1ET8A

Crystal structure of nitrite reductase his255asn mutant from alcaligenes faecalis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
339
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPNLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Catalytic roles for two water bridged residues (Asp-98 and His-255) in the active site of copper-containing nitrite reductase.
pubmed doi rcsb
total genus 88
structure length 339
sequence length 339
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et8A02
2XWZA 2FT8A 1EZLA 3IEAA 3EHBB 1ZDSA 3GYRA 1I53A 3T6XA 3EF4A 4GXFA 2QT6A 2ZOOA 1PAZA 4GP5B 2UXVA 1MDAA 1MG3C 1URIA 2HRGA 1NIAA 3T6WA 2BWDA 1JERA 1AACA 2YAFA 3AG4B 4E9VA 2Y69B 4DPCX 1AZCA 1GS7A 4N8UA 1NDTA 2VSMB 1PZCA 5B7EA 4GP4B 3NP4A 3ZDWA 4KO9A 2VW4A 3AG3B 4A2GA 1GS8A 4AI7A 4YSAA 2BW5A 2XV2A 5B1AB 4DP8X 3SQRA 2IWEA 2BHFA 1PLAA 2GSMB 2UXFA 6PAZA 1GSKA 1PLBA 4HHWA 3NYKA 4BWTA 3NSFA 1ADWA 2AFNA 1XB8A 1JXFA 1M9WA 2FQEA 3U25A 3T6VA 4YVUA 1NIDA 1X9UA 2R7EB 4E9WA 2PP9A 1CC3A 1N68A 3HB3B 2YAPA 2EIMB 5B1KA 2CJ3A 1ZV2A 1SJMA 2ZWNA 4X4KA 1TEGA 3ABLB 1L9QA 2BZ7A 3MBWB 4NAJA 3IBOA 2VSKB 2A3TA 3NT0A 2CALA 1AZRA 1OF0A 4DP0X 3AG1B 1BXVA 2BWIA 1OCRB 1NZRA 1V55B 3EH5B 3JTBA 1DYZA 1HAUA 2JFCA 4M3HA 2FWLB 3X1NA 2ZXWB 1E5ZA 3JT2A 2BP0B 4BK5C 3QJTB 1KBVA 1IKOP 2HXAA 1WS8A 4HZ1A 4P5SA 3T9WA 1FFTB 3OMIB 4F7KA 4E9RA 3NJKA 3S3BB 3PXLA 3IN0A 2IDFA 2CUAA 1UATA 4G72B 4G71B 3WG7B 2IDUA 5A7EA 3FSZA 1NIBA 4FAAB 4TXVB 4CSPA 1ASPA 3QPKA 4G7QB 4KOCA 3UGEA 3FQ2A 3QQXA 1CYWA 2BZCA 3FU7B 3SBQA 1CYXA 2XYBA 1KDIA 1MG2C 1PCSA 2GBAA 2PLTA 4G7RB 9PCYA 5I6LA 2J57A 1J9RA 4EF3A 1GY1A 4JKNA 1YLBB 1OE1A 1JZHA 3X1EA 1SNRA 1NWPA 3NSYA 1ILUA 3EH4B 4YSSA 1AANA 5AFAA 2PPCA 1BYOA 4AZUA 1JZIA 4G7SB 1E30A 4UANA 1RZPA 4G70B 4Q8BA 1L9OA 3OM3B 4MFHA 2YXWA 4W9ZA 1NPNA 4A68A 3H4FA 5AZUA 1NINA 5TK2A 4QLWA 3NJGA 2VW6A 3SBRA 1M57B 3IE9A 4DP7X 3FT0A 5F7AA 3QJRB 5PAZA 3TASA 1AZNA 4DP2X 5LDUA 1ASOA 1FA4A 2AANA 1BAWA 5B1BB 1NICA 2XV3A 1BXAA 1DZ0A 1XB6A 3GDCA 3TBBA 2I85A 2GB2A 1J9TA 3KW7A 2ZONA 4W1TA 2BP8A 2XUWA 2JKWA 3NJHA 3PAZA 2B3IA 3FQYA 4N4YB 3CDZB 2FQFA 5I28A 4F2EA 1NIEA 2VN3A 1RZQA 3CVCA 2I7OA 4BDVA 1ASQA 4KO7A 3OMNB 4A67A 1ZPUA 2YAOA 4AX3A 4BWWA 1AS7A 3FSAA 3FU7A 3FSWA 2RACA 2W8CA 1MZZA 4FA7B 1JZGA 5D4JA 3UADA 1F56A 2IDQA 2DV6A 5TK4A 1CUOA 1J9QA 1EHKB 1KGYE 1RKRA 2BW4A 3FS9A 3S8FB 2Y1AA 3FU9A 3NJFA 3NJMA 1XMEB 2FT6A 1L9SA 2DY2A 1AIZA 3NSDA 1TEFA 2OJ1A 2YAMA 2CBPA 1W8EA 1OOWA 1GY2A 2HZHA 2H5UA 1BQRA 1AZUA 1J9SA 1J5CA 2GIMA 4AKPA 1GYCA 5I5MA 1A8ZA 1SFHA 2UX6A 4DPAX 3DKHA 2YARA 3PPSA 7PAZA 2EIKB 2N0MA 4YSCA 2E86A 2GC7C 1GS6X 5I5IA 1SDDA 5ANHA 2AVFA 2X87A 4HCFA 1WA0X 1L9TA 4KNTA 1KCBA 4HCGA 3X2QB 1ZIAA 1GW0A 1BYPA 3X1GA 3NJNA 2IDTA 3NP3A 4YSUA 5B1JC 4YSQA 2VM3A 2IH8A 2J56A 3AY2A 4E9QA 1A4BA 1WA1X 2J5WA 2QPDB 2VMJA 4P5RA 1ETJA 4CSZA 1KCWA 2FTAA 2GHZA 1X9RA 4HCIA 4HALA 2WO3B 3WNIA 3TA4D 5I6NA 2EINB 3CVBA 5PCYA 4BWUA 2QDWA 1A3ZA 2IAAC 1SF5A 3ABKB 2YAQA 4A66A 1PF3A 2CAKA 3UABA 4PAZA 2FQDA 2OCCB 3RYMA 2UXGA 4BXVA 2QPEB 8PAZA 3EH3B 1JZJA 2HX7A 2P80D 1OV8A 4HHGA 2XV0A 5D4IA 3BQVA 3ZBMA 2YAEA 1BXUA 3OD3A 4ENZA 2XXFA 3ZX1A 3NJIA 4K9JA 2HLEB 3TU6A 2BP8B 4KOBA 3T71A 2PPFA 1VLXA 2VM4A 1NIFA 1FWXA 2Q5BA 1E65A 3PAVA 4E9YA 1WAEA 1PZAA 1ID2A 4QKTA 3ASNB 1AOZA 3HEIB 2WSDA 1OCOB 3CZUB 5AKRA 1IC0A 4YSDA 3H4HA 1JZFA 2HX8A 2DYSB 4DPBX 3ASOB 4Q89A 1A4CA 2X88A 4YSPA 2YXVA 2CCWA 4YL4A 3DIVA 2H3XC 3KW8A 4KNSA 5F7BA 3UAEA 1JVOA 4NERA 1A65A 2YQBA 4A2FA 3OMAB 2TSAA 1PMYA 3AW5A 1QNIA 1KYAA 4ZK8A 5B3SB 1PNCA 1ZIBA 2AZAA 1J5DA 3H56A 1JXGA 1WS7A 1OE3A 3X1FA 3PAUA 1ILSA 4BXSV 3S8GB 2PPEA 1WA2X 1JZEA 1OE2A 2XVBA 3GXUB 3ABMB 3NJLA 4NB7A 1SF3A 3FU8A 1OCZB 2J55A 2YAHA 3X1BA 3V9EA 4A2HA 4WKXA 3ZIYA 2JXMA 2GC4C 2PPDA 2IWFA 2WO2B 2MRYA 5EHFA 2B08A 2DWSA 1IBZA 1V54B 2XX0A 3G5WA 3IN2A 3PCYA 2EIJB 2MTAA 1AZBA 5D4HA 1NTDA 3QJQB 1XB3A 3FSVA 1KDJA 4BDVB 5I6OA 2I7SA 2PP8A 2AZUA 4GYBA 3ERXA 3FYIB 3WKPA 1OCCB 2PCFA 4YSOA 5I5JA 3SBPA 1NPJA 3AG2B 3FYEB 3PLYA 2H47C 1SHWA 4WTQA 4DP9X 1JXDA 1AS6A 2FJSA 1ET7A 1MZYA 1QLEB 4YSRA 5B1JA 2PP7A 3WKQA 2BP0A 4YSTA 2PCYA 4L0PB 4HAKA 4PCYA 1AQ8A 1V10A 3AZUA 3QJVB 4JHUA 7PCYA 1N70A 1BQ5A 4KNUA 3CVDA 1AS8A 2BO0A 2HRHA 2PPAA 3C75A 1L9PA 1A4AA 2DWTA 1ET5A 3NSCA 4GP8B 4RH4A 4YVNA 3DTUB 4YSEA 5B7MA 1SFDA 2HX9A 1AG0A 1E5YA 3N2JA 1PZBA 1ZDQA 1KV7A 3FQ1A 1SDDB 2NRDA 1HAWA 1IBYA 2XLLA 3UAAA 2Q9OA 2IH9A 1CURA 5I6PA 2XX1A 4AKQA 1BQKA 1TU2A 4E9TA 3WNJA 4E9XA 4DP1X 3FPYA 2IDSA 4M4RB 5IY5B 4E9SA 5FC9A 3MX0B 2W88A 1B3IA 1R1CA 1W6WA 3WIAA 3FPXA 2LLNA 3BVDB 1QHQA 1IUZA 5I6MA 2OV0A 3QJSB 4JHVA 1E67A 1M56B 2UX7A 4DP4X 2FQGA 3QJUB 3D12B 1PY0A 3ABGA 2TSBA 5E9NA 4KO5A 5I26A 3UACA 6PCYA 1L9RA 1PNDA 2IWKA 1BEXA 4F2FA 4HIPA 3V9CA 3CG8A 1T5KA 1KBWA 3TBCA 1JVLA 2GI0A 3S3CB 2P80A 1SHXA 5B7FA 3N55A 2EILB 4DP6X 1AAJA 2XU9A 2FNWA 1AR1B 1RCYA 3CDZA 3NJJA 2DYRB 4UF7C 2VW7A 3S3DB 1HFUA 3OQRA 1ET8A 4AKOA 2FT7A 4UAHA 1AG6A 2R7EA 2UXTA 3L45A 3T6ZA 5I6KA 4A2DA 4DP5X 1W6LA 1GR7A 1NWOA 2XXGA 4A2EA 4GY4A 1PLCA 1TKWA 1JOIA 3WI9A 4KO6A 2QDVA
