A 3LXUX 3DI3B 2PO6D 1THAA 4NT6A 4PCKA 1KB3A 3IKCA 1U8HB 2AEPL 3RWHA 1OW0C 2X09A 1GA2A 4GW5A 4UOJA 4FQ2H 2QDVA 2Y36L 3CDGB 3FT3A 5B7EA 2Z91B 3V6OC 3VQLA 2UY6A 3RI5K 1ADQA 3S3DB 2CR3A 3SE8L 1B90A 2C3VA 3PHQB 5T33L 3E6FB 4NN6C 1URLA 2BP0B 1AP2A 1DO6A 1SNRA 4HALA 3BUDA 4PP2B 3EYOB 3FN3A 2FNBA 3JV5A 4YL4A 4R4NC 2A9MH 1QSEB 4EN2A 1JZ8A 4AYFA 3VQMA 4RGOH 2KZ1B 4JO2H 4PWGA 3BW9B 1I8AA 3TTYA 1T1XB 2NY7L 5DUJA 1M6UA 2BY0A 1V55B 2NXZC 5D1QC 5FR3A 2ZXEB 3KPSB 2VGLM 1JBJA 1A66A 1EJOH 1N7MH 1ZA6B 2E9JA 1JNHB 4JPKH 2MQGA 4HKBB 4P2AA 3V7AG 1IVTA 2ZOKB 1RUPL 2ZCHL 3B7SA 1E90A 2X05A 1IJ9A 1F90H 3HFMH 5GGSA 5LAXB 4GYBA 4RGNC 5EPMA 4OZGE 2PYED 3QPKA 4HUWA 3JWOL 5AVTB 5A16A 4A1RA 1EMTH 2XTJC 3GGWA 1YEDA 5D2LB 4NO0A 4BKLB 3ZIMA 4LSDA 4OF3A 1DQLH 4JG1L 3UPRA 1IJNA 2CO6B 4PVBA 1J11A 5AWNL 5JHDA 5I1CH 4XBPA 3ARDC 5FX3A 4R5VA 2MCAA 4O9HH 3D3VA 1UM5L 4MNQB 1ZJAA 4FQPA 1TDQA 4N0UE 4B7IA 5CFHA 3GUTA 4XCNA 3GMQB 1KNOB 2J4WL 3IB4A 3PIQA 1PZUB 1T5KA 5DK3A 5E2WH 2C1OB 2DYPD 3FTYA 4R4FL 2Y9RT 3VWKA 3OWEA 1X7SA 4P5TA 3MROA 3WXWL 2GTZB 3MV8A 5L9DH 3I84A 3IFLL 2I07A 2EECA 5F9DC 5MP6H 1ECYA 5T1KA 3CHPA 3W82A 5B3NA 4HLEA 1CE1L 4RFOL 4OUUB 5E6UB 3KPRE 2X89A 4S1QH 1H19A 2B59B 3G5YB 3ZHLA 4L5FH 2HLEB 3VYPA 2XY1A 1XIWB 4LSQL 15C8H 1RUQL 2YS4A 2FTAA 2B2XL 1A4KA 1C16A 1WITA 1B4TA 2AQTA 3N91A 4NZTL 1O7DC 1VADA 5KSBA 5J12C 5C0CE 3I50H 2CJ3A 1XIWD 2F53A 4UQ3B 1M05B 2YEZA 4KPHL 1LMIA 4HIHB 5FOJA 5AD0A 3KZ8A 2XN2A 3HR5B 3RWDB 2AJZB 5HHQB 5DRNA 1DVSA 4LVEA 4U1JA 3L3OB 5INCA 2P4AB 5KG9B 4JDVA 2IWKA 1ZHNA 4XVSL 4Y5XB 5J56B 5IVXE 1I8LC 2QHRL 5I17B 2X0UA 4E5XA 2ZX7A 5JPNA 3W81A 4XWOD 2OJZH 3O6FB 2V5TA 4APQA 4YFEA 2XI9A 3QIWD 1EFXB 4PR5B 5BVPH 3Q2WA 2B1HH 3V4PL 2V0AA 4YIQA 1N5AA 4X7TB 2OR7A 4Y19D 2GCYB 5DQJA 1X5HA 2F19H 3ARED 4ZXBB 5KBLA 4NQVA 2B2XH 3T71A 2EIDA 1SHSA 2CALA 2OZ4H 4M4PA 3ATAA 3HB3C 5EU6D 3VSQA 2A73B 1FG9C 2HB0A 4OLWL 2OZ4A 4CU6A 1B4LA 4JFYB 3D12B 4NS0A 3BLKA 2YKLH 4UF7C 1T0NB 2NY3C 5IV2A 5E1GA 5E2UL 1ERNA 2J72A 3RQ3A 1HN1A 3CWGA 2ZJSH 4Z3TA 4XMLL 4Z77A 1GZHA 3AC0A 4CMHB 2W65A 1FSKB 4O51A 4MDJA 1V8HA 3QUXD 5CSGA 1A6AB 2PXYD 1NCTA 4AL8H 1EFQA 2WXRA 4P49A 3ULVL 4XP4L 3KE0A 3RY6A 4OIAA 2WXMA 2ZUQB 3MX0B 5I6XC 4O9HL 2NQCA 4C59B 4ELMA 2EO1A 4UQAA 2PYEE 3KYKL 2BVUA 1ZPLA 1NIFA 2WBJA 5AWNH 5CD5D 2D3NA 3QEHA 4HK0A 3E8UH 3KJ6H 5IZ7A 3I74A 4FFTA 1DQLL 5JHAA 1A7BA 4KKNA 4YVNA 1LE9A 1EMTL 1D5RA 3WGVB 2BOCA 4RMUA 3VWJA 3ILDA 3AJ7A 4YDLC 4PLOB 2NTSP 3LCYA 5CR1A 1A65A 5DK0A 5EO9B 3DROA 4TUKH 2XPGA 1D9KD 3TA4D 5IQLA 4I88A 4Q9BA 5AW3B 1XH3B 4OZFH 4GUPA 5IB5B 3VXQB 1QHOA 3N50A 1BZQK 1T1XA 2NY7H 5IVOA 3RILA 3RVWD 3MCG1 4GG8A 1TVHB 1ZLWH 1KTLA 2IDQA 1NCCL 5FO7A 4E41A 1KJ2L 3L3GA 2VT0A 4B5ZA 1ES0B 4NWTH 3JWDC 5J06A 3PGCA 4QIRA 3BKMH 1BFTA 5CAYB 2W0KA 5FLUA 2WCGA 1JHKL 3IM1A 2DLTA 3MGTB 4Q0XH 1N6QH 3MLSL 2GQHA 2WLLA 5FYJL 2NDGA 1AD0B 1UD5A 2YGNA 4WKZB 4JRFA 1JNLL 4M61B 1KN2L 2NZ9D 1I3GH 3OXSB 4GOSA 1QNZH 4ABWA 1E4JA 4D8PA 4Y2NA 5C0GB 5I2IB 5IQ7H 4HA1A 3VXSE 2EH7L 1QSFA 3IN2A 2EDRA 3CXHK 5GZOC 5JZ7D 4ZPVB 5F88A 2ZUSA 2APBA 3BT2L 4UQ9A 3RGVC 3T2PA 6TAAA 3VO0A 4QJ4B 1D6VH 4AV5A 3ABMB 4HCIA 2XQBL 4G43B 5FUCE 3UC2A 4ODSH 5DMIH 4XVJL 5GJSL 1K8DA 5CBAA 1OCRB 1P5UA 1BAWA 2D31A 3FO9A 3U2IA 3ES6A 3L7EB 4GSQA 4XC1L 1N0XL 4L48A 4XE0A 3S34H 5IT2H 1M53A 2XFXA 2FEJA 3RTQD 1PZDA 1EA9C 4DZBB 1KCRH 1OAYH 5IM7B 4JZJC 4OZGF 1S6NA 3H0TA 1R9FA 1REIA 2VN3A 2VLRD 4KUZH 4P46B 4CAGA 3OZ9L 4HHGA 5IROA 5T3XL 1KGXA 4PJ7A 3G3LA 5BS0D 1T4KB 2Z93A 5F0LB 4PRAA 4Q0XL 1X5YA 1KGCE 1PD1A 4HOXA 4XPFL 2ADFH 2OMZB 1NCCH 4HG4K 3BWAB 3AY4A 3TO2A 2CM6A 4LCYA 3EG9B 4ZUWA 3T0EC 3QQNA 1FNLA 3IJ7A 2Z4QA 2MOVA 1G6RA 3GNML 3CN1A 3D1MC 4J4PA 1Y18B 2YD1A 1SM3L 1M05A 1CWVA 4ZZKA 1MW1A 1U58B 1IBYA 1YY8A 2PNDA 5EA0H 4XAKD 4HWUA 1XL4A 4WO0A 4N87A 1TFHA 5IK3B 4WU5A 