1ESOA

Monomeric cu,zn superoxide dismutase from escherichia coli
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
154
structure length
154
Chain Sequence
ASEKVEMNLVTSQGVGQSIGSVTITETDKGLEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGPEGAGHLGDLPALVVNNDGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGGGERYACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CU, ZN SUPEROXIDE DISMUTASE
publication title Unique structural features of the monomeric Cu,Zn superoxide dismutase from Escherichia coli, revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 30
structure length 154
sequence length 154
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1esoA00
3GZQA 1RK7A 3T5WA 1UXLA 4A7QA 2WZ0A 4BCZA 3L9EA 1B4LA 1JK9A 2Z7WA 3QQDA 5KBMA 1E9QA 1TO5A 3GZPA 3H2QA 4A7SA 2C9UA 1N19A 1E9PA 1IBDA 2AQPA 2JLPA 1SDYA 1DO5A 2AQSA 3HOGA 4A7GF 2Z7ZA 1SXAA 2Q2LA 4OH2A 3KM1A 1IBBA 3HFFA 1SXCA 1S4IA 3KH3A 1COBA 1BZOA 1F1DA 3CE1A 3CQPA 2C9VA 1B4TA 1IB5A 1U3NA 1YAIA 2WWNA 2XJKA 4A7UA 1PZSA 1SXBA 1IBHA 1CBJA 2NNXA 2WZ6A 1ESOA 2JCWA 3F7LA 4B3EA 1OAJA 4U4IA 3ECWA 3GTTA 2WKOF 1FUNA 1SXSA 2AQQA 1SPDA 1SRDA 1PTZA 2AQNA 2GBUA 2V0AA 1E9OB 1F1GA 4N3TA 2APSA 1Z9NA 3LTVA 2WWOA 3ECVA 2E47A 2WYZA 1KMGA 3MNDA 1YAZA 2GBTA 3F7KA 3H2PA 1DSWA 2WZ5A 3KM2A 2ZKWA 1TO4A 5KBKA 2VR6A 4FF9A 4MCNA 2XJLA 1OEZW 2C9SA 2GBVA 1N18A 2LU5A 3S0PA 1MFMA 1CB4A 3GQFA 1E9OA 1F18A 1OZTG 3GTVA 3KH4A 4A7TA 1BA9A 1Z9PA 1E9QB 2VR8A 1YSOA 1XTMA 3HW7A 2E46A 2R27A 3PU7A 1EQWA 1OZUA 2ZKXA 2WKOA 2AF2A 1P1VA 2AQTA 5CU9A 3SODB 3KBEA 3GZOA 1UXMA 2ZKYA 3KBFA 4MCMA 3MKGA 4N3UA 4A7GA 1OALA 4A7VA 2K4WA 1XTLA 1SDAB 4L05A 1QUPA 1Q0EA 1XSOA 3K91A 3ECUA 1F1AA 2VR7A 3QQDB 1JK9B 2AQRA 1HL4A 1SXNA 5KBLA 1IBFA 1HL5A 4OJAA 1L3NA 1PU0A 1AZVA 3RE0A 1E9PB 2SODB 1SXZA 4BD4A 4BCYA 1SOSA 2AEOA 2Z7UA 2Z7YA 2ZOWA 2WYTA 3L9YA 1JCVA 3CQQA 1EJ8A
chains in the Genus database with same CATH superfamily
3GMNB 1WZKA 4PJIA 4KUCF 1MIMH 1SJEB 3HUJE 4WAFA 1SJHA 2L8AA 3VI3A 3E0GA 1BQUA 1UZ6E 4HQQL 1F0LA 3F7YA 2IFFL 3OC5A 1QRNE 3DDFA 4HLJA 1SY6L 1QHQA 2CE6A 5CD3B 4KKPA 3FN0H 1JD7A 2QGBA 4NCC2 3DX8B 3HCVB 3BVTA 1MCFA 1YQ2A 4LBEA 3EF4A 3T71A 2UV3A 1OCCB 3QH3A 1XF3B 4GY4A 4F9LA 3SJVA 4KVPA 4A66A 3EO1B 5JQ6L 2Z92B 4I77H 4UAHA 4D9QE 2Y5QA 1ZXQA 2EICA 2COVD 5EO1B 3AREA 2AXGB 3VXOA 1GZQA 3DSFH 1QTSA 1UFUA 2X2UA 3FQNB 4FQCL 3UJJH 4MMYB 4ZPVB 1HX0A 3MRJA 4BZ1L 3HC2A 2X4OB 1U8LA 2KT6A 3CSGA 5E8DH 4M6NL 4UB0H 2R69H 3CZSA 3PDDA 1NAML 1Y1UA 1YEIL 3CFQA 3IXTA 3N04A 2ORBL 4R7LA 2Z3FA 3IM1A 4XTRD 5C08B 4RAVA 3QRBA 1FL5A 3QUZC 1I8LC 3CHQA 3GMOA 1M2VB 3ECVA 4G8GE 3KYKH 1UD4A 4AL8H 2L04A 4OGYL 4HKJB 2Z9TA 3F84A 3U4EA 2V37A 4Z7WF 5ITBH 1TQVA 3OPUA 1SJXA 5FO2A 5K1JA 3DJSA 3UBXG 4X4ME 4PP2A 4MRCA 5JPNB 4I0PB 3OKYA 4P4KA 5FYJU 3STZB 43C9A 2LE9A 3I9GH 1FN4B 2ZXCA 2DTMH 2EXTA 3U6XA 4TVPL 1TJXA 4G7SB 5HDQH 3RNKA 4KXZH 1G6RL 3GSWA 3NEEA 4X6EB 2CK0L 3NCXA 3NH7L 4JDTH 2QLYA 5HGGS 3ZT7A 2EVJA 4AXWB 3E9TA 2K9UA 4NJAH 3H55A 3RHWK 3APMA 5I1GL 1MWOA 2J1WA 3SODB 4IBTA 1UB5B 4H2CA 2C4XA 4OLYL 6TAAA 2G5BA 3LKNA 3M1BA 2L7UA 3I9AA 4Z0BH 1TT6A 2W1NA 2XXGA 4PG2A 4TSAL 3U25A 5ABDE 4UTAL 4XCEA 5MEQB 2NY7L 4KROC 4UT6L 1UCBH 5ACMA 2ESVA 1I4FA 2JCCF 3TN0B 2YAQA 3S5LB 4QKTA 4P9HL 3WMPA 2WN2A 3QJTB 2K6ZA 5DVMA 1SHWA 2OSYA 1AGFB 2FJHA 1ZANH 2C3VA 3QNFA 1FNHA 5MHSE 4LEEA 1FE8L 1OM3H 4KKLC 2KL6A 2IAND 4ELMA 2H6OA 5JLZB 2EE9A 3O8XC 5H94B 1AKJB 3HNVL 3KCWA 5EC1A 1JYNA 1DQJB 3O4OC 1T1YB 4GLRH 4ABQA 3N42F 4EBQL 4MA7L 1TEFA 4LB8A 2VKWA 2PN5A 4ETQA 3X3FL 4JJ5B 4OIBA 4NQDA 1U33A 2XIDA 4Y9GA 3OJDA 2NUPB 2IAMC 4UM9B 2ZG3A 4HKBA 1NKOA 3S2AA 1N0LB 2EDFA 3W0WE 2CGYA 4F1SA 2WQWA 3EYFA 4J4PC 3WFDL 1ET7A 4XX1G 1RZFH 2YRZA 1WP6A 3HNTH 3ZIMA 5KWYC 4KRPB 4GI9A 4HUUB 1TVBB 4BQBA 1H3WM 5KUKA 1CF8H 2BCMA 3Q1EA 4PR5A 4XPGL 3QWOA 1E4WH 4Q6KA 5IHBA 3M7FB 2VLJE 5D1XB 4TS6A 4C47A 4ZW7A 4L4VB 1S5HB 4MD0A 1W91A 4FNQA 4MQSB 1UQSA 5HJGA 1SRDA 2WIIB 5IQ9B 4D8PB 4WUUD 1RMFH 1M7IA 2P28B 4HCRH 4DEPC 3MRIA 3CFEA 1ZHKB 5DA4A 3Q2VA 3ZL1A 1YNTF 3CN2A 3O6KL 1N7ML 2R51A 2K9FB 1O7SA 2YQ2A 1CGYA 4XMKH 4ADIA 4PJXA 1ZEAH 3QUYA 4XRCA 3ZGHA 3I75A 3PHSA 4LFHG 3QNYB 3L4YA 1SY6A 1IT9H 1CXLA 2ICCA 4MYWB 1N8ZB 5EN2B 3SQRA 1SDDB 3UZQA 1NIDA 2HVJA 4X5XB 3F6IA 3TNNB 4K3JL 3Q6GL 5I0VA 1RZJL 3D3VB 3CDCA 3FB5A 1ZHLB 2B2XL 3BDYH 5M94B 1CL7L 2BFVH 1ZV2A 3MYJA 3MZTA 1TCRB 4G80B 1WBXB 1A6VL 4K8RD 1CLYL 4Y5XC 5FOJA 1UXSB 4BKTC 5L7XL 3MZGB 3P3RA 3PQYA 4LARH 3Q2NA 4JX0A 1F13A 3ESVF 1QFPA 5BV7L 1BD2A 3VD7A 2EQDA 3N5AA 4J6RH 4Y1AA 2CIIA 3F62A 4I4WB 3LQAL 5EOCJ 2K4AA 4OUUA 4BZ1A 5JW4M 4NHCL 3B43A 4L05A 4XP1L 1P4IH 2WINA 1OSYA 2ICWJ 1BZQK 4FXKB 5IVXA 3KBHE 1EZVY 1NAMA 1UA7A 2G0LA 1T22A 2ZQKA 2BZ7A 1AZNA 4NPYA 3LZOA 3RWFA 5FM4A 5BZWB 3LN5A 1VEMA 3KLKA 4CVXB 2DWEB 4U3CA 4ODVH 3MRQA 2HVBA 5KSAB 4FL4C 4Z3FA 3FONA 4U1HA 5DS2A 2NY1C 1BBJA 2J43A 3FFCB 4TUJA 5DT1L 3QGVA 3U79A 2D31B 3WTSA 2Q20A 2N0KA 1QO3B 1U21A 4EI5A 4X6CA 2WV3A 5E23A 3FT3A 5ICXA 3H85A 2BHUA 3OZ9L 1Q0YL 1WS7A 4QTHA 2IH8A 3MRHB 3SKUD 1IGIL 2DQCL 3IDXH 1G6RA 3ZDYB 4E0RA 4K9EH 4YGVB 2BNUB 1KOAA 