chains in the Genus database with same CATH superfamily
1B9ZA 3QR2A 3BP4B 5E4AA 1DFXA 4LSTH 2AMUA 1A3QA 3BYTA 1FCCA 4NQXB 3GYRA 4WO4B 1I1AC 2EKJA 2K45A 1GCFA 4L5FE 4P4KB 4C4KT 3PG2A 3SYCA 3BVVA 2GG1A 2WVVA 1F02I 3QC5X 5FR3A 1IBGH 3QORC 4X4ME 3ZTJG 5KWYC 1I8IA 3DX2A 1TETH 5C8JA 4LGSB 5HVWA 2YMTA 5H2BA 2WGNB 1EXUB 1IEAB 3HE7A 3D3VD 1X6LA 1KJMB 4IJTA 1GS7A 1IFGA 1MSPA 4N1CA 2X53A 1RERA 3CVHA 1OSEA 1FZKB 1FV1B 2Y07L 3BVTA 1PKQA 2VW4A 2WQWA 1J12A 4KO9A 1Z9SB 4A2GA 4YSAA 4IJ3C 2AMGA 3AWFA 4QRRB 3MNWB 2YOAA 5F7MC 4WUUA 3ZZ1A 3MAWA 3HZ3A 3QDJB 4MAUH 4EAEA 4FEIA 3RNKB 4J3TA 4P9MH 5I74C 4BWTA 1A7NH 1CBVL 4U3HA 5ENWB 3ULVH 3O6LH 3CK0L 2J71A 4M5SA 3RZCB 4MA3B 2O4EA 1NUDA 4ODXA 5DJ6B 4F2ME 4AK2A 4XB8A 3WTWA 1N59B 4GKZB 3DX9B 3LRMA 1JI2A 1MVYA 1WUZA 4R2GC 4KITB 4LHUA 4ZO8A 1FLRH 3PFQA 3RL1A 3TX4A 3VU1A 3MBWB 4RGNE 2GAZB 1JZ5A 3FUJA 3BE1L 1OAUH 4CKQA 4DP0X 3AGVA 3AG1B 4B9KC 3DBXA 4NOFA 1XZWA 1WD9A 4NUPA 2CJUL 1E9OA 2C34A 5K9JL 1NMAL 5AVWB 5DS8B 4IBZA 1F5WA 1Z9NA 3QDJE 4E0RB 2OSXA 4PD4J 5TPWH 2Z7UA 5DD0H 2QEJA 4MQ7B 4NFDA 3UC0L 3T0VA 4BFRA 4HS8H 1QOKA 1YO4A 4KDTA 3LDBB 2WO4A 5SWSA 4KKAD 3ZIMA 1EDQA 1IFHH 3OKOA 1ZXQA 1MCOH 1VENA 1YY8B 2H1XA 3BAEL 1DO6A 4WWKD 4ENED 3MJ8B 4PJHE 3NA9H 5FYLD 3VO0A 3R18A 5DD0L 4OFPA 1S3KH 4UTAH 3FU7B 4TPRH 2NZ9C 3QH3B 1LEKB 1W0WA 5DHDA 1YPZE 5E2UL 5B8CA 2Y9RT 4WEMB 3DI2B 4DW2L 4ORGA 3FB7B 1WAAA 2BP5M 4X6CB 3NSYA 1IARB 1MAMH 1ZANL 2M8XA 1H3PH 5EBWB 2V5RA 4ZW6A 5AB0A 2A83B 4F33B 5CMAA 3K1DA 2BSBA 3EOTH 2C9XA 3DX9A 5I15H 4YXHL 3HFFA 4YDNA 1CGUA 4UUJA 4Y1SA 3ARWA 4Q97A 4DQOL 1HE7A 3C5XA 4GG8B 3MV01 1M1SA 1M57B 2ZYIA 3CWGA 4OLWH 3ULUH 4RX4A 1G9HA 3EYQD 2A9ML 4W9DC 3GLZA 4A7TA 5I17B 1CDUA 3F12B 4MB5A 5ECGA 1IBGL 1LGVA 2DIJA 3ARSA 4FI8A 3P3SA 4QAWA 5CKGA 1E7VA 1SHMA 1BAWA 2XBZA 3FFCD 3FUMA 4BHUA 4C58B 1CU4H 4P49A 2BSSB 1M71A 1X5MA 1L3WA 2E7LC 3CXHJ 6FABL 3LN4B 2Y2YA 3II1A 4PRAA 2VLKA 3MV7A 4LASH 4JK0D 3FQYA 4ZTOH 2VE6B 5L88L 2YUWA 1F11A 1F6AB 4R3SA 3NK3A 4F2EA 3G6JE 2F53A 4BDVA 3QWOA 1ASQA 2WBJC 5F8RC 4GIPD 1GPOH 4ZDHB 3V52H 4EOWH 2B9AA 4EUPA 5HYSG 2J5LB 4P57A 3FU7A 2F19H 2GEEA 3IDGA 3RWGA 4LLVA 4KX8A 4FTVB 3Q2WA 3L4ZA 4J3OD 3VJ6A 4G8EA 4NHUA 4ONHA 1YCSA 1CF8L 5JXED 3S8FB 3O6FA 1HINH 4LVOC 1OSPH 5DC0A 4C55A 2FT6A 2B7DT 5CMAB 5DJXA 4NBZB 3L5WA 4RAVA 4OM1L 2NY1D 2L3BA 3L13A 3QDGA 1RFDL 5MEPB 2FO4B 3HHMA 2XZAH 4JAMA 2OLDA 2XQBH 3O6ML 2BSTA 4DPAX 1RURL 4AMKH 7PAZA 3HMXH 5HVGB 1IAII 5A16A 3UPRA 4X2UA 4WI9A 1FAIL 2DTMH 1P5UA 4XVUC 3FO2A 4PJGE 1CYGA 1QSFA 3SKMA 5EN2A 4F9PA 3NCXA 4NM8H 3G5YB 5AVUB 1K4CB 1IFHL 5I5RA 2IH8A 3TPKA 1R5WB 3Q13A 2EDMA 4UB0H 2GHZA 1TTGA 2BIOA 1G9MH 2XIIA 1BVLB 4HALA 1CFTB 4KUZH 2D0FA 1A9EA 3HR5A 4TSAL 5PCYA 1SOKA 4RGOL 1ODAA 2ITDB 3N06B 2YAQA 3D39D 5A6MA 2I9TB 3VNZA 4Y2LA 2J1WA 2L7JA 5FCSH 5LG6A 2J2ZA 4XPBL 2BSEA 3IDUA 1CFQA 4HPHA 3SGKA 3IXAB 3RL1B 4C83B 4E41B 1D5ZB 2QQNL 2G2NA 4WQOA 1LHZA 3IETA 3D39A 3OAYH 2LE9A 1BXUA 3D87B 4XXCC 3T4AC 4Q58C 3NJIA 4ELME 2ZD0A 3IJHA 2BP8B 3L81A 5L4FA 5JUEL 1TIUA 4CC0A 3ULVL 1E65A 4Y89A 1IAOA 1CGVA 1DANU 2UUDK 3LPFA 1GGTA 4PRPD 1KACB 3G5VA 5LGHH 3SQOL 3VX0A 5KAQF 2RAMA 1CG9B 2ADGB 1F6FB 2G2PA 1RJZB 2QQKH 2X4TA 1YY8A 3FUEA 2HLAA 5EU6A 1LP9A 4R2GB 2QMJA 3BQUA 4R7NB 1IC5H 3O6KH 2DQGL 4JRFA 2DMHA 2LU4A 1U9KA 1WG3A 4FLHA 1QR1B 4Z6AT 3KPMA 3V4UL 4NI3A 3MJ9L 3AREC 1HZHL 1P5VA 2XI9A 1TJIL 2HFGL 1SJEA 2QTVA 3MACH 1T89C 2EIBA 2XWBA 4KI5C 1NAMH 4OGXL 1YEDA 3RDJA 4Z7WB 1FNGA 4YQXH 1JPEA 3OMAB 4F57H 4P4KC 1NCCH 1AGFA 1INDH 1JGLH 5HY9B 4K94L 4B9JA 3BSGA 2GJZB 3F8UB 3VWJC 5L4JA 1E9OB 4O58L 4HX1A 3BAWA 2BVTA 1QFWI 3PWPA 1CLYH 5DEFA 3H56A 1WS7A 1AGCB 4PJFA 4WI0A 3GF8A 1ILSA 2A0LD 3VTAA 2EDWA 4P2RD 3V4LA 4AT6A 3S8GB 1P7KA 5EU7C 1ZT7A 1WF5A 4X4XA 2P28B 3M17A 1ETA1 3FRPG 2EDFA 3BZFB 4Z8FL 2YRPA 4KVCL 3BCDA 2XACC 1FFQA 5INCA 2NY7H 2OK0H 4ISVA 1FL3A 1Q0XL 4WUUB 3UJTH 4PSRA 4BQ8A 2BX5A 4Y7OC 1UACL 3FOLA 4EO5A 4NQCA 5KVDE 3RUGB 2EH7L 2X3BA 3GIVA 3VMOA 5EF3A 3JSSA 1OD7A 1WEJL 2YWZA 3HC4L 3MNMA 2Y7NA 3C12A 2P5PA 2DD8L 4Y16A 3WFDH 3HBQA 5IJBC 3BUBA 5F0PB 3SE3A 3EH1A 3X12B 5C97A 5IB2A 4GXVL 3TZVD 4PHXA 2YJQA 5GSVB 3ULVE 4L9LA 4P2OD 3DGGA 1LEGA 2YK1H 4N0FB 3QCVL 1JTOA 3CHPA 4GUPA 5IB3A 3PP3K 4QOKB 4HU8A 3NABH 1SZNA 4Z5RB 5DQJA 3BSHA 3GRBA 1MXGA 1ZVNA 5E8NA 3OHXB 4QIRA 5A2KH 2XFXB 2ZX8A 3GNML 1RSFA 1AQ8A 3WKML 1JMZA 4QEGA 3RKPA 2WTRA 2JNZA 3B9EA 3L1OL 3CVDA 5DJXB 2NY2D 3UBXA 3HG1A 1Y0LB 2Y36H 3GXTA 3B83A 3NSCA 5T5FH 4GRMB 1NEZB 3VXPB 3KPNA 3IKKA 5CGTA 1RH8A 1A47A 1DQKA 1X5AA 2EC9U 4WI4A 4P2QB 4OZGF 1T1XB 5FYJD 1BF2A 3UPCA 1JHTB 2DIBA 1BZQK 3V0EA 3WEAA 4J39A 3V4PA 1CXIA 3D0LA 4WWKA 2Q9OA 4O2FA 1CFMA 3TV3L 1A25A 2ZOUA 5ILTH 4ODHL 2JB5L 3UBXG 3ZKSD 3L54A 3OAYK 4KJWD 3TVMC 5I6XC 2I60H 5EOCL 1PDKA 4G8EB 4NHUB 4ONHB 1J18A 4RWYL 4RZCB 2J88L 4UIMB 2D2CC 1DN2A 1FCGA 2V7HA 2LVCA 3LRSA 5D7LB 4E9SA 1QRND 2AXFA 4U6XB 5C0IA 4LSRH 2AERT 3D6GA 3K91A 1TDQA 4WNQA 1QHQA 1X5LA 2J3SA 3IWUA 4Y5YA 5I1HH 1EEQA 4DUWA 3LV3B 4ODWA 4HWNA 1EANA 1N10A 4AUYA 2Q7NA 4YPJA 3AQZA 1KBGL 3CQFA 1PY0A 4HDIA 5FX3A 4G6AC 3KS0J 