1ET8A

Crystal structure of nitrite reductase his255asn mutant from alcaligenes faecalis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
339
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPNLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Catalytic roles for two water bridged residues (Asp-98 and His-255) in the active site of copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 88
structure length 339
sequence length 339
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et8A02
3FS9A 2H47C 2OJ1A 3NP3A 3IN2A 1L9SA 2J56A 4YSTA 3GDCA 1M56B 2BWIA 4A2FA 1NIAA 1RZPA 1NINA 3HEIB 4E9RA 2B08A 4AX3A 4ENZA 1TEGA 1KDIA 1N70A 1PMYA 1TKWA 1JZIA 4Q8BA 2ZOOA 2CJ3A 1AZUA 4YSEA 1T5KA 1WA2X 1J5DA 4HAKA 2HZHA 2HXAA 3T6XA 2XWZA 1E5ZA 4N4YB 5TK4A 2N0MA 1J9TA 2VM3A 4FA7B 4NB7A 3KW7A 5I6NA 2DWSA 3PAZA 3NJGA 4E9SA 1E30A 4DP1X 4M4RB 3SQRA 1W6WA 2DY2A 2OV0A 5AKRA 2VW6A 4P5SA 5PAZA 2CAKA 2I7SA 1IUZA 5AZUA 2EIMB 4KO7A 1MZZA 1AS8A 5B7MA 5ANHA 1JXDA 1L9TA 3PCYA 4A66A 3GXUB 3PAVA 3FSWA 1IKOP 4HHWA 1JZGA 3EH5B 5FC9A 3S3BB 1A4AA 1N68A 3RYMA 2E86A 1KV7A 3EHBB 4G72B 1B3IA 7PAZA 1SJMA 2W88A 1BQRA 2P80D 3NJNA 4CSPA 3FU7B 3FQ1A 2XLLA 2XVBA 3NYKA 3NSCA 5I5JA 3PPSA 4GP8B 3DKHA 3CZUB 1ET7A 3UADA 1QNIA 1ILUA 4YSUA 4QKTA 2QDVA 3ZX1A 3H56A 2HRHA 4F2FA 1HAWA 1X9RA 5I6OA 4E9QA 4AKOA 2DYSB 2QPEB 4BWUA 3FT0A 1ZDSA 1I53A 1NPNA 3SBRA 2BP8A 2WO3B 3C75A 3OMNB 2AVFA 1SHXA 4A2GA 2PCFA 3NJIA 3T9WA 1ILSA 2BZ7A 2PPCA 3JTBA 2WSDA 2VW7A 3ABMB 4BDVA 2GB2A 3BQVA 4Q89A 1HFUA 4DPAX 1ETJA 1IC0A 2XX0A 4YSCA 5I26A 1GS7A 3D12B 3AW5A 1A65A 4HCGA 3X1GA 1CC3A 1W8EA 1OCZB 1NICA 4A2HA 4UANA 4YSRA 1KYAA 1ZIBA 3NP4A 1J9SA 2XXFA 4HHGA 1PNDA 2UXGA 4G7QB 4KNUA 1GSKA 5F7AA 1TEFA 1URIA 1UATA 3FSZA 2BO0A 4DP4X 1PZBA 2XU9A 4QLWA 2IDFA 2HX8A 2XV2A 1JZHA 1V10A 2IDSA 5B1BB 3UAEA 3EH3B 3UABA 4DP0X 6PCYA 3ERXA 1KBVA 2IDUA 1JZFA 2BW4A 4BWWA 1ZIAA 1AIZA 1BYOA 2I85A 5I6LA 2IWEA 1JERA 1L9PA 3T71A 3FQ2A 4GYBA 2VSKB 3QJVB 1CUOA 3ABGA 4AKQA 1SFDA 2Q9OA 4HALA 1FWXA 2HX7A 5AFAA 1WAEA 1AOZA 5B7EA 2ZWNA 1OF0A 3ASOB 1PF3A 2PLTA 1XB6A 2J57A 3X1BA 4E9TA 3GYRA 4KOCA 2JFCA 1A8ZA 2CBPA 2QT6A 2PPDA 4UAHA 4DP5X 4DP7X 1A4CA 2GC4C 3V9EA 3PLYA 2AFNA 1E65A 1MDAA 2HLEB 3T6ZA 4N8UA 4YSOA 1PAZA 1IBZA 3TBBA 2YXWA 3X1NA 1SNRA 2GI0A 2X88A 3T6WA 3CG8A 4MFHA 4F2EA 5B1AB 3S8GB 1AR1B 1KDJA 1ADWA 1SF5A 1PLCA 2Y1AA 4TXVB 1YLBB 1BXAA 2UXFA 1IBYA 3SBQA 4A68A 1RCYA 2TSBA 1M57B 4RH4A 1BEXA 2UXTA 1SHWA 2AZAA 3AY2A 3KW8A 3QJRB 3NJKA 2GBAA 3QJUB 2FWLB 3FU7A 2PP7A 4W9ZA 2EILB 4DPBX 3IEAA 1OCOB 2IH8A 3FYEB 5I5IA 2H3XC 5EHFA 4DP9X 1PNCA 4WTQA 5I6PA 3UACA 1NTDA 2Q5BA 3NJLA 2MRYA 1ET5A 4W1TA 1OE1A 1AZNA 1E5YA 2XYBA 4PCYA 4DP6X 5B7FA 1BAWA 4M3HA 1SDDB 1WA1X 1E67A 1NWPA 1VLXA 4BK5C 1BYPA 1NPJA 3ASNB 1HAUA 2QPDB 4G70B 1RZQA 2FNWA 3BVDB 3OQRA 4KO9A 5D4HA 1AACA 2R7EB 5I6KA 1BQ5A 4GY4A 1W6LA 1CYXA 2J55A 1X9UA 2I7OA 1V54B 1ASPA 2BZCA 4DP2X 2A3TA 3IE9A 1CURA 2PPAA 3JT2A 4YL4A 2FJSA 2YAFA 4E9VA 2YAPA 1SFHA 3UAAA 3N2JA 2XV0A 4GP5B 1KCBA 3ZIYA 2GC7C 3S3CB 4GP4B 1AZRA 2YAHA 2YQBA 2WO2B 1ZPUA 3TASA 3N55A 2CCWA 3WI9A 9PCYA 2BWDA 1KBWA 2PP8A 4KOBA 1PY0A 2IDTA 3WG7B 1XB8A 1BXUA 3OMIB 1WS7A 2YXVA 3OMAB 2PPEA 3ABKB 1TU2A 3IN0A 4UF7C 4YSQA 1JXFA 1ET8A 4BWTA 1R1CA 4KNSA 1OE3A 1PCSA 3NSYA 3QQXA 3AZUA 4CSZA 3EF4A 1JZEA 1BQKA 5IY5B 1AS6A 3CVBA 1MG2C 3FSVA 1NWOA 3FU8A 3WKQA 4FAAB 1WA0X 4YSSA 1OV8A 1EZLA 1SF3A 2BP0B 3CDZB 3EH4B 3FSAA 3CVCA 3OM3B 1J9RA 3G5WA 1ZV2A 2HRGA 3V9CA 3FQYA 1A3ZA 4EF3A 2AZUA 3QJTB 3WNJA 3X1FA 4HCFA 2YAMA 3NSDA 4AI7A 3FU9A 5B1KA 2GHZA 5I5MA 1AZBA 1NDTA 1NZRA 2OCCB 2PPFA 2NRDA 1GR7A 5D4IA 2FT6A 1JVOA 2AANA 1GYCA 1MZYA 2UX7A 3AG3B 2YAQA 2H5UA 5B1JA 2FT8A 4BXSV 2VSMB 2P80A 4KO6A 4JKNA 3CVDA 5PCYA 2PP9A 1J9QA 5B3SB 3ZDWA 3X2QB 4DPCX 2W8CA 1BXVA 4NERA 2CUAA 2VM4A 3NJMA 3T6VA 1A4BA 2ZXWB 1XMEB 3DIVA 3L45A 2IWKA 2J5WA 2JXMA 2FT7A 2YARA 2IH9A 2YAOA 4AKPA 2B3IA 4G71B 3QJQB 2DV6A 5LDUA 3UGEA 3H4HA 5I6MA 3PXLA 1KCWA 1SDDA 4GXFA 2XX1A 4WKXA 4PAZA 1OE2A 3WNIA 3H4FA 2X87A 4A2DA 4YSAA 1EHKB 2EIJB 3TA4D 3FPYA 4E9YA 4BXVA 2R7EA 3MBWB 2FQGA 3PAUA 1PZCA 1DZ0A 2FQFA 4A2EA 2FTAA 1PLBA 2ZONA 3OD3A 1XB3A 2BHFA 2VMJA 4L0PB 3WIAA 2JKWA 1JZJA 5A7EA 1RKRA 5F7BA 4ZK8A 1OCRB 2YAEA 2VW4A 1QLEB 2XUWA 1AZCA 3NJFA 2FQDA 2CALA 1OOWA 4JHUA 5B1JC 1QHQA 1FA4A 3AG2B 1JVLA 2VN3A 1OCCB 2XXGA 2MTAA 1J5CA 1M9WA 2EINB 4HZ1A 1JOIA 3NSFA 1AQ8A 3QJSB 3TBCA 3NT0A 1V55B 1GY1A 1NIFA 1KGYE 3AG1B 1GS6X 1GW0A 5I28A 4K9JA 6PAZA 1AG0A 2BP0A 5D4JA 3CDZA 1NIBA 4E9XA 1AG6A 4JHVA 2BP8B 2DYRB 2IWFA 3FPXA 3FYIB 1L9RA 1ASQA 2EIKB 5E9NA 3U25A 3ZBMA 1PLAA 2UXVA 2PCYA 1ZDQA 1L9QA 2Y69B 4YVUA 2RACA 1DYZA 4HCIA 1ID2A 3IBOA 4YSPA 3MX0B 3S8FB 1FFTB 1AAJA 3NJJA 2FQEA 4BDVB 1ASOA 2GIMA 3ABLB 2IDQA 2LLNA 4DP8X 4KO5A 8PAZA 3HB3B 2BW5A 4NAJA 1NIEA 4F7KA 3SBPA 3AG4B 2TSAA 3X1EA 1GY2A 3DTUB 4A67A 4HIPA 2QDWA 3WKPA 1MG3C 4P5RA 4YVNA 4YSDA 3NJHA 2UX6A 1JXGA 4E9WA 2HX9A 1CYWA 2GSMB 5TK2A 4AZUA 1GS8A 3QPKA 3S3DB 1AANA 4X4KA 1PZAA 7PCYA 4G7SB 1NIDA 2XV3A 4G7RB 1AS7A 1WS8A 3TU6A 2IAAC 1L9OA 2DWTA 4KNTA 1F56A