1OGAB 2XKNA 4CC4A 2OJ1A 5I18L 3KLHD 1I8UA 1AO7D 1RK7A 1G7JA 4XP6H 3ESPA 4G8IA 2WWMC 3G5ZB 3E8UL 3KJ6L 3F7RA 3UX9B 3UAEA 1PIFA 5LXVA 1UOLA 4XNMA 5JR1L 4B7LA 2EVIA 3BIAX 3BVVA 4G6FD 1MWAA 3BO8B 1RKRA 2CDEB 2ERJC 2JMRA 4Q9RL 4GKOA 3RL1A 1HEJC 2J88L 1SF3A 3SJVE 3QNZB 3KBHE 4WWKB 3U36B 1HYSD 1X5KA 3IKCB 4XVUC 4XH2A 3OKEA 1G6RL 3HS0C 2ZJSL 3ZDYF 2VXVH 1GYAA 1WWBX 3FO0H 4L9LC 3GS4A 1JPFA 4N0RA 4EKXA 4DWHA 2R0KH 3PWPD 2X4OB 3F3HA 1VPOL 4WV1C 3LH2L 1A8ZA 3PWPA 1XEUA 4ACPA 2HTKC 3MOBL 3K0YA 3BESR 3FTGA 4NLHA 2XKUA 2VKWA 5MERA 1U2CA 1WZ1H 5HI5D 1JGDB 5AOJA 5DRWA 4XPBL 3NPZB 3U83A 2MQ0A 5EORL 4KI5F 1GZHC 2D7NA 1PAMA 2O5XH 1NSNL 2RAMA 2J1WA 1QW9A 3LN4A 4R7XA 3C2AL 1S3RA 2EEAA 2FWSA 4LLVA 4BQ6A 1PDKA 1H5BC 3AWFA 1JWMA 2IQAB 4PJBF 5DC0A 1Z9SB 5TK2A 4JFPA 2LHAA 3VXNB 2OM5A 4PJDE 4TUJA 2MOQA 5CCGE 1GS6X 5HYJA 4W6YB 2VERN 3EH5B 5F96H 3RKDD 1ZGLM 4KI5D 4HJEA 3OKMA 1NDGB 3GFUA 4WSKA 3REVB 3STZB 4DESA 4JKWA 1FJ1A 4RFEA 3QWOB 2Z0BA 1AIFA 3IU4H 1MREL 4N4YB 4CVUA 3EH1A 4UBDD 1ITCA 5HHNB 4KKCD 3VXPA 4K5MA 2WQVA 5F7BA 1CT8A 4PRPB 2ADGB 4ODXB 2Q7YB 1KPRB 2XN9D 3FRUA 1NAKH 2V7HB 2DQEL 4K5OA 1KNOA 2VM9A 4CKQA 4DP9X 1TETL 3S96B 2BNQD 1UASA 5BQ7A 5C0BE 1KB5B 5B39B 1G5GA 4Z7VF 4ZS7H 5GRJH 2YRPA 3UTTE 4YMPA 2A83B 3VWKD 15C8L 1TZAA 1AHMA 4OZHB 2BIPA 3N5AA 4JFDB 2HKAA 2BW4A 1T2QL 3VCLA 4NQDD 3UCRA 2SEBB 3QEQA 4LAQH 2DJ4A 4L29A 3ARBB 4Z1PA 1B2WH 4P5KA 5EOCJ 2HJLB 3IT8D 1PZBA 4RZCB 1CE1H 2MRYA 4OUUA 3BGFC 2K1MA 1T1ZB 1JGUH 5LO7A 5D1ZD 2Z35B 1AOZA 4PTTB 4TTGA 1HNFA 2DTSA 3UZQA 4N2CA 1Z32X 2E4TA 4FDWA 5FHAL 1QAWA 3JTSB 5EU3B 1ZWIA 1LEKB 3ZDXF 1TVBB 4G83A 3UDWA 1I9IL 5CHNB 1OHZA 1KIQA 4XCYA 2L7UA 1EQWA 2XV2A 3CVHL 2LGNA 3GMRA 5DJAA 5INDB 5KANG 1KXTB 5I1KL 2HVKB 5EDSA 1XIWA 2F53D 3FSZA 1VGKB 4PJIF 2IBZX 3QUZD 1Z9MA 2COQA 2QMKA 1GYUA 4QXWA 4L8CB 1RZ8A 4K7PX 5I1CL 4JRYD 3RZCC 1LNUB 3OC5A 4P46C 1E4XL 1XX9C 2RD0A 3BP7A 1Q1JL 3G08B 4R5XA 2DYPB 4FFWC 4OLZL 4EMZA 1V3JA 2NR6A 5DJDA 2JFCA 3BAEL 4CADA 3UO1L 2HFEA 3QFJD 1ZTMA 3KWTA 4O4YH 2VR8A 1HNYA 2XZQH 5AZEL 3RWDA 5ICYA 3MNWA 4G8GB 4TLSA 1WQVT 2VRKA 1RHHB 2AQRA 1FCGA 3CMOL 1P2CA 3EYUH 3NMEA 4JY6A 3X14A 2EUWA 1CFVH 1BZ9A 1PEZA 1HX0A 1JE6A 1FVCB 1G7QA 2JCCA 3AAZA 5E9DA 3ARDA 2GTWA 3LNGA 3T65A 2K78A 4ANXA 3ETSA 2BFGA 4KV5E 1XB6A 4APQB 4ZQKB 4DKDC 4I3SH 1UT2A 2NLJA 4PJFF 5DD5L 2Y2WA 2F1EA 3O11B 1DBAL 1MVYA 1QFHA 2GITB 5CZVH 4K7PY 5KVMC 3RWIA 3QUYC 4K94H 5EN2B 1YMMA 4WO4D 3MLWL 2DM2A 5JHLL 2EVGA 1B9KA 3SD5A 4KZEL 3FOLB 4LSTL 3FTWA 4OAWA 5C6PB 1I1AB 4MDRA 3UG5A 2J5WA 1MH5A 5EZJB 1HOEA 2DEYX 3T2LA 4PJCA 3EJZC 1G7IA 3FRPB 1NGYA 1QRNB 1P5VB 4CW1A 2RBLA 4KKCC 1G7JB 3DVIA 5KBNC 3QORA 3DHUA 4GKLA 4TVSa 5F3HB 4F2FA 2AJUH 2XXCB 3MX0A 1PW3A 1QASA 5GZOD 3FK3A 2BVQA 4R2GD 2WSKA 3RWFA 5MEQB 2LU3A 3TBVA 1QI4A 4PG9B 2WBJD 3EFDH 2IPUK 2WAHA 3GSQB 3BO8A 1J8SA 3MNZA 4R7NB 5F9AC 3V0VA 2ZIDA 3WTTA 5EUKB 1TKWA 4A7GF 3HI1B 2DYRB 1U42A 3QZWB 2CO7A 3RIFK 5E8DH 4FA6A 1DUZB 3B83A 2Y1VA 3ARQA 3QNZA 3B7YA 1JZ2A 4YHPB 2HN7B 5KSUA 2VISB 5HI5C 1E28A 3QAZB 3UC0H 4LKCA 4MQSB 5HJGA 1UZGA 1TG8A 1TO5A 4S1RH 4FXKA 2VXSL 4XAWL 3LKQA 2DQTH 2EAEA 4F57L 4F7EA 3K2UH 4YAQB 4OGAD 3I02B 3O3EA 3QJSB 3TV3H 3ZT5A 4X5XB 1VFAB 4D9LH 2FBJH 4Q6YA 1UM4H 2NTFA 3GIVA 5EC1A 2VZSA 5BW7C 2R0WH 3KR3H 1CFNA 3FCSB 2WLLB 3H9SA 1RZGB 1NLBH 3V5KA 3CC5A 4KQ4H 3GBNL 2WUCL 5FCUL 3GJFA 1ES0A 3V5HB 2I07B 1CDGA 1SFHA 4X5QA 4DGVH 5H37G 3AZUA 4U6HB 5F72S 5AB9A 1N26A 2DJMA 4KMTL 4L4VE 1D7DA 2A77L 5E2VL 3VFOA 3T08A 2QSQA 3U48A 4BFBD 1I1YA 1R3JB 5IHWA 3MJ8B 4H26A 1X9QA 3QCTL 5C08D 1E4XI 2CCWA 3CX5K 1E5YA 1FL6A 4KHXL 3ARGA 3VFMA 1LWRA 4WUUA 5ESAB 1S9YB 2C9XA 5DZVA 3MMEB 4OZ4A 4XHJC 3KGUA 2LVCA 3QWRA 4IMKC 5HHMD 2ADIA 4MCYA 1K3IA 5F7HA 1ZXQA 2EDWA 5JOFB 3PXHA 4HS3B 4NHUB 4XNBA 4CUCA 5HGBB 3GXPA 4PB9L 3H3BC 1NFDA 1BEYL 3QARA 