1PFCA 1TJMA 3NZHL 3WV0A 2AXHA 2CRZA 2WJ7A 3VFRB 1A6AA 1HNFA 1X5YA 3S5ZA 1FH5H 1FE8H 5EU5B 5LNEA 3CTTA 3RU8L 5IR1B 2WXPA 1BZ7B 3G6DL 4LQFH 4HWBH 5FV2A 3E3QC 3LB6D 1N7ML 1ZGLM 1UZGA 5HDBB 3K6SA 4OGYH 5EZJB 3ULUD 1D7FA 1HFUA 4HK0B 3L2LA 5F1NA 3OKNA 4P23A 3WLWD 3VXUB 2G2RA 1UJ3A 3FU5A 3H8NA 3TFKD 1WAAF 2CIKA 3H42H 2DPKA 1IAOB 3FTYA 4MBRA 2YD8A 3DHJA 1QBAA 5EPMB 5BXFA 1XCQA 2AAAA 1KEML 4KI5D 4KX9A 2E9IA 4MHHG 5CCGE 4X9GA 5ADPH 3AWEA 1X5JA 3SDDD 2XY1A 4Z0BL 1E8WA 2ADIB 2G9KA 4UM8A 5AW2B 3VSVA 3NG5A 3GXIA 2FBJL 1M7IA 1RJCA 4C83A 4XP1H 5I9QC 5F7KC 2D4FA 5D71L 4WHYH 3GMNB 4KUCF 3O8XC 5KYWB 1QLEH 1MG3C 5GHWL 4QOKD 1UADC 4I0CC 4NDMA 3CZNA 4MNQA 4XMZA 3HKZA 5ITBH 4PY8J 4XCEA 4RAUB 3T08A 1NLBL 3O9WA 4Y9BA 1HC1A 3VFOA 4EN3A 5GS0H 4WW2C 5E2TL 4Z7UA 1NDTA 4XC3L 5JPNC 4I48A 4G8IB 2FE0A 3BZFA 5J6GA 3VNYA 4P46C 3LNIA 4BM7A 2WXNA 3DMMD 1I9EA 5EWIL 3JWOH 3BH9A 4LQ1A 5KYXA 3EJZD 1P9MA 2UXFA 4WO0A 1QSFD 3CJJA 4AOFA 4JG5A 4JRLA 2HP4A 4PB0L 5IW3A 3O3UN 3F05A 3MOBL 1FAIH 2DTML 1CXFA 1C12A 3HI5H 2DKSA 1IVTA 2EIMB 4MD5B 2WN2A 2QBWA 4QT5A 4JRXD 2GI7A 4B9YA 4FQ1H 3DO4A 4IIQA 2BY1A 1ZV5A 3SCMB 2LQRA 2XHNA 2WINB 2WQRA 3IDNB 4ADIA 1JHLH 1G87A 2JFCA 5CBEB 1S2EA 3KVDD 4N8VB 3IVKA 5IHBA 1JWMB 1HINL 3HHSA 1JF6A 4XVSL 5DUBA 5C3IA 4Z3HA 4JM2A 2KPNA 1CLYL 1IKOP 1G9EA 4GKNA 1PX4A 1N5YH 3BGMA 4NN5B 4DGYH 4WEEA 1MCCA 1T1YA 1KWGA 3W11D 4DKDC 5I24A 3LKPB 1PCXA 1INDL 7CGTA 3GRWA 4LT7A 5AVTB 3GMPB 4YO0A 2ISDA 4KY1L 4Y5XB 4B7IA 3QEQA 1HKLL 3HC3H 1PZ5A 4HKJA 1FI8C 1UD8A 3C60D 2ITCA 4KDTC 4XC3H 1CGWA 5L7XH 1E2VA 1TLMA 5E0FA 4NUMA 3NZSA 4MAYC 1SMDA 3FQ2A 5D7EA 1U30A 1FZMA 2D03H 4Z7IA 4G1MA 3BSZH 3OLEA 5D2NB 1GY1A 1RSYA 2PYFA 3Q6FA 4FNTA 4JPIB 2OSYA 3FAXA 5JA9A 4XCCH 1ILUA 1U8HA 4E2OA 3SDAA 4Z7QE 2UV3A 5HGBA 3RY6C 3PREA 4BSVA 3SYAA 3OPUA 4WEBH 3A6BL 3DXAA 5HP5A 4W9ZA 5HDRA 4AT6B 3E1ZA 3RTQD 5AZUA 2RMNA 5FA3B 3NJGA 1HQRB 3QDMB 2UZXA 3KYMA 4HS3A 4LDEB 5LBSL 1JK8B 3GLAA 3L3GB 1DUZB 1PY9A 5F88B 5DZAA 3DIFA 3ROOA 3APDA 1R6VA 1GGCL 1S4IA 3S5LG 4WEUD 4GLRI 2Z64C 2F8XC 1TQBC 4G42B 3EYVA 2GK0B 1HI6B 4ZAKB 1BM3H 1W80A 4HJ0D 3PJSB 3NZUA 1T03H 2J8OA 5KVEE 2WLNA 1K5NB 3VFPB 5CEXB 3HE7C 2G2RB 5LQBL 3GEWB 4P3CH 3QNFA 1A3RH 3BPNC 1S7WB 1OSYA 3V5HA 3RY4A 1YMME 1MN4A 2FUTA 3BSZA 2F58L 3BW9A 5D4JA 1DQIA 2VLMD 1CFSA 4OF3A 2Q86A 2VB5A 3DBXB 4W68A 1I1AA 1CUOA 1F58L 2E9JA 2ZAHA 4GB9A 4NQQA 1WCBB 4WHYG 4AMKL 1LMIA 1FL5B 1XMEB 4MS6A 4PM1A 1IAIL 2OL3B 1SOSA 4QHLA 5L2KB 2AQTA 3LYRA 3NSDA 4OD1L 1CGSH 4TSAH 5IB5B 2IANE 1RFDH 4P9HH 4D9RD 5E24E 3EDEA 4R97C 3ALWA 5EBLA 3QQ4B 7FABL 4P5MA 2CBPA 3P77B 5F7LB 5HHXL 4KZEL 2H1LM 4WI5A 5CLWA 1J9SA 3VE0B 4MCYA 2FCBA 4X5XA 1IC1A 3UTTB 1AD0B 3LN5A 5DFTA 2UX6A 3I02B 1KTLB 2EO7A 4N8VG 4JCWA 2XN9D 5CP3A 4JFEA 4XMXA 4LCWE 1WA0X 1U36A 1YMMB 1VZHA 5HDLA 1G6RA 1LQSR 2P8MB 4PGDB 2A0LC 3HMXL 5AQ0A 3GBLA 4KJPD 3K2IA 1HSAA 4MQXD 2VN5A 4QRPB 1IMHC 3KE0A 3VGBA 2V7HB 1RK7A 2E7BA 4P5RA 1KIRA 3HS0B 3FT2A 3VSUA 1KCWA 4JFUA 4HCIA 2EINB 3QHZH 1EJFA 1T3FB 3TBSB 3CVBA 3BPNB 3TURA 4HUXA 3WL9A 5AWNL 4BH8A 5EF2A 2QGDA 3IDIA 5FOJA 3DV4B 2OYPA 2CAKA 3EJQA 2C3WA 3AQYA 4OJDH 2GJ6A 1CFSB 4ONGL 4YPGA 4PAZA 2H2SD 2WUCL 5DD3H 2DDQH 4LP8A 5I17A 2FIRT 2HA1A 3PWVA 4YDKL 2IPUG 1XSOA 3KPRD 4L8SB 3VRJB 1OV8A 3O4OC 3KM2A 1X5KA 5FO9A 3A47A 2OL3A 3DDFA 1KENH 3QDME 2CQVA 4QHLB 3W9EA 3MRIB 5L2KA 1I1RA 4L1LA 3MRRA 4LFHD 3LPWA 2WIIA 4YLQT 1TTUA 4RRPG 1R3KB 1NUNB 3QQ4A 4PJEF 2EH7H 3DARA 2R2BB 1FZOA 3QT2A 2VDNH 1VLXA 1DBAL 3PL6B 1M3JA 2QKIC 2VDPL 4XVTL 2JJTC 1XIWC 2J8UF 4NN6B 3GTTA 1E90A 3N85L 3VCLA 4QRPE 4ZTPL 3EH2A 4D0CB 4QXUL 3UL4A 3NH7H 4UNIA 5E1GA 3K1KC 4P57B 1B0WA 1HSBB 1TKWB 5HYQB 1UEYA 2MNJB 2VRQA 5DA4A 2C4XA 5LCVH 1YMHB 2Z92B 2VLJE 4QNPF 1HSAB 3KJ4C 5AYUH 3ARGB 3D1MC 4U49A 1EHNA 3NEXA 5IOPA 1KGIA 3NA4A 3CVHL 1BF8A 5SWSE 1TPXB 4Y9CA 4PS3A 1NFIB 2GUYA 5HHMB 1HWGB 1D5BB 4G80A 4WV1A 2BVPA 2IPKB 4Z95L 4YHMH 1NBQA 4MMXB 2ZXAA 4HFWA 4N2DA 3QS3A 4IBYA 2WZPA 3KPRA 1UD6A 5KVEL 2XVBA 2V9TA 1HN1A 2WZ0A 3ROLB 1IL1A 3L5HA 3VGAB 1XZ0A 3X1BA 4AL8H 5IQ9B 3V9EA 1LO2H 3M1CA 4CAGA 3NA9L 4JG9A 1K8DA 1ZLWH 3EXLA 3SE8H 5F7NC 3I6LE 5KVFH 4GAGH 4HJSA 2FATL 3ISWA 1ZV9A 1IBZA 3BDBA 4G42A 1PTZA 2WCGA 3OR6B 3PCYA 5DEGB 2BOCB 3CHRA 4X80H 5EORH 1BOGB 5BZZA 4UQCA 3HAEA 2YUXA 2FGZA 2MTAA 1U8OB 3B34A 1L7TH 3JBG7 3QJQB 1HOEA 2DWEA 1D7DA 1OGAD 1E5AA 2WWOA 4U1NA 4Y7MA 4OT1H 4QXWA 3BZ4B 3DX7B 3ZK0A 4OF5A 2X6MA 3CV5A 3SBPA 4G59C 4ZSOE 3S97C 4CDGC 1FGNH 4XN2A 1UA6H 5E2WH 3WLWC 2GCYA 1B2WL 4JFXA 5T1DL 4K9EC 5FA3A 1SHWA 4WTQA 2VXVH 3O2DA 4HG4K 5L9DH 5LBSH 3C5ZA 1A1NB 1MHHA 4Z7WA 3IXTA 3PNRB 4KUZL 1MCNA 4MD4A 4YSTA 2WPGA 3KPQA 1E4KC 1W15A 4HIXH 3MLXL 3ZHFA 3TYFA 4WU5A 3A6BH 3UZQB 5LGKA 2F54A 3MCKB 3GM0A 2PABA 1MWAB 3L95B 3QIBA 3IJHB 3GMMA 4LCCA 2CWRA 4HBCH 3EYOA 3KPRB 2NY0B 3OAUL 1YC7A 2V9RA 4PJ7A 3UEQA 1PZ3A 4JL1A 4ZYKA 3PDOA 1A4AA 1FNEB 5I1CH 2MPVA 1KF9B 1HYSC 3N1PC 4B6ZA 4O02L 2D03L 3BPCA 3DSFL 4IDLA 4YSEA 4Y2DC 5B7MA 1T6WA 3ATFA 5E9AA 4OGAD 5BZWB 5E5LA 5CCKH 1S9WA 2ZCLH 3K3QA 3PL6D 2XLLA 3UAAA 3IK2A 1PKOA 2BIPA 4HETA 4B9CA 2IH9A 1MJ8H 3OC8A 