1ET8A

Crystal structure of nitrite reductase his255asn mutant from alcaligenes faecalis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
339
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPNLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Catalytic roles for two water bridged residues (Asp-98 and His-255) in the active site of copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 88
structure length 339
sequence length 339
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et8A02
4YSAA 2FQFA 4ZK8A 2RACA 5B1BB 4M3HA 1FWXA 4G7QB 1OF0A 1JXDA 3ABLB 4HHGA 4EF3A 1F56A 1A3ZA 3RYMA 1T5KA 2HRGA 4YSRA 5D4IA 4DP8X 2HX9A 4RH4A 5I26A 3CDZA 4BXVA 3V9CA 3NSFA 2FT7A 2AZUA 1RZPA 3BVDB 5B1AB 3S8FB 1SF3A 2Q5BA 4A2EA 3QJSB 3S3CB 1NWOA 3NJMA 2OCCB 1XB8A 3DTUB 4E9RA 2EIJB 2I85A 2EILB 5PAZA 1BXUA 1OCZB 1W8EA 3QQXA 7PCYA 3WG7B 3TBBA 5I6PA 3FU7B 2VMJA 5EHFA 3ABMB 2CJ3A 4BWUA 1AZCA 1XMEB 2HX7A 3AG3B 5I6LA 1HFUA 2PP8A 2BW4A 2YQBA 3N55A 2IAAC 4NB7A 2GHZA 1V54B 8PAZA 1KYAA 1GS6X 2XUWA 1SHWA 5I6OA 3PPSA 2CBPA 2PPEA 4A2FA 1E5ZA 4AX3A 1NPNA 1AZBA 4A67A 4DPCX 9PCYA 4G72B 2E86A 3UAEA 5B7MA 3ABKB 1CYXA 4NERA 3T9WA 2HZHA 3NJGA 3S3BB 3NJKA 3TA4D 1KBVA 3BQVA 2EIMB 3ERXA 1OOWA 1E30A 3T6XA 5PCYA 2EIKB 1MZZA 5AFAA 5B1JC 3FSAA 3FQ1A 3AG2B 2BP0B 3ZDWA 1JZJA 1HAWA 4JHUA 1BQRA 2UXVA 2YXVA 3H4HA 3WKPA 3UADA 4HIPA 3KW8A 2IDSA 1JERA 4YSEA 4Q89A 2X87A 2OV0A 2XVBA 1SFHA 4YSTA 1SJMA 1BYPA 1JOIA 4W9ZA 3KW7A 1JZFA 2QT6A 1OE2A 3ZIYA 1FFTB 1OCOB 1JVLA 1W6WA 2PPCA 3OQRA 2FNWA 3OD3A 1AZRA 2PPFA 2FQDA 4GY4A 4CSZA 2DWSA 2JKWA 5FC9A 1GR7A 2VM4A 3X2QB 2N0MA 1ZDSA 2AVFA 4YSOA 1ID2A 4A2DA 1L9RA 1NIBA 2GBAA 2PLTA 4WKXA 1L9PA 4BWTA 1M57B 1AAJA 3TASA 4AI7A 1ET7A 2YAFA 1EHKB 4N4YB 1XB6A 1JZIA 3GDCA 1J9RA 1KBWA 4M4RB 3IE9A 3CG8A 1HAUA 2IDTA 4JKNA 2NRDA 1SDDA 2XV3A 2XX0A 3JT2A 5B7FA 1PNCA 3NYKA 4E9QA 4E9WA 2UXFA 5D4HA 2WSDA 2QPEB 2GC7C 3QJUB 1WAEA 3FU9A 3T6ZA 3FSWA 2JXMA 1ASQA 3OMNB 3X1EA 3C75A 2B3IA 1MG3C 2J56A 2QPDB 1OE1A 3ABGA 2YXWA 1IUZA 2GIMA 1GY2A 2IWEA 4GP4B 1JXFA 4YSQA 5TK2A 1DZ0A 3ASOB 4N8UA 3ASNB 1AG6A 2IWKA 1A65A 5F7BA 1NDTA 1RZQA 1BYOA 2YAMA 3NJJA 3WI9A 1QNIA 6PAZA 2GI0A 4A66A 2CAKA 4YL4A 1OV8A 1PF3A 2I7OA 5F7AA 3PCYA 1WA2X 4UANA 1ZPUA 2IDFA 2UXGA 5ANHA 3PAVA 2ZOOA 3AW5A 4BDVB 1J9QA 1W6LA 1J9TA 1AZUA 1PLAA 4AZUA 2H47C 4G71B 1CC3A 1NIAA 3D12B 4X4KA 5AKRA 