5FIEA 4WI9A 4BM7A 5FK9B 5INCB 2VMCA 4B9JA 1ZT1B 4P06A 4D8OA 4H7VA 3VMNA 4XN2A 5HHOA 2TRYA 1Z9LA 5DJZA 4OKVA 1L9TA 4AEFA 5T3XE 2NDFA 4H20H 5BS0B 4NN5B 1X7QB 1FNSH 4XNQA 4AYDC 4LCWD 5IM7A 3N1GC 2VLRA 3AU1B 1A7QH 1CFTB 2WO3B 3BFQG 5FM4A 3ASWA 3OLIA 1ZWIB 2X4QA 3MFFB 8PAZA 4NUGL 3EG9A 3ARGC 3MLVH 3B6SA 3BP5A 3KJ4C 5IEKB 4DP7X 5IG7A 3KGTA 1VKXA 3P73B 3RWEA 2GI0A 1IQWH 1A6ZA 1XCTA 3GLAA 1ZT4A 4PPTA 2HWZH 3BI9X 3ZKMD 3QZBA 1MDTA 1ZMYA 3NJNA 1IM3B 3RZCD 2QV4A 2V5SA 3TCXA 5IFJA 2ENYA 3N9GL 5GGQL 4DKEL 3S35X 2D9QB 4BXVA 3KXFB 3DKHA 4Q56A 4XWGH 4BSVB 1ZK9A 1BVNT 3QZNA 4A68A 4KVCL 4ZQTA 1R17A 4MDJB 4YHYC 5T1DH 3DPBA 5EMYA 2Y7MA 1XMEB 3FN0L 1I1FB 1DVZA 1SHWA 2AZUA 5DWUH 2YD6A 5HJ3A 1WD8A 1MCOH 1VENA 3ARDB 1PG7L 3SE6A 4HUXB 4N2GA 3C2SA 1ORSB 4KZ0A 4KKLC 1I7ZB 5MEOA 1DBBH 1UXWA 2Y24A 1CR9L 4U6VH 3W5MA 1TTUA 2HT2D 4K9JA 5T1LB 2K70A 4PJIE 3FO1B 3LKRB 2ATAA 3RAJH 4G7SB 4PJ8B 5A2KH 5KOVC 1MWAB 1DE4B 2ADJB 4B6ZA 3NSCA 2G4EA 1N59B 1QTSA 1NGZA 4YFLI 3TIEA 2UWEF 3O0RH 3U7YH 4QHUA 4PGCB 5HD8D 3P9LB 2YQBA 1QBBA 1EHNA 3SDAB 3DIVA 5EZOL 2KZWA 3DRQB 1BF8A 3BKCL 2ZXQA 4RMRA 3ARDD 2AF2A 1QEXA 4ZTEA 3SYOA 4DK3A 4JHVA 5C71A 1SOXA 3D05A 4EDWL 4JHZA 5C8JB 5A43C 4V1DE 1P6WA 4X5WB 1EDYA 3TEXA 1QA9A 3TTSA 5LGKA 3BWUC 4Z7NB 4BZ2H 1TVHA 3GLDA 4TSBH 4YQXH 5E70A 4IBZA 3RUGF 4C4KT 2L7QA 4R7NA 5KSVB 3MNDA 1WG3A 3T4AA 4HUCA 4FGMA 4IM8A 3HI1A 3QZWA 4R7DB 2QKIC 1NDGA 2IQ9H 4MXQD 2DTMH 5CN1A 4TQEL 2P47B 3JV4B 5F2FA 3FMGL 3CQFA 5ID0B 2CO3A 4GB9A 5I6NA 3HNTH 2DEXX 3BKJL 2QSCH 3FB6B 5AAPA 2IQAA 4HJ0C 4CVZA 1RUAL 1QP1A 4JBSA 4UTBL 4ONGL 4XP5L 5TDOB 4RMWA 5D2LF 2V2WA 1WBZA 2GC4C 5EUOB 3MRQA 1AG6A 4L3ED 4OLVL 1QWUA 4BE5A 1VFUA 2E86A 1S7SA 3S96A 1Z9NA 5T5FL 5D2NC 3KLAA 3QXVA 1KB9K 5KJRH 4LKXB 3VXPB 1XB8A 3DV6B 1XF4A 5T1LD 3T3PB 3FN0H 3B3BA 4Z7UE 1VACB 3U0TB 4B50A 4P5KB 5TDPB 3VFTA 5F6HJ 1F97A 4RFNB 5AAMC 3DGCR 3MV9D 4JAMA 1R3IL 2XFXB 1ADQL 3VA6A 2NR6C 1KBKA 2A83A 4IYKA 2YAEA 7PAZA 4Q9QH 1AIZA 3CSPA 4M02A 5GGTL 1A6UH 2CRZA 3ZDZB 5G5DA 3IMRA 5GIRB 4CGTA 3L5WA 5ADOH 1QABA 1E9OA 3FSWA 3NACH 1F56A 4WFHD 3RA7H 2CUHA 2VXUL 3TU6A 4JN2B 1KIQB 4MJ6A 5HTSA 1LGVA 5F1KC 4ENZA 4FCAA 4BCYA 3C12A 3B9KB 3LS5H 2CCVA 2M8XA 4HWZB 5LBSH 4ALAL 4KQ3L 2BNRB 4B9KC 4KXZI 4JDEA 4LCYB 2XN9B 5H4ZA 5D5ME 2WXPA 4I77L 3G08A 1AHWC 5BV7B 2OCFD 5LAPA 3V4UL 4LEXH 5KW9L 2HFEB 1XGPA 4FHBD 4RFNC 4BINA 5JORA 1J0HA 3MDJA 4UU9B 1IGIL 2WXNA 2XN1A 4ZS6C 4U1NB 2WSDA 5E1HB 3WIHL 2C9UA 1QFWH 2ZWKA 4XB3A 1Q38A 2V17L 3KVPA 3BZFA 1CYXA 2D3LA 3EBGA 4Y16C 5AVZB 3UAJA 3Q8CA 4E9QA 5ICYB 4J7RA 3SKJH 1NKOA 3HC4H 3R0NA 2XLLA 3WKYA 4AM0B 4BH7A 1H3GA 3BEVB 4YHML 2X4QB 3MFFA 3QUMH 2KHAA 1OAQL 1XF5B 4WHYH 2QR0A 2EXSA 1JGLL 4PJXE 4ZMAT 1PZ3A 4IDJL 2YFNA 3QRGL 5D1XD 4XMUA 2VCOA 3MCKA 3Q2VA 3IPEA 3PQYD 1YYMH 1IAIL 3DRTA 2WCPA 4NUPA 3GSVA 3U1QA 2ZONA 2BSEA 1IC7H 1P69B 4X4MA 3ARFB 3U9PL 4FABH 4O00A 2WUCH 5FCUH 5D7LB 1OARL 4PRIA 1SXAA 5BRZD 2CMRH 1T5WB 2DIAA 3LN5A 4IRZL 4NQCD 4W70A 5F97E 4M7KH 3CVHA 3SE3C 3U0WH 7FABH 4NNYB 5GRVK 3X1EA 1J5CA 4NQSA 4U0RC 3P02A 1GCFA 3FRPA 4O5LL 4R96A 3BD5A 1TFPA 2Z8WC 3D4ZA 5KYXB 3WNLA 1S78D 2IH1A 3NIFB 4P2OD 1FFPB 1KENH 4N22A 1TPXB 3TO4D 2CO7B 1NUNB 1J1XL 4JO4L 3SCMA 2YD8A 5DFVC 3LKOB 4UM8B 5K5YA 4XC3L 3LN4B 2R8SH 4X6DA 3FNKA 2PTUA 1U2YA 1PDKB 4QR7A 3RBGA 5J13C 1UA6L 3GSQA 4WEMB 1A6TB 1CDHA 4L3EE 4BFIA 2KS0A 2LOEA 3UJIL 3QE5A 2BO0A 2LLGA 4P2CG 1RUKH 4WGWB 1SRDA 1FBIL 2UXTA 4A2EA 2ICWI 4UTBA 1DJSA 5CLYA 1CD8A 1N18A 4JRXA 5C0JB 1BD2B 4RQQA 2ICES 4IK7A 2RFXB 4LKCB 1BVKA 1B9ZA 4ADJA 2H3KA 1FDLH 1T3FB 4FFYH 3G5WA 3VD7A 3BYYA 1CXIA 5FDYA 1W16A 3BCFA 3BPLB 1T89C 4JFFB 3FCSA 3T6VA 5J1AB 2AXGB 4UWQB 1UB5B 3T3MF 1ZA6A 4F27A 4DGIH 2IWGA 3HG2A 4QNPE 5ITFB 4HU8A 1EZLA 1HHIA 5LJYH 4H1LG 5G4OA 1KFAL 1QPXA 3BSHA 5EPMB 1SF5A 3E6HB 1E8YA 5L8LB 3MUY1 