chains in the Genus database with same CATH superfamily
1ROWA 2OJ1A 4ZFOA 3EGDB 5C0EA 4JRYD 3D8MA 4I13B 4OAWB 4GRMA 3QQ3B 3RKDD 4MD4B 4LVOB 1Z9PA 4LAQH 4TUKH 5D7HA 2QKSA 4IJ3C 5HYFA 4W9KC 2A9CA 4TNEA 4BCZA 5HHNA 4KK5D 1PSKL 5CSZA 1T5KA 3N5AA 4PHZA 3NPZB 1WBZA 3HN8A 4GKLA 3WN6A 2DLHA 3RNQB 3RKDC 1EK3A 3B7SA 2CGRH 3P9WB 2R1WB 3KE0A 3ZDZE 2XIIA 5D7JD 1VJSA 4EMZA 4GLRH 4KK5C 3U0PB 1FL3B 3RVUD 3VNZA 3CX2A 2GK0B 4U1LB 2EKJA 1UWYA 1PD0A 3FF7A 5D7JC 3T09A 3SSGA 2VR4A 4JNXA 1NMBH 5H4YA 2DM4A 5B7MA 2UZYB 3WSQL 1VZGA 2APWA 2R2HB 4KX8A 1O0VA 1OHQA 4AUJA 2QLVB 5FO7A 3EFFA 1ZA6B 2VZVA 4HT1L 4WIQA 3FQNA 1Z9NA 4N8VA 3TNMB 1J1PL 1RP8A 1VACB 1IZKA 1RPUA 5HGDA 1ZGLB 1BJMA 2BDNH 3FB5B 4JUSA 2YKLH 3IYLW 2MCPL 3MV8A 4BSVA 4GFTB 5IB3A 2BSCA 2N59A 2BM3A 4BZ1A 3HN3A 1EFXB 1ONQB 4Q6IA 5D2LF 3FT4B 5T5NF 4FFZH 1RD6A 1KZYA 3ZDXF 3O41A 5C0NC 4MVBC 3GC3A 4F7PB 4ZW6A 3HBQA 4GT7A 4OCSH 2YXMA 3ZYZA 1XXFC 1FI8C 1KFGA 3K6SB 3DI2B 4JKKA 3FT0A 1G7MA 2AJZA 3K1KC 4U1GB 3NZHL 4LVNC 4L1DA 3N6YA 5IHWA 1CVSC 2F74A 5KVGL 4JGJA 1HL9A 3RIKA 5J89A 3EOYG 4R3SB 2O5ZH 4RAVB 5ESVA 1XR9A 1S7VB 3VXUB 4U6VL 4Y9FA 1F00I 1I1YA 5CWSA 3RUGA 4KTEL 4PWHA 5C0RL 4JY4A 1U92A 1JD7A 2QSTA 2QMJA 3OKEA 3E38A 2PTUA 4WY7H 1UACL 3ZY7A 2FLBT 1BJ8A 2X1PA 4Z76B 2X53A 2HN7A 2KS0A 3L5WA 5EO1B 2KT6A 4GSDH 5HHME 4ZJ9A 5J5EA 1SN5A 1N0LA 2OBGA 1OZUA 5ABAA 5A2IH 2AK4B 4BZYA 4JRXA 1AC0A 2J72A 4JFOA 4CMHB 2BFGA 4Z95H 3BRDA 1ZAGA 2RR3A 3MLZH 5SWSD 5AW6B 4YHOH 4X6DA 5CD5D 5FUOH 2XTJB 5KSUA 5DHVH 1S3RA 1KN2L 3S5YA 4NS0A 3HG1A 4PJIE 5EULV 4DP0X 5D7LE 2AXFB 3D39E 1EBPA 4WHDA 2K70A 3KL3A 2VE6B 1BD2D 5CD5C 4ZG1A 2UYLA 2X3AA 5KSVA 4UOQA 5I73B 1F2XK 1P6AB 2BIIA 5CZRA 4BIKA 3UROR 3IFPA 4JM2A 3P30H 4MA3A 4A7GA 2OPCA 5T1KA 4G80A 4S1RL 1JNJA 1JGEA 4JAMA 4S2SA 3DVGB 5DI8B 5FV2A 4ZFQA 1H3XA 1IFGA 1OCWH 4UTCA 3B2XA 1JF1B 3MV7D 1VFOA 5C0GB 3TXAA 1MQKH 2IMNA 2HLEB 1OQXA 1BPVA 2E4TA 1IBZA 5C0CB 3RQ3A 5CZXD 3HG2A 4PJ7B 1GYAA 1WDAA 3FUNA 3GSQB 1I4FB 4LOUC 1GH7A 1NCWL 1DBAL 2D7MA 4Z18A 1M57B 1FZOB 1OZTG 4CC1A 5CZXC 4UT6A 2WJ5A 2YSSB 4C56E 4YDNA 3BDYL 1P0SE 2NW3A 1FN4B 4O2CB 3WDHA 2O5YH 3GZOA 3LHPL 2AEQH 2VDKB 3FZUD 3QJUB 2FWLB 1ZEAH 4QOKE 1F2QA 3RTLA 4ELMA 2G9KA 3SJVD 2DQMA 2VMEA 5FYJL 1P53A 4MD5A 15C8H 1DQIA 1O7SA 3ZKND 3WLWC 5E1QA 1FLTX 2F54A 1ZK9A 4ZUWB 2VDQH 3GINA 5CFHA 1N4XH 3FZUC 3GSUB 4IBWA 3QP3A 4QI3A 3MRGA 4XPGL 5FOJA 1MWAL 3F83A 5AG8A 5C08B 3ZKNC 2AXJA 2O1AA 2AKRB 4N9GB 4JHAH 4ABWA 5E56A 1N67A 1OP5H 2ATAA 4JFVA 4ETQB 3QHZH 4BZ2H 3ETTA 2CIIA 3NQKA 4H2AA 2NOYA 1U8CB 3C2SA 4J3XA 2YQ2A 2ODHA 4FXLA 4H25B 3UIYA 3ZYJA 3EOBA 3OAWA 2VKWA 4IRJA 3FL7A 5EUKA 4DUVA 5I76A 3MR9B 2BVQB 4JL2A 3HVDA 4KJYA 5HXMA 3GLEA 3MV01 2OJEB 4UNVA 5ITFB 4KRPD 4Q74A 3KL0A 3M88A 4U3SB 1X5KA 1TQVA 4ZQKA 5EEZA 5KVEL 4PJXB 4JB9H 1KJ2B 2R0ZH 4XN2A 3KGRA 1W6LA 5HYJA 3MUJA 3EFOB 5I1IL 5LJYH 2Y9RT 3QORA 1E9PA 4WGWB 4KRPC 5KBNC 3SKNA 3HMXL 2XQYA 5LHDA 2YAPA 4PB9L 3VFUA 3HZMB 4KX7A 1E5CA 2AXGB 4PGDB 4AYGA 4MNGA 4ODWB 5E99H 4M6AA 4WNQA 1AQMA 1FJ1A 5HYQA 1L0PA 2BWDA 2OZNA 3ESNA 2B2XH 3CZNA 4LFHD 5J1AA 1DQKA 2Y25A 3KM2A 4OLXL 4XPHL 5KVGE 3MV8D 4FQ2L 2Q6WB 3IN0A 4FTVE 2J88H 1CDJA 4OD2A 1BVKA 1J8RA 4UOJA 5L9DH 2QV4A 1NGWA 3WEMA 3TBTA 1RI8A 3SO3B 3PWPE 2Z7ZA 5CCKL 5ACZA 4X9HA 3WKQA 2Y4SA 4NM8H 2W07A 5K93A 2FX9H 2GG1A 3LKOB 2YQGA 5DWUL 1U3YA 4MCYA 5ALBH 4YHYC 5ANMB 1A4KB 2J25A 1FYHB 3ATFA 1JPGA 4H8VA 2AZUA 5I9QC 2EDNA 3ULSA 2JJUA 2F18A 3D33A 4LLWB 4HMDA 4LRNH 4XX1E 5DLML 2ZAGA 3ARFC 3QJZA 2W65B 4X80L 2OXGA 5D55A 2Y23A 1F3DH 1IKFL 1AIFA 4IK7A 1JPFA 3RUGF 4D0DA 1IU1A 1G7JA 4PG9A 1MHHB 1U8MA 1WK0A 4IRSB 1GR7A 2FT6A 3QRGH 2IPUK 5AL0A 4JRXD 4PRPA 4ZW7A 2UX7A 3ARDB 1IGTA 1T83A 4DGIL 5JZ7C 4R2GC 1Q9LA 4FI7A 4GRLB 4PI0A 3ARUA 3D7PA 1OLZA 3BH8A 2DQEH 1T2JA 4ZX4A 1A1MA 2W8CA 2MQ3A 5E8DL 4JG9A 3V2AR 3Q06A 5JA8B 4UQIM 1TTFA 3HG1D 1A4BA 4PVLA 1S5HA 4X6DF 3BGMB 4U1MA 5HDBB 3OR6B 4AUUA 5JIQA 4W93A 1KTRL 1KLGB 2GCYB 4Y16A 2HLFD 1KTDA 2JIXB 4I8DA 1CDIA 3T8VA 3X3GL 4ALAC 4QAMB 1ZHKA 2A73A 2BERA 3CN4A 4JEGB 3ESOA 4RESB 4ZUSB 3BC9A 1KCSL 4PUBH 1SDDA 1S8DA 2V5SA 4JM2D 4ZW8A 2DQJH 3FDWA 4DK5A 3QZPA 4OQTH 3NCJH 3RHWF 1MRDH 1CFQA 3LN4B 2IVFC 2V4LA 3LPGA 4N2BA 4TSAL 4EI5A 4JM2F 1TXKA 1ZLSH 3IJ9A 4R7NB 4N1EA 4A7GF 1YEIL 2PWEA 4HD9A 2W0LA 3BHBA 4E9YA 2CUIA 3FTGA 3NVQA 3I6KA 1EJOL 3JWNC 1QSFE 3WFDL 3UBHA 4JQIH 1S7XB 5F6HJ 5EO9B 4A2EA 3FUKA 3O3BB 3II2A 5FYJE 5D7IE 4F20A 2R9HD 4RAVA 2Y6SC 4Z8FL 1IO4C 1ICTA 1E6JH 1KPVB 4U1IB 3TF7C 2IQAB 1PX3A 3IWUA 4K8RH 2WBJB 2FSEB 4IU3B 3AT8A 2D8KA 1FYTB 2MOGA 5E1AB 3G6JE 3V0WH 2R9HC 1DR9A 1F11A 3F7YB 3FB7A 3LRGA 5ID0B 1CQYA 2AQ3A 2FQDA 3MFFA 5E2UH 3IU3A 4DQOL 1FA4A 1U3JA 1P4UA 5I1CL 3QR0A 2CBQA 4B7IA 3FOMB 1CGSL 3GS4A 1KTLB 1N59A 4X9BA 1UM6H 1V27A 2RA1A 3UTQB 3EGXB 5C0FB 1NPUA 2P49B 3QH3A 3S98A 4KZEH 1S3KL 4GKSB 3FHQA 3O2DL 2F54D 4ELMF 1ZLVH 2J4WL 1XFPA 3W5NA 1C5BH 4KNQA 3TFBA 4ZXBA 3UTSA 4XP4L 2G4EA 3K7UA 4WUKL 4RX4A 5C0DB 5A16B 5DCCA 1CDGA 3SOBH 2FBJL 4QCIB 5I28A 2ZOTA 5KVEE 1OL0A 4A7QA 1PLGL 5SX4I 3O6KH 3M1BB 2Q3XA 1MPAL 1Z7JA 4MLSA 1D7CA 4ZOAA 5GISH 