4BXSV 3X1GA 1PLBA 5I5IA 2XV2A 2W8CA 3WKQA 1JZGA 3ZX1A 1L9QA 1TEGA 3FT0A 1AIZA 3DIVA 2YAOA 1AACA 3H4FA 1WA1X 3U25A 4TXVB 1EZLA 3X1FA 1ZV2A 2GSMB 1MG2C 1BQKA 3CVBA 4UAHA 1NWPA 4L0PB 4DPBX 1JXGA 4P5SA 1IC0A 2R7EA 1A4CA 1AANA 4AKPA 1PZBA 2DYSB 2GB2A 2X88A 1ET8A 2VSKB 2XWZA 2ZXWB 3IN0A 2A3TA 1GYCA 1FA4A 2OJ1A 2H5UA 1KCBA 4KO7A 2AANA 1QHQA 2FQGA 2DYRB 2BP8A 3GYRA 3NSYA 3ZBMA 3NJIA 3CVCA 4JHVA 4E9YA 1AS8A 3NJNA 2VW6A 3AG1B 1PZAA 1SFDA 1NTDA 1A4AA 1BXVA 2FTAA 2TSAA 3PAZA 4GP8B 3MBWB 3CDZB 3SBQA 3EHBB 4HCIA 2PP7A 4AKQA 3NJHA 3NP3A 2LLNA 1JZEA 3QJRB 3DKHA 2MTAA 2PPDA 1CUOA 2FWLB 4BK5C 2HXAA 2XXGA 1KCWA 4GYBA 3WNJA 1ADWA 2CCWA 4DP6X 4E9TA 4HAKA 2AFNA 3FYEB 4DP0X 1AR1B 3MX0B 4YSPA 3JTBA 4ENZA 4YSDA 2P80A 2JFCA 1A8ZA 1AS6A 5B3SB 2YARA 1JZHA 4YVNA 1ZDQA 2H3XC 2PP9A 5D4JA 5I28A 1PCSA 1M56B 1URIA 3QJVB 4G70B 4F2FA 3FPXA 2BZCA 3AY2A 1V10A 2XX1A 3FQYA 2FT6A 1X9UA 4MFHA 1SNRA 4E9VA 2DWTA 1YLBB 2CALA 2B08A 2YAQA 3FQ2A 1IBZA 2IWFA 3UAAA 1RCYA 1L9SA 5B7EA 3PXLA 3FSVA 4YSSA 2J5WA 4AKOA 4GXFA 1WS8A 2R7EB 5B1KA 1BAWA 7PAZA 4HZ1A 1GSKA 2BW5A 1BXAA 1OCCB 1RKRA 4WTQA 1ZIBA 2J57A 3NSCA 2IH8A 4G7SB 4HALA 2BP8B 1E67A 2I7SA 1J5DA 2ZWNA 3G5WA 6PCYA 3QJTB 3TBCA 2BP0A 2AZAA 2IDQA 3WNIA 1CURA 2Y1AA 1PMYA 3N2JA 5I5JA 4DP2X 1IKOP 1BEXA 3FSZA 2XXFA 1GW0A 1ZIAA 4FAAB 5B1JA 2XYBA 1KGYE 4F2EA 1OCRB 2DY2A 5E9NA 3NJLA 4G7RB 2XLLA 2QDWA 2BWIA 1KV7A 4W1TA 3FPYA 4QKTA 4P5RA 1GY1A 4DP9X 1ASPA 1N70A 4DP1X 2GC4C 3SBRA 2J55A 4YVUA 3TU6A 2FQEA 1MZYA 2MRYA 3FU8A 1NICA 2PCFA 3T6WA 3NJFA 4DPAX 1UATA 3HEIB 3NSDA 3NT0A 4CSPA 4QLWA 2WO3B 2FT8A 1TKWA 4PCYA 3NP4A 2BO0A 3T71A 4E9SA 1WS7A 3UACA 5I6MA 1I53A 1ILSA 4KO6A 4HHWA 3EH4B 1AQ8A 1X9RA 4HCGA 3PLYA 2VW4A 3QPKA 4F7KA 4YSUA 1GS7A 5IY5B 2UX6A 1NPJA 1N68A 3UGEA 2YAPA 3FS9A 3H56A 1XB3A 1SDDB 4UF7C 1E65A 4HCFA 1ILUA 4NAJA 1BQ5A 1ASOA 2IDUA 1AG0A 3T6VA 2HLEB 2TSBA 2Q9OA 3X1BA 2VN3A 3SBPA 1B3IA 2BHFA 1NIFA 2CUAA 1ETJA 2BZ7A 3WIAA 4E9XA 1AS7A 4PAZA 1V55B 1CYWA 3IN2A 4KOBA 4KOCA 2XU9A 2YAHA 2UXTA 2BWDA 3OM3B 3QJQB 4Q8BA 4A2HA 3SQRA 4KNUA 1NZRA 4KNSA 2IH9A 1J5CA 3IEAA 2EINB 3IBOA 3UABA 3V9EA 1NINA 1DYZA 1QLEB 4A68A 5I6NA 1KDJA 1TEFA 4DP4X 2VSMB 2PCYA 4A2GA 1WA0X 1MDAA 2XV0A 4KO9A 4FA7B 3FYIB 3EH5B 1OE3A 3FU7A 2UX7A 1M9WA 1AZNA 1PNDA 1J9SA 4KNTA 1E5YA 2HX8A 1R1CA 1KDIA 4BDVA 1TU2A 1VLXA 1ET5A 2DV6A 2P80D 1SHXA 2W88A 3S3DB 5AZUA 1PZCA 1PAZA 3CZUB 3EH3B 3L45A 3OMIB 2QDVA 3PAUA 2Y69B 1AOZA 2PPAA 3CVDA 2FJSA 3OMAB 5LDUA 4YSCA 1IBYA 4DP7X 2YAEA 5TK4A 3AZUA 4DP5X 1JVOA 4KO5A 1GS8A 4K9JA 1L9TA 1A4BA 1NIEA 3GXUB 3HB3B 3EF4A 1SF5A 5I5MA 1L9OA 3S8GB 2VW7A 5A7EA 2VM3A 2WO2B 4BWWA 3X1NA 2HRHA 5I6KA 1PY0A 2ZONA 4GP5B 3AG4B 1NIDA 1PLCA