3OG4B 2AC0A 1BQKA 3ELQA 1OARH 4FFVC 4UMGA 2WXJA 4E9TA 3QUXB 4JFHE 1TETL 4C57C 1PZSA 1DJSA 3FPYA 1OM3H 5L4MA 2PWHA 4X83A 3LS5L 1KBBA 1AXSB 3CU1A 3LCYA 4LLDA 1J86A 4R97B 2VDLL 2GJ6E 1ESOA 2WVSA 3DX4A 2DQTH 2BNUA 4GRLB 5GGTA 3BO8B 1QRNE 3PRZA 5AVVB 3PXJA 2GCYB 4K23H 2OMWB 4P5MB 1SHSA 4CSTA 2TSBA 3EO9L 3CFKB 3L7FB 3UACA 4N87A 4OD2B 5HHMD 4G6ML 3MRBB 4HPYH 1QEWB 2DBJA 4IIZA 2BDNH 2IQ9H 4H44C 4NUGH 4RA0C 5IHZA 3N9GH 3CFEA 1BJ8A 3BAJA 3FN9A 3CFIC 4HKBB 5I76A 4PCTA 2NW2A 4XAKD 1ZLSH 3T0XA 2WLZA 1ZLUK 1RZKH 3IGAA 4AW4A 3WFCH 2WNXA 3CDZA 4DK5A 3NJJA 5T1KB 2X89A 3EO0A 1FZOB 3WMSA 5HHNA 3HZMB 1KENL 5DHVA 3MRJA 2X0VA 3EIFA 3E6FA 1LO4H 3ARFB 1JV5A 3P2BA 3POCA 1JN6A 4FQIH 1EHAA 3HNSH 3GJFH 4DZBB 3VCLB 1H8NA 1MWAH 1YEKH 5FO8A 1P4LB 1MHPL 2HWZH 4OZFH 5JIIA 5FHBH 3AU0A 4ZXBC 3V6ZB 5D2LB 1QBBA 4A2EA 2X40A 5DD6B 3TFBA 3LAFA 2VDRL 3EFOA 4KJYA 4ANWA 2CGRL 1GW6A 4LHUD 3IJEB 3KDMA 3RWHA 4IRSD 2OJEB 3WNLA 4J3BA 4GXFA 5DWPA 4DGVH 4DPRA 2AXFB 4U6XA 5JR1L 3L4XA 1NFIA 1ETZB 3IDMB 5DZVA 2IO5A 4YHIA 4NWTL 4PLKC 4UDTB 3SJVB 2F74B 3NAAL 4YX2L 1N2RA 2Q87A 3HG1B 3AGWA 1INEL 1TJXA 4YDVA 1ZOXA 2YKLL 3PV6B 1KIPA 3UCRA 3ZYJA 2HJKA 4JDTH 4LEEA 3TH3T 3WIHL 5I73C 1AZVA 2O6EA 4DKTA 4PP2A 3Q48A 3L9RB 1E4JA 4GW1B 4A6YH 5HJ3B 5KBDA 1KEMH 3CN3A 4IBSA 5GPRA 5TE6H 2OCJA 1MJJB 4NM4L 5BO1L 5DRWB 3PHAA 2BHFA 5BJTA 1M7XA 1UXSB 4HKXA 3C60B 1PQZB 4PMFA 4NO5A 4FFYL 4FYSA 1PZUB 5FA4A 5TDNB 4TOYL 1NIDA 2YC1A 3HC0A 5HGDB 4P5TB 1EBAA 1QLRA 4FYTA 1Q9OA 3B1TA 3GSNH 1CC3A 3PHOB 2ESVA 1ZV2A 4H1LH 4HJ1A 2PXYD 4QO1B 4HIHB 2K3TA 2C3VA 3P4OA 3VFNA 1LE9B 4R26L 1QLFA 4LCYB 3WE1A 4DFHA 3FO1A 4HDIB 1WVZA 4XBEL 5ITFA 1XQ4A 4FQJL 4ZFQA 1GOHA 3REWB 1RZ8A 4Q9QL 4PCKA 2FH8A 4BUGA 4UT9L 2J4WL 3QPQC 2C7UA 4JY5H 4MBOA 4HC1A 5IJCC 1F1DA 8FABA 4ENEC 4G7VH 2E9BA 3NIFE 2BFGA 1JCVA 1P6WA 3RPIB 4PJEB 3F7PC 3ZKXB 5IBLD 4OJYA 2LOEA 4U1HA 5IVZA 3BMVA 3ZMRA 4CRPA 5IEKA 4XZUA 1BVNT 4MAUL 1KCVH 3APFA 1E3ZA 1SVZA 5DLMH 4RAUA 3RIAK 3S8WA 2AK4A 1GJIA 4FYQA 5J12B 1YEJH 4G72B 4V1DE 5GGSA 3BKYH 4A6YA 3TJHC 5JHDA 2Y4SA 2CIIB 2IMNA 2VL4A 4HCRA 1WE5A 4AGLA 3BRGC 5IROD 4OV5A 3CBKB 3BPOC 1N8ZA 2COQA 1FF5A 3HC3L 1X5ZA 2ZUVA 4WTZG 4QYAA 4GAYB 1WWWX 2V2XA 4G7RB 5HI4D 2YEZA 1AKPA 5C0BD 4NZFA 1FFPA 3U6RA 3NPZB 3DYMA 3O11B 5EDSA 4F5CE 4M1CD 2YGOA 5CBAA 4XPTH 4GQ9L 3WEOA 2BRRL 4YHZL 1Z3GL 2DIAA 3D4CA 4U6VL 4S0HA 5AWNH 3KLAA 3QXTA 4JM0A 2E76C 4FN0A 1RHFA 2X2YA 2F5AH 4IRSB 4IGBA 1O7DE 4XVJH 1DBBL 2X4SA 3V6FA 3DSNB 4UQAA 1IM3D 1RUKH 2CE6A 4GO9A 3CZJA 5BUAA 2R23A 4KK5D 3UPRB 2JKRM 5CLXA 1QI3A 1ZGLB 2MJWA 4UIKL 1Z0NA 1AGEB 4NHCH 4YHKL 4FQHB 1S7QB 1HEZB 3EOBB 4JG0H 4U3SB 2CBQA 3HBPA 2OKMA 4MRBA 2FO1A 2X4RA 3JZYA 1HHHA 1GAFL 1ZT1A 5I8KL 1ZAGA 3QORB 1KPVA 1INQB 3MNZA 4L4TA 4D7BA 1JPSH 3TIDA 2F08A 3FH8A 3B7TA 4PJFF 4PRIE 1DBMH 3ZDYE 2EABA 1LP9B 3L9EA 5CZXD 2RACA 4IIQB 2IAMB 5IT2L 3UTSB 3BO8A 4LRIC 4JRXA 4PJ5E 2QLYA 4XCNB 4XB3A 3BUTA 5H35A 5J6HB 4Z7VA 2V0AA 2NY2C 2ODHA 3LKOB 4HS6A 4K3JL 4XTRD 3B43A 5FGBA 1BW8A 2OJZH 3L3JA 5GHWH 3T2NL 1ES0A 4J8RB 3H3PL 2WYHA 5JORA 4JO2H 4UT6A 4JM2B 3ZKQD 3HZVB 2Y22A 3WIIL 5EOCJ 2ICEB 4PV1C 2VDPB 3PDGA 4HPOH 2SODB 4K3GA 1RZGA 1NH6A 4N90E 2AXWA 5KS9B 5HHQA 3DX8B 3ESOA 3L17A 2GIMA 2Z4QB 2V5SA 4TNWK 1ORQA 2NW3A 2R39A 2X7LB 3DVNB 2BSRA 3C9NB 4PG9A 2CR0A 3MRMB 2EUZA 3BVUA 1RK1B 5BNXD 1LP9F 3G6AB 3ARBC 4KFZC 3X2QB 2AS5M 1SUHA 3CXDH 4EDWL 4NKIL 4MJIE 3TM6A 5DMKA 3NCEB 5KSAD 3IF1A 3HLAB 5LNGA 1CE1H 3G08B 1C7TA 3H54A 3MUJA 3N3EA 4LKXA 3JVGA 4H0LC 3Q5YA 4XP1L 2OAAA 2GJ6D 4NRYB 4QF1A 2C9VA 2OA9A 4JY5L 3KPSE 4G8AC 3VXQA 3MROA 3IJ9A 3GKWL 3N42B 5FUCE 5HPMB 1BZEA 1KJ3L 1Q9OB 4PD4K 5F7YC 4JJOA 1LP9E 2FX7L 3RVUD 4DVBA 2V8LA 1E43A 3B6SA 4U6HB 1YNTB 2GTQA 5CJ5A 3RYMA 3MGAA 3I50L 4MWFB 5C08B 2GTZB 2FYVA 1J8KA 1X7QB 3BKJL 2NW2B 1EPFA 2ZG3A 3M46A 1RUMH 3P02A 5E8NB 1MAKA 3T65B 3AITA 1OK8A 2DWXA 1I8LC 5IBTL 2W60A 3TU6A 2VLRB 1U91B 5E5MB 4D8OA 4AY0A 2K78A 4PJEA 5AOLA 1K5WA 4ZAKA 3UC2A 3QUZC 3MOAL 3A3YB 4JFDA 3S98A 3O3DA 4GH7B 3IJSA 2V5MA 3DUHA 3IFNH 5T3ZL 3W9DB 5BQDA 2R0KH 4NNYB 5JHMA 4MA3A 4WF7A 1Y6NR 5HYIA 2OR9H 3MLPA 2LHAA 3CN4A 3HI6L 4Q7DA 2F9BT 4GQRA 4UDUB 3RA7L 5AAPA 2ID5A 3U1SH 2VYRE 4NWTH 1LEKA 3DIVA 4MASA 4BH7A 4YZFE 3KW8A 4NQDD 2XZAL 5F7BA 1G4RA 2AEQL 4OGAC 3BWSA 3V4VL 2DQ6A 3VXQB 3K7UA 4UIMA 1PG7L 1A6UH 2IAMD 5DHXB 3VDBA 4JX0A 1JYNA 2Y24A 3QDHA 4ODHH 5D2NE 1HCZA 4X8GA 2CGRH 2VISA 2DWDA 3KYAA 2ZPKL 3VFWA 2ZXDA 3SDCD 3UBXB 4N6RA 1AD0A 2QVKA 4L2LA 4GQ9H 5IQLA 2HN7A 4ZD3L 5C08A 4B9FA 3VD1A 1MFEL 2X4OB 4JFEB 4JGMA 2J55A 1DFBH 1P7HL 1IE4A 5B4MD 4DH2A 2HG0A 2NYKA 1QFWL 4FCAA 3RX5A 2BS9A 2IBBA 2ICWI 3I6GB 2YJLA 1NAMB 1TNMA 5DJCA 4NCDA 5E2TH 1D9KA 1A4JB 5IV2B 1BQHB 5F3BB 3BYYA 2H3NB 3BKYL 2OXHB 2WAHA 2WBJA 3MJ8A 4YHZH 3VQ2C 2BRRH 2FJUB 3AY4A 5LN8A 1V05A 4H88H 4PJGF 4GYBA 4KDWA 3RAJL 4XO3A 2PCFA 5GGVL 2GJ6B 3AG2B 3SPCA 4ZS6D 5IREA 3FUKA 5IIEB 3G6JA 1RUPH 2WQ8A 5AW9B 1SVBA 5B1JA 2X0WA 1SYVB 5J6HA 1WH0A 3WDIA 2IC2A 4WW1A 1AI1H 1DP0A 1REIA 4FHBD 4KUCD 5D1QC 4AITA 1D2OA 1NAML 4OGXH 3FU6A 3UBHA 4DUVA 4JE4B 4NAQA 4FQHA 4CBPA 1JWSB 