1BZ9A 3GSOB 3BSZL 1CLZL 2EIKB 3PFUA 4QDGA 2JCCB 2X44D 4FNLL 1O6VA 2G0KA 4IRJD 4JFPA 2O6CA 2X4QA 3LKSA 5D1XE 5DYOB 1AQHA 4QF1A 2A7BA 4KQ3H 3EJQA 3INOA 3O11A 4E36A 1Y07A 2ZOUA 3E8UL 3N44F 3WKMH 1FHGA 2FWOB 4KO5A 2BNQE 3PUCA 4DW2L 4BFGA 5LGJB 5KSBF 4Z7UB 2BNRE 4IRJC 4Z77A 4I88A 2ITFA 1ZLWH 5DSCB 3WTSA 3WKNA 5HYJD 5EEXA 5BRZB 2XWXA 4HUNB 3QORD 1XF2A 4A67A 4U3CA 4HIPA 4LLAA 4ZSOB 2NNCA 3OMZA 1JXGA 2VC2L 1EWHA 1L9NA 1YQVL 3TN0A 3RY6C 5LBSA 5DUJA 4ODXA 2F0CA 4YWGL 4AH2A 5FCSH 5HHQA 3QORC 3VGAB 4M6MH 5D93C 2BS8A 1FFPB 2YC1B 3IRPX 4FJ6A 4M8QB 4XBMA 1LEGB 1LP9A 1NIDA 3L3OB 4FQIL 5FO9A 4PRAB 1AS7A 1ECZA 4GXUN 4WUUE 1JYWA 1UOWA 2VERA 2JI1A 5C07A 4FNQA 1Q9OA 1SJEA 4M43L 3FK3A 1TFPA 5T3XD 1L9SA 1OAUH 3O9WC 2C7UA 2JNZA 4GOSA 4MQ7A 4BV1A 4PS4L 4HEME 2B08A 2E6JA 3GSNL 5K33A 3ARBB 2ZX7A 43C9B 3KXFE 5E8PA 4FQCL 4OD3H 5DGRA 3HTLX 5K1NA 1OPGL 2EDFA 3HZKA 3EXLA 3V5HA 1TZIA 1CDHA 4AM0A 3CSYA 1A02N 3DTDA 5L0QC 3V5KA 2ICEB 1I8IA 3EH1A 4QO1B 2FEEL 4ETQA 4HQQL 2DQIL 2ZUSA 3GK8H 3FFDA 3K0WA 2HJKB 1ETZA 3SKMA 1NANI 2OV0A 3X17A 4DO5A 5KYNA 2XWBB 1ZJBA 4JY5L 1MRCL 2A9NL 4RGMB 3SDXB 3ULAB 1IC5L 1MFDH 1U8KA 3HI6L 4MA1B 3RWJB 2ZNWA 4JY6A 5SWQB 3F7PC 3FT3B 1DO5A 3PCYA 4M7JL 1K4DB 2LVCA 3T04D 1TQWA 5FWQA 4H1LG 5IKCB 4PRPD 4FG0A 3MVSA 5TDOB 3LZPA 2X09A 3S36L 3B9DA 2W88A 5IFJB 1BQRA 2HAZA 2LU3A 2VDOH 4CSPA 2WN2A 2P44B 3TA3A 2PCXA 3CXDL 3NSCA 3BEWA 4GW5A 3IFNH 1J8HA 2C3VB 3ZE1F 5CJ5A 3RWEA 3LZNA 1JK9A 3PWNB 4TYUA 4XE5B 1MLBA 4L8SA 5EEWA 1XH3B 4J23A 4LZKA 4Y2OA 4DO6A 2PWFA 2Z8WC 4YGAB 4KHTL 4C58B 1O6TA 3ARWA 4JN1H 4M9PA 4Y16D 5B8CB 3VD0A 1CD1A 4KUCD 4PRHB 4AMXA 2OSWA 2A83A 1FZMA 1F8TH 2BP8A 2FYYB 2WO3B 4K3EH 3GRWA 4JCLA 3KPRA 5DQ9A 3SE3A 1QI4A 4KUCF 1QUPA 4JZJC 3RB7A 3P3SA 4Y16C 3KGSA 2GSGA 3GB7A 4XBEL 3SIKA 1I7TA 4JKWA 4EI5D 2ZIDA 3GSVA 5F9OL 1TTUA 1YEHL 5ENWA 4AZ8B 1U8IB 1V8HA 1O9WA 3C09C 4MMYA 4ODHH 1TLKA 4WJ5A 1OQOA 5TTRA 2IPTH 1X9LA 2XKNA 1UB6B 5IMMA 1BBDH 1PZ3A 3ZHKA 1P84J 2Z4TA 5GJSH 2AAAA 2EH8H 2XNAB 4U33A 2RGSA 4JHWL 1TJGH 4F2MB 3UO8B 3I85A 3TS8A 5IB1A 5F7AA 1RMFL 5TE6L 4BGDA 1V3LA 1B3JA 3EGSA 2B4CL 4L3CA 5EU6A 3MRCA 2YLHA 3OAZH 3RZCA 2A4EA 4QGTA 5D72L 1F3JA 1BYNA 3L1GA 3DRQA 4X8GA 1O5PA 4B0MB 1Q1JH 1EGJA 3B4NA 3VWKB 1SEQL 3K6IA 2IDUA 4HJGA 1SY6L 4NZDA 4EZMA 2WQVA 3P4MB 4K94H 5AOZA 3I6SA 5I6LA 4PJFE 1AD9B 5MEPA 3A23A 1FPTL 4ZXBD 4AEIL 3UTSD 5D4QA 4QRUA 4RX4D 1DBBL 5D1ZI 4BH7B 3TO2B 3PL6B 1XT5A 1PF3A 1WFTA 4ZFFB 5ACMA 2FZ3B 2PPDA 5ICXB 1S46A 5H94B 5B38A 5CEYA 1OW0A 3CFEB 4P46C 5EZJB 1P7QB 1YEFL 1XGTB 3CMOL 3OQ3B 1Z0NA 3A6OA 1U8OA 3IJSB 1CGWA 6FABH 3KR3L 2XA8L 4N8UA 4YSOA 3UGXA 2H4EA 4U1NB 3O6MH 1CK0L 4WLCA 1ZA3A 2DLEA 3CG8A 3K81A 4NJ9L 3GHPA 4NWTL 5B1AB 5FDWB 1S9KC 4W6YB 4X4XB 1AHWB 1GZQB 4O00A 5FKPB 2BVPB 3WFBL 1DLHB 1NL0L 2UXTA 4TUOB 1TVBA 2PCPA 1ZT1B 3AY2A 4PJ5B 1E43A 3COOA 3TN0D 1TYRA 4DKAA 4NZJA 4PJ7F 4NQCE 5IQ7L 2GSIA 1GYVA 1SYSA 2B7DT 3ZTNH 4Z7WB 4XP6L 1OP5K 1BMGA 3PUUA 4JKPH 3PJLA 3U9UA 5B4MD 3E6FA 3CZFA 4WTQA 1MW0A 4A7SA 3TN0C 4DK3A 4YFDB 1KTLA 4XI5D 3NJLA 2WTOA 1LP9F 1T80A 1Z3GL 4M7KH 4RNRA 5GGVL 5C07D 3QRBA 4XMLL 3NGBC 4Y9EA 4KY1H 2N1KA 3US9A 1LE5B 4NRZB 4JFDB 2YD7A 2ZOKA 4KTYA 3TT1H 4JRYE 4NN6C 3QEQA 2VJ8A 4KPHL 2MNUA 1WPCA 2D0FA 4NKIH 1VLXA 1IAII 1CIDA 2DQCH 2W94A 3QDMA 2H6PA 3GKWH 5IW3A 2APXA 2NY0B 1NFDA 3G08B 3MJ9H 4HUKB 3JV0A 4DJMA 4LKCA 3CH8A 3RX5A 3VXSA 1HILB 3BVDB 4UINL 4H1LH 3NN8B 3CQQA 4LPUA 1B90A 4XVJH 1ES0A 3OZ9H 5DQDH 1OB1B 3MRRA 2DICA 1J1XL 3Q01A 3O4LA 2ENYA 1KXQA 5IIEB 4GQQA 1LO3L 1ZGLP 4ENED 3HN5A 1V54B 3DIFA 4A6YL 1ROCA 2DMCA 3MLVL 3KLAA 3DRTB 3IKCB 3V7AE 3SE6A 1J5OL 4BQ9A 2I27N 4FQXB 4ATWA 3OKDB 4UQCA 5JNYB 2J1ZA 1NM9A 3FFCB 3MNWB 4ZD3H 5CBEB 3PJNA 4Y9BA 2IFFL 1ZLEA 1L6ZA 4F3FB 4XODA 1KMGA 1BXUA 4M7ZB 1YYLH 2W0FB 3TA3D 2P5WA 1JGDB 3QE5A 4JDTL 5IVOA 1IARB 3VD2A 4U1SB 4HGWB 2XFXB 1G87A 1J8HD 3ARXA 4G59C 2ZG3A 4OZFH 5J11C 3OXSB 4JMNA 1TZ8A 3D48R 3EF4A 3FUIA 3TA3C 3DGGB 5C6TL 1AS6A 1RZ7H 2G60H 2E27L 4FAAB 4IJ3B 4X6EB 1IL1B 1EO8H 2BP0B 3NFSH 2MCAA 4L8SC 2LLGA 5I0WA 3KPRD 2WLJA 1YCSA 3IJYA 1BREA 2DQ6A 3OM3B 4DO4A 1E9QB 2WYTA 2VLKA 5GRXG 3EYUL 1Q9KB 4F8PA 1G9NC 3GHBH 3QJTB 1YYMH 4ZFZA 1BJ1H 4GFXA 4WW1B 5EC2B 4W81A 4M8RA 1Z0MA 2D03L 3HB3D 5AW0B 2J8UA 3N0PB 2E5EA 1MOEA 1T04A 1I3RB 5AVUB 1AZBA 1TQTA 4HJ1A 4O9HL 4AQAB 5EFIB 2ZCKH 3VXNA 2K3HA 4I3RL 1NLBH 3KPNB 3HB3C 2IGFH 1HT6A 3I74A 1E27A 1MZYA 3Q2CA 4JPKL 2WINB 1JV5B 2XACC 4APXA 3X14B 4AYSA 1UUSA 4DKEH 4JO4H 3UFIA 1MCHA 3A24A 3EOAB 2X4UB 1XHHA 1NCDH 4NRXA 3BZEA 1EA9C 5EU6D 4PMEA 3OLDA 1E8ZA 4ELKA 1TZOA 1NCTA 4RA0C 3TIDB 1EXHA 2WQ8A 1KN4L 2YUVA 3CK0L 3N9GH 4XR8C 5I2IB 4PGCB 1VERA 1ACCA 1MXGA 3MYJA 1PG7W 2IWKA 3L2LA 4L0YA 2A5UA 4GUOA 4JPWH 3HLKA 2B3IA 1ZSDB 4P5TC 3V4PH 2XWEA 5IHUH 4WNSA 1IM3B 2D3NA 3PXLA 3C5ZB 3AQDA 1J0JA 1TVHA 1X5XA 2DMKA 2HVKA 3EFDH 5AW9B 4Z3JA 5E6UB 3X13A 3TL5A 3RZWA 4DT2A 3MRHB 2Y7QA 2VXUL 4GS7C 4NWUL 2Y24A 1S7WB 4QY8B 3TYFB 5AW4B 3P40A 3K72B 2OMXA 1DUYA 5A6IA 1IVTA 5JO5B 1RZIB 3BRFA 3STZA 5F3BA 3WFHB 2LQRA 3L95A 1C1EH 4AGNA 5BPPA 2WOYA 2DB8A 7FABH 2XY1A 5FF6A 5KBKA 