chains in the Genus database with same CATH superfamily
4NM8L 1A47A 2RACA 2WP3O 2VQ1A 4ENEC 5E0FA 2ZWLT 4R90L 3WU1A 1A8JH 2WIIA 1BVKA 1JE6A 3DRQB 3SE9L 2NY0B 1E6OL 4XPGL 1YEGL 4PGEA 5T3ZH 1T5KA 4XPFL 3OKYA 1S5IL 3MBWA 1ZSHA 1AFVL 1B2WL 2HX9A 1U8PB 3OAWA 3CDZA 2AXHA 3GMPB 1OO2A 2E8YA 3S8FB 3L3HB 4NZUL 3IFNH 4IBUA 2ZOTA 3RFZA 2OCCB 1FO0A 3BUYB 3MBED 5D1QA 2HRLA 2EIJB 4O4YL 4L8CA 5CNHA 4FLSA 3AC0A 1BXUA 3QJFA 2CR0A 2GK0B 2QVTA 3FTSA 3J27A 4CVZB 1S3KH 2O5ZL 3A4EA 3A4FA 1JWSB 1T0NA 3BDXA 3GC3A 4XMLH 1FG9C 5EO1B 5CEZL 3QNXB 1JHTA 1GL4B 3GB7B 4EIGB 2IC2A 1DFBH 1WT5A 3ZDZF 4U05A 5MENE 4QRTB 1FVEB 2AQQA 2ZXBA 1SHWA 1Y1DA 4JFFA 1NPNA 1OM9A 3KDPB 1XGPA 1Q9OB 2ZKHL 4PRID 4HGWA 5L7XL 3N1MC 1FVDA 4AL8C 3DOSB 2BSTA 2AW2A 2VLME 2YPVA 3B6SB 3NJGA 4GSRA 4JM4H 2AJZA 4E2OA 4ZNEA 2WLNA 4POUB 3ML8A 3F7KA 4ALAH 2CUHA 3DHUA 4JPIB 4OJAA 2EIMB 4WI4A 4QRPB 2ZKMX 1EEQA 1P5UA 3DJRA 1FZOA 2JKRM 2NY2B 5E6ID 1PZ3A 2AK4B 4PJXB 1B4JH 1JTOA 1CGTA 3MLTA 4FFZH 3ZDWA 3I6LE 4N1CA 3AWGA 3TO4B 5DC9B 1YO4A 4PHZA 3MRBA 2YXVA 4GH7B 3UADA 1CFTA 1DVTA 4I7ZC 2R2EB 4NC1E 4YLBA 4KJQC 5I74C 5E2VH 2PO6B 1LP9A 2WVVB 3D6GA 2PYFA 3QZOA 5BVJB 5T1JA 3LTVA 4PBDA 1J18A 2L4OA 4XR8C 5GS1B 5I1EL 5MP6H 1P4IL 2CLZA 2E9WA 1BFOB 1EFXB 4WI6A 3WIFA 1JZFA 1IAOA 1OE2A 5ICXA 3ZIYA 1U3JA 1FFTB 4N6RB 3UC0L 3K74B 1HZHH 3MRPA 3BDBA 4L4TE 3OD3A 1IGTA 3C87A 1J7VR 3F58L 2A0LD 2A74C 4L3CA 4I0PC 4KK9D 3V5KA 3V8CA 4XN4A 5FV1L 1ID2A 3QCVL 4U2ZA 4TQ8A 5T3ZL 4D0DA 4G80B 4N2LA 1PZDA 3H6AA 4K7FA 5GJTH 3RZWA 1CICB 4L4VE 4KTYA 1ZKAA 3NDZE 4AYFA 2OSLB 2IIJA 3FH7A 5HGDA 4F7TB 1MHHB 1H3VA 3BVNA 3IK2A 2CBTA 2F53D 2PW1A 3MRFB 1N67A 1OCWH 1F97A 3EYOB 3IE9A 4OUOA 5JXED 2FBOJ 2ADYA 4R7LA 3KPSA 1DSFH 1U21A 3OGCB 4W9KC 4DNLA 3BRDA 3P3UA 3ZHNA 5B7FA 2IVFC 3RFRA 5AYTA 5IK3B 3RWIA 2E56A 5FFLA 4XMLL 2WTRA 1BJMA 4ZX6A 1DQLH 2NTFA 3EO1B 3NCMA 3LV3A 3PL6D 4RNRB 4D7PA 3QEUB 1J8HB 3MLWH 3QJUB 1ZY9A 4N2AA 3WKNA 4RIRB 2PXYD 3MV8B 4H8WC 1NC4A 3X1EA 4QXTA 4ODWA 1XVSA 1NQBA 2IAMA 2NY1B 3C75A 4JY5H 1M7XA 4GIAA 2V5YA 3L7FA 1D5XB 1PSKH 2BP3A 2J5LB 