1RZ7L 3KPOB 3AXLB 4G8GD 2DWTA 4KK9D 5GGSB 1JXJA 5GRWA 2GT9A 3TCLA 4Z7OE 4N9GA 3FB5A 3I2CL 3GZPA 3EBIA 3ZXAC 1SFDA 1XF3A 4EVNA 3SCMC 2DBLL 4WTWA 3N44F 4BE5A 3GQFA 1N8ZB 2QZQA 4PLKD 4AQ8A 3K2KA 5EB9A 1NAMA 1CE6A 3VWKC 3WXWL 2WKGA 5TE6L 4NT6B 1FFNB 2XX1A 5E6SB 4DNLA 3ARGA 3HOGA 2FX9H 2R4SH 1JYWA 1TLKA 2I26N 4KTDH 5CP3H 5JLZB 4XCNA 4NO2B 5H35B 5IY5B 1JBJA 1TJHL 4TKWA 4EUPB 2VMCA 3GMNA 4PJCE 4YX2H 4XTRC 5E6IA 1UG9A 1KXHA 4JDVB 1SYSB 4FQXA 5HPMA 4RGMB 1NMCC 1XSKA 2NDGA 1A4KA 2UX7A 4HEME 3R1GH 2OTUA 3KBPA 3UZVA 2DQHH 3L5JA 3P73B 5DK2B 3SCMA 3QA3B 1XXDC 5C0CA 3LRHA 4NSKA 4Q2ZA 5G2NA 4N22A 4XP6H 4Z9KB 5E1AA 3SJVD 2WWMC 5BO1H 3PWJB 1MQKH 1FLRL 2A6IB 3MHZA 2V2TA 3S3CB 3PWLB 1ZVSB 3DI3B 4ZZFA 4WO4C 2XU9A 3GMMB 4HP5A 4KXZH 4O51A 5DYOA 2CA4A 4J4PA 1RCYA 3PE9A 3RURA 5FYKH 3TO4A 4N26A 4UF7C 1INEH 4JJHA 2ADFH 4JFPB 2FLRT 3LH9A 2TAAA 1IZKA 2WLKA 4OGQC 1LO2L 2KYIA 3SGDH 5CWSA 1BPLB 4FI7A 3U2SB 4JDEA 3TT1L 5BUGA 2D3NA 2VC2B 1SXBA 2JH2A 4WK4B 4XCYA 1YN6A 5JR1H 1RJYA 1OB1B 2ZG2A 2BPBA 2DQEH 2OULB 1E28A 5ETUB 4FADA 5DUMH 1A64A 3CX5K 4YC2B 1D3CA 1ZVYA 3L3JB 3QUKA 4GNKB 4Z95H 4F58L 4HPYL 1M1XA 1MLBB 2DQCL 4NN5C 1A9EB 3HR5B 1ACCA 3RUGF 3JWDL 3SDAB 4ZMTA 3WFBL 1FG2B 3R06B 5ALBH 2EQDA 3OGOE 4WU5B 4J2QA 5DUBB 1AGDB 4XWGH 5L4IA 3REVB 2ZYRA 2WNWA 2O5NA 4I3RL 2EDXA 2HJLB 3D2UB 5HI4C 1RIHH 2W07A 2IPUK 4L3EA 1FNEA 5F7EL 1D5ZA 3F04A 3GMPA 4Q2ZB 2QV2A 3RWCB 5FLVA 2Y69B 3FTSA 3LN9A 3L1EA 4EUPH 1A6ZB 4QXUH 5F0JB 4MRCA 1BIHA 4TNFA 3MI6A 3TFKC 1PZCA 2X4OA 4I1NB 3HPJB 3NIGB 3G5VB 5DJYA 2CPCA 4MMYB 4PY7A 4OSUH 4CADA 3WE6B 1B4JL 3GSWA 3MV11 1N26A 3B2UD 3K4AA 5LN4A 1X44A 4F24A 1GOFA 1UJ3C 2DLGA 1VB9A 5KEZA 3NCBB 1XB8A 4O02H 4BQBA 1A4JA 3M86A 4YVUA 4TVPD 1KB5H 3VI3B 3OXRA 2PP9A 5TH2B 4EDXB 3DURB 1QRNA 1WT5C 3JQOB 3CE1A 4CKVX 4NQSB 1ONQB 1WTLA 4FXKA 3RDTD 3BEVB 1OARL 4LVHB 1U8LA 2NT0A 2A3TA 3RG1C 1S7UB 4CGUB 3UG4A 4RMWA 1KTBA 1MUJA 2XETA 1T1ZA 2G9HB 4XNQA 1WFMA 4IOFC 1F90H 1NDMB 2JQZA 4HA1A 4IHOB 5IWLC 1Q0YL 1UYWH 3SJVA 2W95A 4FLOA 4LBEB 4XBGB 3WU1A 2QSTA 4N0YL 1LNUA 4MB4A 5T1KA 5JIHA 1I9IH 2Z1PA 1YYLL 4NC1E 1JV2A 2W9DL 3S3BB 4I2XE 4N5ED 3IFLH 1XIWA 4GLRH 3SZKC 2VLLA 3DK0A 1JWSA 3KPOA 3WG7B 4LL9A 5A7EA 3LKRB 1DVUA 4JQIL 2QQLH 2XICA 1E8YA 1G0YR 3MV9E 1XCTB 2JI3A 5CN1A 3MXVL 4Y4HD 5CD5C 5H94A 3IGLA 1J8HB 2RALA 3V8CA 2R2EA 3UDWA 1E5BA 2GQHA 3CFCH 4XC1H 1VFBA 3FNKA 3HPLB 3QDJA 4U1SB 4MNHB 2ZOKA 3BLBA 4NQTA 3V55A 3P4NB 4BH7B 2NR6C 1GJUA 2W0PA 3WNMA 4J3OH 1CGSL 1YLBB 3NQIA 2IWGA 5M7QA 1QSEE 2IBZX 1UM6H 2DQFB 5AFAA 1HOCA 1A3LL 1AIFB 3WN5A 3QXWA 3FONA 2C7FA 1N9PA 3MR9B 1JNNH 3EBGA 3P4OB 1LE9A 3LXUX 3AMLA 4KJQD 5DGRA 4CC4C 4E42B 1NINA 3SBRA 4JFHD 4F7MA 5DQJB 3VE0A 3QJRB 4Y4FB 3S96B 4JFQB 4F2MA 1HE8A 1SXNA 5DMIL 1M7UA 3KPPA 5GSRB 1XF4B 4KPHL 4YWGL 2DB8A 3O0RL 4GSQA 5C0CB 3KPNB 1KXVA 2VLKD 3MV7D 4TQHA 4OU3A 4QCIB 5I8OL 3MO1A 2BJMH 1BXAA 3MRIA 3Q6GH 5KOMC 3VI4B 1UZ6F 1IGTB 4YXLH 1WK0A 1KYUA 4KFMA 1IAMA 1PFOA 4RNRB 5KSUB 4K2UL 3HLKA 2UVFA 4GMTL 4OH2A 4HXAL 1HNGA 1UOLA 3LJ3A 4CMMB 4AYGA 4CSSA 5JLZA 4ODXB 1BZOA 2FJHA 3L48A 5IB2B 2XN1A 4R6UA 4ZPVA 5H94B 4BWWA 4ABUA 5CIPB 3LZOA 4IKIA 2NNXA 1UC6A 1UB5B 2ZSWA 4I88A 1UZ6E 5SV3A 5JOPE 5A6LA 3D50A 5HHOE 3UADA 3LV3A 4F3FB 1E7UA 5C0BE 2D73A 1A4KB 5KSBE 1SY6A 2IGLA 2D7MA 3EJUA 4BGDA 1SXCA 1X5IA 4KZ0A 1JNLL 1GKOA 1CDIA 3CZSA 4NXSA 5IQOA 4K73A 5E8EB 4GMSL 3GUTA 1EAPB 1M7DB 1BQSA 4I3SL 4O2CA 1T7ZA 2LGNA 2GSGA 4X9HA 5GS1C 5KZCB 4JY4A 4YGAB 1JGEB 2DAVA 3QZBA 4ZTOL 2EIKB 2N0MA 5KSBF 2ICWB 4LLUB 1YEFH 3HA0A 2AVFA 4GRWH 1R17A 1TCRA 3HE7D 5CO1A 1YNTF 2O5XH 5JDSA 4Z3FA 1JZ6A 1IGTA 2IDTA 3RRQA 1ZRUA 1ZTXH 3MBXH 3VXRB 1HIML 3X13B 5IVXB 4MDIA 1MCIA 4WU7B 3T2PA 4UTBA 1WGOA 1RVFL 2AP2A 1IIIA 3OZ9H 3BH4A 4Y4HB 2FTAA 3AU1B 3TH4T 3GLDA 2A2QT 3H9SA 1NKRA 1IEBA 2CGZA 1CBJA 2QFRA 4Q14A 1KLFB 4OLZL 1CD1B 4PI2A 3T0WA 4WV1C 4MMXA 7FABH 3DURA 5AOKA 3UABA 1IGMH 3WFEL 1M9SA 3IGKA 3L4UA 4NZTH 3GMRB 1I8IB 1MIML 1NCBH 5T5NG 1SRDA 2FQDA 1MI5D 2OCCB 2WN3A 1DQJB 5K39B 3EH3B 2P80D 2EDJA 2CDEB 3NEOA 2DLEA 1R3LA 4LHUG 4E68A 2VERA 1VF5C 4N8VA 3L2NA 5J6GB 2P49B 4NFBA 4Y4FD 4K7PL 4PJAE 4MDRA 1M6UA 3BIKB 3NGBB 3V4VA 3TVMA 3Q7JA 3O9WB 2O26U 3IMUA 2VE6A 4X7CC 5I1EH 5C2BH 1RUQL 2MFNA 5DC9B 2JJTA 3PWUB 5HHXH 1E3FA 3U2SA 5J89A 1NKGA 2PO6B 1F8TH 4LLQB 4Y2OB 1T6BX 5JW4M 4JQVC 4W9KC 1TCRB 1U3ZA 1E40A 1KB3A 2KDYA 3ES6A 5AYQA 5BZWA 4FLRA 1Q94B 5KSVB 3TO2B 5AVRB 3B2VL 3AAZA 5DRZA 2IANA 2NY6B 1UGNA 4QR7A 1C16A 4UM8B 4LU5H 4LVHC 2WLIA 1QX1A 4M48H 3U0PB 2FEJA 2H45A 2NXYC 2NXZB 2BVYA 2LAGB 1F3RB 1AMXA 1QBLL 1BM7A 5DQ9A 1BVLA 1C5BH 1AE6H 4XMVA 1T22A 4NC0B 3WEXB 4X42A 5FYKU 2WXQA 2YPVA 4OM0L 1NC2A 3QK0A 2W07B 2AZAA 2V17H 2E56A 2HB0A 3GSNA 1FO0B 1RPKA 2AJXH 1R3HB 1RP8A 2KZKA 2D9CA 1G6RL 3WMPA 1LO3L 4YFDB 4EQ2A 3HUJB 1SF3A 1EDYA 1RAMA 4S1SH 4ZUWA 1JHKL 3FUFA 4XXCA 3IDXH 1N3NA 4Y2DA 3EHBC 1DVYA 1MHCB 3C5SA 1KC5H 1PYWA 2BS8A 4LCWD 4FTVE 4K5MA 4Q9RL 2Y06H 2Z8VC 4LVNC 1NCNA 5GZNA 2MRYA 4IBQA 3OB0H 2N1TE 4LSSH 1RLWA 1T0PB 2F8IA 3ZTDC 5CN2A 4ZMPA 3EOAB 3ECQA 2VQ4A 4OIFA 1OLLA 3HW7A 2MTPA 4QF1B 3IMBA 3IFPA 