1A7OL 2Q0ZX 4HT1L 3OKEA 2C3WA 4G8EA 1R19A 2ZNWA 3E6HB 5HHME 3EJUA 3WIIH 5AKSA 4IU3B 1BCIA 2H1PH 2IPTL 4E42A 5IMOA 4JFEE 4K4KA 4MCYB 4UTAA 4YHPB 3C6EA 2X70B 4UT6A 1U8CA 1JWMA 3WJJA 4G8AC 1D9KB 3V4LA 1J8SA 1SQMA 2XCMC 1OB0A 3X12A 2JCWA 2NXZB 2CO7A 5C0BE 2DW5A 1DBAL 2FNWA 3BP6A 2IFGA 3JSSA 4XWGH 3CZLA 5FGBC 2ZX7A 1XGQB 4PRHE 3NDZE 3OB0K 4UZGA 5C3LD 3D85A 3ECQA 1B2YA 5CKGA 2ZWKA 1JVOA 3MV8E 3OAWA 3FRPB 3BAEL 3NGBB 1MVUA 4GPVA 3DVNB 5EZIL 4AQ1B 2XICA 3FZUC 2BRQA 2BP0B 1Y6KR 3VFMA 4ZG1A 1RULH 3HAEH 1DQQA 5FW6A 3MLSL 1VADB 3OKDB 3ZO0A 3HZMA 35C8H 1OARH 4H1LA 1U8KB 3WL9B 5LQBH 1KG0A 4L4TA 4G8IB 1MQ8A 1KGIA 2NNAA 5LGHL 2K3TA 5KVGH 4R2GD 5J13C 3T4YA 3MAWA 2IG2H 4DTGL 4HLZG 4X5RA 3LNFA 3K71B 4IHOA 3I6GB 3TT1L 1KJMB 3GSNH 3D39A 1YUHA 3HUJF 4JG5A 4Z95H 1ASQA 4M7JH 3FO2B 2JXMA 2NY1D 1JCKA 1FIEA 3KWWB 1JHKL 1QLRA 2AVFA 2Y07H 2A6KB 1NJ9A 5JNYA 2ZUWA 1A4JB 3PWUB 4Y19A 3B8YA 1CFBA 4Z0XB 4FQ1L 5IBLD 4UAOB 2GCYB 4AK1A 3GUTA 2YSTA 3H56A 5AW0B 4AMKL 4F9PC 4OJAA 5F9OL 3SE6A 1JNHB 4FQXC 1MFEL 2VITB 3GKWH 3P9WB 4JY6A 3K2IA 4K2UL 1IBGH 1MHHB 4DKFH 5IZ7A 3SQOL 3C5ZC 1OHZA 3NCYS 3N41B 5F9JA 3WENA 4JHVA 5HYJE 1MFVA 3CAFA 1NUDA 1PZ5B 1RZ7H 3VA2C 4IBUA 1EEQA 1FF5A 1RIUL 2J1YA 2YPLA 3VXSD 1JK9A 2YJQA 5CBAA 4MXWL 4WRLA 3V6OC 4HWBA 3JTTB 5G4MA 4PJEA 1FZKB 2AJZB 4MB5A 3TC9A 3MROB 1NMBL 5CEZH 3IBEA 1DQKA 4AQOA 4MJIA 4OSUL 5IOPA 5GS0L 2Q2LA 3FDWA 5SX5K 4Z3GA 8FABA 4MWFB 1HHIB 3T4AA 4YHLL 3WJLC 3LIZL 1G9MC 3FCSA 2IGTA 3V2AR 1CFVL 1UUSA 2UYLA 4JMXA 4DW2H 3QEGL 2XPGA 2P44B 5JW4N 2R4RH 4PJ8C 4U31A 1FZJA 5E4OA 2ITCA 4CU6A 4OCMC 5GRUH 3V6ZB 5L88L 3IJ9A 4Y7MA 2VLLA 1P5UB 2YXFA 5FPIA 3ZSSA 5I5IA 4U1NA 2PABA 1C16B 2DYRB 3ETSA 2FE0A 1FG2A 4KPHH 3A6CH 5K69A 1C8QA 3VCLA 4EN3B 5LN8A 4FABH 2CHDA 2E47A 3ZMRA 4MNQA 1JN6B 1L9RA 2F54E 1Q9LA 2EDBA 3U7WL 3F8UB 4YE4H 2X12A 5INCB 1LEIB 4WKZA 4ZX5A 2GBVA 1W15A 4LEOA 3PWPE 1PLGH 4ONHB 5IB5B 2IV9A 4JW3A 5KVGE 1MAML 3P30L 1ZLUH 1JHLH 4GS7C 2EUZA 2Z8SA 3MV9B 3SDDD 2MCG1 1CFMA 1EJOH 5TF0A 3TVMC 1NEZA 1KGJA 4JPWL 1KLUA 3CDYA 4PGDA 3SE3C 4Q14A 1NMCC 4UV4L 1HAWA 3ARFD 2ZSVA 2QQNH 5HVHB 2VZ1A 3A47A 3BPNB 4K5PA 3NTCL 5DK2A 1HXKA 2WUBL 4P5KA 1Y18B 3TJHD 3TLRA 3ZKXB 3G6DH 3B9DA 1F90L 1LO4L 4OQTH 2FIRT 4BHUI 4OR1A 1ZDSA 1JZ6A 4KNSA 1E8WA 3KLHD 2ADJA 2QHRH 5C07A 1G7HB 1KYOK 3MQIA 1I1YA 1QFWL 5KN5B 4R9HA 2D3NA 3UMNA 3WI9A 1JYXA 3RA7L 2CXGA 1B4JL 3ILQC 4YK4B 1MAKA 4AGNA 4KHTH 5I8EB 4U7MA 2XXCB 3N3EA 3BEVB 5I2IB 3U1SH 3JT0A 2NQDA 3RE0A 4PI0A 2KDGA 5TTRA 5JXEC 3TNMA 1TZIB 3VXTB 1KCRH 2XFGB 4OGXH 4LCYA 4ODSL 5I16B 2N4IA 3ULVH 1LTXA 4KKNA 3V52L 2A6DA 1OT1A 4G5ZL 1M1XA 5FIEA 2X1WL 4NWUH 1LEGB 3MYZA 2Z8VC 1BQLL 3FQWB 3ARWA 2QFPA 2CRIA 3NSFA 2Z34A 5F7YC 3I84A 3PUCA 5DZAA 2C9PA 2A2QT 2R56H 1AGEA 2HT3D 3C2AL 4B6ZA 5JIIA 3Q1SH 1AHKA 1TQWA 1ND0B 3AVEA 4BFEA 1S7SB 1FYTD 1D2PA 4F3FA 4IOSD 4Z6AT 3IMTA 2VDNH 4IGBC 5F7NC 1FA4A 1L6PA 1NFIB 3DTUB 4DQOH 1U91B 3X11A 2DJSA 4QRBA 1BZ7A 2ZCHL 4XMZA 2VO8A 3NRPA 5KVFL 2R0LL 5GIRA 2WBJB 2XFXA 4M6AA 1HI6B 5HTSA 5EUOF 5D7LE 5EO9B 4U1LA 3DO7A 4BINA 1MNUH 2DQUL 1IC7L 1HZHL 3GJEB 1CQYA 3ZE2B 2AITA 3QUXC 4UINH 1Z5LB 1HE7A 2ICEA 2YQBA 1KXQA 5I1JL 2YD4A 5IW6A 3X2QB 5FM5M 1KBVA 1NANH 1A1NA 1A2YA 1DSFL 4D3CL 2WLMA 3DX7B 5DS8B 4P57B 5F7AA 1S78C 4H8WL 5DEGB 1N18A 3QG7L 1FL3B 3SGEH 3WNPA 1LE9A 4HEME 4MASA 1E3XA 1KPRA 5IF0A 1E9OA 5EEWA 2R0WH 3NZ8A 3OLIA 1KTDB 4A7TA 3EOBB 3H9SA 4PLJC 3DBSA 1VFAB 4ZX6A 2JKNA 2QADC 4N8UA 2QKIA 1FGVL 1SN0A 3LIZA 2BOBA 2DBLH 3X1FA 2DB8A 5C0GA 1JPFB 1WD9A 4DN3L 2WXRA 2NRDA 1OZUA 3S5ZA 1GZPA 2AF2A 4FMVA 4N1EA 1TJGH 2X4PB 3HRZA 2VE6A 1T3FA 4MQ7A 4UOW1 1FVCA 1EO8L 5D1QC 5GGRB 4GG6F 4KGLA 5GS1C 3KLLA 1NGZB 1ZLVK 3QUML 3L8QA 4MNGB 4QRRD 5T1DL 1QNZH 5AAMC 4AQZA 2NY3C 5DQJA 1WISA 4ZXBD 1UWYA 1KLGA 2BNQD 1GOFA 2BZCA 3RTQD 1CG9A 2D9CA 2F9BT 1PD0A 2PWHA 4I9WD 4JVPA 3T3ME 5E8OA 1WV7T 5IMLB 3NYKA 1WAAA 3IMRA 4PVMA 1VESA 1QSFD 1K8DA 1S7QA 3T09A 5HPOA 2WBWB 3P0VL 2KYIA 1KBBA 5CIPH 4HFUH 3GLAA 3HJ0A 1UACH 1N6QL 2G2PA 2V5YA 1FFPB 4EDWL 3V5KA 1ZHNB 4XP5H 1IC4H 2WQSA 5TDNA 2Z7WA 3QE5A 3RAJH 4X6DE 4NQEB 2VSDA 3H1ZA 1KIUA 4OF3A 4MD5A 2X0WA 3VGAB 3N9GL 4QY8A 2K78A 4HWZB 4K8RL 4X4XB 3ULUD 3BZFA 4A7GF 5DRZB 2F74A 1HVXA 3NK4A 1SHMA 5K5YA 2TSAA 2HJKB 5I8OL 5A43C 3DURB 1F56A 1XF2B 1YEJH 3B1TA 5C0ND 5IHUL 2OR7A 2VMFA 5JUEH 1JMXA 3CQFA 2B9AA 4PLKD 5JMOC 2HKHH 4E9VA 2EZ0C 2GY5A 1NBYB 1BREA 6PAZA 1CDBA 1U93B 1RP8A 5C09D 4GW4A 2WLIA 1XSJA 4PRNA 4AITA 3I3BA 1JGUL 3RIAK 5IFHL 3BGFB 3V4PL 1I9JL 5A7EA 1PTZA 2I69A 3DIFB 3DV6B 3WN5C 2Y7QA 4JHWL 3N40P 1Z9NA 5A6IA 3DHMA 3S7GA 4MA3A 4BZ2A 1L7TL 3QDHA 5DWPA 1NCWL 3V5DA 2HFEB 1KTCA 2IH1B 1CVRA 7PCYA 1WG3A 3ALXA 2A6JA 3LVTA 4RGMC 3L1FA 3TO4A 4Y4HD 2TAAA 3D34A 3GQFA 1IM9B 3E6FA 1OL0A 5ALCL 5IJVB 3OGCA 4NN6C 1KLFB 4WU7A 2NYYD 3MBWA 4YSTA 5LLIC 5B38G 1IV8A 5HJ3A 4L8CA 5KZCD 1NINA 2VDLB 5DRWA 1DEEB 2DYPB 3PGFL 2DQEH 1DVXA 4B41A 1JPTL 1UZGA 3PDOA 1U8OA 4M5SA 3TBVA 4GRWH 3ECBB 1BVLB 3CN3A 5J6HA 1OP5H 3AJ7A 3QFJA 4UIKL 4P46C 4KMLB 3MA9L 4G9FD 2EIKB 4X6BB 1N0XH 1A9BA 1OF0A 4OV5B 4LSTH 4QHNB 3CUPA 1GJIA 4AIXA 1LO5A 1HQ4A 5CLWA 2PP9A 