2L3BA 3FQNA 4W9JC 4AQOA 2VXSL 2D3JA 5J5EA 1GY2A 4LCWB 2CXGA 4RAVB 4NQVA 5DRZB 1DZ0A 4XBGB 3DJZA 1XAUA 5TK2A 4AJYV 2WLIA 5E5LA 5F7NC 3W11C 2H4EA 2YKLH 2IWKA 2YUWA 4ALAL 1FNGB 4QJ5B 3EHBD 5KSVB 1D5IH 4F3FB 4FQXD 1MVUB 2PR9A 4AIOA 1JPFA 1KIRB 4HIXH 4FQIH 2BNRE 2SODB 4HKJA 3IS1X 2VR4A 4LNVA 5BZWA 1B4JL 2WMPB 3PAVA 1XF2A 2JI1A 4AEIH 5ESVA 4UYQA 1PAMA 1RJZB 4IKNA 3G6JE 1SEBA 1LE9B 4PJBA 3S36L 1NIAA 2LAGB 5E2VL 5AAWC 1BWWA 4PJEF 3UBXA 1XMWA 1HHGB 3IDNB 5DJAA 3BAYA 4DETA 4K55A 2AXFB 3NEXA 3ZX1A 4HIHA 5MP6L 3O4LE 1F4YH 1UC6A 3HE7C 3GQFA 1A0QH 4WUUA 5IVXE 2CDGA 3D51A 5C3LD 2X4TB 4A7GF 4R7XA 5JW4Q 5AG9A 3FOLB 3S37H 4P5SA 4TVPH 3CXHJ 3LVEA 2WPGA 4KX9A 4YN3A 4AKPA 1YMHA 1DUZB 4R5TA 5JZ7C 2FO4A 4RAUA 3HN8A 2DM3A 3DBXB 5E8DH 2CGRL 3QQ3B 4LDLB 4NO5B 5IM7A 3BH8A 4H8PA 4Y1TA 5GJTL 3EGDB 1XGQA 2PKDA 5FA3B 3TYGH 2HT3D 3NJNA 1CE6A 1KXQA 3MMEA 3AG1B 2ZWZA 2O61A 3O6KH 4DKDC 4WUKL 3RHWF 2TSAA 1OCWL 1QASA 2H7WA 1DSFL 2VDOH 3QFGA 3H7LA 3FRPG 1KIUB 2WXHA 3SD5A 2DEWX 4MMXC 3FB6B 5B8CA 1AGCA 3DKHA 4FXKA 4P5TC 4Y19A 3M6DA 4LCVA 2D2OA 2FNBA 1J48A 4I18B 3MLWL 2XXGA 4M93B 3BAJA 3S3SA 4N0FB 3KXFB 1CI5A 1YPZE 4PJXF 4J12A 3EBAA 4Y2OA 3S35H 2C1OB 4XHQA 1HYSC 1SYSA 1M6OA 1PSKL 1XGYH 1WZAA 2FRGP 1ZV5A 4G9DA 4P99A 2GUOB 1AS6A 3DX8B 1C5DA 1FL6B 1S9XB 3PHQA 4CA4A 2FEJA 1D5IL 1D7DA 1BFVH 2W07A 4CAGA 4HGKC 5L8KB 5FUOH 1PG7L 4HIXL 3RVXD 3AY2A 4DOHE 1JWMB 4FD0A 4PJCF 3VI3F 2B39A 4E9VA 3CFDB 1FN4B 1J12A 1IBZA 2YD3A 4BQBA 5L6YH 1DTUA 4PJFF 3VXSA 1CPUA 5IVXA 3RGVC 1ZHLB 3QIWB 4LPXA 4PJGF 4K8RC 5FHBL 2DL9A 3H3KA 1SY6H 1CLVA 3GIZH 1W0VB 1F4YL 3JT0A 3OPZH 4K3DL 1E67A 2FSEB 1A0QL 1DUYA 3VFNB 3JV4B 3ZE0F 2XZZA 4G43B 2P5PA 1KLUA 3QJZA 2WVTA 4FNQA 3S37L 5CGMA 1QZ1A 4TVPL 3RIFF 3RX7A 1H15A 2R1YA 4P2QA 3UYOD 5LN8A 4MQSB 4RFEB 4KUZH 4U1LA 5AL0A 3RAJL 2AS5M 4P5RA 1GY1A 4YBQD 4JW3A 2Z91A 1M2VB 2BVPA 2YWYA 4OZHA 2C7UB 1HWWA 5FO7A 1HINH 4ONFL 2K6YA 1OHQA 3TU6A 3L16A 3IFPB 5IMOB 3TYGL 2WNWA 3DJSA 1NICA 1AGEB 5CZVL 4JHBA 1A6AB 4N0CD 1X4XA 1ZGLA 2LTQC 4QGYA 4RZKA 3JWOH 3HE6B 5K59E 3R4RA 4GQPH 3QHFH 5C6TH 4EI5A 3D05A 4UM8B 2Y72A 2N7BA 5E56A 5GGRY 5I1GH 4QRRA 3T0DA 2Z4TA 3QIUC 3CHOA 3ARSA 4BK5A 3D8MA 2VW4A 4K9EL 3NRQA 3KLHD 3PHOA 4O9HH 1MLCB 1F4AA 4TVUA 1OAYH 2ZX8A 1I3VA 3KCPB 2J7LA 6PAZA 1XB3A 1CL7H 3L48A 4M7KH 4X8JA 2DQEH 4M61B 1ZGLM 4X8XA 3BWAA 3S35L 3HG2A 4J1UB 5ERWA 1FVCB 3VGBA 