3OD3A 1TETL 2EEDA 3K2MC 4KKQA 1OW0C 4QXUL 1P2CB 2FGWH 5IV2A 4U1KA 2Z8VC 3BEVA 3AXLB 2I5YL 5DK2B 1NDGB 5EBMB 5I71C 3AAZB 3HOGA 5F7BA 1OCRB 4Q0XL 1ZLVK 1G6RH 4WTWA 2PO6A 4P04A 1V7ML 1ZMYA 1XF1A 3EH2A 3PNWA 3QA3A 4AIEA 2ZKXA 3RGVB 3FT2A 3WV0A 1C8QA 3OJDA 1M3IA 1RJLB 3MV9B 1CD8A 1WIPA 4NP4L 3K5RA 3QR2A 1AR2A 3MRJB 4B97A 3FO0L 5CINL 5E2TH 2Z92A 3ZSTA 1WIOA 5ICZB 3RWIB 5GGQH 3IPFA 4YO0B 3KDMA 3MLSH 4LHUG 5F9JA 5J13C 2NLJB 3TBWA 2ZOLB 3RAJL 3DJ9A 4AVHA 1M1SA 3UPRB 1U8LA 2DBLH 3GIVA 4GI8A 2VAAB 3QEQD 2G2RB 1UZGA 2D7TL 3NK3A 4I2XE 5DR5L 4C83A 3UCQA 1MNUH 1TITA 4KVPA 3SYQA 4LCIH 2Y1ZA 3QDMD 5EG6C 2W9LA 1SZNA 1YPZB 1UVQB 25C8H 2ICWI 1QLRB 3N91A 3GBNL 3SPIA 3MX0B 5FX3A 3VXSD 2WMPB 3JWOH 1ASOA 3IETA 3SKJL 5E8OA 3GSWB 1H3PL 2X2UA 1KENH 1NFDF 4DP8X 3H6JA 1NAMB 2NY4D 3D4ZA 2BRRH 4MSWB 1P7QA 2F19H 3CIAA 2EDYA 1GC1L 3QZNA 3O4LD 3RWCA 4NEHB 2CK0H 2F7IA 4YFLF 4MNQB 4UQEA 3RTQA 5DU7A 5DHVA 4XNQA 3UH8A 4RETB 1MG3C 3CSFA 4TQEL 4W4OA 3GWJA 4AGQA 2NY4C 4J2QA 4Y1AA 4L8BA 2WIIB 1T0NA 1O75A 3MLYH 3QPKA 1A7QH 2RHEA 4GIPD 2DWDA 3BT2H 3CMGA 4PCTA 2ENQA 1K8DA 2CKBH 3ARRA 2YD2A 4G5ZH 4XCCL 4Z7UF 1GAFH 5T1MA 1UWEH 3I50H 3CFDB 1WHOA 5DC9B 4M9OA 4M00A 3E6HA 4Y4FC 4ZTOH 2P5WD 3WI9A 2W59A 1LLAA 4IBQA 2CO7B 3CUPA 3S97C 3IWVA 1NEZB 1CGYA 5AW8B 1FZKB 1LK2A 4NZTH 3LEYL 1L6XA 3C6LB 3O3DA 4MD0A 4Q8BA 3PV7A 1A3QA 2Y5QA 1A3LH 1T2QH 2BZDA 2EYRA 2PWGA 5EU3B 4B7LA 4Z3FA 2OMTA 3EJPA 4BUQA 1ZHLA 3QIWB 3SDCA 3TFKC 2XPYA 4OGZA 5E2JA 4PI2A 3TV3L 3TEUA 2VLKD 1E30A 1DSFH 2DY2A 4OSUH 3KYMB 4NCC1 5ESAB 5SX4H 2Q76B 1AR1D 2EIMB 3SPVA 5AVXB 1PZ2A 1NGXB 5GRYA 3JVFC 5DJ2B 3LMJH 1VEMA 5FV1L 3RUGE 2CA4A 4AT6B 3AM8A 5FS5A 3MRLB 3QXAA 3CZEA 4PVNA 3ESUF 4AYDC 1AQDB 4IHOB 4FXGA 2AW2A 1AR1C 1PDKB 1A4AA 5IB2A 4MX7A 4UDTB 3GHEH 5DFVC 2ED8A 2BOBB 4JG5A 5KJ4A 1GPOH 3MOBL 4JRXE 4AQEB 2RB8A 2IANA 1A6TA 3WUWG 3IDXL 1PJWA 2CJSA 1U8QB 4J3OF 3UADA 2NNAA 1H3WM 3OAYK 4PJGA 4BZ2A 4CBPA 1W9XA 2Q0ZX 4WI9A 2EVGA 5F7UA 1D3CA 2VXSL 1TJIL 3GT6A 1JGLH 2NYKA 1INEH 3QIBA 3L81A 4UQ3B 4LLUA 5HHOA 3P69A 1A4JB 1MCOL 1CXIA 2X4OB 3DX7A 4G8IA 4L8DA 1URZA 1MFAL 3N85H 5IG7A 3OXSA 2CDFA 1YMME 4LCYA 1BM3H 1M7DA 2AVFA 3N50A 2YPKB 1GVIA 4HPOH 3Q8BA 1MCQA 3Q6FB 2C9SA 4R6UA 4WZ9A 4AXWB 4D8PB 5IBLD 1IMHC 4YHYB 2L4OA 3H7BA 4IBLT 5ISZD 1I82A 4P4RB 1JZ8A 3V8OA 1G1OA 1X3DA 5JPMA 4OI7A 2G5BA 5EZIL 5CF3A 2X4SB 5FHBL 4Z3TA 1OARH 3PWUB 3QULA 1KBGH 2BSTB 5IBLC 2CLZB 1W8EA 2AJVL 4HKJB 4H5SB 3ARFB 4Q4EA 5CJQH 3TX4A 3VFNA 4MDRA 3OAZK 2CU9A 3QDAA 1M1XA 4JZNB 3L08A 2DWYA 5IBUG 1OK0A 3DLQR 3STBA 3NACH 4HBQA 2UXGA 3EYFA 4KROD 4XGZB 4MAZA 3V55A 1LDSA 3PNRB 5GGUB 3TPUA 1DE4B 1RZJL 1TQBC 2DIEA 2PO6D 3Q43A 4R2GB 1DCEA 1NANH 2NTFB 3IAPA 1FV1B 1UD6A 2QGDA 3D25A 1V10A 1ZHBA 1CFSA 3S4SB 4KROC 1E90A 1HH6A 4LSDA 5AOKA 5C3LD 4IBVA 5TDNA 3WTTA 5F21B 4YHLH 4CGTA 3KLHD 3GM0A 4JPVL 1E3XA 2PO6C 3UX9B 1OAYL 2HKAA 1SLUA 5I75B 2MHAA 2DDQH 3KNBA 3ABGA 1U36A 8CGTA 2N3JA 4ZYKB 3V0AC 4X5LA 1AP2B 3AXIA 3ZHLA 4OIIH 2O61B 4F5CA 5DUBB 3GPEA 3I75A 4M1GH 3ES6B 1Q8MA 3GMPA 1XB6A 4OGXL 4ZUTA 3ZDYE 2QJDA 1N7ML 2QT6A 3UC0H 3VWJC 1JHLL 3L3HB 3ZKMD 1DBMH 3GMLA 2JKTM 1W72H 4M4RA 4X4MA 4UOZA 5T8IA 4M62L 3QDGB 3TBBA 4PRNB 5E6IA 5BV7H 3OHXA 4GAFB 3DURA 3AACA 3T0EE 5IM7A 3WEOA 3K91A 2VZ1A 1EPFA 2CH8A 5H2BA 5K9JH 5IF0B 5KSBE 4TXVB 4XZUA 2CQVA 4X9YA 4LO9A 2F7OA 1YUHA 3D18A 4YQXH 4JBSA 3HHSB 5I17A 3RTQD 4BFFA 3Q3GB 3UGUA 2ZJSH 4QMEA 1GHFH 3VXRB 1BBJB 4Y1AD 1XR8B 2YPLE 3IM1A 1XF4B 4S1SH 4W9ZA 5TD4A 3W0WA 3RTQC 1Q9WB 4NAMA 2CMRH 2X1QA 2I9TA 1JPTH 3G04A 1P6WA 2YA0A 1BPLB 4C4KO 4NZUL 4OQTA 2YGVA 4CC0A 4X5WB 3VTAA 4ZOCA 1HEZA 4G7VL 3S5ZA 4RRPG 3N1PC 4Z7WF 2H3NB 5KS9B 4DGVL 1A6VH 1AOHA 4C47A 4JQIA 1FH2A 4NHCH 3EO1A 1NCAL 3POCA 3S88H 3GXIA 2VMDA 2WBXA 5KANI 2NY5H 3SDCD 1PQZB 1R3KB 2JF1A 3ASNB 4HWBH 2ZG2A 1RZQA 1M71A 4JVWA 5F89A 1QR4A 1AACA 3L5XL 3V52H 2VDKL 3CFNA 3HUJA 4GUQA 1E8WA 2Q86A 2ZXGA 5JIKA 4P23A 1TZGL 1D5ZA 1F58H 3SDCC 3WDJA 4ZMZA 5HDRA 4Y5YA 1MJ8H 2DZEA 2BZCA 4JJ5A 3JT2A 1CS6A 3C6SB 3PXJA 1UEMA 1F6AB 3QUMH 3K3QA 3VM5A 1NAKH 1UA6H 1MHEA 4XP1H 3AY4A 1BG1A 4RISH 3ZIYA 4K55A 4JPQA 5CM1A 2EXTA 2JWYA 5CU5A 1MELA 3HBZA 2VLRA 4PLJD 4HA1A 1HXMA 3TASA 2CCWA 2NUPA 1RHHA 1D6EB 5FECA 5EF2A 1A6AA 1DANU 1GSMA 2VN6A 3F12B 2IAND 4IM8A 3AM8C 2OZ4H 5L6YH 1W80A 2GTWB 2IC2A 3OMAB 2R2BB 4M5YH 3VA2C 1BWMA 4ODTH 4FXGC 4BCYA 4DKDC 5FGSA 3UPAA 3TCLA 3BVUA 1N5AA 3BD3A 3C87A 5GSVA 1G9ML 3O9WB 1HINH 4URKA 3BN3B 4H8WH 4JKLA 3QIBD 3DPBB 1L4IA 5HHOD 4BD4A 1KJ2L 5EOCH 1T1XA 3L3IA 1G0XA 1WRFA 3IJEA 2LLLA 4FFYH 4HWEH 5L0QB 4Q7DA 4U0RC 1BDYA 2AJSL 3FQYA 4GG8B 4J7RA 3VI3A 2B1AL 5CN1A 4BK8A 1I8MB 1THCA 3ZN6A 1WG3A 1HXYB 1FFOA 3FCTB 4H0GA 4APQA 3SYCA 5TGBB 1LEIA 1JV2A 1E50A 5M7QA 2XFGB 5E2WL 4CADB 2QVIA 1M2VB 3T8MA 3Q9PA 3OAUL 4NM4L 4PLKC 5F1SA 3MLRL 5LN4A 3AC0A 4I9XA 1QI5A 2NRDA 3GMQA 4ZMTA 5IB5B 3FKUS 4LCCA 3GRWL 3VXUE 1BZQK 4RGOH 4EXPX 3I9AA 1HSBB 1KBKA 4O02H 5F0MB 3W9EA 1XF3A 4W6WB 5GS0H 1CCZA 4LE8A 3T0BA 3LNHA 4ZMQA 4EQ3A 4AQZA 5F1NA 3ZDWA 3DX0A 5J6HB 4XP5L 2OR9H 2X6BA 1UH3A 2AK4E 3EW3B 2UUDH 5A7BA 5CEZH 4P2AA 