3MREA 4KJYA 4Z7QF 5HYIA 5AFAA 2WQRA 3GXNA 1T7WA 4WU5A 3NJMA 4A38A 4YSRA 1LK3H 1DQIA 3BVVA 1LK2B 2W5PA 4GT0A 4LLUB 1CFSB 2A9NH 2OBGA 2VLKA 2IANB 1BZ9B 3HPLB 3FFDB 3G5ZB 4L8DB 5FA3A 4UF7C 2E7BA 1JAEA 4HIHA 4TM9A 3VFRA 3N1MC 5HDBE 3VTAA 4K23L 3OTTA 1VEOA 1AO7D 4W68A 3BAIA 5L2KE 1A25A 4DERA 3P4MB 3V5HA 1CU4L 4HGKC 4OIFA 1XF1A 2QLVB 3N40F 4MBRA 3L5IA 3P4NB 4E41B 2LVCA 3BQUC 3RFZB 2VW6A 1D6EA 5GRXG 5HY9B 1I9RL 1FVDA 2YMXL 3VXNB 4JZJC 3ZTJH 3X1NA 4ISVA 2AQPA 3LEXB 3O81A 4M7KL 2BP5M 1PG7X 4HZLB 4HOWA 4IRJD 2HWZH 2WBXA 5DD1H 5I73C 3EJQA 3EBIA 4P2CG 3QUZB 5IQLA 3ME0A 3HI5L 3PXJA 3QUMA 1NC4D 3P77A 2C3XA 2VQUA 4I48B 4FQPA 3BAYA 4MNHA 3TBYB 4QRQB 1UWXH 2AV7A 2OR8A 5GRJH 2Y36L 3HS0C 1OAZH 4FI6A 1GA2A 4WUUA 2P42B 3C9NA 4PRDB 1PFCA 1H3PH 3UIYA 2O61A 1X9LA 2H26A 4P49A 3SKJH 5IB2A 2OMYB 4UNVA 3EGSA 4ZUUB 1HKLH 1FP5A 2DQIL 2DYSB 4P5RA 3VGFA 2YMOA 4CL7A 3F6LA 3MLRL 1PAMA 4HKZB 1J9CT 4HU8A 4OCWH 2ZUTA 3LD8C 3GM8A 4N0CD 5AUMB 3SPJA 5C0IB 1IKNC 3VWKD 5JHDB 2QSCL 1EJ6A 4H25B 3FK3A 4M62H 4M6ML 3KM2A 2MRYA 2KQMA 2XTSA 3CLWA 1QWNA 1BQHA 3M17B 2V2TA 4HMDA 5AVSB 3KVDD 2IVFC 4KROB 1YNKH 3UABA 1MJJB 1U3ZA 3BZ5A 4OFIA 5D55A 1C9SA 2BM3A 3ZMEA 4WI0A 3VTMA 4F37K 1WZLA 4FULA 5KSUB 5C0DA 4UTCA 4QXTA 4WFGD 5BOJA 2E46A 3PHQB 2OQJB 9CGTA 1WO2A 3PWLB 4U1SB 3WY4A 3N1GC 2YKLL 2VC2L 2BWDA 2VZUA 3PWJA 1WWBX 1NUGA 3U2SB 3NIGB 1Q0XH 3O8XB 2HN7A 5IV2B 2IQ9H 4WY7L 5I71C 1AQDA 1YJDC 3O4OB 3SDAD 1U3HC 1OE2A 1A3RL 4ODXB 2X4NB 3UTPE 4NO2B 4S1QH 3GB7A 1BG1A 3V4PA 2VO5A 2JK5B 4XBPA 5MERB 4ZQTA 4MD4B 5A2KH 4D2NA 3RKPA 2IBBA 1Z9LA 3D8MA 1P84K 4ONFL 4J3OF 1S9VB 4PJIE 4S1DC 3VI3E 2VDMB 2CJTA 2VH5H 2ZXEB 2I7OA 2GI7A 2XVGA 3QDMD 5EBWB 3FRUA 4OBRA 2BNRD 1DBBL 4HBCH 4YR6A 4KI1A 1P53A 4XN1A 5JTWA 5BO1H 1TO5A 1UZ8A 3QHFH 2XA8H 3BH9B 3WO4C 4B50A 1ECYA 2D3LA 3ZE0B 1DQVA 3FN3A 2XPZA 2WKLA 1FZOB 1CYXA 1SDYA 3G5YA 3N1PC 4X9GA 3V0WL 1SXCA 4R26H 3GRWL 4CBZA 5I9QC 4MS8D 4APQC 3QWRD 4LL9A 2VLME 2QPDB 1HILA 3NIFE 4MDJA 3DROB 5DJDB 1KYAA 3ZTJG 1TTFA 3MX0B 4DEPB 1YNLH 4QT5B 4ZOBA 3TFBA 3E8UH 1CTOA 1AIFA 3CVCA 1S46A 3RX7A 1KGCD 3DXAD 4ZOCA 3QJFB 4Z5RA 1EHLH 1RZ8B 1ZD6A 2WIMA 3GIVA 3IGFA 2JF1A 2WBKA 2MTAA 2NDFA 4I7ZC 5E7FA 3WS6A 3TBSA 2XSKA 2DLFL 3DYMA 4K07A 3LH8A 3LKPA 2O5YL 1T20B 3DX9A 3FUKA 4Y5XB 4EI6A 1MDTA 4H40A 3QEQD 1L9TA 5LKNA 2J44A 3S3SA 2Y6SD 3DA0A 2FVNA 4JY5L 2WJ5A 4ZMNA 4XVUC 4PSRA 3WSQL 4HQQH 5D7IE 4Y4FC 2IFFH 1AXTL 4D94A 1N5AB 1UH2A 3T3MF 1SY6H 4HSCX 1HHGB 2H0EA 3K6OA 4M3HA 4JFVA 3NN8A 4H26B 2Q76B 1SJVA 3D05A 5FEBA 2YSSA 4GFTB 2QQKL 5IB3B 5IVNA 3SEPA 1FLRL 3FAWA 5JQ6H 1H3VA 1JUFA 1H9DA 1Q94A 4FL4B 4HIXL 1HYSC 4FNPA 2OYMA 3IKCA 2NY1B 4FQCH 1TETL 4PS3A 2ESVE 4WLCA 5ESVB 3IE4A 1A4KA 4JAMB 4PG9B 4X6DF 2LR4A 4GBXC 1I3VA 4M5YL 1GYVA 4BZ1H 4PRPB 2CSPA 2XYBA 4ZMXA 1G9HA 3BHBB 4M6NH 1NAMH 4XCNA 2CPUA 5GZND 2ORBH 3VE0B 3GJFA 4ELME 4PREB 3FAXA 5BOZG 4PH8A 3VXSA 2OKMA 3LRSA 4F7EA 5HHNA 5T3XL 3SQBB 4ZZFA 3EO0A 4OJEH 2FYYA 4OGYH 3TWYA 2JJSA 4X9HA 1XZ0A 5F3HA 1CLCA 2ZXAA 4B9PA 4Y16D 3IK2A 5T1KD 1AD0A 1WAPA 4NQDE 5GHWL 3NJLA 4M43L 1RJZB 2JLLA 5J7CC 5E8NA 4MMXA 4TUUA 3IJHA 1RIVL 4TVPH 5FO9B 4AK2A 4I3GA 1C7TA 2PPAA 1G6RH 3S36L 3IMBA 3KGRA 5I8KL 1NWPA 4N8VB 4YN3A 3T1WA 1HOCB 2CK0H 4Q4EA 1U58B 2AS5M 3NH7H 1PCXA 1LO2L 2M8XA 4HS6A 4ABVA 2RR3A 1BGXH 5KOVC 1GZHA 3IJ7A 3FUHA 1E3ZA 4GUQA 4KQ3L 2XTJD 2R4SL 4TSAH 3L6FA 2XPYA 3WDIA 3WY2A 4UTAH 1D5RA 2NY7H 4UT6H 5CWSA 1UOKA 5F7DA 1UYWH 2LV4A 2O6DA 4FNSA 1XGUA 4R4NC 4P9HH 4C4KO 1R3HB 1R3KA 5DEJA 3WLWC 2HKFL 3GXUB 5T1LB 4EKXA 2CZNA 4Q6IC 2HX8A 4P2QD 2RH0A 5DHEA 3ZE1B 1ORSA 1FE8H 2TRYA 5HDWA 4FYSA 5CAYB 3ZKNC 3JWNH 5J13B 4JRFA 4PJXE 4C83B 4MQXD 2X6CA 3HNVH 1JS4A 3ZZLA 2EXSA 1MLBA 2G9KA 3HJEA 1E6JL 1W0WA 1PZDA 3CHXA 1LHZA 2FLBT 4MA7H 4OFVA 5L4IA 3RWDA 4YSSA 5L8JB 2XJLA 3O2VL 4QDGA 1HYSD 5EU6D 4LGPB 4ZZKA 3S0PA 4HKXB 3X3FH 3WNOA 5LNEA 3J8F7 4OI9A 4YHOL 1G7LB 1MPAL 1RVFL 1J1PL 3OMAB 2AXHA 3GRWA 4ORGB 1T2XA 5DFAA 3RDTA 2TSBA 4JFPB 2IMNA 3WFDH 1ZA6B 4L8SA 4JPQA 3W5NA 1JPGA 4U0RC 3FULA 4K0OA 1BD2E 5HDBF 4FQXB 3U6RA 2VDRL 1WFNA 3WEXB 3EOTL 3FSWA 4N2IA 3C5ZB 3KLAA 2IC2A 3T65A 4XPGH 1B0WA 3D2UD 3NZUA 5IVXE 4B5ZA 3BP4A 1R3LB 4LCUA 2R2HB 3CX5K 2ERJC 2DM4A 3MJ7B 4F8NA 3KPPA 1FFOA 5I82A 3EIFA 2HRLA 3SKOA 2OJZL 4H8VA 3I2CL 3K5RA 4WFEE 1E0OB 4ZJ9A 4JPVL 3DHUA 4P2RB 3PNWA 4GEIA 3HS9A 4XWOC 1N7MH 2P43B 4X6CE 2ZX5A 2APXA 2MOVA 4DZBA 5KYYB 3QZWB 4OZIB 3TZVC 4PJ7A 4W6WB 1FHNA 3P9MA 4Z7OE 1N70A 1PYWA 3UTZA 2WO2B 4PJ8B 5EBLB 4K3JH 3DX3A 3Q6GH 4XH2B 1WEJL 1TTUA 5I1LA 2ADIA 3AG1B 1E43A 3O3AB 4G71B 4KZEL 1F3DH 2B2XH 1M9SA 43CAB 2VN5A 1FYTA 1CL7H 4IOSA 3F65A 3MLUL 5L7XH 1A6VH 4J39A 1CLYH 2G9HA 1H8SA 4ZT1A 2YEZB 4B27A 5FO8A 5DZNA 2OMXA 5BV7H 5D1ZD 5GZOA 5HGHB 4HJ1A 1XQ4A 1SHXA 2Y06L 2PCPA 5DD6B 3LQAH 4L3FA 4WO4C 1NICA 2XNAA 4IMLB 3C6SA 4XP1H 3QO0A 5GGQL 2IWKA 3FQ1A 5IK3A 3NFPA 2Z93A 4XCYB 5LDSA 3ZY7A 2LHAA 4KFMA 2UZXA 1Q4NX 3F85A 1KJVB 2WXKA 3QHZL 4MJ6B 2F2HA 3QNXB 3ECWA 1RH8A 1H6UA 2W88A 2YUXA 5E6UB 4BEIA 3ZK0A 4GS7B 1ADWA 1BFTA 3ZUNC 2H6PA 2B20A 2AGJL 4B7IA 3TVMB 4KKQA 3WELA 3ILDA 1S7XA 2QV2A 3OGOE 5DT1H 5DC9B 2YGQA 