5T5FH 1IFHH 3LKNA 4YOKA 1XGYL 3UZVA 4WWKC 4LP5A 3M88A 3T0AA 3EJSA 3DX7A 2NUPB 1A5FH 3N91A 4X99B 3MRHB 1ZLDA 1NSNH 1TVBA 1BFVL 1V27A 2XYCA 2VMEA 1XF3B 4KOCA 2EH7H 1KTJA 3P4MB 3PWPE 5FUOL 4NIYE 3BPOC 3WTYA 3SQRA 1JPGB 5ENWA 5TGBA 2H3NB 4GXUN 4QCIA 4S2SB 3ZO0A 3GBMH 1XL4A 3L4UA 4WV1A 5I66B 1EERB 2D4FA 1CU4H 3CD4A 5DEFA 2B15A 4PR5A 1TITA 2MCG1 3MNZA 4AG4L 3CUPA 4TSAH 5IROC 4ZMNA 5J0BA 4BKSC 4Q14A 2KL6A 3F7LA 2ZSVA 5ANMA 2DTML 2CRMA 4FG4A 1MDAA 3B2MA 5DUBB 3HNVL 2FDBP 1OGAB 4U1SB 3F64A 3T04D 5E08L 1WCBB 1PNDA 4N3TA 4BKTC 4JAMA 4LEBA 4TLKA 2EDOA 2ITFA 1C7SA 3ARTA 1TU2A 3U4EB 2D31A 1UQSB 2IQ9L 4KKRA 2C1PB 1VACA 4FI8A 1BG9A 1QSFA 5ETUA 5AKTA 5E4OA 4P46C 5CWSA 1IM9B 4FE9A 1YCSA 4PJ5A 4WFFE 4YFEA 1K5WA 1WEJH 3JV5A 2FLRT 1OOAA 3OMIB 3PV6A 1MCCA 2GABA 2JB6B 3FO1A 3GMMA 4KUZL 4UNVA 1DN2A 1P5VB 4B60A 4QRSA 1TTGA 1WSST 4UAOC 8FABA 4N28A 4X5WA 4HBQA 3P54A 2WZAA 2F7IA 3BP4B 4J3XA 5F9DC 3FF8A 4AIEA 3QG7H 3HB3B 3GXUB 2JWYA 5TDNA 1KYOJ 5CU5A 5D55A 1UJ3C 1IEBB 2L04A 3L2MA 4JM2D 2G3MA 4HC1A 3IFOB 4H0LC 2YPLA 3QHFL 5AB0A 5D7IF 5C6TL 4UQDA 4Y4KB 5I1GL 4FN0A 4Z7UA 2EQDA 5TQ0H 5DHEA 3ULUH 1X3DA 3BCFA 4G6AC 4N90E 3R19A 5HI5C 2YA0A 4O9HL 2Q8BH 3EDEA 4R2GC 3GHEH 1OAYL 3MROB 5DYFA 2OZ4A 1OKEA 4EF3A 1U93A 2UV3A 2DQEL 2HRGA 2BVYA 1QR1A 1GMIA 2XWJA 5T5FL 1IFHL 3VD7A 5C0CB 2G0LA 2F19H 3BVDB 3CCHB 2RFXA 3PWLB 1JNHB 5D2LA 4GBXC 3T77A 1A5FL 4XMVA 1YMMB 4QOKE 5HYJE 2EVJA 1PL3A 3OSKA 3OKKB 4HV8B 3TF7C 5PAZA 2Y22A 3QG6B 1NSNL 4YQXH 2P5WB 3FTUA 4WEMB 4EI0A 2EH7L 3W0WA 2NMSA 3ABMB 1KC5H 4KV5E 4J5VA 1MW2A 4X98B 3BYTA 4ATWA 5LHDA 4J8RB 4PYHA 1X6NA 2Q6WA 2AV7B 4UTBA 3VXUE 3HNTH 3GBML 3EYUH 1CU4L 1HSAA 3GTVA 1AKJA 3H2QA 1G5GA 4Y8DC 4MJ6A 4K71C 4TSAL 5EF1A 4H0HB 4JFEB 5HVFB 2XZCH 1GGIH 2GK2A 4G8GE 2ZCLL 1QSEA 5HGBA 3IWUA 3UJJH 2WXFA 3ZJAA 1TJGL 1WFMA 2JI3A 4I5BB 4X6CA 3ABKB 2JJVA 2DWDB 5DK2A 3KYOA 3LB6C 1QEWB 4B9JA 2F9BT 3A22A 3AY4C 5CLXA 1KBVA 1ZXQA 3AQXA 3POHA 4HFWB 1E8ZA 1SN2A 2WJ7A 2WWKT 1OOWA 1E30A 5KEZA 5GZOA 1DJZA 2VXQH 1KBGH 2ITCA 3GUTA 3B9KB 3P77A 3Q5OA 3FO9A 2WQWA 3D50A 3QZLA 2NY0D 4QRQB 3QWNA 4X6EA 5KJ4A 3WKPA 5J1AB 1YNTF 2DQHH 1ZHKA 4M3JA 4HIPA 4A7TA 5IFHH 2IPTH 3K6FA 2VLRB 2E5EA 5ITBH 3QG7L 4ZMZA 2IDSA 3CFUA 4MYPA 2WAHA 3WY2A 2LV4A 4IRZA 2OMBA 2QZ5A 1E7VA 5F89B 2EXYC 5FYLH 3FFDB 1QA9B 1INDH 2ARJQ 5ISZB 3L7EA 2YFNA 5TDOA 4FC3E 1P6AB 4UIMA 5F7DA 3WS3B 1AR2A 