5LVEA 3HFML 4Z3JA 4KTEH 4PH8A 1NLDH 4S2SB 4DN3L 4N2NA 4UTBH 3GKZA 2AQRA 3MGTA 4XN9A 3WHXB 2NTSP 3Q3GB 4YSOA 4EEEA 1CK0L 3ZDXB 3BVWA 3BSZL 1L0PA 4S1QH 3SD2A 1AKJD 4OZHE 4POUB 1EZVX 1KY6A 3CLEH 4LBAA 4OD3L 4HS3B 4AVIA 1QLEB 4K5LA 2MHAA 2O5YL 4D0BB 1SN0A 3SE9L 1S7XB 3Q8FA 4L0PB 3NZ8A 2JCWA 3S34L 1V10A 1K8IA 2QVTA 1LNUB 1ETZA 2VMDA 4APQA 1FJ1B 2Y25A 1U3JA 1O6SB 2JJWA 4ODVL 5HBBA 3T09A 1FNAA 3LKRA 3LS4L 4ZMYA 4GUCA 4HMCA 5HYJD 3FT1A 4PJDE 2LFGA 5IBLC 3ARDC 5D7JC 1OAQL 3F64A 1RI8A 2B16A 1E5YA 4MJ5B 2K8QA 4MTMA 2ENJA 1QW8A 1BGXH 4K9EH 4R7NA 1WBXA 4ZXBB 3VFVA 1U95B 1ZK9A 4HZLA 3SY6A 3KPMB 4Y16D 1C9SA 4G6AD 4N5UA 4XN5A 3ESUF 3F7VA 4P3WA 4JFFA 2E27H 2QV4A 1JZDC 3WTYA 3O2DL 1FAKT 1SJXA 1WBYA 2ATKB 4M4RB 4MNGA 5F96H 5I1IL 5I0VA 3HN8A 4HK3J 2ATPB 4PJDF 1R1CA 1W6WA 5DMIH 5EIVA 1KWKA 1OTTD 3A5VA 5GS2D 5IMKA 2YPKB 5I6MA 3MOBH 4NQEA 1UVQA 3IDIB 3IMSA 3QJSB 5FWQA 3S3PA 3D06A 3SGKC 4QNPE 5IB3B 5ES4B 3RB5A 5BRPA 2VC2H 4KO5A 3QI9B 1JDAA 4Y19E 1L9RA 3SODB 2J21A 3W2DL 4ZW3A 3FJTA 3O2WL 1PD1A 4U1LA 1KGCE 4JHBA 4Z0BH 4CNIB 3GO1L 3LPGA 1SHXA 5KN5B 1XAKA 2TRHA 3VYOA 3MSPA 1YMMA 5D5MB 5E51A 4L3CA 3TLRA 5FOBA 3OB0K 2QKIA 3KGTA 4O5LH 2NY4D 2CMRH 2ICES 2VW7A 2NLJA 3GHBL 1PGRB 3MGOA 1I7TB 2OMZA 1DCLA 3FB5B 1CLOL 2RFXA 4QPEA 3C2AL 2GUOA 4M5TA 2FJFB 5T1JA 4KVCH 1J1XL 2VZVA 3UAFA 2EDOA 4PB9H 3V6BR 2H0JA 3Q2LA 4DP5X 2F5BL 2R56H 3GJEB 5H37A 4TQ8A 1JGUL 1I7UB 1I8KA 1EFXB 4L9LB 4X5RA 2HVKA 1JOIA 4XP9L 5D7LD 3S4SG 5GGQH 2J4WH 3UX9B 4NI6A 3UXFA 2AEIT 2HVJB 3NFNB 1TTBA 4R84A 2OP4H 1T6VN 3BUPA 2XKNB 3MMEA 1CLZL 3VYNA 4UT7H 4DEPC 1I53A 3T6XA 4IRJD 3H9HA 5EBWA 2CDEA 1TJIH 3EGXA 1XGPA 3HZYB 5E6ZA 1MDAA 3MJ9H 5JW3L 3CSYB 1NIAA 5I1HL 4O2CB 4WJKB 3KLAB 4X9FA 4XOEA 3RKDD 3DXAE 1PJWA 1FORL 2VR7A 5CCJA 4J6RH 5AG8A 4PJXA 4HD9A 2Y72A 1U3HC 4OCYH 4MX7B 3P4LA 2YSSA 5T1LB 1G7JB 2VSMB 1FG9C 1UCBH 2ZT9C 2Q6WB 2VSDA 5SWZD 5E94A 4ZFGH 4KNQA 2XV2A 3LD8B 4UTCA 5C6TL 3QCUH 3CFMA 4J3UA 4MDIB 1OGSA 4Z7NE 1NBYA 2KLTA 2OL3L 4OCXH 5DD5H 4N0UA 4M5ZL 1HH9B 1AQKH 1I7TA 1KLGA 3RX7A 5BMFL 3ENEA 1ADWA 3CCHB 5CBAB 2CK0L 1JWUA 2E9GA 3HG0A 4OB5L 5J1AB 3NAAH 3QWOB 2G75B 3IPFA 4FQXB 4AQOA 3NCMA 5DVNA 4G80B 4WV1B 4AG4H 3G3LA 1GYVA 3NEEA 4KK6D 3MLWL 3SYPA 3VTMA 2EE6A 3ZHLA 4QHMB 2BWQA 2FBOJ 3LQZA 2WVTA 3RIKA 2A73A 4PRDA 2WZPD 4DGIL 3IDJB 3INUL 2YHGA 3PY9A 4JB9H 3X1NA 4D9LH 2XPYA 2IMMA 1H5BC 2BY2A 3TEXA 4QLRA 3FQTB 3MNVA 1GTFA 2KS0A 4MAYD 4BFBD 4N25A 4HIJA 4PSPA 1I4FA 3FQNA 4ACPA 1BQUA 3CFDB 2UY7A 5INDB 4PJBB 2VITB 4M43H 3NCWA 3DV6A 2DQEL 4U6YA 1XR9A 1HTYA 2VR4A 3SDXE 3VFOB 4Y2OA 1U3HB 2FL5A 3PDOB 1IZJA 5DZJA 3IFPB 1HHJB 4I1PA 3UTPE 2RR3A 1C5CH 1T0MA 4L9DA 3P3YA 4PRID 2WQSA 3FFDA 2A6DA 2BZCA 5BZDA 4LAQH 1QP1A 3FRUA 4TL4A 4C4BA 3Q1EA 2EDNA 3N0AA 4HWBA 4M7KH 2NUPA 1FP5A 2P24B 2IAMC 4RMTA 2FLBT 3FUNA 4TNVK 1F42A 1ZXKA 1SNRA 3CZGA 4Z7WF 1EJ6A 3SDXF 1DEEB 4CJ1A 2WGXA 2YZ8A 3SDXB 2ATAA 1H9VA 5FHAL 3P3UA 3TF7C 3FH7A 1FO0A 1SQ2N 2YXWA 4NN7B 3FQRA 4K5OA 4ABWA 3AQDA 4JQXC 2YPKA 2VW6A 3KS0H 4U7SA 3WSQL 2F19L 2P47B 4LSUL 1CR9H 2WLYA 1BBDL 4H2CA 4Z7QF 1AZNA 3CD4A 3CFBA 4MAYA 2AK1H 2ED8A 4BQ6A 3CGTA 1MJ8L 5CF3A 2NSXA 4WI2A 3FTVA 3EJYC 4G5ZH 3LQMA 2R9HD 2UY6B 1RLBA 4ZTEA 3BH9B 2L4OA 1G7QA 1XIWD 2FX9L 2DICA 4AM0A 2B3RA 1CZ8H 4AJYV 3DV6B 5D5MA 1JRHL 2OMVB 4IBUA 3N5AA 3CFUA 4ZW7A 1ULVA 2CU9A 3NBNA 3QUXA 2XSKA 3VD9A 3ARFA 4RRPA 4UNTA 2X4PA 3TN0B 1T4WA 3F85A 1EZUA 2HG5A 1T80A 2N59A 2LTQB 5AALA 5BRZE 1MFAH 5DLLA 3GMLB 5E2JA 1LM8V 3C2AH 3MACL 4R96B 3ARRA 5GGRB 2W8CA 4DQOH 4XNAA 1JZGA 4XBPA 1UVQB 5I0XA 2WXIA 4XAWL 3Q0HA 3O3BA 2OMWA 4AENA 2CUIA 5SX5H 1AQDB 1S7XA 3GGWA 1EHKB 4IMLA 4LSUH 4X98A 4P2RB 5DDHB 4LLWB 1RQ5A 3PAYA 3GSOA 2GTWA 4F8PA 4N6QA 1TEFA 4AIZA 5LUMA 4UAOB 4FD0A 2WXLA 4LBEA 2GJZA 3UMTA 4K94C 2NCEA 3MJ7A 4KRLB 5ACLA 2XT1B 4P5TC 3UIZA 4ZQTA 3HB3C 4Y5XA 3WIFA 4M9PA 3BUDA 1A8ZA 3KPPB 3DKHA 2YARA 5IHZB 5GJSL 4MAYB 5C9KA 4MNGE 4AIXA 3ROOB 3E6FB 5IVOA 4P46A 4OAWA 4NO0A 3O9WD 1NCWH 1H0DB 1JNHA 1G7JA 4UOW1 4JHAH 4DZBA 5I1IH 3O0LA 4XP5H 4G6JL 3U46A 4BQ9A 3I6GA 3P40A 4AL8L 5DRWA 3RHWK 2ZXBA 3QUYC 1XGZA 4ZFOB 4P4RA 1K6QL 3G5XB 1SLWA 4E9QA 2P45B 1KPUA 1A4BA 4P2OB 2H32H 3UJIL 2J5WA 4J3OC 4X5LA 3AS3A 5EEUA 3F7RA 4OQTA 5IUSA 1G5AA 5AKSA 3RFZA 2P43B 2HG5B 4BWUA 3EXJA 1WIPA 3H9HB 1EFQA 1S7WA 4YHML 3QNZA 4UOJA 3X12A 3Q5TA 2VISB 5GGRA 3QPXH 3RBSA 2VR3A 3MQIA 4ONFH 3HZKA 4HOZA 3INUH 4JB9L 4D9LL 5HHOD 4N0FA 3QRBA 3JWOC 2VQ1A 3IDYB 5C0AA 5CEYA 3DTXB 3WGVB 3X14A 5B8CC 4C4KO 1F4WH 1MIEH 5F7FA 5DZ9A 2WKOA 3U4AA 1M71B 5GS0C 2DM3A 4YGVA 1IV8A 1QUPA 4M7LL 3EYUH 3STLA 1GA2A 4XVUD 4PBDA 2XCMC 2WNKA 2X10A 2QELA 3QIUB 2DEWX 4PJGA 1HYSD 1DJZA 4HIJB 2VM4A 3P0YL 4OJFL 4TLKA 3V0AC 1DDHB 4PMEA 3WFZA 1TVBB 2HJKB 1BX2A 3GUFA 4HJGB 3APMA 1S7RB 2X2JA 4GRMA 4TUKH 5KBKA 1WYJA 3DROB 2QQQA 1K2DB 3ARDB 5D7JB 5D7KD 1XX9C 2HVKB 4PU2A 1ZMYA 3C60A 2QL1A 3U2IA 1OW0A 4DPBX 3FBKA 5JQ6L 4NT6A 1A1MB 1QLFB 4LCYA 1G7HA 2EO1A 3P11L 3PIQA 1OP5K 3PQYD 4Y9GA 1GZHC 3EDJA 3ZE1B 5C70A 5DD3L 4LF3B 1A0QL 3TA3A 3J07A 1JGDA 3GSXA 1XO8A 1OAZL 4UNUA 1PMYA 4HF5L 5A40E 4Z18A 1GGIL 5F1KC 