4PV9A 1ZHKB 3MRGA 2NY4B 2DQGH 2WXQA 3MRQB 3LSOB 5GGUB 1QBLH 1BBDL 4OZ4B 1SGKA 3WTVA 4U4IA 2DJUA 2J1XA 5ILTL 4BRJA 2EDBA 3BGMA 4U3XA 2CKBA 1KXTA 3GRWA 2YAFA 1FFOB 4JVPA 2YPLD 3WS3A 3VFMB 1YNKH 1Z6JT 1S7WA 2H32A 3L2MA 4WO4B 5B38A 1Q72L 4G3YL 4PQXA 4QRRB 4Y1AB 4E9LA 3KPNA 1AR1D 4U49A 4BDVB 4KMLB 4ONHA 4QF1B 3QXUA 4KKPA 1NGPH 3MC0A 2VERA 5HI4C 2XIBA 3O4OB 1BOGA 2B08A 4OLZH 1ZANH 2FQDA 3VRLF 1RJLA 1NFDB 1QBMH 1PY0A 5EV7A 2QKSA 4DGYL 4PY8J 2FGZA 1VERA 4KWUA 4KGLA 4KXCA 1JZEA 4GRWH 5A7EA 5LNGA 4FZ8H 4PUBH 1BM3H 5BJTA 1UJ3C 2CLZA 1R5IA 1PJ9A 3SE9H 5BVJB 4H8WL 4IU3A 3MLUL 1I9IH 3EGXB 1WS7A 2DWTA 4DPBX 3QDGB 4L5FE 3LIZH 5DHMC 1FL5B 1ORQA 3C6LD 2WWNA 5AW8B 3O2WH 1HXKA 1ZK5A 1QYGL 5CWSA 3UIZA 4AGLA 1G7LA 2F2HA 4I0CC 5AALA 5EF1A 1L9PA 3QJOA 4KUCF 2FL5B 3HC2A 5LG6A 1B2WL 4YUEL 25C8H 4Y8AA 2DM4A 1JGIA 2MH4A 2OA9A 3GHBL 1W2KT 3NESA 1W8NA 4YHZH 1NLDL 1NIBA 4OIBA 3QUHA 2VDPB 4XTRD 3CQPA 1S9VA 3QH3A 3ECBB 1U8QB 1RSYA 2X3AA 1DLHB 1AHKA 1QI5A 1ZV9A 2TSAA 3RPBA 2FJGA 1P7QA 2HJKA 3GHPA 1P9MA 3IAPA 4MB3A 2BVQB 1N2RA 1YYLL 2E9WA 3LJ3A 4NKOB 2VUKA 1NGPL 3R1GH 1YMHA 1T1YA 3PL6A 1TITA 1LVEA 4MQ7A 1SXCA 4PJ8A 3VYOA 4RAHA 3TNNA 1JWSA 1BEXA 1XZ0B 3MLXL 4YSCA 2NY1C 4ZFFA 1UACH 1T66D 1CVRA 4KHTH 2R1WA 2BS71 1QD0A 2PPAA 4M3HA 2G5BA 2FQFA 2WKOA 4PJGA 5GHWL 5F96L 5ABDE 2NT1A 4EDXA 4ELDA 3LKRA 2YA2A 1IB5A 1B0GB 5B39G 3NZ8B 1T5WA 3ZQXA 4AM0Q 3BWZA 4APQD 2DQGL 3DO4A 4ZODA 5ESVA 1IEAA 2HLAA 4OW6A 4GQZA 2X88A 2R0ZH 1IAOB 2P1YA 2X2UA 4NGHH 3RDJA 2W92A 3MA7A 3JVGC 1ZDQA 3APNA 1F58L 3FFCD 4AT6B 2PTTA 4L8DA 2XRAH 3AREB 4ZXBD 1QFWI 4AIXA 3CZFA 5CJOL 4G8FA 1FFPA 1BLNB 1FH2A 3SE3A 5E4EB 5J57B 4Y9BA 2OSYA 1J8KA 2WBJB 1KGJA 2Z8SA 4F80A 3PAUA 1AR1B 4RGMB 4J3UA 2MIZA 3ZHDA 3U2SB 1Q0EA 1EK3A 4RH4A 1XTMA 1A02N 4DP4X 5D1ZB 4KJQC 3WHXA 4LOUD 2J88H 2OMWB 3PWLA 4EBQL 3RU8L 5I6OA 1JXKA 3F7YA 1DZBA 4HWEH 4AG4L 3AG4B 1M7UA 4ZTOH 2P5WB 4P5MA 1Q9LB 4ZSOA 1T3FA 1DBJL 1HINH 3I9PA 1S7RB 1S7TA 2K4AA 3G04B 4KKZA 2H0JA 1LO5B 3P9MA 4IBYA 1OANA 5DD0L 1CFQA 3UAJC 4UZSA 3K4DA 1LE5A 1MF2H 3MRBA 3KGRA 4LKXA 4HJGB 1TMCB 2H47C 3WO3B 5A2IH 4A6YB 5KYWA 1YQ2A 5HGHB 3BD3A 1XF3A 3FB7B 5GGRB 3WNJA 3ZE0F 4JPIA 1IARB 1F6LL 4HSCX 5IUCA 3L1OL 1RPUA 1W0WA 1T0OA 5EU6E 3RIAK 2GK2A 4GS7C 3D2UA 4I8DA 4TNWK 1W72L 5I73B 1O9WA 4YLCA 3HS0A 1JD7A 5C2UB 2GJ6B 1FYHB 4GQ9L 3SPVA 3LRMA 4ABVA 1CK0H 1JHLH 4BFFA 4CN6A 1BYPA 1OIOA 3HR5A 3LVTA 5D7EA 4R90H 4G6AC 3K46A 5IJKA 3S3JA 2YXWA 2CLRA 3ESOA 4WK4B 5CGMA 2EEDA 4JDVB 4WTXA 5BUPA 5HHVH 1G1CA 1FFNB 4QNPF 2Q76B 1F6FB 1UD6A 1GIGH 4HCFA 4LSUL 5CZXC 4BFKA 1FZOA 3VXRD 1M9WA 2OMUA 3X1BA 4E9WA 5KZCD 2X9XA 1AXTL 4DN4L 4M7LH 7PCYA 1IE5A 3APDA 2NR6D 1Y1UA 4Z7QF 1Z0NA 4KKAC 2I27N 5AKTA 1SZNA 2K4WA 1PL3A 2AABH 5EBGA 2V17H 3C5ZB 1XD1A 4NZUL 2IGFH 1UVQB 2OYPA 4X8XA 3ILEA 4AUYA 4NFCA 5C7ZA 3ZKXC 1WZLA 3G7TA 5CF3A 3WIHH 3AMLA 4JVWA 4BA8A 3EJSA 4CILA 4ZW5A 3UTSA 1KXQA 3F62A 3DJZA 3AT0A 3BWAA 1IGMH 4LARL 4PJ5D 1FH5H 3SDXE 2X4PB 3I6LD 2ZQKA 2EDEA 1CUOA 2D4DA 2IDSA 3EDKA 2PETA 3HZKB 1OF2A 3CLWA 1RPQA 2VLLB 4PYHA 5I1HH 2HSIA 1I8KB 1DJZA 2B9AA 2BWQA 3CDGA 1G7LB 2ZNXA 4U31A 5TD4A 4HGMA 3OSKA 5I28A 4N8UA 2O5ZL 2DI7A 5HDWA 4DN3H 5HDBF 3BUYA 4F7CA 4KI5C 1RFDH 3IKKA 2MPVA 3V6ZA 2OXHB 4NO0D 1KWGA 1VIWA 3ETTA 1TTCA 3ZRCC 4UOQA 3W56A 1TEFA 1I9RH 1XGYH 4AMKH 2IPTH 3RIKA 3WNIA 3QYMA 3PHAA 4PWHA 5DWPA 4DEPB 1DLFH 4QXVA 1MRFL 3EYOA 3ECBA 4CU8A 3O3AA 5EEYA 1K5NA 4FYTA 2J6EL 2YBGA 4KK8C 5DD1H 2AP2A 2DQDL 5IB2A 1AY1L 1DEEB 2Y2TA 2B16A 4NNYA 3PABA 2W81C 4P2QA 1R3IH 5IW6A 4KXAA 1G7MA 4XE5B 3OXRA 1O9VA 2VM4A 4A6YL 3TNNB 4NJ9H 1ZY9A 4X4XA 3H9YA 2G2RA 3QGVA 4M7LT 5EC2B 4YXKL 5SX4I 3WOVA 4N9OB 1UKSA 3DX7A 1CE6A 2V37A 4MQXD 5ECGA 4K3HA 5LAXA 1GJWA 3HZYB 1IUZA 4NO5A 5B3JF 4IIQA 3I6KA 3ZKSD 1DVFB 4JM0A 3DLQR 5ESVB 2OSWA 2AI0H 4K71B 5EOQL 1DVQA 4YN3A 