2FEEL 2BS9A 2C26A 3UEZA 3AWFA 2ZXDA 5LG1A 3QO1A 3KDPB 2WC7A 2W65B 3MJ8B 4N0UA 4UUJB 3JWNG 5AENA 2HJLA 2XZQL 3OZ9H 5T5FL 4YBLC 5DUJA 3CDGB 1IGIH 2DQCH 5A2IH 1ACYL 1MCRA 2RIKA 1A7OH 5E94A 4MVBD 4HT1H 3D30A 4PJIF 4QRRA 2MH4A 1Z1WA 4ZXBA 3DUUA 2IPTH 5TFSL 1UJ3A 3RTQA 3ABGA 2BCKB 4HJEA 1CDCA 1KPUA 4U1JB 1J0HA 4WVRA 2FNBA 2ZG1A 1HSAB 4Y19E 4I3RL 1UOWA 3GBNL 4PCKA 2BNQB 5TGBB 1DLHA 1QSFA 3S48A 4PBWD 1DBAH 2OA9A 4QXWA 5DDHA 2B5IB 3Q6FA 5CNHA 3WHXB 4AEFA 2CXKA 4G70B 1NBZB 3KZ8A 1QEWB 5GRVK 4ELDA 4AC4A 3OMZA 3C87A 3NIFF 3BAEH 4JO5A 5EZIH 3QAZC 1MCJA 2WLLB 1QLFB 1NCTA 4PJCB 1EDYA 3D4CA 1VENA 4PRAA 2O5NA 3NJIA 4F2MB 2VIRB 4HFWA 1ZY9A 3EH2A 3MLSH 3WG7B 4ZD3L 4F8OA 3FTYA 1ETZA 3MJ9L 2D7PA 3NPSC 4IGBB 3S4SG 4QCIB 2YC1A 1WD8A 1HINL 3SE4C 4MKMA 3PS6A 1OAXL 5LGHH 1WIOA 1UGNA 5IT2L 4F8PA 4AZ8B 4KU1A 4UQBA 1DO5A 5DURD 1X5IA 4DTGH 1CLOH 3TT1H 3EYQD 3SY0B 5DLMH 4LSRL 4U1GC 4TNVK 2MOQA 2WZAA 3DARA 2DIBA 1I85C 3QUXB 4KDTC 4Z7UA 5C09A 3S3CB 4DP2X 1ECZA 1ZA3B 5D7IF 1LMIA 5IB4B 2VR3A 3CSYB 2F08A 3A24A 4I1RA 4NT6B 4PJFA 4P9ML 4LGRB 5J1AB 3RGVD 1JHKH 4XODA 3PY9A 4NOBA 4Y1TA 1J8RA 3X3GL 3ABZA 4FI7A 2EIEA 1SOXA 4FQ1H 3N06B 2B4CC 3GSRB 2BIOA 4NQVA 4W4NA 4AMKH 1H3UA 1I1FA 1PD1A 5F9OH 1IJNA 2QMKA 4MNQE 1MFEH 1FCCA 4K2UH 4L37B 1C08B 2QADB 4N26A 2QQLL 2Q7YA 1OF2B 4R7NA 5CF3A 3GMNA 4Y4HA 2Z91A 4HJSA 4JE0A 3HI1A 4ZAKD 1KV7A 2X4RB 3HZVB 1RIUH 5D1QB 5FK9A 5GS1B 4MXWH 4O2CB 3GMMA 3WE6B 2JB5L 5CD3A 3CDZA 2JQZA 2NY3B 4GLRI 1IVTA 3D06A 3DX8A 1NMBH 3CHSA 4ELMF 1HK6A 4G6ML 4OSUH 5GS0H 4G9FA 4DH2A 1XF3A 1OAKL 3TO2B 4YHLH 4WSKA 3LIZH 4XE5B 1TTCA 3CLFL 3RP1A 1BQSA 1NDGA 2HB0A 1CFVH 4PW9A 3OMNB 3UYRL 3IU4L 4TL4A 5FUZL 3QEGH 4M5TA 4JJHA 3W39A 2R29L 2XA3A 3KBFA 4RETB 1NEZG 2W9DL 3CVIL 1NC2B 2I07B 5GGRY 4K55A 3MCG1 4KK6D 2X4OA 4U6TA 1QP1A 5L88H 1T2QL 3WCYA 3LKOB 1HE8A 4AIZA 1DVQA 2WSDA 4HIIA 3IDMB 3HHSA 5EIVA 3RGBA 1XFPA 2XBTA 1Z7JA 4N0YL 3HN3A 4H2AA 5D4HA 5KYUB 4NEHB 3P3TA 1C5CL 1EEUA 4TNGA 4XB8A 4NRZB 2WB7A 2F0CA 4LNVA 4XB3A 1U8JB 3HBZA 2HPOA 2E74C 2WJ7A 3U7WH 5JPNA 3K4AA 1M6OA 4OF6A 3DPBA 5T5FA 5HSFA 2AABL 12E8H 3B7SA 4U1KA 5TH2A 4DPCX 4NFBA 5FGSA 3STLB 4EPSA 3Q8BA 4P8QA 1MAMH 3P30H 3T0VA 4U6HA 3VG0H 4IRJA 3RWGB 1B0RB 1BEYL 2C9UA 1NC4A 4JPWH 2PW2A 2JJTA 1UXWA 1X6LA 5CKAA 4UV4H 3UG4A 2PNDA 3WKNA 4UQ3A 3CZGA 3QZMA 1UD2A 3FQXB 3X13B 1S4IA 2Z31A 3NTCH 2C9RA 2WUBH 5E5MB 3KPSD 3TIDA 5D4IA 5L4MA 1T6BX 2VR5A 4GKOA 3WIFA 2ZYSA 1F90H 1LO4H 2YAMA 2APFA 4NKIL 5MEQA 4PCSA 3TA3C 1TUPA 3L4TA 2RCSL 4LPTA 1QFWH 2VLRD 1JGIA 2CUHA 3KPLA 3S5LA 2X9ZA 3RA7H 3IAQA 3ZRSA 1B4JH 3SKMA 3IXAB 2FR4A 3VWKA 4RMTA 4NN6B 2ZKMX 2E59A 4FYQA 1KXQE 5MEPB 5JLZA 3AUWB 1OGAD 4DPAX 3H7BB 5ADPL 5JW4R 4M8QB 1T1YA 5ESAB 2DKSA 3RX9A 1U92B 4ODSH 5IM7A 2XN2A 3MJ9A 5J11B 4LRIA 1NFDB 4P46B 3V52H 3CZFA 4YSEA 3UBHA 4G5ZH 3BKYH 2D7NA 1RSYA 1FFRA 1OPOA 3IJSA 5F7MC 1JG9A 1G9NL 4N2CA 4H7VA 4OCRL 4TSCL 4NLHA 1H6TA 2OXGB 4EZJA 1BQLH 5ESQB 1F86A 2J6EH 2V17L 2ZJSL 1IQWL 2VZVA 1ACCA 1A1MA 3C2AH 2GY7B 3SDAA 1VACA 3R8BB 1T04B 3EJZC 4M1GL 5HGAA 5DJXB 4Z7OF 5FA4B 4HUWA 1IGCL 1KELL 3CFBB 3HG4A 2ROYA 3GMPA 3MRRB 4S1SL 5D1XA 2XWCA 2ENQA 5KUMA 1JVKA 1X5ZA 1S5HA 4A7VA 5KVMC 4YDLB 1RPQA 2E4FA 1MW1A 1W72B 2FBRA 2ZCHH 4AH2B 4PRBB 4W9FC 4ZMTA 1G7JA 2WWMD 1X7QA 1WAAE 5IQ9A 5KVFH 2R0LH 3KXFD 1KCKA 2CDFA 2JWYA 2XZZA 3BQUB 3QFGA 4LPYA 4QRPD 5DD5H 5DZLA 1AQMA 3GMLA 1E4KC 4CRPA 3ALWA 4JZJB 3QDMA 4ZFFA 2DQUH 1IC7H 1HZHH 1TSHA 1ADQA 4OT1L 1WAEA 4GRMA 4HCGA 2BNRA 5I1JH 4Q97A 2EH7L 1KZQA 1RK1A 4X8GA 2YBGA 3VQMA 1LGVA 1DSFH 4D3CH 5I73B 3QNYA 3CQQA 4JS7A 5G4OA 3FH5A 4H8WH 3TNNA 3D07A 3QG7H 4AENB 4DKEL 4I5BB 1AJ7L 3IU3B 3U0PB 3NSXA 2XG5B 3ESMA 2GTWA 3OKLB 4OF8A 1AIZA 3RYMA 5CZVL 3SKNB 4NKOB 3DSNA 5E5RB 5I76B 1WCBB 3GO1L 3L2LA 4KK9C 1UXSA 1FGVH 3H9HB 3L54A 2EEBA 1KCLA 3O6ML 3QG6B 3QR0A 3T3PB 4DN3H 3UGUA 4JVWA 1P4LA 3B2XA 1DJHA 5I8CA 1PLAA 3NEOA 2R29A 3DXAA 1NCBL 4I4WA 1NCGA 3LD8B 1EO8H 1AP2A 1TU2B 2DJUA 2EDKA 3QUMH 1MCBA 5T1DH 1BXUA 1DFBL 1WBZB 3PHOA 4LSUL 3B7TA 5FX3A 1KIQB 1CJYA 5BS0D 4XN5A 4BUHA 1TTGA 2B8OT 4PP1D 1EAOA 4NC1C 2KHAA 1CDUA 4U4IA 3QEQA 3DIVA 4U3SA 5KS9A 4L9LA 3DOHA 1M3JA 4BFRA 3EDKA 2PYEB 5KSAA 3DRTB 1JZGA 4YO0B 3HZKB 2WGNB 4FXLA 2ZZUT 1HZLA 4AYEC 1IEAA 1QSED 1A66A 2D31A 2EILB 5EEUA 2FZ3A 1L0QA 2UWEA 1QO3A 3B9VA 3LN4B 2WVSA 4DP0X 2H3NB 5DHVH 3ZHDA 1E27B 5CSZB 1N6QH 2EIDA 1E5YA 1J7VR 2WO3B 4EDWH 2HT2C 2CKBB 2EEFA 2X05A 1INQB 3CHRA 1YN6A 5C0FA 4B95C 1RUAL 1K5NB 3HC0B 1CFQA 4LIQE 3BO8A 1U3HB 2NMSA 4GP4B 4CILA 3WV0A 1WPCA 3QEUB 5KEZA 5B1BB 5I8OH 4K7PY 5AVWB 4LCIL 4MCYA 1AGDA 5IHUH 3OAZH 2I32A 4QHMB 4YHPA 3CXDL 4N90E 5D2LA 1AACA 1JDAA 4HGWB 1Q9KB 1KB5A 1JZIA 4YHKL 3OG6B 4KX9A 5G5DB 3BFOA 2IANE 1BIIB 4MZ3A 5GZNA 5FR3A 3HR5A 5DHMC 4HALA 3LKSA 3P2DA 1E5UI 4WI8A 5SX4H 2D8KA 4JKKA 3VD0A 1JGUH 3P0GB 4JPIA 5IFHH 3F7PC 3EH4B 4BFNA 4U0QB 4O4YL 3V4PH 1I9JH 5TE7L 1VERA 2Y0SA 3WO4B 2FBOJ 2VDPL 3KW8A 3WXVL 4OF0A 4JHWH 4YZFE 3BDBA 3VXUB 5JDSB 2OYLA 4Y16A 5T1KA 1BSIA 1Q72L 5K39A 4BQ6A 1N64H 1L7TH 4FEIA 4LPXA 1SEBA 4AM0A 1NCWH 2JI3A 3BJLA 3CSBA 3EYVB 4UILL 5I9QB 3SPVB 2ZE0A 4PJ6A 3TF4A 