1ZJAA 3E9UA 3WO4B 4PJFE 1YECH 5KW9L 4ERSL 4HU2A 5FM8A 1ZA3B 3DJZA 4H8VA 3CPLB 1TTFA 2YKKA 3ZKMD 5I1JL 1WA2X 2VJXA 1JZEA 1VSCA 3E80A 3ABMB 4M5YL 4APQD 3MRKB 4KXDA 4LLUA 5HJ3A 4AYEC 2N3JA 1A6AB 3MVSA 4MGXA 3L1GA 4WKXA 3FL7A 4PJIB 5BJTB 1GZQB 2XYCA 1FBIH 4PTTB 3M07A 4TUOA 5SWZE 4N2FA 4ZOEA 5IFAH 4B96A 3MRHA 2DWSA 3T3MB 1MDTA 1RJLA 1CT8A 4R7DA 3CLFH 1NM4A 4P5KA 2VN7A 2OMVA 3GHBH 4UBDC 4NX0A 2CMRL 5D4HA 1JE6A 1NTDA 4LLQA 4HS8L 4YXHH 3EOTL 2G3MA 3FSVA 3NVQA 5CWSB 5I15L 1BJ1H 3QCTH 4GQZA 5CKAA 2NYYD 2AZUA 2PP8A 5J5EA 4WFHE 2X41A 4PI0A 2V17L 4AEHL 1OCCB 4LEXH 2FSEA 2WQUA 5DUJA 4ELMA 1TQCC 2O61B 4OVUA 5J56B 5EFIA 4LDLB 2C7UB 1QTPA 5D1XA 4GUOA 1MRDH 3P1VA 1M1XB 1R3LB 2F58H 3F00A 5F9DC 1MJUH 5IHUH 3EYFB 4F9LC 2AABL 4PCYA 4OLEA 1TYJA 2N7AA 1T7YA 1YEWA 5FYJH 4OTXL 3HMWL 4C56D 4XZUB 3HI1B 4J1UA 3SPHA 1ZVSA 2IFGA 4AIZB 4FA6A 2ZKWA 3TCTA 3O3AB 3CPLA 4L05A 5CD5D 3GDBA 1H8OA 3CIAA 4A6YB 2X1XR 1OPGL 4N2GA 4BZ2A 5I18H 4A63A 4IOIA 1CBVH 4OV5B 1XGYH 1EO5A 1EO7A 1JPST 1DQMH 4JPWL 4Z7UB 1AG0A 1EDHA 3U7AA 4AE0A 4Z7AA 2A6DB 1VIWA 2XPZA 5BZDB 3LN4A 4XAKE 1S7QA 3IBEA 3T6QC 2Y6SC 4TULL 2B9BA 3PNWA 3U0PA 1SJVA 3UP6A 1OGAB 4QRQB 2UWEA 3OR6A 4P8QA 1ZTXL 3MBXL 4OZHF 4L1DA 1H3TA 4EJ1C 4P59L 2AQ1A 2PXYC 2IDSA 4JO4H 2KQMA 3MA9H 2B59A 1JRHI 2KHAA 3LNDA 1WTGT 4XPAH 2V9UA 3EJCA 2B20A 4WGWB 1NCBL 2WQXA 3D05A 4ZG1A 1HK6A 3TONA 4JZJC 4GKZA 3PWPB 4KXCA 4OIIL 1MH5B 4XO4A 2HH0L 3SKUD 4OZIB 2C1PB 3VGAC 3ECVA 3KPTA 2DEXX 5EBLB 2H6PB 3KBFA 4G8FA 4ZMLA 3N1QC 4GS7C 5TE7L 5I26A 1GGIH 3TJPA 2F2HA 3FTGB 4AVHA 1H6FA 3I9GL 4F2FA 3I02A 3ZU8A 5JIPA 4X8JA 1JNLH 2GI0A 5C09D 1V5JA 3UTPD 4HUVA 2HH0H 2D3VA 1NLDL 4FNQA 5H37G 3LZQA 1W8OA 1PKQE 2VDQB 4ZYKB 5BOZG 1AO7E 4H1LG 4B95C 5JW4R 4XPAL 1KYOJ 4WZ9A 3HUJF 2DIEA 4Z7UF 4YR6B 2DQUL 3J27A 4ZFZB 1PZ5B 4M7ZC 4ODSH 3D09A 4IKNA 2WXKA 2A4EA 2Z31B 3ZY7A 4ZFFB 1AKJA 3QUXD 4ZX6A 4APXB 1UEMA 4JE0A 1N18A 1QKZH 2X0UA 1ONQA 3VD2A 3QFDA 1V7MH 1NEZG 4M6MH 3L3DA 1U92B 1A1NA 1MHHB 3QDMD 1KYOK 5KS9E 1SDYA 4L8SA 3F62A 1AXSA 1LQBC 5IKCB 2ZOOA 2EYTA 4PS8A 1EXHA 2UXVA 3EG9B 2JF1A 2BNUB 4GRLA 5CJQH 3ULSA 1CTOA 4DCQB 1S9YA 3WTUA 5JZ7C 5DD1H 2AABH 3B9DA 3BWUF 3T2OA 4JO8A 2ARWA 4E9VA 3MRBA 4TULH 1RK1A 1U8KB 1VZGA 2D7QA 5BV7B 3OSKA 4Q6YA 1BLNA 3FMGH 3QE5A 4RFOL 4U0RB 2DYPB 2ZXCA 1QNZH 4YDZA 2E4FA 4HV8B 3L6FB 3OZKA 3ARDA 5D7JA 4AEHH 4LKXB 4HZLB 5DZOA 1E3XA 1NOFA 3HPLA 3MLZH 4U1SA 1S8DB 2DKUA 2R0LL 2C9AA 5B39G 2B0SL 4P2QD 1RUQH 5C2BL 1XF5B 3MDJA 5JO5B 1QZ1A 3QEUA 4U1IB 3GI9L 4NJAH 5MI0B 1KGUA 3TA3B 2EE3A 4ZFFA 5L0QB 3VGHA 3I6KB 2OMYA 1IVLA 1YNKH 1FPTH 2YKLH 3B5GA 3GLEA 2CHDA 4OFDA 2BZ7A 3HAEG 5JXEC 4NAJA 3FB6A 1XWVA 1E4WH 4IEFA 3P2TA 1A1OB 2NUTB 2VXSL 4AZ8B 4ZQKA 3IAPA 1CFNB 3TZVC 3VI3E 2NX5E 3QNXA 2R0ZH 5IVXF 1BCIA 1WDAA 3TBYA 1IGML 3CIQA 1U91A 3LH2L 1NUFA 5E5MA 5IB5A 3DX3A 2JIXD 3C6LB 2NNCA 4XN4A 3NCJH 4TLUA 3PGDB 1JPFB 4G8GE 1FFTB 5C0ND 1YZZA 4Z7NF 2YRZA 1HXKA 2GITB 3NMEA 4BZ2L 1EEYA 2KI6A 3W3BA 1GGYA 4KXZI 1MCWW 4PW4A 3W9DA 4WAFA 3LN5B 1WCQA 1YEIL 2B1AH 4R3SB 4N3UA 4GPVA 2EDDA 1BVKB 2Q6WA 3ZQ9A 3EDDA 3CZLA 3T2LA 5I1DB 1U58B 1I8KB 1I7UA 2DMBA 1R24A 3MN8A 3FOMA 3OC5A 3SZ6A 3U82B 1JMXA 4DK3A 1PSKL 5JNYA 1KDIA 4PBWD 4HKXB 4N24A 3VXUD 3VRIB 1VFAB 1G7LB 1RZKL 3CC5A 5KANG 3LEXA 2E8ZA 3PNWB 3MRFB 3X1EA 2YD4A 5JO5A 2Y7QB 2AJSL 4XGZB 4YSSA 3O81A 4U31A 1JYXA 2QVMA 2R15A 4KC3B 2HT3C 4FTVD 5DJ0B 3JWNG 4CVZB 1JZ4A 3TF4A 4R8WH 1A14L 3QQ3B 3DV4A 3NUKA 1EJOL 3HNVH 5IB4A 4G1EB 1GIGL 2IGTA 5FF6A 1P5UC 1TVDA 5IIEA 1RUAH 1FYHB 1E9PA 2JI2A 3GSUB 2CHWA 3ZE1F 1GH7A 3IXAA 4L8DA 4QTHA 4QI3A 2PWDA 2HAZA 3WS3A 3L5XL 2BFVL 2RB8A 2W0FB 2OQJB 3BUQA 3QEHB 5D1QE 4FABH 5GZOC 3TBBA 2XVGA 4JRYE 5DWUH 4D3CL 4ODTH 2P5EB 1MCHA 1CTNA 4KKPA 3QXUA 2FWSA 4M7KL 5AW5B 2OSWA 4JG1H 1PW3A 1QA9B 2BP8A 4KY2A 4NQUA 2WKLA 4PJ9C 5E4EB 1PX8A 1KEGH 3BESR 2ZCHH 2R4RL 4ELKB 2Y36L 4EVNB 2CRIA 1XH1A 3T1WA 3TBTB 2J73A 3CFNA 1CFVH 3BVNB 3B7UX 1U58A 1BJ1J 1UFGA 1V3LA 5EMYA 5B3JE 4K7FB 1RJZA 2X4TB 3FSAA 4L29B 5DO8A 5HGAA 5HYQA 4G6JH 3MNDA 1ED3A 4UV4L 3T4YB 3FO1B 1JFQH 1YN7B 2X1QA 2WK2A 3FSOA 3GSRA 3KD4A 3GSQB 1NC4A 2IADA 4XWGL 4APXA 4F37F 5AB2A 3CH1B 1N6VA 4YWGH 5HD8C 3MRFA 2H6PA 2IDQA 4WW1B 2LW3A 3HTLX 5CBEA 1VAHA 2FH6A 2VLME 3QJFA 5JZ7D 2RCSH 35C8H 5C0AE 3SCMD 1QEWA 3FFCE 3ILQD 4UZUA 2I32A 1OO2A 1HKFA 4X5QA 3WO4C 1HWWA 4PGEB 5AZEL 2DL9A 4V1DB 5AOJA 4Z7QB 4GG6A 3NSXA 3PPSA 1YY9D 2A9CA 4J12A 5ANMB 5EA0L 2YOCA 4PR5B 5I5IA 2CO6B 2X28A 2JIXB 3C6LD 5D72L 4UQ2A 5D1XE 1S5IH 4HOXA 5MENB 3FHAA 3CPUA 1M53A 1U6AH 3MRPA 2P5EA 2Z8RA 1P4LA 2JQAA 2ZUTA 5GJSH 1MFAL 4JN2A 1AQHA 2X3AA 5DRXB 5DVLA 2QQLL 1C16B 4GW5A 5E9DE 4FFTA 2R69H 5KVFL 2HJFA 3ARDD 4KU1A 5D7JD 3ULUF 4Z8FH 2Z34A 3QFDB 2WWKT 2F1BA 3CDYA 1N19A 5AUMB 4UU9B 5L8JB 3QJHA 2CKBB 4U1MB 1YN6B 3U2JA 2YBRA 1QQDA 3ULVC 2FB4L 2KERA 4KTGA 3R1GL 4XPGL 5TGBB 1J5IA 3TPUA 1SF5A 3AMKA 5D6DA 2YA2A 5KVEH 2F7PA 3BLPX 1FORH 1Y6KR 1DJWA 4WNSA 3WTSA 4PBXA 4XPFH 5MERB 4X4ZA 1QI4A 4LEXL 2EZ0C 4Q0XH 1HZHH 5DF0A 2QPEB 3L4YA 4HC1L 3PV6A 2NY3C 1EO8L 3RWCA 2VMEA 2HT4C 4F93B 2V2TB 4MD4B 3WD5L 4PJBF 