3NA9H 2BRRL 2DL2A 3LKSA 4OV5A 3HN8A 4N1HB 4FERA 4UAHA 3FMGH 5TQ2H 1JWUB 2H0PA 5JHMA 1TJHL 1ZOXA 3RJDA 2FVNA 1VACA 3H3PL 3U0TA 2J2ZA 2WXJA 1TCRB 1JZDC 5I16A 1G0DA 2Y7QB 3BZDA 1M7IA 4OGAC 4MNGE 5L2KE 3ULVE 4UT9L 3KLHC 1T89A 5BZDB 2Y7LA 1Q94A 4ZYKA 2DMCA 2ZPKL 4OFKA 1FN4B 5EIIB 3BE1H 1DANT 3T3PE 2QFPA 5BCAA 3OAYH 2BMKB 4F8PA 4QRTB 4APXA 1JZGA 3GKZA 1AIFB 3CHQA 1Q90A 4N1EA 4G7VH 4JFDE 2WY3B 2AITA 3U7YL 1QQDA 1HI6B 3MRGB 1JPTL 1U8KA 1J1OL 1R5WA 1NBVL 2YPKB 1G1YA 4YR6A 4L8SA 3VRJB 4FA8A 2WMPB 1AD9A 1PPIA 4F7PB 4X50A 1YEJL 3F8UB 1LE5B 2Q8AL 2Y69B 3NGBC 4GI8A 4F24A 1U92B 1CLCA 1NUGA 2YEZB 1FFOA 4FHJA 2JKJA 3OZLA 3X13A 4BGDA 2OYKA 1D5XA 5M94B 1PG7H 2XXFA 3KXFD 4G80B 2R69H 4KO5A 1S7XA 1DQDL 1RIVH 1ZVYA 2BNRE 32C2B 1LDPH 4UNTA 5F9WB 3LNIA 5D5MB 1BGXH 2P5PA 1NBCA 2ZWNA 5ABZA 3T2QA 4OCLC 1HSAA 3BSZH 4XWGL 1GR7A 5DSCA 3TT1L 3LHPL 4MKMA 2WWKT 1FL5A 4FQXC 3WD5H 4FNLH 2WVTA 2MMXA 2XYBA 1U8MB 3QUYD 1JDDA 3VGFA 1SJEA 2CR6A 1GH7A 4MNHB 5C2BL 2GUOB 1RZ8B 4LF3A 1LNUA 3AM8C 3IFLH 4IRSB 4MCMA 3IETB 4PGDB 3V4LA 4PBVC 3VXRB 2G4GA 4NM4H 5HDQH 3PJLA 5AYQA 3NFSH 3WKMH 2CHXA 3WXWH 4NQDA 5CKGA 4U1KA 4PRNA 1FZOB 3LH9A 5AYUH 5J1SC 2AEQL 3UTZA 3SO5A 1HL4A 3BVNB 5FM5O 4LDCA 1WICA 2FJGB 4Y16A 1RU9L 3FC8A 3GI9H 3WEMA 4TPRH 3L4CA 2XACC 3KPPB 4PEEA 3MLRL 1T1YB 3HBGA 5I74B 5F9JA 5K9JH 1KPUA 5I1DB 1FNFA 3QR2A 4TUOA 1EO7A 1Y6KR 1JI1A 1GJUA 2IH8A 4XPTL 3NGBB 3LVEA 5CJBA 1QRNE 1FGVH 1V3MA 2A9BA 5GS2D 3MBXH 3U36A 5J9PB 1A1OA 2KH2B 3NCYS 2ATKA 4Q6IA 4GKZB 3U7AA 4AQ1A 5CN2A 4P2RB 2KUTA 2L0DA 2E9IA 1JZIA 3IDNB 3FQXA 2QJDA 1MCQA 2XWJB 4KHXH 1JPGA 3LQZB 2ZUQC 3WIIL 5I0WA 1MH5B 2A99A 4M7ZB 4UV4H 4LAJH 3ULUD 4AUJA 4JRXB 4H13C 1IM9A 1Y1DA 3NCMA 2PYEB 1C12A 3F6JA 3FTGB 1WAAF 5CP3A 4KMTH 2PTTB 1XEDA 4L8DB 4YXHL 3Q1SH 2XPGB 4O2EB 1Z5LA 5LBSA 1ET5A 2VDKB 3GSRB 4DGVL 1U30A 5DO8A 2G0KA 4O2CB 1L0XA 4KKBC 4OZGA 5FUCC 2AJSH 2GG1A 5DJ0B 4C58B 5AG8A 3QORC 5ELIA 1WAAE 4JK0D 5J1AA 1N3NA 4K7FA 1JWMB 2ZUXA 1CS6A 1HHJB 5BOZG 2FJSA 2WJ7A 4TUJB 3AREA 1NC4D 3RUGB 2UUDK 2Z92B 1W0YT 3IDYC 2FBJL 3PNWB 4D9LL 3TF7C 2V9TA 4DERA 2X4UB 2AEOA 4K2UH 4ETQA 1XCQA 4WCYL 2FO1A 2UUDH 1KZQA 3T8XB 1N6QL 1MIEL 1JPSL 2NCMA 4F57H 4GIOA 1JZ5A 3P0GB 1MG3C 1S4IA 2P80D 1XZWA 5KWYC 4XI5C 3QRBA 5G4MA 1JZHA 1ETZB 2QQLL 4PGEA 5DYOB 4BSWB 2YPVL 4F5CE 2FO8A 1FYTD 4HXBH 2HX7A 4JPSA 4MNGB 1GZPB 1JAEA 2DQIL 4GI6A 5KVDL 1NCWH 3FT2A 4G82A 4GXUN 3T0EE 3D69A 5I30H 2J20A 1UD2A 4ZSOB 2H32B 1E5UI 4YGAB 4FQ1H 1K8DB 1TCRA 3NABL 2NTFB 4UIKH 3UJJH 4U7SA 1FV1B 1CFSB 1MLCB 5CSBA 4JFDD 3RL2B 2VXQL 3QJUB 2LU5A 4L4TB 1PSKL 1N4XH 1U3JA 3OF6D 4PTTA 5D96B 4P46A 2J25A 3NK3A 1MIEH 1GOGA 1Z3GH 3KPSE 1MWOA 4IRZA 3IEAA 1SLWA 1LTXA 2DLFH 2EYRA 3TURA 1HZHH 1XIWC 2FH8A 3CD4A 2DIJA 4GMSL 2D0FA 2DWEB 1TU2B 1EEZA 5GJTH 2R2BB 1T5XA 2HVKA 4ZNEE 4F37F 1X9RA 1H3PL 5GS0H 4L8CA 3FN9A 3BH8A 4YWGL 2F7RA 3SODB 4X6EB 4UM9A 2B8OT 1AKJB 3QUKB 1FFNA 3SOBL 4L0YA 1NCJA 5M95B 1R75A 3HNSL 4FG2A 1W80A 1NC2D 4LNVA 1E50A 3US9A 1DBAH 4JY4A 1NGQH 3U7WH 4I3SL 3C8HA 5ERWB 3VB8A 3WBDA 2NUTA 1FFRA 1V3KA 4IOIA 3B9AA 3NDYE 3H54A 5L88H 4WWOA 1DLHA 3FF7A 3BAJA 4P4RB 3RBSA 3K2IA 3SGEI 3MBXL 1N2RB 4U1GB 5DDHA 3IXTA 2ZXBA 3FT0A 5GS1B 2IFFL 4O02B 1G4RA 3CFCL 1ASOA 3CFMA 1KBWA 1SJEB 2R27A 3DDGA 2OL3B 4JJOA 3TN0B 3JV6A 3MRNB 3GSXB 1OEZW 1EDQA 5D6CB 3WUWB 2F8IA 3U9WA 2AJXL 3PGDA 2PWGA 1QOKA 4S1DC 4TNVF 3WFZA 5J0BA 4B41A 2H9GA 3FTVA 4FXGB 5C0AB 2C9SA 4ZOAA 2AEQH 2RMNA 3DVFA 3NZSA 4N8CH 3QXDB 4TVPD 3GMMA 5C0CB 3WKML 2OXHA 5HHOD 3MA7B 3S5ZA 1YCSA 4MDIA 3LXCA 1ACCA 3TBVB 2P24A 2IOIA 3IAQA 1FLRH 3OXRB 1UKQA 5F7DA 3C8KB 3U25A 1NIAA 5E8EB 3K6IA 3BFWA 1A4AA 1VZHA 4LRNL 4QRQA 1NAML 4ZFQA 1OCCB 4UB0L 1TZ8A 3UG3A 5E95B 2WLMA 4JW3A 3K6FA 4MRCA 5KOMC 5EF0A 3L9RA 5C9JB 5HGAB 2Y06L 1E9PB 2FATL 3HG1B 4F8QA 3T0AA 1QLEL 3MN8A 3UROR 