4NRYA 4APQB 1F02I 3FO1A 2E0PA 3NA9L 1R3IL 2NY0C 2H32A 3EO9L 1U8KA 1H0DB 1TKWA 1RKRA 1MCOL 2ARJQ 4L5FL 4UOJA 4UQ9A 1RZGB 2NNFA 5FF6A 5ALCH 1HJBC 2A3TA 5H4ZA 1H15B 1JPTH 3HOGA 3PGCB 4JNXA 2AK4B 1O6SB 5CSGA 1PKQA 1KJMA 3PG2A 5CD5D 3L3JA 5DHYB 4DUWA 2FQDA 2M1KA 3APDA 3V4VL 4PPTA 3Q2CA 4UIKH 2EEAA 1TTRA 3MA9H 4P2OC 4RGNC 2NY5C 1PKOA 1XB8A 4WUUE 5JHLA 4NO3A 1MCCA 3TWCL 4WJKB 3VFVA 1YEWA 2A74C 4Z23A 4P2QA 2BP3A 4RLDA 1A4JA 1PY4A 4G6JL 5F93C 4PCTA 1YY9D 2GCYA 4Y4FB 4FLRA 2E9BA 1AXIB 3CVHH 1G7IA 2MCMA 2B3RA 3FB8A 4WCYH 4A2EA 4NQTA 2H8PB 4YDVB 3RVTC 2EXYD 4X7DC 4YSQA 1KWGA 5EU6A 3DI3B 1PZ5A 4GW1A 1RZKL 2IADB 5SWSB 1CXIA 3IETB 4K23H 4XMWA 2WZ5A 1JGDB 4F33B 1MCPL 1CU4H 5CHNA 4MTMA 4L8BA 3K6DA 2HLAB 4W4OC 5F97E 4GBXB 1I9RH 2YMXH 3OJMB 3VO0A 3FTGB 4J3TA 5IWLA 4QO1B 4DOHB 4M7KH 5JOFB 4E9XA 1KTJA 3LQZA 4HV8A 4TNWF 2HSIA 3D2UA 2J12B 4LP4A 3ZR6A 1LEKB 2APVA 2GAZB 4GSRA 1UOVA 3LB6D 1BVKB 3HI5H 4JZNB 1YDPA 2VL5A 1B0GA 4TXVB 1UA6H 4JO4L 3OR7B 4XPFL 1UWGL 2XN9D 2Y36H 3M1OA 3MRFA 5F7KC 3V6ZA 4EMZA 5IEKA 1MWAH 4E5XA 3TYFB 3FOMB 4OKVA 1T7ZA 1A6AA 3WTVA 1FO0A 1QR1A 4I1NB 4KKBC 5GGTL 3S8GB 3LRLA 4ILDA 2DQIH 3PAZA 1KNOA 1MLCA 3A6OA 4QXUL 4UQ2B 3D0VB 5E8EB 3BIKA 4UM8B 3GJFH 4QRUA 1JF1B 4LU5L 1UKTA 1AC0A 4YXHL 2QSCH 2CDEB 1I1AC 3GEFA 4G83A 1MFBL 3HZ3A 5AW9B 5FW8A 4P59L 3HTLX 5L9DH 5K9KB 4R3SB 1Z2KA 5BRZB 1JPEA 3RX8A 3BWAA 2AJUL 4GUPB 2VXVL 3QZBA 3I85A 2E3VA 4M1CC 4RDQG 2B16A 3HG5A 2R2BA 3D4YA 1CFNB 4Q6IB 3BI9X 4OIIL 3HFFA 5F1KC 3SGKC 3O9WD 4UIMA 2YKLH 2VC2H 1NGXB 1A6PA 2JQAA 2R59A 2AC0A 1RV6X 4OZFB 3ILEA 4WY7H 2UZYA 1TSRA 2XC8A 1Q90A 1JVLA 3C6LC 1HNYA 4YUEL 1A3RH 3SGDH 3SDXA 1GMIA 1Y0LB 2X4TA 3MFGB 3B2UD 4XI5C 4X4YB 3M1CA 4J1UA 3RVVC 3S37X 3MTRA 5J1TC 4XP6L 3NIDB 2ICES 2NW2B 4HUVB 1G0DA 2YPKA 2IMMA 3BVDB 4ONFH 4WV1A 3ARBD 3U46A 5GGUA 1TLKA 5I16A 3D12B 4U0RB 1UKSA 1DJGA 2EDWA 1DJYA 1LDPL 3GSXB 4HH8A 4KTDL 3IDNA 4NO5B 3LCYA 4XMVA 1CS6A 3JWDL 3LPFA 5FECB 4MHHI 3KWXA 1DBBH 3L45A 3ABMB 1WAAF 3ZTCC 2A4CA 1MFMA 2P8PA 3H53A 3QXVA 3KWTA 1BVZA 2EDEA 1B2WL 2IDQA 3O3DA 3B6SA 1IFHL 2VDLL 1E5CA 2ERJB 2FLRT 3V4VA 5CUSL 3V0WH 3BCDA 4YJZL 4XP4L 3GRWH 2AQ1A 5IKCB 1S9YA 2FEDC 2R1XA 5FWRA 2OL3L 2O93L 3ZDZB 1NFIA 2YD1A 3MRBB 2ITEA 4QUOA 4PWKA 4GRLC 3TZVB 2OS7A 1RQ5A 4G6FD 1YMMD 5CJXA 2Q7AA 4YDJA 3TBWB 3OC8A 2H47C 3QJUB 5HI3D 4X5WA 2QDVA 1KYOJ 2DLFH 1EHKB 4M9OA 3VXSE 3AG2B 4BHUA 1IBFA 4LLVB 2G2RB 4EO5A 5IROD 1L3NA 2O5YH 3FQ4A 4FTVB 1WCQA 2OMBA 3JV4B 5DS8A 4BSWB 2RQ8A 4P57A 3PAUA 4XPTL 4JY5H 1AGCB 1OCZB 2J2ZB 4ZODA 5SWQB 1I3GL 1OV8A 3WSQH 4NO0D 3EJSA 2KLRA 2F53D 1AXTH 4BJLA 4JDVA 5E9AA 1MKFA 4N9GA 4WO4B 3T8MA 1KIRA 1VFAA 1R4XA 2OMNA 1Q9WA 4UOZA 2QQKH 4CJ1A 2JKSA 3C5JB 2FIKA 1FLRH 3QB7C 4MXQC 3OKNB 3RGVA 2E8YA 1SYSA 4FQHB 3NQKA 4PS7A 5DZ9A 4JQXC 4HIXH 3V7AG 2OX5A 1TZAA 3HI6L 1JWSB 1DVZA 1OAQL 1YAIA 3PP3H 4JFFA 5T3ZL 5JW5B 1J11A 1TETH 1WZMA 5DHXB 3GTNA 4B5EA 3ET9F 2ZYHA 4M5YH 2X1OA 2OTUA 5GGTA 1I9IL 3REVB 2JI1A 1MHCA 4ANXA 3VGBA 1N67A 3T77B 2DQ6A 3MR9B 5IMLA 4YBLB 3C75A 5IW1A 2Z1KA 4L3ED 3EJJX 5CLXA 5MEND 4ZAKA 3HS8A 1WITA 1BXAA 4DN4L 4JFUA 3C2SA 4RISL 5T3XH 3H4HA 5DYOB 4DWHA 2KLSA 1KSRA 3BAXA 1JF6A 2AJSL 4DFHA 4A2GA 2BIMA 2W07B 1D5BB 4Z3TA 1KV3A 2ZUQB 4ZQKA 3BLPX 3DX1A 1SUJA 1BWMA 1V3KA 1HL8A 4OZ4A 4QYOA 1PAZA 2VB5A 3B2PA 4M43H 5GHWH 4KMQA 3NT0A 1RIVH 4OBSA 1J87A 2VUYA 3BUYB 5K59E 3E9UA 3VI4B 3S36H 2FX7L 3NP3A 4YZFF 4UU9B 5I8KH 1CMOA 1BMGA 5CN3A 3VU1A 1OSPL 4P5TA 1PPIA 4K7PL 1QUNA 3S3BB 1LO2H 1Z0MA 4KXDA 2OMZB 1LNUB 1LD9B 2XWJB 4KQ3H 2R4SH 2WMPA 2CHXA 5AOKA 1I7TB 5GGVY 2CUAA 5DMKB 4NRXB 5I26A 5ACLA 2XWBA 3QAQA 4NENA 1EPFA 1QUPA 2XX0A 2UY6B 1V7NL 3NPSB 3O11B 4HJGB 4I2XB 2MCAA 2EE6A 3MUUA 1SLWA 2HKFH 3DIFA 3SCMC 3VWJC 1GVIA 4GJTB 2BY1A 2PR9A 3B4NA 3FUDA 4WSGA 1RCYA 4OGAC 3ZYIA 2NY4C 3UTTD 1XD0A 2X6AA 5D6CA 3T0DA 1IL1B 4PY8J 3KPRD 4RSYA 3VFPA 4YFLI 2VDML 2BW4A 4UNUA 1E6JH 4PJ5B 1ZV5A 2GJJA 4U1GB 1U2CA 4RBPH 5E0QA 3WEMA 2X3AA 1DVTA 5GS2H 3H42L 4GXUM 1RK7A 2MNWA 3O2VH 4ANVA 4KUZL 1KLFA 1ZGLP 2JSFA 5EH1A 4QJ4B 5FYLL 3BAJA 4P5MB 1QPXA 1FYTE 4QKXB 4YHOH 2E7CA 5T33L 3KPSA 3UADA 1AYOA 2JKJA 3JBG7 1MPAH 1RVFH 4LLQA 1J1PH 1HEJC 1ZVNA 2WTRA 3GXPA 1RJYB 4NHUB 5EF1A 3B9EA 2K3HA 5FKAB 1FV1A 2DH3A 5BMFL 2BVPB 2EKJA 2OL3A 2R0KL 3JVGC 1XH1A 3DLQR 2VDRH 4X6BA 4QGTA 3EOTH 2GJZB 3BD3A 1VPOL 3KPNA 3KYOB 3PGDB 2X4UB 3EYOA 2VLRB 1TJHL 2H2PC 2CHZA 1YEGL 4MDIB 5H35A 4V1DD 1T0MA 3U4BL 5FB8A 2ZONA 3BRGC 4WWKD 4AE1A 3VXMA 1RJLB 3FB7B 1I8IB 1Q9OA 1M7DB 4LDEB 5EO0A 2OJZH 4M9PA 5T1MA 3G5ZA 1NPJA 2AMGA 3I2CH 4JPVH 3T0WA 3TBTA 1ORQA 1A3LL 2BLFA 2WWOA 4N0UE 2J5LC 1YAZA 5C0RL 3BH4A 3O6FC 1MG2C 4CC4A 1E7UA 1FL6A 3P4NA 3NRQA 1NBQA 5JW3L 1I9EA 3R19A 3U83A 1T0PB 5CEXB 1WEJH 4UNTA 5DHDA 4KZEH 3LEXA 3CMOL 5IVZB 3WMQA 1OZTG 2CLVB 1OWWA 3KNBB 2EKSB 4QRRE 1CIDA 1YLBB 2KDYA 1DVYA 3MLUH 1YPZA 3MRLB 1A3QA 3FT1A 4NNXB 4JHBA 3SCMD 1OTSD 2BNQE 3FT2B 3NBNA 1XGZA 4I9WE 3ZPDA 4QRQA 4OZGB 3QIBD 1T1XA 1XZWA 5CLTA 2HVKB 1ZS2A 2NQCA 5CU9A 5L2JB 4RQQB 1QSFE 1YG9A 1ZTXL 3CIAA 3G6JB 3IWVA 5GGQH 3VXQA 5JW4Q 3PYCA 1IGFL 1GTFA 3QHZH 4LSVL 2Z4TA 3BH8A 3KXFB 2N7BA 