1CDGA 5TQ0L 1A1MA 1OAZH 2GCYA 2W59A 3UPAA 3ULUL 3BIAX 4JS7A 3IBEA 4NZ8A 3DUSB 2UY7B 1F2XK 1KXHA 2PCPA 1ZHNB 3KMDA 2Q8BL 2WQAA 1H8LA 4AOFA 4POYA 3GHEL 1S7TB 3ZQ9A 5IW6A 4FG6C 2PYED 3FFOA 3D0AA 4ZXBD 3QDJE 1KSRA 4X9GA 6CGTA 3CN0A 1SZNA 3BKCH 3GJFH 4N85A 5BS0D 3QQDA 4N2MA 2FE0A 2OPCA 2EDEA 2F1AA 4RGNC 5GGTA 3TH3T 2FEDC 2HLFD 4NP4H 3X17A 2QR0B 5HHXH 1NUDA 1QVOA 1OARH 1VCAA 2IDTA 5E4EC 3AABA 2XQYK 5E2WL 1NOLA 4QRPD 5J89A 4UQBA 4LVOC 5ABAA 1E27B 1R5VA 4WJG3 5I16A 1GZQB 1DVFB 4MRCA 1MCRA 3O8XB 4IU3A 3EYUL 1R47A 3TO4D 1QO3B 1DJGA 4O02A 4J3OH 1P6FA 5C7XH 3GRWH 3ZUNC 1A7OH 1JTPA 4OIBA 1FFPA 2XZCL 4W9DC 3H3PH 4J3TA 1XF5A 3UJJL 3W9EB 2IH1A 4EDXA 2HLAA 3C6LB 4KC3B 4LLYA 5ILTL 3U0PA 3WBDA 4WFHD 2BIMA 3BP7A 1MCOL 4JO4H 4MD0B 4GI6A 3T1FB 3DETD 3LKOB 1EFXD 4HSQA 4Y2DA 3TBWB 5BOPA 1JYVA 2NYYC 4Q6IA 3FQXA 1T1WA 4NRZA 1KBGL 1KCKA 2FCBA 3V4PA 3HPLB 3MRQB 1NJ9A 4HHAA 1ZPUA 5IFJB 1TFHA 3RJOA 4M9PA 1F3RB 2X70A 5FHAH 1PZ5A 4UV7H 4H8HA 2VN6A 1JK8B 4F2MB 5LGYA 1V7NH 2I32A 2NY5H 2H47C 2DQHL 4PS4H 5F1NB 5I75B 1CC3A 2J72A 5IFHL 2IPTL 1AR1D 1A7QH 5ITBL 1GA2A 3V7MA 1CICD 2XV2A 4TQEH 4I1RA 25C8H 5FYLL 1L9QA 3RL1B 5LUMA 1INDL 3LEYH 1N2RB 1NPUA 3TPUA 3L5IA 4Z7QE 3FUKA 2UY6B 1E4XH 1FJ1A 5EO9A 4PRNA 4G1MB 1OHZA 1OAZL 3TH2T 2B3RA 1ZHBB 2ZOUA 2YKKA 4IIQA 2GBUA 2VDQH 4WHYH 5D71H 4GUPB 3SGEI 4PJ7B 5J4MA 3KLDA 2GT9B 4X7FC 1V05A 2H26A 1ES0B 4XCNA 2KS0A 2J1WA 4Q4EA 2F2HA 3C5ZD 4W9FC 1I9JH 2BNQA 1J8HD 4QT5A 5IBLC 1GYCA 3LD8C 3MV8D 1P53A 2P8PB 4MSWB 2WWNA 2NY1D 2FQGA 2DYRB 4JG5A 4JUSA 5AUMA 3RWEB 2FJHA 4V1DE 4G6KH 1AVAA 2FX9H 2D73A 3BKCL 4E9YA 3DXAE 3D85B 3GM0A 5E6IA 2X4RB 4GKOA 4Z7NF 1LQSR 4HUNB 2Y2YA 4M6NH 5KBPA 1FYTA 5HHXL 5EU7E 3SBQA 1OARL 4IBWA 3CLFL 5FF6B 4MDIA 4KMTH 4QYOA 2P45B 3NJHA 4PS7A 4YR6B 1QUNB 1MFUA 3BSZA 5I15H 1L0QA 1QG3A 1MHCA 4PQXA 4XI5C 4MTMA 3JBG7 5IJKA 4AENA 1D5MA 5ACZA 2H0FA 2C26A 3PV7A 2B4CL 3SPCA 2VERN 1MNNA 4BZ2A 5F0LB 1OM3H 5KSUB 4LKCB 3RPKA 3GRWL 1A7OL 2YLKA 3VQ2C 4YSPA 1F18A 3FU6A 4FFWC 1AO7E 4JDTH 3I85A 4Z7VB 4YSDA 1ND0B 2C3GA 1IAKB 3LAFA 1ED3A 4X7DC 3QFDA 4JO4L 1HNGA 4HH9A 4KK5C 3ZW3A 1V3KA 2IGTA 3LQZB 1BZ7B 3SPVA 4L4JA 2V4LA 3C8KA 3EJYC 3CPLA 3HRZA 2ZCZA 1ZLSH 4XX5A 2Q3XA 2R51A 1CDBA 1CD9B 1HJBC 1M42A 3B3IB 4MFHA 2JTYA 3RNQB 3MLXH 4TKWA 3FQ2A 2VZOA 4PRBB 5BRQA 4EIUA 3RVTC 5FHAL 1UOWA 4UV7L 4YGAB 4ZUSA 1V7NL 1HL5A 4GXFA 4OZGA 3IJHA 