3UJTH 5F0MB 2WIMA 4Z78A 1SN5A 3B5GA 1AZZC 4I18A 1ZHBA 4UV7H 4GKSA 1BXVA 1MN4A 3VI4A 2XDHA 4H0IA 1WD9A 5HGGS 2BFVH 4KX9A 1KPRA 4R6UA 2Y6TE 4A63A 4LLWB 2AK4D 5KBPA 2OI9B 1NSNH 3JXAA 4F7MB 1E2VA 4MVBD 3SKMA 4XBEH 5KSVA 1DQMH 2X2IA 4K7PL 2Q5BA 1WZ1L 4JHAL 4M6AA 3FYIB 4LLAA 3GTTA 4GQQA 3F64A 4OR1A 1CGYA 5TH2A 2NSXA 5FWQA 2YGOA 1XGZA 4NRYB 1SJMA 1NCAH 4F2MA 2J7LA 3QXWA 4XT1C 3BAIA 1YNTF 4R97C 4Y4HB 5DJXB 4JQIA 4MXWL 3KYOA 1NGXA 4N2FA 4MLSA 4OJYA 2C9PA 3MYZA 1ETZA 1SN2A 4HX1A 4U7KA 1WBZB 3NTCH 5EUOA 3V52H 1FVDA 1LEKA 4DVRL 1R24B 4G9DB 2OX5B 4GP5B 4L37A 4NKIH 1I3RA 1I7TA 3ELAT 1PVHA 2CPUA 1CVSC 4NBZB 2DAVA 3WSQL 2R56H 2P8LB 3L48A 5AVQB 2HKHH 1HI6A 3LS4H 4FQXB 5J3HD 4RBPH 1QTYT 1RSFA 4MJHA 4PJHA 2XYCA 2VUYA 1DANU 2WMPA 5TPWH 4KXZH 4L1HA 1CXFA 1PBYA 2UY7B 4JZJA 4PW4A 5DK2A 4HCRL 4WEBH 2RGSA 3WUZA 4ZZFA 3MJ7B 2GJZB 2PXYC 2VQ1B 1A1MA 1AG0A 2VDLH 3ECUA 3O4LB 1VEMA 3GB7B 2ZICA 4LSSL 4P4KC 1D5XB 1T04A 2NNAA 3K6NA 2WAQA 1EBAA 4D0BA 2JI2A 1I4FB 3K4AA 2KI6A 2XWZA 1S5IH 1E27A 1EUTA 1U3HC 2JCCB 1TU2A 5E9DB 2GTWB 1RZKL 3FKUS 1KN4H 2PW2A 4XMWA 4DQOL 4F7TB 5EF2A 3BX7C 3TFKD 1HSAB 2UZIL 1A6ZB 4G6ML 1X5FA 4OZIA 2XN9A 4Z7WE 5FYKU 1WFUA 3VYNA 4S1SH 5D7IF 4DSYA 3GNMH 5GS1C 3MCLH 3MR9B 1AY1H 2WVSA 5CUSL 1FNGB 1PIGA 4GUCA 1AR1C 1AGFB 1I1AA 1MXGA 2OW7A 3OG4B 1YNLH 5GJTL 4GAJH 3C9NB 1PKQA 4P46D 4DW2H 3VW3L 1QSFE 3FFOA 1Z3GL 5FKPB 3GMNB 3ME0B 2ZKMX 5I8EA 2JF1A 3MNVB 1UADC 2O5ZH 3DX6B 5T3XH 3IJSB 5A2LH 1UZ6F 2BNUB 4NAMA 2F61A 1UXWB 5J11B 3BEVA 3O4OC 4P2QB 5B3SB 1KN4L 4QTHB 3GBLA 2BC4B 1KBBA 2ATKB 4PN6A 2ZTBA 4LHUA 2Z65C 4FFZH 3MNZB 5TPWL 2NUPA 2ZAIA 3HMXA 3DIFB 4MJIB 1BZ7A 5IMLA 5EULV 3FQNB 4N0YL 1JFHA 3W1ZA 1RIUL 3KH3A 2IGFL 2R4SL 5C0AD 3TVMA 4XVOA 2AGJL 4OZFB 1XF2B 2ZZUT 2OXGB 5HGDB 3VFWA 4HCRH 4GKZA 4WEBL 3TZVB 2O72A 4KK9D 5C07D 2ARWA 2ARJA 3ZX1A 5DURD 2E76C 5LCVL 4PSPA 2AV7B 1I75A 4NX0A 43C9A 5IQ7L 1W15A 3GSNA 4BCXA 3KL5A 2HKHL 4NUMA 2G2PA 3SCMC 3QQ3A 1ZKAA 2NX5D 1M4KA 5CJXA 4TSAH 1DQQA 1NCAL 5EO1B 1EAPB 5ESQB 3MRJB 5EU5B 4NKIL 4PJEE 4X5XA 3EH3B 4OCMC 2PYFA 5B22A 4MJ4A 4XBEL 1HFUA 2C34A 3C6SB 4PRHA 4BJLA 1XGTA 1QR1B 3H9SB 4I89A 4EVNA 1I8IB 4IBQA 2AKRB 5F7NC 3QJFB 3TT3H 3FYEB 2E6PA 4M4RA 4D9RE 4YXHH 3DYOA 4TVPH 5EEZA 1MWAL 2ZAGA 5HDBE 1R5VA 4FTDA 5F3BA 1OHQA 3CFKB 1KLGA 5D9SB 4AV4A 1I1RA 4TUKL 4JL2A 4UQDA 3WIIH 2FZ3A 3N55A 3UTTA 4A38A 1S7SB 3V0JA 1J86A 3GJFK 1FGNH 1R3JA 3DC0A 3IDXH 1J5OH 5AB2A 1Z66A 5CU9A 1V54B 5L2KB 3MA9L 4PGEB 4TL5A 3I3DA 1U8KB 3MUUA 3QO0B 3VI4B 3EOYG 1FNEA 2YC1A 2OKMA 3GEFA 4FXTA 2QVMA 3MMEA 4LXFA 2UX7A 3WI9A 3EFOA 5FYKL 2DLHA 5DD0H 5EIQA 2P44B 4XMKH 2C1OA 2ZYIA 4AJ0A 5ICUA 1AZVA 4P5SA 3KYKH 2ZKHH 1XR9A 3SDDD 3L45A 3ABKB 4MMYB 4LRNH 1PCSA 4ZMOA 4LLQA 5FDWA 3DYMA 2KL6A 2X1PA 2FSEB 1BZ8A 2FATH 1EGJA 1YDPA 4Y2DA 2GFBB 3ZE0B 3DHJA 2VLJA 3PWPE 1JOIA 2VE6A 3TH4T 5BV7H 1VZIA 3F2LA 3FW6A 5A2BA 3VG0L 3K2MC 4NM4L 2UVEA 5HDQL 3K4ZA 4XMLH 1EHXA 1KTJA 3EADA 1QRND 3T4YA 4YE4H 2X28A 3H4FA 3RE0A 3F00A 3MRKA 3V9EA 4IKLA 1FLRL 1TEGA 5KSBB 4W9ZA 3ERXA 2CKBB 2HCZX 3EDJA 4C83B 2FQEA 2TAAA 1G0XA 3AROA 5JORB 4N5EC 1S7WB 2AJVH 4K3EL 5B38B 2YK1L 2KDGA 3F7QA 4R5TA 5E6RB 1ZHNB 1H6EA 1KOAA 5ETUA 3BSZL 1X6LA 5CEXB 2YMXH 4M62H 4F93B 4P5TC 1NOLA 3QDGE 5ERWA 3SPHA 4HEPG 2WTRB 3X11A 2DOCA 2APFA 3WKNA 2B9BA 4D0BB 1N5AB 1MAML 2FT8A 2MCPH 2PCFB 2AJ3A 4HCGA 4X7FC 4E9YA 1KG0A 2Q8AH 5DEGB 5F8RC 4BFRA 1BQ5A 5C08B 3O9WD 5GS1A 2PLTA 3DSFL 4UZGA 4CBPA 5CXPA 2NMSA 3GDBA 1IEBB 2OK0L 1AGFA 1QW8A 4JE0A 5BO1H 2ZG3A 3UMNA 5GS0L 3OJDB 1JXFA 3CVHB 4JRLA 2FE0A 3C75A 4QRUA 2V2TB 3VI4F 4JCLA 3LHAA 4Z6AT 2ZPKH 1NGWB 1E43A 2DLFL 1WZMA 3HNSH 4MJIE 1BQLH 4NO2A 4GT0A 4Z7IA 1OQXA 2FUQA 3QXDA 2R7EA 2QLVB 2HT3D 4UM8A 3RNKA 5L7XL 5DJ0A 5C0ND 3HAEA 3L4TA 3J8F7 1FAIH 4IIZA 1E8XA 1X5IA 2KLRA 5E2WL 1NFIA 3UGUA 5TQ2L 4EXPX 