2OCJA 1CO1A 1KACB 1WZAA 5DO2D 3FQWB 3UTPE 3FO1A 2F15A 3FBKA 5CLYA 1SXBA 4DESA 3H4HA 3JV4B 1NM4A 5IEHB 4FKHA 2XTJE 5LXGH 1WFJA 4F24A 1KJVB 1T66C 1ZT7B 4FADA 4UQ3A 5DO2C 2QKIA 3EZJB 3QCVL 4TVPD 4X98B 1UOKA 4JZJB 3F58L 5E1GA 3B7TA 3ROLA 4D9LH 1TUPA 2EIJB 2OMWA 1L7IH 3LQAH 4I4WA 3MCLL 2D31B 1EGJL 2R0LH 4BM7A 3QNXB 4QHMB 3C09B 1IEAA 5E6ID 2WUCH 1U8HA 1K8IB 2JKSA 5DFAA 3OR7B 1VCBC 3GGWB 3HC4L 2NQDA 4DSYA 2EIEA 5CS7A 1DEEA 3NOIA 1RKRA 4PJCB 3DJSA 1OANA 1J05A 3OHXC 1RVFL 2VLMD 4M48H 1OP3K 4PRDB 1AZCA 4HS6B 4XAWH 2EXYD 3AQYA 5C0CE 4LEOA 1QHQA 3RWHA 2NDGA 4PJ7E 4OM1L 1UWXH 4JFEB 4N0YL 4R90H 4WHTB 2NXYC 4QUOA 5GGUA 3W0WD 4DUWA 1MAJA 4LU5L 2JLPA 4NDMA 1GYWA 2MTAA 2CD0A 2DL2A 2O6EA 3VFRB 3DO4A 3L4YA 3IDMA 4ESKA 5BVJB 1R19A 1HIML 1W0VB 1C5DB 1LP9E 1V55B 3OPZL 4OI8A 2PW1A 2QVTA 1KGYE 2DQFA 3QZLA 3U0WL 4ZMVA 1YRKA 3D0VA 4I0PA 2OL3H 1BX2A 1JRHL 3D2UB 1MCKA 2BSDA 5KVMC 2AJXH 3ETSA 4XO5A 5DGQA 1IILE 1VGEL 1YN6A 2DYRB 2HT4D 1RJYA 1PLAA 3SE8H 1AP2A 1MCCA 2ZXBA 3S34H 1CDBA 1N0XL 5LGHH 3U6XA 1HKLH 5FYLH 4IMLA 3MV11 3SYAA 3BIBX 4P46B 5DO8A 3QYNA 1YUKB 2UWEA 2A74A 1A1NA 1G0DA 4H8UA 5C08E 4K8RD 2HT4C 2IDQA 3LS5L 4NRYA 2BY0A 3MACL 4XC3H 4DK6A 4M6NH 4H88L 5AOMA 3H9SB 3C2AL 4P23D 2QVFB 3DWTA 4XN1A 1N6QH 1UD8A 4E41A 5HHXH 2XKUA 1BIIB 3WKPA 1RZ8A 4P4KC 4KXBA 4EBQH 3W2DH 2Q20A 3FCBA 4P23C 4V2CB 3VB8A 3HCVA 4P5MB 4AZUA 3GMNB 2WKGA 4KQ4L 1AANA 2V5MA 4PJXE 1AZVA 3FQTB 1ACYL 2VLRD 3LXAA 4ONHA 5I74B 3RWGB 2RQEA 3KPSD 5DJYB 1LXMA 2QPUA 5BRPA 1AO7B 5KZCD 4EZKA 1OKEA 1XCTA 2G3ZA 2D2OA 3MNVA 2I60L 3IN2A 4KKZA 4B53A 1K4CB 1M56B 4PS7A 3CXHJ 4CMMB 2J44A 1MREH 3SGJA 2WZ0A 4E9RA 3U7WH 1DCLA 1TKWA 2B9AA 2GFBA 3NZUA 2SODB 1CN4A 2E9WA 4NN6B 5DFWH 3MCYA 1IBHA 2BWQA 2COVD 2ROYA 2ARJB 4MQTB 4QT5A 3S7GA 3F7RA 3W3BA 4I9WE 3DUHA 4PWGA 3BUQA 1Q0YH 4F7TB 5F3FA 2YD0A 3Q1EA 1UJTA 5BXFA 3H0TB 4R4FH 2YK1L 4OB5L 3SPGA 1R3HB 3RY5A 3QGVA 3E0GA 2B8OT 4B9CA 1I7UA 3VI3F 4APQD 2X0VA 1VKXB 1RZGB 2KERA 5IFAL 4Z7NB 4TUUA 4F91B 3QEGH 5BVPL 5EO0B 1XZ0B 3G6AB 3MO1A 1JXDA 1PIGA 2XWTB 3SD2A 5JR1L 5DS8A 3QCUH 3D85B 3O3AA 4YBHA 1UWGH 4APQC 1JZGA 1WP6A 1TLMA 4IDJH 2EYTB 2VZTA 5IROA 1KV7A 3BESR 2A38A 3LXBA 7PAZA 3E3QE 4R8WL 4I18A 1JYXA 3QI9C 2O5XH 4NNXB 2D2CC 4LBAA 4PIBA 4TQ8A 3SDDA 1XSIA 2V17L 4YE4H 1ADQH 1NFIB 5E5MA 2V8MA 3TZVB 1ZVHA 2V3DA 4H44C 5IOKA 4JR9L 3HFFA 2OMBA 4E0RA 1EHAA 3VO0A 1FFQA 1H8LA 1KIUA 5E8EA 2ZF8A 4OKVB 5F7DA 4OCRL 4MKTA 1WSST 4H1LA 4ONFL 1E6OH 1QLFB 3WE1A 3DDFA 4KK6C 3QWOA 4MCZB 1CD0A 1JGUH 3F7VA 3N41F 4F7CB 5FPIA 4MA7H 3Q48A 4N8CH 4HKZB 1YEGH 2ILLA 1S7UB 1IIKA 1KXHA 3MNDA 1ZCRA 3HFMH 4HJIA 3HE6B 4NJAL 4F9LC 2W38A 4FGMA 5TF1H 3QCTL 4R5XA 4YSCA 1OSYA 3U4EB 5KAQG 2NCMA 1C16A 1MAML 3X1GA 1R5IB 3J7HA 4KTDH 5HHVH 4TV3A 2QKIC 1RZFL 5E08H 1KEMH 3DV6A 2GW5A 4K73A 4Q9QL 1UD5A 3KPLA 2F8OA 3VAEA 3D51A 1E9OB 2XXFA 5E9DA 5I6XB 4N2EA 2MNWA 3MOAL 3GFUA 1GSKA 3LRLA 2EADA 4LPCA 3U7YH 1PS3A 1FCCA 4X6CA 1MLCA 1URIA 4J3UA 1BMWA 1N6VA 4MNHB 5ALCH 1F90L 1R0AH 2GEQA 1S7TB 5IMOA 4WFHE 2QV2A 3LKQB 5TFSH 4Z7AA 3T65A 1YECH 3PPEA 1OGTA 3P77A 3KS0H 1LYQA 4UQ2A 5M95B 4LLMA 1KBVA 4FFWC 2XHNA 1LE9A 4HCRH 3INUL 4GKNB 1AGFB 1FYTE 5DJ0B 4UUJA 2PWHA 5HDLA 2CJUL 5IVZA 1BVLA 2HH0H 3L3GB 2VSKB 1A7BA 3CPLB 4P5TB 5ICYB 2I69A 4Y2LA 5AFAA 5CUSL 3BRGC 5CJOL 3PHOB 2R8SL 3TH2T 3AABA 1AOZA 3T77B 1FAKT 4I0PD 3LZQA 4GQPH 1QACA 4Z9KB 4A39A 1ITBB 1IFHL 3LNIA 1WCBB 3PWJB 4LGPB 3W82A 2JFCA 3MRFA 3PXHA 2XRAL 4HXBL 3D34A 2BHUA 1A1OB 3SYPA 4UAHA 4ZDHA 4DP5X 1QBLH 1IBDA 4GS7B 4XNUL 5ID1A 3QEQE 2ZKHL 2AFNA 5DC4B 2FX7L 4I0PC 3AJ7A 1HQ4A 2XIBA 2G4GA 4MZ2A 5JYLA 3EYOA 2Z8SA 3LH9A 1IAOB 1CLVA 4MXVF 2UWEF 1KCVH 1KDJA 2VLJA 4XCYA 4W68A 5CGTA 2FWUA 1QBMH 1LO0L 3ZXAC 1GKEA 1IBYA 5IHLB 3PDOB 4XX1G 4D0BA 2JCCE 4YXLH 4E41D 5I71B 3L4WA 2PTVA 4K2UL 4UQDA 2AZAA 3HG4A 5IJVA 5J0BA 5DMIL 1B0GA 2CIKA 4MS8D 4AMKL 5JXAL 3DV4B 4AQ8A 3ESVF 1T5WA 2EILB 3HC0B 1Q94A 4DGWC 1LGVA 4Z7UE 5D70L 4F7EB 2P5EA 1FGVH 3TC9A 4FQQB 3HKZA 4OD1L 4QWWC 1RFDH 4BE5A 5BRZE 5F9WC 4PJEA 1G7IA 3V6OE 3I02A 2DMHA 4ZSOE 1B88A 3FO2A 1LDPL 4Y5VA 3VXQB 4K94C 3VRJB 5JPNA 3LEXA 1UGNA 1V7NH 2HT3C 1E5YA 2F61A 3K6FA 5HVFB 2XWJA 1MF2H 5LKNA 3BSGA 3E2HB 1U6AL 1ZANL 1KYOJ 5E6SB 1C5DA 1M6OA 1Y0LB 2R23B 1WA1X 1E67A 3D5OF 3K6NA 4KI5D 5F6HI 4CSSA 4M1CD 2IAMA 2AJ3A 4PP2A 4JO2L 2WYZA 1BYPA 5I16A 2TRHA 4PV9B 4KI5F 5EBWA 4MDIB 1A5FH 2WCSA 1XGYH 1F13A 4N6RB 3APNA 4JVPA 5CLXA 4NKMB 2R7EB 1FGNH 1G6RA 1HXKA 4NN5B 4KITB 4GBXA 3WY3A 3UEZA 2EC9T 2YZ8A 2I7OA 4F37F 2E3VA 1PEZA 5KOVC 4YL4A 4F8OA 4DZ8B 5FXCH 4IGBA 3MRQA 4R97C 4WFEE 4OF0A 5IW6A 3MUGA 1PSKH 2ESVB 2GC7C 3C12A 4RFNC 4EDXA 3MA7B 3MN8A 1VFBB 2FECL 3CDGA 3P2BA 1JYVA 1XO8A 3MGOB 3IMUA 1F6FB 5IROD 9PCYA 4OU3A 4U6TA 2AGJL 3TYGL 3LZFL 3OWRA 2IO5A 3SDDD 5LAXA 2WANA 1FG2A 4LCWA 1K5NA 3L4CA 3RDTB 3MRDB 4Y4FB 3MRPA 5DMGD 4ABQA 3VH8G 4KNSA 3VRIA 1H9DA 1MFMA 1DN0A 1PZSA 4I18C 4GXUM 2XQ0A 4LNVA 3T4YB 3D3VA 3WSQH 3SDDC 4UQAA 5EB9A 1T0MA 3VFOA 3OKKA 3FMGH 4EKXA 1NWOA 3SQBB 2E7BA 3EH4B 4HT1H 1J1PH 1R6VA 4NUJA 1X5MA 3WJLA 4DIXA 3L17A 2MCPH 2AK1L 3NRPA 1JXJA 4LP8A 1DVTA 