5CGYC 1GSKA 4MAUH 3TGXA 3T0EB 1KBBA 1PFCA 4TQEL 1OTSC 3RY6C 1RURH 25C8L 4YXKL 3IJSB 3FFCA 2HTKC 1PQZA 4OM0H 2BP8B 3PL6A 4HUXB 3SDAB 2HB0A 4FOMA 5L2KA 4HX1B 4YBHA 1E4XL 4URTB 3MCG1 2DKSA 5EC2A 1ZIAA 1Q72H 4FAAB 1FUNA 3N04A 4ODUA 2VDQL 2CJTA 1G9HA 5D71L 3T4YB 1S9WA 1C16A 1H9VA 1T1YB 4O2EB 4KMQA 4XXWA 3TJEH 4DEWA 1B0GB 3HMWH 5AW5B 4DESA 4XTRC 1TTRA 1I9JL 4I0KA 4WW2F 2DQMA 4JKMA 5E23A 3KXFD 3P9WB 4WI0A 2ENPA 1TENA 5CMAA 3P9LA 2F18A 5JQ6H 4GMTH 2YRBA 3P73A 2QKIA 3NIGB 1K5NA 1QI5A 2DQIH 2GSGA 4RDBA 1U30A 4ZUWB 4EVNB 3IVKA 3NSDA 1N12A 4QLWA 1VEOA 1T20A 3F3HA 4M6NL 4NYLA 3OR6B 1XO8A 1GGBL 1NGXA 2Z0UA 5D1XC 4Z3JA 4NGHL 1A9EA 3VXQB 1A3RH 1CFVL 5DJYB 4KMTL 3RWJB 4M5SA 2QMJA 4L0YA 3LCYA 4PB0H 5I15L 1T4KB 3LRGA 1ZMYA 3S97C 1OXYA 2EO1A 1ZSDA 1AO7A 4YDLC 1CGXA 3TBVA 3ATAA 4WHDA 3WUZA 2H6UA 2XY1A 4KFZC 4UOQA 1ORSA 1RFDH 2ZXDA 3FS9A 2DLFH 2Q3AA 5JW4N 3S4SB 3WJLC 2YD5A 1FAKT 4CGUB 1OM3L 2BOLA 2R0WH 2YD0A 3WLWC 1P9MC 3BP5A 3MV7E 3RUGE 5KUKA 4MA8L 4XZ4A 4G2AA 1ZS8B 3MJ8B 1NFIB 2X38A 4JDTL 5FKPA 5H35B 1A2YB 1B3IA 3JSSA 4AYBA 4P2RE 1QI4A 5I8KL 2OR8A 1CLCA 4PPTA 3AFLA 4JFXB 5D6DA 2BERA 5DHVH 1B4TA 5D1QC 2IGLA 1E4KA 3CHXA 3D2UB 3L13A 2UXTA 3OR7B 1ZLSL 4F9PA 5JIPA 4POZC 5A6LA 3LNFA 3X13A 4CKVX 3FNKA 2A6KA 4PLJC 5DUPH 5FYJH 5HVWA 4FKEA 1UD8A 5D9SB 3VI4F 4PJ7F 1GSMA 3O45A 1G94A 1O5DT 3IETB 3WUWB 2R2CA 4M5YH 5F70A 4XAKD 2K4AA 3BN9C 4MAUL 4DSYA 3MCKB 3R7RA 3HA0A 5J6HB 3E3QC 1RURL 4NQXA 3BP6A 3CHPA 4RETB 2CH8A 1UCBL 2X12A 2YEQA 4DKTA 1HEJC 2O5YH 2D7TL 1YAZA 1U8QB 4ICWA 4F8LA 3HE6D 4PWGA 5MI0C 4NP9A 3MRMA 3HFMH 4JE0A 3DVFA 4NXSA 4OCWH 2RJMA 2ED6A 1B0RB 1Q94B 1Q72L 2DWEB 3HJ0A 1USZA 2OX5B 2PUQT 1KYFA 3DIFB 3TJEL 3UBFA 5J7CC 5I76A 2DMCA 1E8XA 4P4KD 3HPJA 3HMWL 2R15A 1N8ZB 1Z66A 3QUYA 4LL1A 3CDGA 3G5XA 4RGNE 4O58L 5D7LA 5I8EA 4ZG1A 3QDMB 3U2SA 4LEOB 2XWXA 2R69A 2RCSL 3VQ1C 4QTFA 1M05B 1EVUA 4R0LA 5JQ6L 4GMTL 5I71B 1WZ1H 4WU5A 2M83A 2W60B 1HU8A 1I8UA 2DQIL 2LABA 4LDEB 1T0MB 1ZTXE 1XT5A 2IOIA 1UASA 2E6QA 4CJ0A 3P30H 3RB7A 5MERB 1PY4A 4YWGH 4W4NA 3RIKA 3GJFB 4XCFL 2ZONA 3AG4B 1A3RL 3RUGA 5JIQA 5C07E 2KUTA 4PB0L 3HZMB 4TRPH 5FK9A 1XF4B 2CHNA 2LU7A 2YEVB 1AC6A 1Y6KR 3QUXD 1S7XB 1IVLA 1OF0A 1JI2A 1RJYB 1R3HA 1QX1A 2BXZA 1VB9A 4OFYD 1JXDA 4WFEE 5GRZA 1RFDL 5SWZB 1JBJA 2MJWA 3TBYA 5C0BB 1Y0LA 1NMCC 2DW5A 4R4BA 4XVTH 2J6EL 4CDGC 4CUCA 4F7CB 1WF5A 4KJYA 2R0WL 3PQYE 