2CLZA 3OKOA 3RJOA 3BEWA 2XETA 3EOAA 2Q1EA 1RPUA 3CFKB 1NOLA 2AGJH 3AXHA 2GUOB 3QDJD 1S7RA 3A67L 2D0HA 3SDYL 5FYKL 4KO7A 1S7WB 2BOCB 1M1SA 2NR6C 4KZDL 3MUHL 2JJUA 5JHDA 1A65A 2FQEA 2FECI 4QWWC 4Z7VB 3ULUE 5HVWA 3AAZA 2WYTA 5LGJA 1JCVA 2N01B 1CBVL 1EO5A 4D0CA 4L0PB 4YDIL 1KPVA 2ZSWB 2XZQH 4LLYA 3F5WB 4WNQB 4WDIB 5T5FH 1ZLUK 3TA3B 3WOVA 3V0JA 1BLNB 1MJJA 2F1BA 1ACYH 3G9AB 4PLOB 4YIQB 1BG9A 4BK5C 4NUGH 5HHMD 3RWJA 4NQSB 1FNEB 3NOIA 5DVNA 4Z7UE 5C09E 1MCEA 4UT7L 3VM7A 4F2FA 5TFSH 3U2SA 3FQTA 2QPFA 4PJFE 5IV2A 4FYRA 4ZFOB 1Y7VA 4IS6B 4PTUB 3VD2A 1AHWC 4WO0A 4P04A 4HS3B 1XGTA 2X4NA 2Y1ZA 3LAFA 1XVSA 3C8DA 2Y2YA 3GBNH 3IFNL 2QR0A 4I3RH 3RL2B 5BS0B 2NT1A 2PF6A 3UG5A 1QSEA 1ZVSA 4YHYC 1I3UA 3CC5A 5D4QA 3IJEB 3O4LD 4N2LA 1WGOA 5E2WL 5I6MA 4ZFZB 3MOQA 2IAMA 2XKUA 1MAJA 4NYLA 3LZPA 4CSZA 2OP4L 4V11A 1GAFL 1CDHA 5F9DC 5HHOD 3W11C 4XXWC 5EBWA 3T04D 1KGUA 3CK0L 4W9IC 3H2PA 2BS71 3HG1B 4ZD3H 1AI1L 2CU9A 2JJWA 2Y7SA 1UH4A 3MJ9H 4NUPA 1CICC 3KL0A 3EH3B 2PW1B 1HINH 3WTTA 4DVRL 3VGEA 3PIQB 1FZOA 1J9QA 1I3RA 1OAXH 4G9FE 4OCYH 2LLLA 4HC1L 4PB0L 4ABUA 1VHPA 5KYWB 3B37A 5IT2H 1G7QA 5LBGA 1HHHB 2P5ED 3SYPA 2NX5A 3DETC 1P7KB 3RHWF 3JYCA 1FSKC 1JE6A 1IAII 5DJDA 1Z32X 5E4EC 3O41A 1MH5B 2G0KA 1EQWA 4LSRH 1P4UA 4OF5A 4S0HA 1KJ2B 4HJ0D 3UOAB 2WN3A 3B34A 3JV0A 3UZVB 4DFIA 4P3DA 1MJ7L 5ID1B 2Y1YA 4JKLA 3VXRD 4P9MH 3QFDB 4FXGC 3BXNA 1HHKA 1D5XB 5IMMB 3IAPA 1XTLA 2ATKB 1DQDL 1EX0A 1LYQA 1JGEB 1N5YL 2GBAA 4KI5D 1AO7E 2C34A 5KOMC 1GOHA 3QIUC 3DVGA 3T0ED 3ECUA 5I6PA 5B1JC 2HT4C 2P24B 3CN1A 1ZJBA 4XVOA 3X17A 1BIHA 2CO4A 2QQLH 3FU5A 4LAJH 5ID0B 1WK0A 2MKWA 3GUFA 4F8LA 4P4RB 4PWFA 4XGZB 5CJQL 5KAQG 5K1VA 3ZE1F 3C8KA 1G9ML 1SVZA 4FCAA 5KBPA 1P84J 4M8VA 1VKXB 1N5AA 4YFDB 4R96B 4KY1L 4A6YB 5E9DA 4X5PA 5AZ2L 3HC3L 5CEYA 3OWRA 1JV2A 3I6LD 3IF1A 2JB5H 4TF4A 3VYNA 1IGJB 5DC0A 4N8CL 2EDHA 4EZLA 1E4XI 2IQAB 4G6MH 1ZHBA 4OJFL 3U9UB 5C1MB 3L3IA 1N6VA 1OAKH 2CHWA 5B1KA 4FFZL 2AQ2A 5DSCB 3W5MA 1DJIA 1IBBA 1OW0A 1QQDB 1R1CA 2X6UA 1H8NA 2PO6C 3DTXB 3N42B 1E65A 5DQ9A 2FSEA 4F7MB 3UYRH 3IU4H 5FUZH 4Y9BA 2R29H 4PG9A 2BVYA 1QKZL 2W9DH 2KPNA 3CVIH 4IIZA 5GGSY 5DZOA 4PRPA 4GKSA 4N2EA 1T2QH 1D7BA 1VFBA 4AQEB 4X99A 1U8NB 3BHBA 5KJ4A 4F7PA 4MFHA 5I17B 4B3EA 3L3KB 4N0YH 1EVTC 4J3OC 3VE0A 3WDHA 1R5WA 4PWJA 5IBUB 5I6OA 3HE6D 1P7QA 1YY8A 5D7KE 1C5CH 1J18A 3T2NL 5CN2A 3SQBA 2C4FU 1F1GA 3PCYA 4IKJA 3S5LG 3D2TA 5TDPA 1IU1A 3IMVA 4IRSD 3HB3D 5D7JD 3ZKSD 3MI6A 1AMXA 2E27L 4N2NA 4WFGE 4U1MB 2AABH 3KGSA 3JZ7A 2YD7A 3ZQ9A 2UZPA 4JRLA 1NCUA 2K0RA 1X9QA 4MAYC 5IIEA 1BEYH 1WA0X 2DQFB 4NSKA 3OD3A 3UL4A 5FGBA 3CSFA 3VSQA 2O6EA 4JO2L 3KBPA 4LHUB 1NCHA 2OZ4L 2XN9A 3MMEA 4FJZA 2FUQA 3QQ3B 5KVDL 3RJDA 2PPFA 4JN2A 1T83C 4Q7DA 5C86A 4NKIH 2DDQL 1EBPA 5DR5L 5GGVL 2Y69B 2ZKYA 2Q6WA 2RCSH 2OMWA 3BZ4A 1IM3D 2NY0B 3LH2L 5J3HC 4JRYD 5I66B 2J73A 2AV1B 4ADGA 1Q0EA 1U8QB 4JBSA 3QDME 2W9EL 2YXMA 3DV4B 3FTVA 2EADA 3P02A 4G42B 4JM2A 4PJ9D 2VTFA 2W60B 1F1AA 4MA1C 4MBOA 2GJ6D 5IQMA 2BNRE 2G60L 2PLTA 3ELAT 2MCPL 1OIOA 1Q38A 3H9ZA 4HA1A 4X5LA 4ZBJA 3LXUX 5LAXB 3VYPA 4MLIA 2QEJA 1EEZA 4GAYA 4TUOA 5CEZD 1K3ZA 3SSGA 5KYXB 1FPTL 2WQ8A 3NFNB 1G84A 1I75A 3PHAA 4P2OB 3EHBC 2VDQB 1C1EL 4HC1A 3LS5L 3I3DA 2A74B 4OCRH 1G7LA 3O9WA 4TSCH 3K6NA 4XZUB 3B5HA 4Z76B 4OGZA 4G9DB 4X7TA 2V17H 3H3BC 2ZJSH 1IQWH 1QOKA 2P8LB 4FHJA 1A9EA 1KGCE 3DXAE 3CZJA 3NFSL 1RUPH 5LNDA 4X6FB 1OP5K 4Y5VA 3WEXA 2GSMB 1JJUA 4M1GH 2P4AB 3CQPA 32C2B 4W9KC 1IGCH 1KELH 2V7HB 4J8RA 2HG5A 4HXBL 4S1SH 4HUKB 3EFOA 1ITCA 3OPZL 4AT6B 1N6UA 2R15A 3LPOA 1C5DB 2R2HA 3QEQE 2GJPA 5KS9E 5FGCB 3MJ7A 3VQLA 1RY7B 1BFVL 3ARBA 4OFDA 3WKYA 2VQTA 1ZV9A 5IJBC 4ODWA 1BJ8A 4YGAB 2PXYD 3SN6N 3R0MA 2V3EA 3K8LA 3DK2A 1L6ZA 1TCMA 2AQQA 3TCLA 1K9TA 2UWEE 1SYVB 4OT1H 1A6WL 3IAGC 5T5NF 1GSMA 2OZNA 2EH7H 1AMYA 4M93C 2NYZA 4PV9B 3ABLB 3RIFK 5JZ7D 3ARGC 4PBDA 4OAWB 4PY7A 2C4FT 1CPUA 4Y2LA 1OCOB 1YEDB 3ZQXA 1EH9A 4DKEH 3RWIB 1AJ7H 2GB2A 3M86A 4XH2A 5DUBA 5SWZB 5CZVH 5C0AD 2OW6A 5ICUA 3ZZ1A 2DWXA 1HDMB 3AQXA 43CAA 3EG9B 4BQ8A 3EW3B 2WNGA 3GO1H 1TYJA 4FFZA 3ASNB 2A99A 4N1CA 1R17A 2WOYA 2NY2C 2EDXA 4L3CA 3ULUF 1VGEL 2XXMB 3ARDC 2NT0A 3UACA 4OJYA 5D2LE 4X5QA 3L3HA 4F5CE 3KPOB 4PMFA 5C2BH 1NCBH 1YMMA 2VERN 1UWXK 1FJ1B 1HYRC 1DFBH 4M48L 5ITBL 3QDGD 4LSUH 2DIJA 2OJEA 1S9WB 2FWOB 5IROA 4LL1A 4K5MA 3QIWD 4KZ0A 1MHPL 3QZNA 2V3DA 2XKNA 1IGTB 1PVHA 2E9JA 3ULVD 4HJJL 2NLJB 4CMHC 3TVMA 4Z7UF 2HTLD 4IM8A 4BM7A 2DOCA 3SE3A 2YPVA 4Q52A 2VDOB 2RD0A 3HUJB 4HVBA 2VXQL 4NO0A 1FZMB 4PJFF 5HPMB 2F53A 3CBJB 2IOOA 4V2CB 4YDNA 4BD4A 1QRNB 5EEXA 3LYRA 5J89A 5LAPA 1JXKA 2ILLA 3KYAA 5CP3H 4F1ZA 4LCWD 3VFTB 3BDXA 1T5WB 4JB9L 5IR1B 5HDOA 2OMUB 4MSWB 5E8PB 3FRPG 3VRIB 1RUAH 1WHOA 1Z0NA 1SNRA 4F8TA 3G08B 2YZ1A 5B3SB 2XU9A 3C6LB 2BSTA 4JHUA 4CJ0A 1KBGL 1AZBA 2C9XA 4YLBA 4GB9A 4U1IA 2XTJE 4JGNA 1QFUL 4K73A 3FTUA 1N2RB 1E8YA 4GQPH 5D7SL 4HX1A 4JQVA 3FO9B 3RVUD 1ZLSL 5A2AA 5FS5A 4LCIH 3K4DA 4FNLH 4M29A 2YA2A 5DEFA 3TV3L 4CA4A 1CIUA 4P2QE 4YHKH 5EBGA 1DVFD 1HH9B 3RPKA 3ARGD 5MENA 4OM0L 5KJRL 5DC4B 3FT4A 4WWOA 3VGGA 4YDKH 1NBZA 4L3EB 1QEWA 4O4YH 4XPAL 4FFVC 5TE7H 