1RP9A 3BKMH 5IBUB 1BAFL 2HJLA 3D2UA 1F6LL 4QXTA 5IG7A 2JLPA 1XGRB 4XB7A 1AP2A 3RFZC 3F7KA 1HI6A 2PPFA 1MEXH 4M1DL 5C0FA 4NKMA 5LXGH 4ZUUB 2Q5BA 5DK3A 5ANME 1USQA 3M6DA 3MNZB 1XF2A 4S10A 4Y1AA 1FFOA 2P5ED 4MMYA 4PY7B 1AOZA 3CZFA 4JPVL 5HGDA 3CHQA 1FNLA 3G6AA 5AKRA 3BFWA 1IC0A 4OVVA 1U2HA 4LLYB 1QAWA 1KTDB 2Z65C 2DYSB 4R4FL 3GRGA 3NIFF 3MRGB 5GS2H 5CGBA 2EC8A 1A4CA 3SPGA 3FCSB 3OXRB 4N2CA 4W9HC 3TZVB 1A1OA 5LBVA 5FWRA 4PJ5A 4NBXB 3ZE1E 3WN5C 4F9LA 3Q06A 1QYGH 3LZRA 2ZP9A 2F0CA 5EO0B 1A7BA 2N7BA 4PGBA 2BHYA 4YFEA 3KGRA 3K2UH 1NMBH 1HCVA 3NJLA 4MQ7A 4OD2A 2VLRD 1IO4C 1T2JA 4PG9B 3GSUA 3VG9B 4FMFA 3KBEA 1WGVA 3JTSA 3RTQC 4TUKL 1DQLL 3AREA 3KPSD 4YGVB 4MMZC 4LP4A 3IU3B 4O2EB 1AR2A 2EDRA 5AVQB 3RX9A 4ZODA 2WTPA 4AUJA 1QD0A 4CW1B 2RTTA 1DUYA 3G5ZB 3ULVF 1VGKB 4M3JA 3LQAC 1XF5A 4M43L 3L3HA 1HXYB 4OKVB 2P4AB 4JMNA 5KYYB 2WKOF 3I84A 4FERA 5BS0E 3RWJB 3KYOA 3NTCL 3Q05A 3CMOL 3HJ0A 3B9VA 4FQ2H 5A2JH 5CINH 5FUZL 5I5JA 3W0WE 3I75B 3MRGA 1YNTA 1PG7X 4RETB 4JM4L 1MPAH 5CEYB 2XQYK 2BNQD 4X6CA 1QSEB 2FYYB 4I0PC 3GXDA 4DP9X 1JXDA 4IGBB 5E2VL 3LIUA 3FTXA 2SEBB 2WBKA 5H4ZA 2D7OA 3VMPA 2R51A 1Q9KB 1RZKC 4EZLA 1A14H 3DYPA 4KZCA 1WRFA 1BQ5A 3QUMH 3UYRL 5F3FA 1ACZA 1CN4A 2R69A 1AS8A 3D0VA 3N43B 2H8PA 4HVBA 2HRHA 3N44B 3O3EB 1T21A 4HLZH 5EZJA 1N6UA 4BINA 5IROC 1P1ZB 1BX2B 4XP5L 1PLGL 3BVXA 4M5ZH 5E8EA 1CWVA 3MJWA 1ET5A 5SWSB 2OMZB 1Z1WA 4Y5XC 4BSWB 4YVNA 4V1DA 3ARED 3KPSA 3C5JB 4OW6A 3VXUA 1S7TB 3S4SB 4EBQL 4QRBA 3U30B 4OFYA 4ELKA 4KTEL 2AF2A 2VLJB 3D85D 4RMRA 5D7IF 2H0FA 4JHWH 2AEWA 1ORSB 1PIFA 5ESAB 2Z0BA 5A43C 5CUSL 3Q5OA 1CU4L 2PTTA 5LBSA 4OCYL 5KVGL 5ISZD 1CURA 2VDMH 1YEGH 5EN2B 4KWUA 5FW8A 4WI3A 4R7DB 3P3RA 4OKVA 5D70H 2DLIA 3QO1B 2JK5B 3D51A 4W9GC 1KLUB 3UZEA 1IGIH 2EDBA 5AUMA 1B3IA 3PYCA 4AMXA 4HMEA 2N7SA 2XXMB 4PLNC 3ARGD 1NL0H 2H1PH 2HT4D 3ZL1A 3KVQA 1HESA 5JIKA 3BP6B 1IGYB 2R0ZL 4OCWL 4UT6H 5E03A 5I16B 1T66D 4QDGA 4NKOA 3QJUB 2KL6A 4E36A 1S7SB 4PWEA 1XDTT 4XMWA 4MA7H 3U7WL 5LLIC 3M8OL 3KLQA 4LVOB 2ZCKL 3QULB 1AGBB 4GSDH 3V9CA 2OMBA 2YMXL 4RLDA 3ZVVA 1ZSDB 1AAJA 2FEEI 1AR1B 5DI8A 5CGYD 1N12A 5HHPB 5DT1L 5IV2A 1XGRA 5IEHA 3S5YA 5E9DD 1R5IA 3CQQA 3KPSB 3MTRA 2FT7A 2BOBA 4UOZA 4FJZA 1QSFB 3ILPA 4XRCB 1AD9B 3SIKA 2YA0A 1W6LA 4HCRL 3VDAA 1NWOA 4KVNH 1I1FB 4H5SB 2IADB 1T5WB 1UTDA 1GGBH 2H7WA 3ULVD 1H5BB 2OMXB 1Q72H 2QDVA 3DX6B 4U6HA 4A1RA 3BZ5A 1OAUL 3IEAA 2XJKA 5DJ2B 4ZD3H 2VXTL 2I69A 5CFHA 2Z93A 2N1KA 2R69L 1G7MB 1FIGH 1A6PA 2V8MA 3K8MA 2FZ3A 4LNRB 4ZOCA 5B38G 5SWQB 2FR4B 2JVUA 3CMOH 3D3VA 4OQTH 4CL7A 3BP6A 3FT3B 1IIKA 3T6WA 2GSGB 4H4NA 1GOGA 2ZF9A 5FK9B 2BWDA 2X9WA 3AXLA 4GBXA 3E8UL 3OG6B 2EKSB 4BCYA 3FCUB 3HVNA 3D18A 4MJ2A 4RMVA 3W0WD 1U8PA 3V6OE 5I75B 1AZCA 2DW5A 4UQDA 1L7IH 1FGVH 5GS3A 2G3ZA 2J72A 2Y1ZA 5H8DA 2XZZA 2J20A 4XOCA 3DA0A 3U9PL 2I25N 1FL3B 4H0HB 2EXWD 4FYRA 5DZNA 2A38A 4DN3H 1UWEH 1QPXA 1RPQA 1KYDA 3C6SB 1NBVL 5E4IA 4N68A 1UT2A 4UU9A 3DDGA 4NZJA 3NSFA 4GI8A 5IWLA 4WHTB 5D96B 4URKA 4X7TB 1J9CT 5DURB 1IQDB 5CEXA 1N68A 3HB3B 4KXBA 3HE6A 3QW9A 3WDHA 5SX4H 2OYMA 2Y3AA 3B9KA 3I3DA 1QYGL 1ROWA 1KPRA 4GFXA 4WHCA 5HI5C 4XNBA 1NCGA 5EO0A 4RSYA 5ITBL 3QWRD 1AFVH 1FDLL 4M1CC 1G94A 2ZKHL 4NSKB 5DR5H 3WXVH 1UUSA 3FQXB 1JK8A 3V0WL 1IBDA 4J28A 1P84K 3U4EA 3HE6D 3ZHDA 3WO3B 4OZHA 3R4DA 3RTQB 4GRLD 4HLJA 1NBZB 2L04A 5M94B 1F1AA 4K8RD 4EI6B 2FBJH 3DPDA 5JPMC 3MV8E 4JG1L 2IVFC 1W9XA 3REVA 5D9SA 5E95B 4G6FD 1AQKL 5I1EL 2YGNA 5TE4L 4FFWD 1ZS8A 4P5SA 4PV9B 3LHAA 4H8PA 4OFIA 3K0YA 4F7KA 4E9RA 2A77H 4X9YA 4H26B 2ESVE 3FOLB 4PRPE 3MRLA 2O6DA 4R4ND 5LCVA 3TBVA 5K1JA 4ZFZA 2BVOA 4AVJA 3JT0A 3LXAA 1WT5A 4JRYD 3VFPA 1TOXA 4JUSA 2IAND 4M48L 1WAPA 3AQXA 3IDXL 4EN2A 3LY6A 3OF6A 3QQXA 1IM9A 1CYWA 3HNTH 3MLTB 4GJTB 1YEIH 3WBDA 2JWYA 2RGSA 3NFSL 4XHJD 3ASWA 4TM9A 1J9RA 1U92A 1YY9C 4K3EH 1M3IA 3ETSA 1CICD 3KG5A 5FYKD 4LSQH 4UT9H 3RZCA 2DLTA 4NM4H 4NRYA 4Q9QH 3D25A 1NKOA 1EUUA 3QO1A 3JV6A 4KK5C 2B39A 4QRFA 1NCIA 1THAA 3EJPA 4G70B 4AK1A 5CZXC 3WS6C 1ZLEA 4FC3E 1A7OL 4LHUB 1NPNA 1QBMH 2FB4H 3NCYS 4HXBL 1N2RB 1EHLL 4WNQB 1BREA 3FBQA 2LR4A 4L3EB 4QOKA 5DMGC 1WHPA 5L2KD 1DE4A 4W9FC 1TG8A 5IMOA 5D7IA 5DFWH 1UH3A 1G43A 3BIBX 4RESB 3RWEB 5B39A 2EE2A 1K8IB 4KQ3H 3QUGA 3K80A 4K5PA 4FFYH 4JZNB 3T65A 4M61A 3GI9H 1BECA 2R1WB 3UTQA 4P9HC 3W39B 4A7SA 1IJ9A 2P8MA 2LV4A 4L4VE 4PGDA 1JHTA 5AB9A 2VLRA 4XX1G 4OY9A 2PTTB 4P46D 4H26A 4KTYA 1HXYA 1R33A 2B1OA 4S0TD 1FL6A 5JTWA 1J8HD 4MXQD 1KBKA 2QKIB 4A7UA 5C0JB 1YMMD 3B5HA 4XXDB 3RWJA 5F9JA 1S7RA 4KQ3L 2V6HA 2IOIA 2VMFA 3SY0B 4JG0L 4FULA 4JFFE 2KT6A 4OF7A 4YK4C 4B3EA 3L3KB 4PWIA 3TOPA 5K9OB 2ATPA 3FOMB 4AGOA 1LEGB 5CZVL 5D1ZI 1R75A 4Z1PA 3DO7A 3S37L 3ME0B 1Q1JL 4IW4C 1BVOA 1QBML 1DVFB 4HXBH 5HDQH 3H2QA 1QFOA 3SDYL 3OHXA 2Z4TA 5I1JH 4XVJL 1XBDA 3NJMA 4UM9A 4TSCL 4F7TA 3UTZA 2G0KA 5F96L 1YPZB 1BFTA 1UHVA 4MZRA 3QIWD 2CKBL 3CSFA 1HYRC 4HEPA 3SPVB 3D07A 2B1HL 3ECUA 1I3GH 4IRSC 4HFWB 3VXSD 4CN1A 3T1FB 1AZUA 2YD6A 5C09A 1A0QH 4MNQB 5I5MA 5F7WC 3KNBA 4K23L 2R4RH 2ZCHL 4WI8A 1J0JA 1JFHA 4QTHB 1UKQA 1X4ZA 4R5TA 1N67A 4D9QE 3T0ED 3KM1A 4W9LC 3ZDZE