4UIKL 2DWDB 4M6OL 3NA9L 4LQFL 2P49B 5E5LA 3BN9D 1KJVB 3VFVA 1INEL 1E2WA 4J4PD 5EBWA 5E5UB 2H5UA 2W07B 3MRIB 4BFJA 3NZHH 5E08L 4KTEL 2ARJB 3OLEA 2V2WB 4OFYA 5F7KC 1WA0X 4TV3A 2AV7A 4MMZC 4ORZC 4YPGB 4IHBA 3FH5A 1KELL 1KB5L 4W9IC 3VXQA 4AJWA 5GS2H 5IB5A 4MXVF 2QQKL 1EBPA 1RPKA 2R9HD 2VIRA 4GKSB 1YNKL 1SVBA 3L3HB 4JGNA 3MXWL 3QS2A 3JQOB 2ZXDA 4HXBL 3CZFB 2Z7ZA 3IMVA 4JPKL 3GO1L 5EU7E 3T77A 2BIQA 3PL6D 4NB7A 4B9ZA 1F1GA 5TH2B 1BREA 1KEMH 3PAZA 4W9HC 1P4LA 1DSYA 3DO3A 3OM3B 5GS0C 2AC0A 2DEWX 1PAZA 1URZA 1MFMA 4GEJA 1I9RL 4ZDHB 4KUCD 4HVBA 4UINH 1R5VB 2YXFA 4ZSOE 2APTA 3CH8A 4G9DA 1RFDL 4O2FB 2Q86A 3QIUB 2H26B 4OZHF 2DWEA 2YRLA 4UV4L 3FO2B 2Z7YA 1GGCH 1VFMA 3NJLA 3S4SB 2E59A 3QUGA 5F9WC 5PAZA 3OKLA 3WS3B 1QUNB 2FHFA 3NSFA 4PLJC 2IC2A 3OTTA 2Y36H 3ZYOA 3W0WD 3P9MB 5T1MA 3FO9B 4XZUB 3U6RA 4PP1D 1J10A 3IJEA 4C47A 3MRMB 5EU6B 3BW9A 3I2CL 2V3EA 3MRHA 2XG4A 2O6PA 1AGBB 1LO4L 4CJ1A 3WE6A 2P42B 4Y2LA 4NZUH 5F0PB 5GGTA 3TA3B 1JRHL 5KSBE 4CNIB 1XSJA 1A5FL 2Z93B 1UEYA 1P7KB 1KTBA 5IUSA 3GMPB 4GSDH 2CHZA 3G6JB 4QYOB 2VE6B 5CEZH 3BEWB 3BDYH 2OMZA 3GTNA 1CLOL 3OMZA 1LM8V 4P4KD 5EFIB 5KBKA 1IRAY 2CDFA 4LBEB 3T4YB 4AZUA 2Y5TA 2J71A 3THMH 3IE4A 2DLEA 5I71C 1AO7E 1MFEH 4W81A 3AUVA 3MR9A 1JGVL 3Q0HA 3W2DL 1KENL 3C5SB 1CK0L 3BWUF 2VQUA 5JTWA 2A9NL 1YAIA 3IRZA 3EH2A 5C2BH 5FXCH 4BWWA 2FCBA 3M7FB 5TFSH 1NCGA 3GSNH 1ZTXE 4GRLB 2B1AL 1KJ3H 3AT8A 3W9DB 2OZNA 3MNVA 2VDKL 1ILUA 3NFSL 4FC3E 1W91A 2P3YA 4BKSC 3X12A 2J3SA 4G8GD 4R83A 5HYSA 1KCUH 3DJRA 2X6CA 4DKFL 1PKQB 1ACYL 3CFQA 9PCYA 3U9PH 2E8ZA 3UBGA 3U6XS 1QSED 4L2YA 3PL6B 3IJHA 3SDXA 2FQGA 3LXBA 3UYRH 4BHUA 2J5LC 1NIDA 1WCBA 3TJEL 2IH1B 4XMZA 3LHPH 4XX1G 1NFDE 3RL1B 5L4FA 3T0XA 3UXFA 2NY5H 3MGOA 4K3DL 4N6RA 4X6DB 4GI9A 1EWHA 2PTVA 1EXUB 4X6DF 3MXVH 3ZDWA 5T1JA 3IFPA 3Q5TA 4NFDA 2NT0A 4FG6D 1B0GA 4Z7VE 4ZTOL 3CFBA 3D30A 4OF5A 1DQDH 1RIVL 3CPLB 1BIIB 3KVQA 4BFIB 2YD3A 3RX5A 1J1OH 4ELME 3DETD 1MFVA 1DYZA 3RU8H 3GSNB 4DOHE 3ALXA 2DM7A 2EACA 4AH2B 1CLZH 1OGAD 1RULH 5DI8A 2Y25A 5EU5A 1EO8L 4H1LA 3SDYL 5J13B 2R29A 3V4UH 4IRJB 1KYOK 3D08A 3D39E 2Z3FA 1V7NH 4DZ8A 4EIZC 5C0CD 3AFLA 3F7LA 2EYTB 5CGTA 4JQVA 1HU8A 1MDAA 1W72B 1MJ8H 3DECA 4Y1SA 5IW6B 5LGJA 3MRJA 3D9AL 5CP7B 5IVXA 4DCQA 3U2SA 3JTTA 4PJ5A 4RGND 4P23B 1IAIM 2A6DA 3PAYA 5CIPB 4NQQA 2VITB 1ZT7A 5ICXB 2FZ3B 2F54D 4GKNB 1UM6L 4EN3A 4HJ1A 4MLIA 2VSCA 2DQCH 2GSMB 1AQ8A 2PPDA 5D2NA 5IVZA 4Y4HA 5DJXA 5J89A 3CZEA 4QTIL 5B1BB 2AI0L 2WINB 1CT8B 1Q9LA 1WBXA 2XV6B 4UIMB 2ZCKH 3LSOA 2V7HA 3L4WA 4B3EA 2ZOOA 4N85A 2WQXA 3LPGA 3PXLA 2KT6A 4NNPH 1N10A 4RGMC 2Y6SD 1IAII 5BQ7B 1B6DA 2BP3A 3LMJH 2X6MA 5MENA 1Z9OA 2CXGA 4NN5C 3SBWA 1A25A 5DQ9B 5L2KA 5C0RL 1JRHI 1SYVB 4RMBA 4Y4KD 4UNIA 3S97C 3UPCA 1MCDA 1NEZB 3DGGA 3VTMA 2NY3D 1Q9WA 4YXKH 4XPHL 3M86A 4Y1AA 3T77B 4QRRA 4ZS6D 4RZCA 3N0PB 4Y2DB 5LGHL 3MV11 1NMAH 3VVVA 5DRZB 2DBLL 2VQ1A 1TVDA 4B9GA 1BOGB 2D7OA 1DQKA 5EBLA 2WXKA 2VR6A 5DHYB 4B53A 4IBTA 3B9KD 3MJGX 1T80A 1IQDA 5DMJB 1RV6X 1O9ZA 3EKCA 2W0PA 2Y22A 4PS3A 1GTNA 1CL7H 3EOAA 2P45B 5I6MA 4XCYB 4UYPA 4YDLB 2BXZA 1ZV5A 3WFDH 3HCVA 4F7TA 4OUOA 5I6PA 1DBMH 4F15B 3T5WA 3W0WB 1PLGL 3O4LE 3UDWC 1L9RA 1TMQA 2J73A 1S9KC 1WVZA 1IGFL 1S7QA 1NFKA 5E00A 3WEOA 4Q6IC 5I1HL 1ID5I 2FSDA 2DD8H 3AABA 3ISRA 5ETUB 4CVXB 4K8RD 5EOTB 2P5EE 1E5BA 1FH5L 2VJ0A 3U1PA 3VFSB 3VX0A 2E27H 4PUBL 3VD0A 1F8TH 5EO0A 4BRVA 3VD9A 1G1KA 2GT9A 3EGSA 3A24A 1ZLVH 5BXFB 3SDDC 4N9GA 3OMAB 3GMNA 3P3UA 4XNXH 1N67A 4A2LA 2I60H 2VWEE 2NZ1A 5ID1B 1BSIA 4HFWB 1AXIB 3OR7B 4XR8C 3N04A 2R9HC 3G6JA 4PJ9D 4QYOA 1MELA 4LLDB 4QWWD 3PDDA 4M93B 4Z7NF 1QX1A 2EIJB 4KRNA 4PRDB 2W9EL 5C0IB 3BPCB 1A3RL 2X2YA 4K9EH 5C0EB 5DSCB 1D7CA 4WEUD 4H8HA 4JPQA 1B3IA 2R2CA 2WJ5A 1TQCB 4LSUH 1FIGH 4C55A 2AK1H 2N01B 4L18A 4R26H 5ABAA 1JWSB 3AM8A 2WZPA 5DR5L 1L9OA 4NNXA 4XNZC 