1MF2L 1UC6A 2VDPH 1LQBC 1NGYB 1I7RB 5EU6E 4GIPD 3WXVH 4LLWA 3DUSA 3PUUA 1Q72H 4TQEL 1B9KA 4UILH 3MDJA 5F7BA 4F2MA 3OKKA 2X28A 1NIEA 3IDIB 3MNDA 3NA9H 1R3IH 2GBTA 3CFDA 1DSWA 3EO9H 2EIBA 2WNKA 1NGWA 1MCOH 4L5FH 1J9SA 5E4IA 4RX4D 4MJHA 1CF8L 2E6QA 3DOIA 4L1DA 3U7YL 4FXTA 2FAUA 1JBJA 1J05A 4GRLB 4ERSL 5IFJB 2ADFL 1EEYB 4YPJA 4G43B 5HHPB 2YHGA 1F3JA 3DMMC 3OXSB 2XY2A 3FSAA 3ZW3A 3A22A 3SY0A 3UAJC 1EFXB 4TQHA 4WTZA 4GW5A 2DQJL 5FXCH 3V4VH 3QUXA 2IDSA 3D69A 5EU7E 3RWCA 4Y4KA 1CXKA 3GC3A 4QMEA 1NTDA 2LT9A 3DIDA 5DJYB 1B3JA 2GSIA 2D4FA 1NDTA 3TWCH 1KTRL 3QQ9C 1MCHA 3GXFA 1W6LA 3RGHA 4G8FB 1KTKE 4G82A 4RFEB 1W72L 3MRMA 2FO4A 1MI5D 5KW9L 1I8AA 1PY0A 4JRXD 1NGQL 2GFBA 1QFWI 1TJMA 2JIXD 4Y2DD 1OF2A 3GIZL 4WFHD 1OGTB 4E5XG 2BFVL 2QVFB 3KPRB 5A40E 3H6JA 1BQKA 2D2CC 1BVOA 3L4ZA 4HPOL 1RZKH 4AKPA 4CAGA 4PJHA 1O6TA 3B9KD 1XIWD 1RK0B 2V8MA 4W93A 3FBKA 1NL0L 2KPWA 1EXHA 1MCPH 2F8VA 4XHJD 3WE6A 1IZJA 2BWQA 1UXLA 1YMHA 4WTQA 3P4OB 1KT2A 3W0WB 4ZUVB 4A7QA 1FVEB 2E7DA 4OLZL 5IJKC 3U4KA 1P9MA 5BVJA 3N55A 1YEKL 1N10A 1E9PA 1DDHB 2GW5A 2J72A 3LRMA 1X4YA 3NJFA 2DQHL 3VNYA 4ZI8A 2UXVA 3ESUF 2Q2EB 4V1DA 5EFIB 4D7PA 2KH2B 4BFIA 3V10A 4WWKA 5I75C 1NC2A 5I0ZA 2I07A 3AY4A 3ILPB 4MCZA 4NKDA 4XPFH 1UWGH 2DICA 3GBLA 3NIDE 5F0PB 4L2LA 3S34L 3WGVB 2HJFA 2OTWA 3AREC 5GGTH 5JIKA 4FA7B 2X38A 4EOWL 5EU4B 3KWUA 4YLQT 2VXQA 5I74C 5D93C 4OJCA 4NRZA 4QXUH 4D9RD 2HUEA 2X2YA 5ALBL 1U8JA 4LU5H 5CCKL 4G2AA 4YXHH 2DM2A 5F6IC 1ZS8A 4HJTA 3D6GA 4FNRA 1URLA 8CGTA 3ULSA 4P59H 5C0JA 2C1OB 2IH3B 2VR6A 1BQ5A 2CLRB 1RLWA 1ZT7A 1YHPA 3I02B 1S7UB 5EU3B 4O51B 4OLEA 1XXFC 3R7RA 2EDRA 5BO0D 1QI5A 4P4KC 2AJUH 4J2XA 1OTUC 4N5EC 4X98B 2VXVH 2NPLX 1GS7A 3D5OF 3PPEA 3QIBA 4XNYL 4UBDC 2CM6A 1PDKB 5A2LH 3SCMB 3VXPA 3TV8A 3WN5A 1CFTA 4FG4A 5LUMA 2APTA 4OIIH 5GJSL 2F8OA 3P2TA 2NY4B 4LDLB 3KEHA 5AYQA 4R4BA 4JQIH 2EXWD 1A1OB 3T3PF 4KKAD 1AS7A 4GP5B 4LAQL 5ITFB 4JO8A 3QDJA 4YUEH 3SPHA 5IB1B 3IXAA 1RUML 1I1CA 5F1NA 4PG2C 2VW4A 4BSVA 3K91A 5I6LA 5AVZB 4KJQC 4X0KB 4XP6H 4BFJA 3HMXL 5KBLA 1QASA 1MZYA 3OJVC 4M8QA 4OD2B 1I82A 4FEMA 3K1DA 3WFCL 3VDAA 1WTLA 1W6WA 4LKXA 3BMWA 1LDPH 3MUGB 5LXGL 1NFDA 4KTDH 4P46A 4YSAA 3H0TB 1FFQA 5AZEL 1GYUA 3JWDH 2QGEA 5AQ0A 5BQDA 3LZQA 5KS9F 3QRFM 1S8DA 1OB1A 2WKGA 5KANI 4GG8A 3SJVD 1YECL 4BRVA 2VQ1A 3IDGA 5HHMB 2ZXBA 1QRKA 4DGUA 4QAMB 1IFHH 3L1OL 2UWEF 2VDLH 2VLMD 4JFEB 3MRPB 5CUSH 1FNGB 3HBGA 1DDTA 4XP4H 4HCRA 3US9A 1KCUL 1GW6A 3QR2A 2YO3A 3U36A 3IFPA 5DJXA 4H0GA 2JNZA 4QTFA 3CFBA 5FA4A 4ZMWA 3UMTA 1BF5A 2ZG2A 4CSTA 4O00A 2BOLA 2ZWNA 3UC2A 1HZKA 3O4LA 5DFWH 5FGRA 1X6NA 1T1WB 3EBHA 3OMIB 1BZEA 2J5LB 4PYHA 3RIAF 3UAFA 4AH2A 1RZ7L 4PRHB 2ZXGA 3O6FB 4A39A 2OJ1A 1IEBA 4Q56A 4GAJL 3MV8B 2G5RA 3EDDA 1HEZB 1UASA 4LNRB 3OJ2C 4TYUA 1MRFL 4AZUA 4ZO9A 3WJMB 1DHKA 1R3JB 1ED3A 4OY9A 4ZSOA 2DL2A 1N3NB 3R4DA 5MP6L 1WWAX 4RMWA 1HQRB 3O6LL 1K4CB 4PB9L 4ZUSA 1FFNA 3CVBA 4PGEA 4XPTH 4AENA 2VL4A 2WCPA 4JKPL 4N86A 4MB1A 1B6UA 2P5EA 3HS0A 2BVQA 4IKKA 2VAAA 4WQOA 5HGBA 1XSIA 3V0GA 1TF4A 3QUYC 2NCMA 5I28A 1CB4A 3AG4B 1TZ8A 3M7OA 3MSPA 4X83A 3VSTA 3QG6A 4PVNA 3UO1L 4IOIB 1Z9PA 1UKQA 1J1XL 3AWEA 4XO9A 3VXRA 5AVXB 2PYFA 2Z35B 3SPCA 5GGSA 4J3XA 3VVWA 2IGFH 2AW2A 4I2XE 3IFOA 3HI6H 4XNZC 1OAQH 5T3ZH 2YA1A 5KSVA 2AJ3A 2GTQA 1LE5A 2OV0A 3HG2A 3FF8A 1XGPB 1GC1C 2DMKA 2EEDA 3PABB 1QFHA 4KO5A 1UVQB 4ELKB 4R97C 1BAGA 4FXKC 3CXHK 4A63A 3G04A 4ODBD 1AGBB 3RUGA 1JHLL 4YO0A 4J3UA 1P1ZB 5HYJB 1D5MA 5CN1A 2EUXA 3B2MA 3E80A 3LN4A 4DN4H 2QTEA 5K9OA 4RISH 4ZPTB 4LE8A 5CSZA 1PU0A 5DK0A 1UENA 3SE9H 1NA8A 1KEGL 1S9XB 2MSPA 2AJSH 3GS7A 3IMUA 2XACC 2DWTA 1U8HA 4CN6A 3MV7D 4R7DB 3QYCA 1AHWB 4NQXB 3KPSE 4RAUA 2A83A 4EI5C 2FJGA 5C7XL 3OM3B 2CALA 2L4OA 3KD4A 2FX7H 2NY6D 1FFTB 2VN7A 2XN0A 4WHYH 3DRQA 4YHYB 1OSPH 1PBYA 1X5GA 2VLRE 4K7PH 2XVLA 5ISZD 3MRGB 4U2ZA 2AEPL 4FG0A 5E1AA 1Q9KA 1M05A 4ENEC 4KO6A 3SO3C 3HAEA 3LXBA 5EOTB 1JNNL 2LAGB 1KYUA 1IJ9A 3ARVA 4N0FA 1O9WA 1OGAE 3HE6A 1UT1A 1DE4B 4JVUA 3LNHA 4AJWA 1GOGA 1JV5A 1V7NH 1XCTB 5AW2B 3W56A 1CICB 2HG0A 3OSKA 4Y9CA 4UQCA 2D7QA 3BT0A 3ROLA 3WJJC 4WI5A 3GRBA 3H7LA 3L5JA 5IMKA 1L9MA 4ZYKB 2P8MA 1KIPA 3GSNA 1FSKB 3PWPB 3CH1B 3LZLA 4IRSB 1SEQH 5D7JB 4BZYA 5IREA 2XZCL 2VDMH 4RIRA 1FAIL 4KOCA 5E4EB 2AXFB 5H2BB 3DX0A 4EDXB 1H0DA 2WOBA 3H42H 4WWNA 2V3FA 4KUZH 4HJUA 5FYLH 5GSVA 4F37F 1HAUA 4R90L 1JPST 1T4KB 3DPDA 3PQYD 4FXGB 4HH9B 1ULVA 4XP9L 5DJ2B 3MRDA 5T33H 4JKWA 4BA0A 3PL6D 3TM6A 2KBGA 4Y1AD 2ZXQA 7PAZA 3Q2LA 2A77L 5BMFH 2ITDB 2R0KH 3QXAA 1WUNT 5DJAB 4QRPE 4F27A 1VPOH 4OFQA 3WFBL 2O26U 3LZFL 3WNLA 5I23A 3QJVB 1JZHA 1TJHH 1YEGH 4PJ9A 3ZDWA 1EZUA 1IM3B 2X4QB 2GJ6A 3SBRA 3U4BH 4JRYB 3QXTA 3LPPA 4PGCB 4XN4A 4PEEA 1O5DT 1AZCA 2IPKB 1T5XB 5KVEL 4UAOC 1R5IB 3GI9L 3MBEC 3ESOA 4ZK8A 3B83A 2E5EA 3L7EA 4EI5D 4M03A 4G6AC 1G5AA 1KBWA 1MELA 1JOIA 1QVOA 1A3LH 2IADA 2R1WA 4KAQL 4TVPD 3RVWD 4XBGA 4FJYA 1QZNA 2H9GB 4RRPA 1PG7L 3ZU8A 4Z77B 4LP8A 3UX9B 4F33A 1UM4L 3NIDF 5C0RH 2PO6B 5CLZA 4P06A 1TJGL 3MGAA 3NSCA 5JW3H 1UG9A 4GBXA 2B15A 3FTGA 4PGBA 1ZLWH 4Y2NA 3VFNA 1BF8A 3FYEB 1VZIA 2Y22A 3T6XA 3CMOH 3EKCA 1I1RA 2L7EA 3BD4A 