3FJTA 4LRIA 2OULB 5IQ9A 1JTOA 4TRPL 1A9EB 1JUFA 3NIDB 4PRHE 2KLTA 2NQ3A 4PY7A 2V2WA 4NO3A 3UYRL 2FD6H 4PG2A 3QXWA 3QJFA 3FN9A 2CR0A 4XXCC 3GRBA 2CKBA 1DSWA 5C0IA 4Z7OB 4AJWA 2OTWA 4YHKH 3TCTA 2Z0UA 5IW1B 2YFNA 5FOBA 3PABB 4OZHB 3WLBA 4YPGA 4UMGA 3NZHH 1G7PB 5EOQH 4OV5B 3HMWL 1IFRA 2UUDK 5E9DD 1HSAA 3A4DA 4NQSA 4FXKC 3WGUB 1U2CA 4HUCA 1EDQA 4LP4A 2WXJA 4MWFA 4BXSV 4DCQA 4KO6A 3ZRFC 3OTTA 3QFDA 5EC1A 4JX0A 5JW5B 3HVNA 4U6VH 4X6CF 3VFTA 3PWVB 3ULVF 1OF2A 1WZ1L 4KTEH 1Z5LB 5C0RH 1XMEB 4WFGE 2MMXA 3BYYA 4LKXB 4PV8B 4AGOA 3F7QA 1UACH 1NOFA 2FT7A 4G6FB 2ZCLL 4P5KA 3ZGHA 2JKJA 4ZZKA 1YDPB 4ZPVA 4POYA 3MGTA 1FL6A 4BRVA 2VT0A 1LO4L 2Z0BA 5DJ6A 3MZGB 5LWYL 1N3NA 3FUMA 4FP8L 3L4ZA 4JE0A 2QQQA 2XX1A 3Q8CA 1JP5A 4F93B 5KYXA 4A2LA 1ZJAA 4LDOB 2QSQA 5CIPH 5GSRB 3WAJA 2NSQA 3BKCL 1I75A 3BAYA 4NQTA 1KN2H 3CVHB 3D69B 3PV6A 5G4NA 3GLAA 2IOMA 1XF5A 2BY2A 4O2FA 4PREB 2DJMA 2FTAA 3IGLA 4X7SL 2P9RA 2BHFA 4L29B 1HCFX 1UWXK 2YOAA 5D9SB 3WIAA 1UYWL 3S5LB 2VLJD 1ID5I 4U6YA 1PCXA 1FRGL 2DW5A 4U1HA 1BCIA 1AI1L 5EBLB 2PYEA 1CQKA 1QFOA 3IFLL 4S1RH 4L0ZA 5KJRL 5KW9L 4TVPL 2DLFL 1UXSA 1OOWA 1GGTA 1NOAA 4F7MA 2WVTA 1JWMA 5LXVA 4HC1L 1OT4A 3GBML 4OT1L 4Y1AE 2XN9A 1NC2B 4NNPL 2P5ED 3HAEB 3HZVA 1J5CA 4LDEB 3TURA 3S37X 4EN2A 1QKZL 2NYZA 5AW7B 2DTML 5EU7C 2R2EB 4PJ5E 2R1YA 4R84A 1NCWH 3FB8B 1DBAH 2YSTA 3FUJA 4KXZI 4RBPK 4PJEF 5F93C 2EECA 1ZS8A 4PSRA 1EHLL 1JZ3A 2WXNA 5K9OB 2NY2C 3BZ4B 5FGBA 3UEQA 5DDHA 3SGDI 2RALA 4Z7WE 2QFPA 4JFFB 1CXFA 3IS1X 3ETBF 3LHPH 1KXTB 2WCPA 4Y5VC 5E9NA 2UXVA 2IAMD 2L04A 2RACA 3A4AA 4IIZA 5FYJH 3VWJB 4MB1A 5EU5B 5C09B 3DGCR 4YSPA 3F8UB 3IB4A 2IPKB 3QFJB 3ABLB 4YHPA 4AIOA 3DROA 2WLKA 4B96A 3HPJA 4JFDE 2XWRA 5L4MA 2EDKA 4NKQB 2C9RA 4LOVA 4LHUA 4XPGH 1MWAH 5CP7B 4GBXD 1EXUA 5JMRA 3DSFL 4OZGA 4P2YA 1BFOA 2FO4B 3P3UA 3FNKA 4BH8A 4DZBB 3B2DC 2E7LC 4J8RB 4IGBD 2YWYA 4PTUB 4PJ8C 4GBXC 4L8CB 2GTZA 1BEYL 3REWB 2PKDA 3HIZA 4LCUA 5DJZA 1S7SA 2DYPA 1OGSA 4RRPM 1JNLL 4IGBC 3NPSC 4QRPA 3MKGA 3WN5B 4YUEL 1D9KA 3TU6A 1KFAL 3BW9B 1LQBC 4XOBA 3Q5OA 5KVEH 1TO4A 4LCWD 3ARGA 4LF3A 1IGYA 3EZ8A 5BS0B 5I1IH 2ZQKA 5LDSA 1G7LB 3FFCE 3HMXH 5KN5A 5FAAA 1TEGA 1W72A 4PB9H 3D3VD 1NAML 5IK3A 1VESA 3VXQA 3CCHA 2TAAA 3DHUA 4JDZB 4O2EB 4YSEA 5A3ID 4BK4A 2CXKA 4LLQA 2A99A 2OI9C 5L4IA 3HC2A 1KGIA 4G8GA 3ZKSD 4CBZA 2YPVA 3NJGA 4JFQB 4JPSA 4FN0A 3DPDA 1NJ9B 4OLXH 4XPHH 3R0NA 4L4TD 3V6FB 2KZBA 1KCLA 2A6KA 4FQ2H 1U41A 4PVMA 3JWOC 5DJAA 2VW6A 1P5UB 5E4IA 2IH1A 4P3WA 2CAKA 3F6JA 1L0QA 1FC1A 1Q4NX 3WJLC 3T0XA 3FF8A 3NIGB 1PL3A 3ZL4L 3QDJB 5I1KL 2E9JA 5CCKH 5DRWA 3BAJA 4PJDB 1A64A 4JZOA 3PAVA 2VL5A 4GRWB 5DWUH 4YIQB 1JN6B 4I0CC 5FC9A 3A21A 1D7BA 5A6LA 4PG2C 3EHBB 4XRCA 3DMMA 1B3IA 1SJMA 3L6FB 1EZUA 4P06A 5E00A 1KSRA 3VG9B 1F42A 3WE6B 5EPMB 2YA1A 1UFGA 1BAFH 3IDGB 1FVCA 4XMZA 2K6ZA 1SMOA 4HFWA 5DLMH 4AENA 4BSWB 4I48B 1AD0A 4X80H 5JOFA 5F70A 2A6JB 1T1YB 4MB4A 5HSFA 2ARJQ 1IKFH 1PPIA 5I1AB 3MNZB 3KYAA 2A0LD 3VD4A 3TEYA 2PYFA 2QQKL 4ZNEE 3WFEL 5MEQA 3VFGL 1Z2KA 2FL5B 1THAA 3BMVA 3OX8B 5FB8B 1DQTA 2OKMA 3ZO0A 4DGIH 3ARPA 2XTLA 5J56B 2WBKA 3PE9A 4A7VA 1UCBL 2EDQA 4M5ZL 5D1ZA 1YEDB 2PCFA 3WUWA 5EF0A 2WWKO 1IM9A 2ICWB 2EDEA 3ABMB 2A6DA 4ZS6D 4G6ML 5E8DH 1C12B 4HK0A 4DPAX 4TVPE 3QUMA 3V0EA 2XX0A 4EN3A 4UM9A 4YDIL 1IQWL 2ORBL 4KKAC 1KJ3L 2NY6D 4I89A 1T22B 1RK1B 2E47A 2HTLD 2P8LA 3CH1B 4G42A 3TO4A 3X3GH 4ZS6C 3QS3A 1FNGA 3FCSA 1K3IA 1TF4A 5F7EL 1KCSH 2J6EL 5CO1A 5FUZL 2NY6C 2P46B 4M7LT 2G9HA 2H32H 1U95A 2CO6A 1F4YL 1UADC 2PYED 3G5ZB 4TSAH 2Q7NA 4KK8D 4LPYA 4PJBA 5LCVL 5IMLA 1FNLA 3V7AG 1R33A 3G5YA 2HX8A 1LJMA 1YEIH 4ONGL 2X1OA 4PSPA 3CLWA 3BVWA 1EJOH 1IB5A 3EDEA 3UAEA 3APFA 3WFDH 1W0WB 1HOCB 2BOCB 4LQFL 4HJTA 1PKQA 2XN9D 3NCYS 3SB3A 3QHFH 4BWWA 1UM4L 4KZDL 2B1OA 3CDYA 3W39A 4A63A 2IWEA 4FFYA 5GHWH 4Z3HA 1A7RL 4BKSC 3VGDA 5K9KB 4LLYA 2EVHA 5T5NG 5C0AA 2Q7YB 1E8YA 4HALA 4NFCA 4PIRF 4W9LC 4WI7A 1WAEA 2FH8A 4PCKA 3QEHB 2CO3A 2Q7AA 2MQCA 2H0JA 5CSBA 1IGFL 4ORZC 4TUJA 4B27A 3GYRA 3KG5A 1FVEA 2DPKA 4DQOH 3MXVL 1RIUL 5FA4A 1L5GB 5I1CH 3MUHL 4WK4B 1CGSH 4UTBL 4QXWA 4XC1H 2J3SA 5AKVA 4G9FB 3D87B 1D2PA 4MMXB 1S3KH 2WYHA 3O2DH 3B34A 2YQ3A 4HS3B 3X1NA 2J4WH 1C08B 1DJIA 4X6FA 4F2EA 2AQ1A 1A2YB 4XP4H 5G5DB 4MAUL 1PLCA 4O02A 4WUKH 2C1PA 3US0A 1U3ZA 4LHUD 2FBJH 3ZR6A 2V9UA 4XXDB 4KDWA 1PLGH 4YGVB 1MPAH 1YPZE 3MCG1 1NKRA 3BSZH 1CLZH 1D2OA 2WLLB 3A6BL 3HC3L 3RRQA 1QVOB 1TCRA 4FNLH 3FU7A 3N1MC 1QFPA 3ECVA 2DKMA 4D0CA 1KT2B 2YD6A 2DYPD 4UM8A 5E9AA 6TAAA 2NXYB 4MNQE 1XGQA 2GPZA 3E8UH 4QRPD 2VAJA 2VLRE 3FQRA 1D9KD 4O51A 1KGCE 3QARA 4DW2H 3UACA 2QR0A 1S9VA 4HSQA 3ARGD 5D7SL 3QUXC 1DQDL 2H2SD 3QK0A 3SE4C 1TDQA 3LKNA 1D9KC 2QSCL 3KVQA 1FCGA 4UV4L 2VC2H 4TPRL 4JM4L 1YQVH 3AB0C 3BP7A 2WZ6A 2GHWB 2CM6A 3ARGC 4YWGH 5I1EL 1NBYB 5F1IB 2H2SC 2F7RA 3FB6A 4YDVB 3QXDB 3BCDA 2YEQA 2QADD 1HAUA 3WIFB 1NBQA 1KIQB 4G8GD 3OKOB 4FQIH 4GUPA 2V2TB 4JFYB 1G6VK 4H2CA 1CWVA 3FQUA 1MH5B 3M1OA 4WCYL 5BV7C 4M43H 2WWMD 4FLRA 3LJ3A 3SKUD 1CYXA 2LT9A 2QADC 4RRPA 2NTSP 4PS4H 4GW1A 2OXHA 3FOLA 3L4TA 3GSNH 3DVNA 1ED3B 4FQCH 3U46B 1OPGH 1TTRA 