2OR8A 4P2OB 2FYYB 3BUYB 4U33A 1R3KB 1KV3A 3ZIYA 4PS4L 3TCLB 1BX2A 3PRZA 3WENA 4PH8A 1G7IB 1AJ7L 1CZ8L 2J8UB 2VNCA 4KU1A 3PF2A 3MLPA 2OULB 3MUGA 3SJVA 3M1BB 3VXUB 1IEAB 2HLAB 2AZAA 2HT3C 3CFIC 3GPEA 4MZ3A 4Q7DA 4TULL 2QKIB 5TK4A 3LEXB 3FCTA 2IDTA 1EAPA 2VJ8A 3PWNB 4HPHA 2JKIS 3LB6D 2DZEA 2IJ0C 1C5DB 3CZGA 3TASA 1MCPH 4QKTA 4BV1A 1QZNA 4TNEA 5E0QA 4PLJD 4PRIE 3LV3B 4HUNB 2H1XA 4IHOA 3W2DH 4L4VD 5A2FA 2EDYA 3WMSA 2EILB 5D7SL 1RP9A 3HE7D 3PWUA 4MAYA 4F33B 4AEIH 2O6FA 4X6FA 2H2PC 2PCYA 1Z2KA 2W80C 1CLOH 3IVKA 3HJEA 4L8SC 3ZKNC 1BYNA 2G2NA 5CEZL 5D1ZA 2YSSB 4DTGL 2K6ZA 4XXCC 4FXKB 4DHLA 2KQMA 4H8WC 3K5SA 2CZNA 3S88L 3F7YB 3S98A 5SWSB 1QG3A 4MBOA 1IM9B 2WB7A 1JV5B 2IOOA 2BIMA 4M9OA 4PJ8C 5B8CB 3W11D 3PL6C 1XB3A 1INQB 2P7TA 4AYMC 3A5VA 1M2VB 3QO0A 2LQRA 4QXUH 5DZNA 3RB7A 4DZ8B 1LO5A 2QT6A 1DBJH 4KRLB 3DJSA 2J56A 4G9FB 3FCBA 1CFNB 5TE6H 3MLTA 4KAQL 4IJ3C 1E6JL 5CCHE 1TUPA 1S9WB 5AZUA 2XHNA 3BC9A 4MWFB 4NZRH 4A2GA 2ICWA 3P2DA 3OHXB 1R3LB 2PP7A 4DH2A 5BZDA 3H2QA 1Q94B 4ZYKB 4DUWA 4DVBB 5G4NA 3QCTH 5FO7B 2NYYD 3WHE1 3NIDF 3SGKA 3QUZC 4JG0H 5HHME 4QO1A 4FMVA 4YLQT 6CGTA 3FUMA 1PTZA 3QIUA 2Q86B 3FT1A 1J18A 3T0ED 4N8PA 3QEQE 1IAKB 3P2BA 3WY2A 3BUIA 3T0EA 1S7UA 4NCC2 3I6LE 1OAZL 4ODWB 3NEEA 4NERA 4Y89A 2V7NB 3ZMNA 5CJOH 1KEML 5E6ID 5HYQA 3EBIA 2R0WL 1KC5H 4MCYB 3IJEB 4ZNCD 4Z8FH 2YUZA 3BH9A 3EO1A 1OSPH 4IDJH 4NN7C 5B3JE 5DR5H 3UMTA 4KJPC 1ASQA 1RJZB 5IJDC 3APCA 1HQ4B 5AOKA 2AK1L 2IAND 2XKSA 4YHIA 3VUAA 2EABA 2OMVB 1S9XA 3LQAL 4Y2OB 5GSVA 4XAWH 3QHTC 3ZGHA 1FG2A 4IS6B 3S8WA 4IEFA 4U1HB 4HIEA 2JJVA 4KJQD 1FZJB 1AGBA 3ALWA 1HXMB 1QFWL 2XWBB 3PV6A 3PREA 3D34A 3WJJC 4AXWB 4DP8X 2XY2A 3A6BH 5I75B 1AZRA 2AQ3A 2UWEE 2E7HA 4NZDA 2PP9A 4MJ2A 1ZA3B 2J57A 3PP4L 5B38G 1I31A 1F8TL 1IFRA 3B6SB 4LQFH 4P2QD 5IG7B 5IEKA 3EJUA 1KG0B 1I9JL 3H7LA 4WY7H 3VGHA 3P73A 4A7QA 2ZSWA 1KSRA 1K72A 5EFIA 5G55A 1T0MB 4PJ6A 3AB0B 3F7PC 4X6EA 1GGUA 2ADGA 2Q7YA 4AVHA 4L4VB 5L7XH 5JMRA 1IM3A 4J12A 2CCLA 5I1JL 4YHZL 4LVHB 3TBYA 3JBG7 3ULSA 1AMXA 2V2TA 3NJJA 5FGBA 4KK5C 3TF4A 4HYTB 2HVJB 3SDXB 3TWCH 1I9EA 1U8PB 2OSLB 3O2WL 2CBOA 4GSRA 3LXAA 3O3AB 3LTVA 3W39B 4M6ML 2GIXA 4DAGH 5JYMA 1QBML 1UXLA 3IGAA 4QWWC 3T0WA 4RA0C 3JWDH 2BCMA 4H8WH 4POYA 4F1SA 4L9LB 5B1JC 5F89B 1ND0A 5AUMB 4Z3JA 1N6VA 2QBWA 5J6HB 4JFHD 3SKOB 4PJBA 2C3XA 3AGWA 4F91B 4NNXB 4PGBA 4POUB 5EHFA 4XMPH 1TYJA 4HKXA 4JZNA 4H40A 4PHZA 4E41D 1L7IH 2MCPL 3ZE2E 1C08B 3M45A 2VDNL 4IGBC 1DN0B 4FTVA 2CHDA 4EI6A 3CMOH 3EYUL 3NJGA 5EIVA 5EBWB 3RI5F 5IHUL 5JQIB 3U4EA 4W9CC 3DOHA 2YARA 3TM6A 3WFEL 4RIRB 2JKLA 2WBJC 1DVFA 1JUFA 1Q72H 3H9ZA 3MJ9L 4FA7B 2G3XA 4IJ3B 1C7SA 2VXQA 2WW8A 1J5DA 2DTML 2EXYD 2I9LA 4HZLA 4TLUA 1E4XH 1ITBB 3ZKND 4K3EH 5T5NG 1FNAA 5JIMA 3LZPA 2WTPA 3CDZB 1H15B 1BFOB 2XFGB 3F58H 4W4OC 2V8LA 4XMXA 5DJCA 1QBLL 3GSUA 4YBLB 3RFRA 4ERSL 3KXFE 3O45A 2MNUA 1X9UA 5FV1L 4M5ZL 4W9KC 4YE4L 1C8PA 3HRZC 4I0PA 1ZE3C 1UQSA 3NVQA 3SY6A 1Y7VA 4DCQB 1WBYA 3TPUA 1CYWA 3SDCA 1YQVH 3GRWH 4YPJA 3VI3E 4QLWA 4X9HA 2YSSA 4X0NA 2KZKA 2D0GA 2CU9A 4UT7H 3FTXA 2Y72A 1X5JA 3FO2A 4BQ8A 1B4RA 5ANHA 4EO5A 5IROD 4OJEH 2Y4SA 3BAYA 3T8MA 1YEHL 3GXUB 5I8KL 2ZUYA 3RWGA 2BVOB 4NDMA 4YR6B 3FUEA 5D4QA 3QORB 3DUHA 2F08A 35C8L 5DVOA 3X3FH 2HMIC 1BHGA 3V0AC 3MRHB 3FUNA 1U92A 3UTOA 3ZT6A 4P5TD 2K8QA 3RTQB 4WUUE 4BZ1H 5I6LA 1LEIA 4WTWA 1NEZA 5DWUL 4WUKL 4RSVA 1HH9A 4UT6L 1QSEE 2NCEA 3SDDA 1FGNL 1BPVA 5EUKA 2MKWA 4G80A 3EJPA 4LSRH 4DK6A 3EOAB 4H0LC 3LD8B 1VCAA 4MJ6B 4DO6A 1KCUL 4KO9A 2CK0H 2C9QA 1TJMA 1M3JA 3ZHNA 2NNXA 4JGJA 7FABL 3DV4A 4R84A 2X4TB 3IXAB 4ABQA 2CWRA 3KCPB 4JO4H 3I9GH 4X9BA 1IO4C 2BIOA 4JKPL 3WEAA 4PJHE 4E42A 2VZOA 3MOAH 4E9RA 5FPIA 5K9QG 3U9UB 1UWXH 2QVFB 1OCWL 2F7IA 2APVA 1I82A 4FHKA 2DV6A 2HT2C 3JYBA 4LLUB 3THML 4WNSA 2OJEA 2R2EB 3HJ0A 5D7KE 3S5YA 3TBWA 4M5YH