5HGDB 1GKOA 1RZJC 4D0DB 1EMTL 1N19A 3K2KA 1CWVA 2CO6B 5BS0E 1M71A 3DC0A 3JWOC 4FYTA 4ODUA 3P9LB 4GIOA 3QRGL 3VFOA 4WHYG 3OHXA 1SGKA 3KGUA 3BPCA 4YHIA 3OAYH 3G3LA 3US1A 2PXYA 2X0UA 1ZTXH 1TXKA 3D08A 1UACL 1QSEE 3N50A 3WFHA 4XAWL 1IGFH 4FG6C 1ERNA 2V7NA 4LSVH 4PWIA 1HU8A 3ZDZF 5DUPL 1IC4L 1WFJA 1DANU 1G7MB 3HKFA 1MNNA 4MAYB 2NQ3A 2ZT9C 3EJYC 5E8EA 2CGZA 3A67H 5AL8A 3SDYH 2O6PA 5FYKH 3WY1A 3FB6B 4GKLA 3WS3B 3DGGA 4LQFL 2CDEA 1WICA 5EZJB 1X3DA 2QZ5A 1YA5A 5C0AA 1LP9A 2WXQA 5E1IA 4L4TD 3EGDB 4OQTA 3DJRA 1CBVH 5K9KA 3BUQA 1N59B 3OBAA 4YDIH 5FUCE 3HHRB 5G2NA 2BC4B 4AJVA 1BECA 2PPDA 5DJ0B 2DH2A 3MLTB 3D39D 4IDLA 2IAAC 4FD0A 3O3BA 2UY7B 5KTEH 2FX9L 2X88A 1TNMA 1BBDL 1MY5A 3AW5A 4QRSA 4UT7H 4MA1B 1U2YA 4U49A 3QDGA 5MEOA 5FKPB 3V0FA 2EYSB 1LVEA 1TLMA 5E1HB 3QIWA 2JQMA 5DD0L 1IEHA 2BSEA 5DI8A 4P23D 5B4MD 2HFTA 2ITFA 3IFNH 1OALA 3JUZA 3QULB 5I6NA 3DKHA 4QXGL 1J8HD 3K6SB 1P5VB 3EHBB 4FERA 4AUUA 4U6VL 2ICWB 5E2WH 1TDQA 3MA7A 4UANA 5F89A 1HSBB 1K6QL 4JPSA 2OP4H 4MJ5B 2YPLD 1GAFH 3POCA 4EQ3A 4QD2E 2FL5B 3G5WA 3SOBL 3CK0H 3A3YB 4X6DB 4LCWB 4WI2A 3TT3L 5C0CD 4MKTA 2MEJB 3WO3B 4JM4L 1AI1H 2OMTA 3FU9A 4MJID 4LOUC 4DUXA 4PU2A 3FU7B 4DP8X 3L3OA 4JO1L 3T5WA 5DCCA 3VD3A 1RU9L 4MX7B 4HDIB 4DVRH 2P45B 5AWNL 5BW7A 2J6WA 2VDNB 5F3BB 5CBEB 4HC1H 4PB0H 2CMRL 4IBSA 2RTTA 4EIUA 3PV6A 1PCSA 4IBWA 2B4CL 2J57A 1CVSC 1E6OL 1LK3L 3FCBA 1ZSDA 3W1ZA 4YHNB 5DZJA 4BGDA 5J56B 2PWFA 1D6VL 4NP9A 4NI3A 5CMAB 5DRNB 4M93B 5BXFB 3RU8L 5B38A 3RWHB 3ARGB 3TZVA 1MUJA 2F18A 5HYQB 1DQDH 2ZF8A 2YLHA 1M6UA 1E40A 1N5YH 1BX2B 5DFTA 4YAQA 3L3GB 1YYCA 3HPJB 5I1AA 4FTVA 1DN2A 3BT2L 5JPMB 3MRCB 5DJ8A 5IBTL 4RFOL 1DANT 1A47A 1D7FA 2OCFD 3IPEA 4WF7A 3D18B 1EXUB 3BWZA 2J2ZA 3CN0A 5CJQH 3ROOB 3ARDB 1MVYA 3B7UX 4HS8L 4XO4A 2FQGA 1G9MH 2R2EA 3O0RL 3N0AA 4WGVB 5AW8B 2F7IA 4O2FA 2QBWA 3C60D 4KY1H 4M4PA 4WO4A 5BPPA 5AZ2H 3HC3H 2R7EA 4KHXL 1OAZL 1TZHB 3SDCC 4RMSA 4W9GC 3PWVA 3F01A 1XCWA 2CQVA 4OJFH 4A2MA 2XN9E 3D52A 2Q3AA 4IKLA 4AYFB 4AMXA 3WU1A 3FUJA 3Q3GB 3OR6B 2BMKB 3LHPL 4FFZH 3V4UL 4CMHB 5C07D 1A5FL 5IHLB 4DCQB 1D7DA 2OK0L 5J9PA 1BOGA 5CIPA 3RDJA 1CGWA 2R9HC 4RZCA 4CKVX 4DNLA 1DSYA 2OI9B 1XR8A 3EADA 1P1VA 1DQML 1QKZH 1A14H 3L48A 3TFKD 1E50A 1ET8A 1OE1A 1L6XA 2JIXA 4M4RA 4NKMB 5HD8D 4LHQB 3HRZC 1PG7W 4WTXA 4XPHL 2P80A 1NDMA 3WHE0 3NJGA 3QWQB 4JRXB 3HFML 3JV6A 4A67A 4QAWA 4WEUD 1QSVA 5JO5A 3C5SA 1XIWA 2C7FA 2FJSA 5HDBB 3HE7D 1MFUA 2MNJB 3MGOB 3T2NH 1A6ZB 3N1FC 5L2KB 3OLGA 2DY2A 4Y5YA 4FA6A 3UYOD 3JTSA 2J8OA 1HL9A 1IAKB 1SXZA 4WSJA 4F57L 4Q0XL 2XI9A 3RZCA 2DQGL 2E27H 4BDVB 4XNQA 2W59A 5D9SB 2O72A 1U2HA 1Q0XL 1H9VA 2VERA 3DOSB 4LP5A 2NTFA 2AKRA 4KJWC 4N2AA 4CW1B 4J8QA 4UYPA 5FUOL 3VI4A 4UU9A 4DZ8B 5F7FA 1I7UB 2NSQA 1BAFL 5DJ6B 4JO2H 3F7VB 4ZW3A 2OZ4H 1MRDL 3OAZK 4ZS7L 4HLEA 5KVDH 5H37A 1E30A 3ARZA 1S2EA 5DR5H 5GGVH 5ERWB 3F64A 4BH8A 1S7VB 1WRFA 2QFRA 3R0NA 3AS3A 3HNSL 4NGHL 4FRWA 2W0PA 3NZSA 3LH2H 3QJXA 3A4FA 3GSVA 3SE4A 3K0YA 2W9EH 4LLMB 5B39A 2Y72A 4M7LL 2FWLB 3K5SA 2JE8A 4CN1A 2G60H 1Z5YD 2MCPH 2X9YA 3FQRA 4FFTA 2WTPA 1PJ9A 4RH4A 5AEAA 4IQHA 3DMMB 4DGVL 4HHAB 4PJAA 2GIYA 4AI7A 5GS0D 1FPTH 1KUMA 3H9SD 4G7VL 3NA4A 3ES6B 1EFQA 2VYRE 3GT6A 1GYWA 4PV8A 2MTPA 4L29B 4Z7VF 1C1EH 3IJYA 3LS5H 2ZOLB 2WW8A 2I9TA 3TEYA 4JANB 1QD0A 1K4DB 2FATL 3RL1B 3EGXB 4OFYA 4TRPL 2PCFB 3TO4C 4ZO6A 5EIIA 3GS4A 2FECL 3B9AA 3NFSH 4YOKA 2HZHA 5BRPA 3B2DC 5J12C 5D71L 4KVCL 1YMME 3AU1A 1PY9A 1L5GB 5KSBA 5GQBA 1P4BL 3KYOA 4YPGA 4R6UA 1EERB 1KJ2L 4HXBH 4MDIA 3F2LA 2AQ3A 3OPZH 4PCYA 1JZEA 1OK0A 1O7DE 4WUKH 3IDJB 3VD5A 3EBAA 4ZUWA 2CDGB 4FFWD 5ELIA 1BFVH 1I8IA 2FHBA 1M7DA 2A4ZA 4CNIA 3DX6A 4FG2A 4PJIB 4JFDA 4R7VA 4C57C 2AFNA 1SJHB 3MUJA 4KJWD 3VI3B 2P5WD 1J0IA 2F53E 3KS0H 3F7YB 4AJYV 1A6WH 4Y2OA 1ZK5A 1FORL 2NXYC 4L48A 3GHEL 2PCYA 4TTGA 4Z8FL 5TDOA 5HHQA 4AY0A 5I75B 1ICTA 3REWA 3QH3B 3CG8A 4ZOEA 3SJVB 3V0VA 5LXVA 3RFZC 2WZ0A 2CLVA 3KL3A 4HSQA 4OW6A 3AB0C 4TLSA 1T66D 3AREB 3NIFB 3LXAA 1GZQB 1WIPA 4TNVF 4WNJA 2CD0A 1ROCA 1VGEH 5I74B 1IC1A 5D93B 2Y6TE 4OZGA 5B21A 4WIQA 2H0FA 1U8LB 5AL0A 4L3EE 4P0DA 2BRRL 5L2JA 4KJPD 4RQQA 2B1AL 5MENE 3FU6A 3MFFB 4U1HB 3G6JA 3IXTB 5F6IB 5TPWL 1CD1A 4M48H 4RAVB 2KKQA 1FL5B 4AV5A 2VJ8A 4FQQA 5LWYL 3GMOB 4R83A 5FFGA 4CMMA 3VJ6A 4KX7A 3QI9D 3BZEB 1MHPH 3CFKA 3GLDA 2NZ9D 3U4EB 4HJJH 1IAIL 1KY7A 3AABA 4GKNA 1KC5L 2X9WA 4ZOAA 4P4KB 3AS0A 43C9B 1FHGA 3GJFK 2ENSA 3DHPA 2VXQH 1DYZA 5I24A 4H13C 3TO4D 5D7IB 3NJKA 4EJ1C 3RNKB 1KB9K 3GEWB 4XB7A 3GSWB 1BGXL 1RZIA 4JB9H 4WDIA 3TA3A 3V0AC 2Z1PA 2EDMA 3OKMA 2AEIT 3FH7A 5ETUA 5E1GA 1SHSA 4LSQL 5CGYD 4EIBA 1KBGH 2RFXB 5DMGD 3MTXA 3QFJD 1UYWL 3LKQA 2JTYA 3LKNB 1ZWIA 3M1BB 1QFUH 4LLDA 4K8RC 4HUXA 3AS2A 1QLEB 1V05A 3DGCR 4L3AA 4XCEB 5D7SH 4F7KA 2B08A 3BWUF 4N90D 4PGJA 1ZLSH 1F8TL 2ESVB 5C6WH 2B1OA 1I4FB 1OLZA 3BCFA 4Y8DC 3T0AA 4BELD 3E3QE 3I3EA 3TV3H 2FJHB 3H2WA 1WA1X 2C3VB 2NXYD 1E5ZA 4XX1E 3UTTE 4IYKA 5C0EB 4OM0H 2X53A 2VLKD 5KJRH 1E4XL 2YUVA 4ELMB 4WTZG 3KPRE 3MNWA 2K4WA 1KXTA 1IKFH 4FC3E 1EIBA 2BK8A 4H5SA 4NCC1 3ISYA 5EC1B 3W9EA 4XPAH 3KEDA 2K6WA 4UDUA 1MF2H 3VX0A 4LCCA 1S6NA 1G0XA 2WQVA