2WWMC 4P4KB 1SQ2N 3ZZLA 1YAZA 4GW4A 4UU9A 2M83A 1P4LB 1KB9K 1NMAL 2X4NA 3L7FB 2JCWA 3DMMD 2IIJA 4HQQH 2DQIH 2PP8A 3VX0A 1CMOA 3I3DA 1SYVB 4JFUA 1PY0A 3A4EA 3G6DL 3WG7B 1T4WA 2Q1EA 1G5AA 3II3A 5E94A 2OL3A 5HGHA 4KHXL 3QZWG 2F53A 4K5PA 3P73B 4OVUA 1QP1A 4O58L 3V4UL 3V4LA 1MRCH 1F45A 3VFVA 2A9NH 5MP6L 4AV0A 3DMMC 4QNPF 1IC5H 1UB5B 1K85A 1GXEA 3HI6H 2EDJA 3TVMB 5IJCC 1LNUA 4A38A 4M7JH 4S1DC 3CVBA 1HZHH 1OM3L 1HESA 1SF3A 3K71B 5A2LH 1QO3B 5J4MA 1QQDB 5IMKA 3S36H 4EZJA 1J9RA 1I8KA 3TJHD 1CT8B 2NY5C 1WFIA 3IXTB 5D1ZD 4NIKB 3KWWA 1CL7I 1WEJL 3CXDH 1NCNA 1IM9D 3JVGC 1Z5HA 2FHCA 1CLOL 3R1GL 5DHMC 2R59A 1M05B 3UDWA 4EN3D 4UM9D 2R1XB 3TJHC 4ZW3A 2WWOA 1MEXL 4KHTH 2PXYB 5J6GA 2GUOA 4MB3A 2CBOA 3TO4D 1L0YA 2AVGA 1QSEA 1OY3B 2JB6B 4EN3C 1X44A 3AG3B 4NQEA 5I1DB 2XXCB 1J5IA 2ZCZA 2BJML 2Y7OA 3WJMA 3DX9A 4XBEH 4EUPG 4O4YL 3TO4C 4LLVA 4C8XA 2B15A 3RBSA 4XVTL 2WHVA 3QI9B 4HKXB 1DJHA 5F9OH 5FYJU 4CL7A 1XIWB 2EKSB 1KCUL 1YEHH 5JHDA 1P7KB 2IALA 4PJBF 1LMIA 4OZHF 3T6VA 5IVNA 1QA9A 4WI0A 3O45B 3MI6A 2YARA 4NGHL 2HPTA 4M3KB 4IMKC 4CILA 2XG5B 1JFQL 4W9EC 5AYTA 1NCCL 3FRPB 4OF7A 4H8WC 3ZE0F 1IGJB 3H1ZA 1M7XA 5C0AD 4JHWH 1LTXA 3LIUA 3KPPB 1RMFH 5TE6H 1JPSL 4MJIB 2VTFA 3MUUA 4RGNC 4OM0L 5TDPB 1G94A 4HZAA 4AYID 2IWGA 3ULVL 2OMVA 1EAPB 5D2NA 2B4CH 4YDJB 1EEYB 5D72H 3FPYA 4CN6A 4N0UB 3MBWB 3NIFB 4PJAA 2MIZA 1P9MA 5MENA 5CSGA 1SEQH 2EIZB 1SY6H 1UXLA 5E51A 3DO7A 3QAQA 3QO1B 2BC4B 3EO0B 4MXVE 2HG5B 1FPTH 1CDCA 2CRMA 4AEIH 1MFBL 5E24E 4N0FB 5AW3B 2QVKA 4PYHA 4LLDA 3DXAB 3MRMA 1DBBH 3HRZC 4QRSB 1X4ZA 1DQLL 1CFTA 3R4RA 1HH9A 4P59L 2A4ZA 1KV3A 4HUWA 5C70A 1QLEB 3VSUA 2XUWA 4HIHA 3C5SB 4QHLB 2X3CA 3HS0A 5AOLA 3C08L 5CEZD 2CLVA 1YEFH 3CMOH 3ALXA 1RQ5A 2WNXA 4G8FA 4HX1A 4NZRL 2VNCA 2L7EA 1QPKA 2XA8H 3KR3H 4BELD 3GSXB 3NTCL 4DKFL 2N7AA 3A0OA 1CK0H 5JUEL 4Y5XA 5F7HA 3MRKA 4N5EC 3ZMNA 1NKOA 3BWAB 1OAKL 3CZGA 4NJ9H 4NWTH 3GLDA 4ODUB 3VXRE 4Y1SA 4HAGA 4P2OC 3O8XA 4OCWL 5FUCE 2JKNA 3SDAB 3WFBH 1U3HB 3TTYA 4ZX3A 1KLFA 1JNHB 2FR4A 1NL0H 1AG6A 2O6PA 4P2QB 4HPYL 3VACA 1HZLA 5JW4M 3ARYA 4PEEA 5IQ7H 2Z64C 1TYEB 1VGKA 1U91B 4XP6H 3B9KC 5B39G 4KI5E 2FJFB 3LQAC 4P0DA 3JV5A 5KS9E 1BLIA 1WV7T 1QAWA 4WO4C 1Z3GH 4PRBA 5GGVH 4F7KA 4XMLH 5F7WC 4RZCA 1JTTA 1ML0A 3IXAB 3MJ8A 5AKSA 3UC2A 4K3DL 3NG5A 3MBEB 4YVNA 2C3HA 1I31A 1UD4A 4MZIA 4JW3A 4KPHH 2WLIA 3X11A 3PP4L 3KLLA 5ADPL 5J9PB 2E8YA 2ZNXA 1I9RL 4HCRA 2FX8L 2JK5A 1ZE3H 1H6TA 1KC5L 4H8PA 4UILL 2X41A 3L9EA 5A2AA 2EIBA 4UINH 4ZTEA 3F62A 3KPMA 1WS8A 4XNXL 4B50A 1J1XH 4WSJA 3ELAT 3VJ6A 2NT1A 2F53D 1FL5B 1LO3H 3PGCA 1QWUA 3GDCA 3DSNA 2D7QA 2M8XA 4HIJA 3TM6A 4A6YH 5JXEA 5KVFL 3MLVH 2BIOA 3VXMB 4S0HA 4PBWD 3PGFL 1D7DA 3CFCL 4G43A 2QGBA 1J5OH 4TNVK 4D2NA 4Y7MA 2CJ3A 3L7EB 3NCXA 1ACXA 3T6XA 2D4FA 1INQB 1QUNB 5TK4A 3RVVD 2CGZA 4CVXA 1J9TA 4F1SA 4NB7A 3MAWA 4Y19B 4EKJA 2XICA 5DEFB 5CBAA 1P6FA 5I6NA 4B3VA 1QFUL 2IFFH 1S9XA 3KL5A 5D6CA 3BH9A 1T1ZB 4TLTA 2C9VA 4JDTH 3BKJL 5HYSB 1R5VA 3DOSA 4XTRD 4CN1A 3RVVC 3WIIL 4EUPH 1HNGA 4JJHA 1SJHA 2I7SA 1U9KA 3MA9L 4PJIA 1KY7A 5D7LA 3CHSA 1PFOA 3D39A 5I0ZA 3CFKB 1T4KA 2VQTA 4KO7A 2YLKA 1AS8A 1X5GA 3U6XS 2E59A 3SCMB 5C6TH 1IKNA 4XTRC 2E27H 3GXUB 4A66A 2AEWA 3FSWA 5KOMC 1IKOP 4ZO6A 1QSED 3MLPA 2WQAA 3UDWC 4NQED 1J87A 1WCQA 4BFJA 5FM5O 4PYGA 2Z7WA 1TZAA 1OPOA 3NJNA 3EYUH 3RFZB 1IBBA 2HJLA 4DEUA 2NNRA 2YEZB 2XZAL 1NEPA 3FU0A 3ULVE 3MJ7A 2D03H 3H9HB 2G5RA 5I8EA 2D0HA 3AU0A 4FEMA 4D9RD 4L48A 4E9QA 4YPJA 1I8AA 1FNEB 2QPEB 4O9HH 1BFVL 1A6ZA 2ED9A 2QVMA 1AXSA 1DP0A 4I3RH 2JLLA 4X5XA 2OSYA 1Y7VA 4JPKH 5I82A 4LVEA 1G9EA 1WC7A 2ITDB 1IAMA 5I1LA 1QR1B 2V7NB 2FJHA 1TO5A 4X6BA 2BCKB 4C56A 3ILDA 3JTBA 2IADB 4BDVA 2GB2A 4G1MA 4Q89A 3R19A 3DETD 4QOKA 1KN4H 3CK0H 3B3IB 1CLYL 5MEND 4A1RA 1EAOA 3QXTA 1PW3A 4WEBL 5DRZA 2VIRB 2DQHL 4PJAF 4P9HL 4C55A 3BKYL 3ZZQA 3DETC 2V3EA 3QJHB 2BPBA 4TOYL 5G4OA 3TIEB 3KYOB 5JTWA 4KNUA 2GABA 1QRNB 1XGZA 1YNTB 2QZQA 2P24B 4UTAL 4FXKB 1TEFA 4CVZA 4LB8A 4QLWA 1KTCA 4P2CG 4NO0B 2VXUH 4NWUH 5HD8C 5GIRA 1ORSB 1FUNA 4OJCA 1EXGA 3I6GA 5T1LA 1KTBA 4OIBA 1EEZA 1T2XA 1B6UA 2Z35A 6PCYA 3ERXA 4Q9BA 4BQBA 3D4GA 4HIIA 3O6FB 4EPSA 5ES4B 2QZ5A 1BYOA 5MI0C 5F71A 1TETH 1WE5A 3T1FB 3HS0C 1L9PA 4GYBA 4QXUH 4OZFB 1EO7A 1G9NL 3TNNB 2B1HL 2I5YH 4PJEE 3O8XD 3ARQA 4L4VA 5HHPA 3BIKA 4Q0XH 1U0QA 2DQTL 1FZJA 4JFEE 1N8ZB 3UJJL 2VDPB 1V7MH 3D0LA 3D05A 4BK5A 1JJUA 3HPLA 1TZHB 2X9ZA 1P1VA 2C9UA 1T3FB 2APBA 3ZJAA 1YMHA 1MVFA 3MXWL 4YE0A 4NP4H 4PW4A 1AGCA 1C7TA 2DI9A 2FIKB 5L7XL 4KKPA 3FO0H 4RCAA 5CINH 2BS9A 2QMKA 3QVAA 4X7TB 4FYTA 3STLA 2APSA 2CDGB 2Z65C 1FAIL 4JKMA 1SJXA 5F44A 4FTVA 4XAKE 4WWNA 1M42A 3BLKA 4Z3IA 2XV6B 3GBEA 5C97A 2TSBA 1WWCA 3UZQB 4H26B 2ZX8A 1XVSA 4YX2L 3FONA 4NQDB 1SHWA 3CD4A 3RIFK 4ADJA 4M5SA 1OM9A 3PF2A 5DURB 5KVFE 5DR5H 2D7TH 3OL2A 1BECA 3VFWA 1P7HL 4FRWA 2ZAHA 3UZEA 2VQ4A 1M6UA 1U8PB 3H9SE 3GBNH 3UTZB 2ZYRA 1A66A 1NCOA 4LNRB 3TPKA 4P3DB 4Q9RL 3UJTL 3SKJH 2E7MA 1H3PH 2WXOA 3QW9A 3R0MA 4X8XA 3BFWA 1GC1H 3X12B 4OV6F 4PGJA 3CDFA 1E4XI 1AZNA 2Z6FA 4W9GC 5JXED 2WTRB 3TBVA 3O3EA 3V4PB 1KBPA 4TQEH 3JV6B 1AQKL 4LEXL 2NY2B 4YBLC 2PW2B 5BZWA 2E7HA 3UBGA 2HT2C 5DJ8B 5L2JB 2OX5A 2OS7A 5HHMD 2BSEA 1AO7E 1CB4A 1U3NA 3GDBA 3BN9D 4XCCH 3JYBA 1N2RB 5F88B 5JXEC 1I9JL 2EDOA 3CLEL 3VFPA 2HCZX 4GPVA 4OCLC 5FK9B 2WXRA 1KPUA 5FKAA 1OP9A 3SBWA 4BUHA 1A9VA 4RIRB 4HHAB 5H35B 2BSSB 3P0VL 1XCQA 4P3CL 4GY4A 4WI4A 3NDZE 3WTWA 2XI9A 4DP2X 4L1LA 5D7LD 1J10A 3D39D 4YBQC 1KB5B 3LEYH 3LNGA 2XV0A 3NCYP 5D5MB 1RUML 5LBGA 5KSAA 1OALA 1YVLA 1AXTL 3LKPA 3S3CB 3KMDA 4PJ8B 3GJEB 2X12A 3BPOC 5BW7C 3CX5J 3NFNB 3PWLA 5G55A 3R8BB 3TV3H 5AAWA 1WGVA 3ZPDA 1IKNC 4Z1PA 1S9WB 3MLTB 1SEBB 3NPSB 1RK0A 1Z66A 2WC7A 3SY0B 1HCYA 3KHQA 4AW7A 1L3NA 1QSFA 3D4YA 2OQJA 3NSYA 2GJZA 3SDYL 5E8NA 1FP5A 4ZMYA 3PQYB 4HJEA 1KOAA 2AI0L 5D7IA 2CLRA 1E28A 1MG2C 1CF8L 1OAXL 5LG1A 3T3MB 2QHLA 1OV8A 5KBDA 3CDZB 4LAJH 4MMZA 4V1DA 3EYVA 4QRQA 3G6JA 2OI9B 2R69L 1MWAA 1ORQA 4C56D 3IDXH 4KJWD 5GRZA 1JS4A 1JVKA 4IRZL 3U0TA 4Q6YA 3SGEH 3IFOB 3ILPB 4P99A 2LTQC 3ROOB 4QOKD 4W9CC 3VH8A 1DDHA 4HIEB 4MYWB 4Q2ZA 3TBSA 4AQOA 4A2MA 5EEUA 5D7EA 2VXSH 1T6VN 1TJIH 1E42A 4BFIB 5E5UB 3W9DA 1MCOH 2YMTA 4X99B 3QQ4B 4OQ1A 1T1WA 1JZ2A 1QHPA 2Z91A 3B7UX 5FYKU 3RIAF 1MFAH 2VO8A 3BPCB 2ADGA 3WS3B 3C60A 5DJDB 2HVJB 1GZHA 1HHGB 5F3HB 3HG0A 1SOSA 3GBDA 2XCMC 1XEDA 4DVRL 5LQBL 4DERA 3ZRSA 2HFEA 1XGRA 1MWOA 5EZIH 1ZWIA 5FGRA 4XCNA 5IEKB 1RUKL 5T1LD 3V8CA 2B14A 3ZGIA 5FHBH 4G8AC 5D1XA 2AJVH 1MCIA 3V0VA 1FNSH 3H8NA 3FO9B 4FABL 4GIAA 1J5HA 4AKPA 2F1BA 3REVB 5FO8B 5KAQF 5EOTA 3W37A 2BNQA 2V0AA 3OKMA 5BQ7A 2ZX5A 2DV6A 4LPVA 1QI3A 2XWDA 2BNRA 2VLLB 1K2DB 2UY6A 2Z4QB 3NFPB 4LBEA 1A9BA 3QUGA 4H0HB 4L4VD 3BT0A 1F6LL 4LL4A 1FVDA 3O4OC 3OKLB 1RZJH 4XOCA 5KYUA 3VXTB 1FG9C 3I6LD 1QYGL 3Q7JA 4YSAA 1JWUA 2CUHA 4EIUA 4YNYA 2XQBL 4H7VA 2FBOJ 4ZAKA 2B59B 4Z0XA 3PRZA 4JPVH 3JTSA 3SPJA 3CC5B 2Q2EB 2UZPA 3QWNA 2YWZA 4MJ2A 1YSOA 2NX5B 2F6AA 2WVVA 1OAYH 4WUUA 2N7BA 2ZSVA 2DWEB 4UT7L 4DUXA 2AABL 3PIQA 2EDLA 4FTVD 2QLYA 1CXKA 2H9GA 1UH2A 1AKJB 5DEGB 4HJSA 2G3XA 2GITB 4HEMA 4NENA 1VAHA 3H85A 5FW8A 1E4KA 3KXFA 4TVSa 1N7MH 1JHLH 2HTKC 3AREC 1VFAB 1FNHA 5C1MB 2P7TB 3K4DA 2FECI 2X9WA 2D7PA 1SM3L 1G7HA 2DJSA 4M62H 3QEUB 1IAIL 3AMLA 4ZMWA 4XB8A 4YHIA 2VITA 1IEBB 3WHXA 1R3LA 2GJ6B 2X4RA 4K23L 1I1FA 1QFWI 2XN1A 2OM5A 4TLKA 2MKWA 3CVHL 2WK2A 5FR3A 2UY7B 5MERA 2XY2A 3AG1B 4UQBA 3C8KB 3OLIA 3BPLC 1MFVA 4F8LA 3RDJA 4MXQD 1E4JA 1RY7B 3DARA 3ZBMA 2R51A 5JORA 1UJ3A 1EAJA 3AWEA 2BSED 3P9MB 4RWYL 3DUSB 5A40E 4NZFA 5AAPA 4HCIA 4PM1A 4HPHA 1JHKL 1F4WL 5A2CA 3DJZA 2V7HB 1JWSB 4OCXL 2P8PB 3L5JA 5DHYB 8PAZA 5DQJA 4AEFA 3QFGA 2H32A 3L3JA 4NZUH 2F58L 4NAJA 4LQ1A 5T1JA 1M4KA 4FYSA 1CXLA 1GGBL 3SBPA 2CDEB 4G7VH 4GKZA 3GTVA 3FAWA 1G5GA 1G7QA 1XSKA 3UAJA 1TEYA 4DGVH 3LV3A 3NMEA 4HGKC 1F1AA 3QUYA 4L9LA 3DX6A 3GMMA 5AUMB 5HDOA 5C9JB 4G1EA 3R18A 5KSAD 5HY9B 5DZAA 1NCAH 5AB0A 3H53A 1GS8A 3DA0A 4X4KA 3S3SA 1WVZA 1XTLA 5IJKC 2RH0A 3VI4B 2FSDA 3CGTA 3JUZA 1CR9L 3DUUA 2H8PB 4IIQB 4G7SB 2QPFA 5DD6A 4G7RB 2VABB 4W9HC 1AGEA 3L5XH 2LV4A 2IAAC 2VDKH 3EYQD 4UZUA 4XMKL 1IEHA 3IDNB 1RUPL 2ZF9A 3J27A 2A77L 1TZGH 1TMQA 2BVOB 3DBXB 4AE1A 4XNMA 3HKFA 1QW9A 3C6EA 4FQ1L 1QSFD 3C9NB 1H3VA 4TLSA 2XBTA 1CFMA 3QUXB 5AAWC 3VMPA 4FG6D 3P2TA 2MOQA 2P47B 4ENZA 3EYQC 1N70A 5FYJD 4NO5A 2G75A 2JB5L 2DLGA 1BZ7B 3ZT7A 3F5WB 3O2DA 3ET9F 2HXAA 2HRPL 4FMVA 4OFQA 2XWZA 2BMKB 4WDIB 3ML9A 5HJ3A 4G82A 4FZ8L 2J7LA 3KW7A 4FG6C 4HZLA 3KBFA 4V1DD 4MCMA 4XNAA 5GS1A 3HBGA 3CFTA 3IDIA 1HNFA 2AEIT 3LN5B 1HI6A 4JLRB 1OTUD 3H2QA 4OUUB 2KC0A 5EUOB 3SPHA 4XBGA 3IGAA 2W5PA 5C86A 3OGCA 3HLAA 3QQDB 4QYOA 3BSZA 4JFZL 4MMZC 5BV7B 3MROA 4YHOL 3K8LA 5F0JB 1G9MH 4OFIA 4EEEA 1GZPA 2VR6A 2EZ0D 1TJHH 1TNNA 4UDUB 4PJFA 1KJ2H 2XBZA 3U83A 1AH1A 3WJJC 5HI3C 4HHWA 4XCEA 4MBOA 3C60D 4CNIA 2ZTBA 2NDFA 5SWZB 2F8IA 4TNWF 5LUMA 3NIDE 3A5VA 2EZ0C 2Y6TE 2AJSH 2W9EL 2ZUQC 3IT8D 2B1AH 2CGYA 4Z7OE 3C60C 3DKHA 3MRBB 4QKTA 2UVEA 4OZHE 1GZHC 5J1SC 3U2SB 4QTHB 2QDVA 1ZD6A 1N26A 5E2WH 3SQOL 5D1XD 1PAMA 4JN2B 1VPOL 3OAUH 4NM4H 1EEQA 4DTGL 2I32A 4HOWA 3MLRH 2BNQD 4BQCA 1VADA 2IF7A 2AJYL 1J1OL 1NUGA 2BNRD 2NXZD 3GRWH 4Y2NA 4ISVB 3U6RB 5D1XC 3BZFA 2ATPB 1HL5A 2OJZL 2KHAA 1L0XA 3UBXB 3R06B 5IHBA 5MEOA 1FORL 4KJPD 1E40A 1TNMA 1FF5A 2VXVL 3KCPB 1O6SB 2H1PL 3GSNA 4NQCA 4XP5H 1MCWW 1NUFA 1DQQB 1GS7A 1XQ4A 2FUTA 1T20A 2JTDA 4ZAKD 4BCXA 4U6HA 5AVQB 4LOFA 4KJPC 1E5AA 4UANA 4YSRA 1DUZA 4OZ4A 2OW7A 5CKAA 4WUUD 1JDAA 1JNNL 3OJVC 1YN7A 1J0HA 1S7RA 3VNYA 1FSKB 5AZEL 3PHQA 2VXQL 4U7MA 1Z9SA 3QCVH 4WJG3 4DP4X 3F58H 3RHWK 3KXFD 2YD8A 32C2B 3F3HA 1E7VA 4Z78A 2CHWA 1Y18B 2YD3A 1TPXB 4L3EB 3GMRA 3MCLH 2C4FU 1LD9A 4OLWL 1EGJH 2X42A 1UQSB 3QNYB 3F04A 2C7FA 4IEFB 1UUNA 2X70B 1AIZA 1TSHA 1Z32X 2ZUYA 4Y88A 2E74C 3EJJX 5LNEA 4IKNA 3L5IA 3BH4A 3HC4H 5DUML 2IH3B 4J3OG 1KELL 5F8RC 1YEWA 5GGRA 1EZVX 3NZ8A 4Z5RA 1RVFH 2K1MA 4JPIA 2ADJB 1HX0A 1HDMB 4PWEA 4YR6B 2VRAA 4RGNB 4DAGL 3B5GA 3LKRB 3ZHNA 1PYWB 1MJJA 1CZ8L 2E6PA 2J73A 4OM1H 4WW2B 2IOOA 3FHAA 4N0YH 5MHSE 2GC4C 4KKCD 4MAYB 1ZXKA 4M93C 3V9EA 4NNYA 4NCC2 1KIPB 4DNLA 3QDHA 4LU5H 1DHKA 3HNSL 2EYSB 4XH2B 4WV1A 1I3GL 5JDSB 2GI0A 4P57A 4K15A 1I1CA