2FUTA 4DKAA 3K0YA 2NZIA 1PZ2A 4G6JL 3DV6B 5CZXC 1RZPA 2Z92B 2Q5BA 1HXYA 2E0PA 1FL3A 3CZFA 3VCLA 4JN2A 2UYLA 1IGIH 2DLTA 1RZKL 1OGAD 3OB0H 3DTUB 2G2RA 3PAYA 4GQRA 5BOZG 2IG2L 1W0WA 2EILB 4FZEH 4KHXL 4NHUA 4Z7OF 1ZWIA 2HFEA 1QSZA 3QDGB 5IUCA 3ZRFC 1P7BA 3WG7B 3VFOA 5HBBA 3DGDA 3ULAB 1HXMB 1O6SB 1G4RA 3HC2A 2OK0H 1YN6A 2V2WA 1N5AB 4Y4FB 3VXPB 1CIUA 2V9RA 5I9QB 5IB2A 1TLMA 4J2QA 3H9YA 3SDCD 1P7KB 1MJ7L 2ICWA 3QQ9D 1EMTH 4M5YL 4E5XA 3PPSA 3BWUC 5D2NB 3DO7A 5BV7C 1RK1B 2P5EE 5DRNB 1TZIA 2E86A 3UAEA 5B7MA 3SCMC 3OKMA 3MRJB 2O5YL 1I8IB 1ZK5A 4QHMA 5INDB 2C3WA 4Y1SA 4BFEA 5B38B 4OCWL 4Y4KD 1N6UA 2QKSA 5E8PB 4N20A 1BZ9B 2R1XA 3HKFA 4IOIA 5F88A 3DX6B 5GIRA 1UD6A 3S98A 4MDJB 4D0CB 4NEHB 1MZZA 5GRWA 5AFAA 2J2ZB 4AQEA 2KLSA 4LLUB 1CDHA 2A9NL 2VDQB 5E6ZA 1RU9H 4BFIA 1SJVA 3VFRA 3SEPA 3WTXA 2VGLM 1BVNT 3MXVL 2WXJA 3LNIA 3K72B 5C0CD 1WZ1L 4RCAA 5HHOE 2P48B 4X42A 4FADA 1L4IA 1O7SA 1S78C 3S36X 3DX9A 5CEYA 4CJ1A 1WRFA 2PW2B 5D5MB 3ARYA 3U7YH 4YWGL 4APQB 3EYQC 2Y2WA 4BSJA 3DMMD 3W39B 2PPCA 3PQYA 3PUUA 3RX5A 2P5WD 2PCFB 3MJGX 4TRPL 4KKZA 4JDEA 5CR8A 1JCKA 5DMIL 5E51A 2G75A 5C3IA 3GXNA 1BFSA 1VFAB 2VM4A 5EO0B 1LXMA 4AM0B 1ZPLA 3LDBC 1SMAA 5BJTA 1KPVB 4GKNB 4ADIA 3CC5B 3N40F 1F4WH 3QXTA 5ABZA 1HEZB 2IPKB 3IKCB 3AU1B 4JFED 1KFAL 2XPGA 5D7SH 1P1ZA 1UXWA 1EHKB 1U8HB 2JQMA 3BPNB 3GDCA 4FYTA 3FQWB 4XBPA 2D7QA 5KG9B 4FZEL 4A7VA 5IMMA 5J3HD 3EGSB 2XA3A 3HG1E 5A2LH 2BVQB 2OK0L 3QORB 2UXFA 4CVXB 1XD1A 5DT1L 5B8CC 3QNZB 3Q01A 4FXKC 1I8KA 5IQ9B 5TE7H 4BEIA 3E9TA 2EDJA 4JRYE 2NX5B 1BMZA 3S5LA 1M7IB 4G82A 1ASQA 2AJUH 4L3ED 4BGDA 4TVPD 1EMTL 5FO2A 4PJEE 1J5OH 1TVHB 2VUKA 3ZYOA 1WBYB 2YN5A 4U3SA 4U31A 3KPRB 3V7AE 2VLRD 3ZHFA 4XZUB 4N87A 1X6LA 1FAIH 4I48A 1BM3H 1E40A 3OHXA 4XN7A 3SD2A 3SE8H 3GRBA 1KV3A 3ARBB 1S7UB 1I8MB 1AG6A 1Q9WB 3ESOA 4ZQTA 5LB1A 1TJMA 4MZRA 5F7BA 4MA7H 1K8DA 4WEEA 3STLA 1H5BA 5AG8A 2YAMA 1A21A 2R9HD 2XNAB 2ZAHA 3CMOH 4R96A 4KRPC 4YL4A 3VSTA 4AQZA 3GUFA 5HHOA 3GT6A 3KPLA 4BA0A 4CRPA 4OV6F 3EBHA 1IGFH 1PEWA 3O9WC 4RMRA 5C09E 3BKYL 4PRAB 4YAQB 5IOPB 1W9XA 1PG7X 4FKKA 4LLDB 1TNMA 3G6DH 3HC0A 4ZDHB 5D1XE 4NO0B 3JTSB 4DGYH 1I75A 3K8LA 1MCIA 5LNEA 1MCWM 3LS5H 1KLGB 2ZCHH 3D25B 1GOFA 4J27A 1RIUL 3UPRB 3PNRB 2DM2A 3S3JA 4PRDB 4RX4D 5T5NF 1WA1X 2QQNH 3C9NA 1ZTMA 3U7YL 2GYSA 2JQZA 4J3OF 2HCZX 2BOBA 3HAEG 4QHPA 5FECB 2Y7MA 4UAHA 1XX9C 4AMWA 3VXME 1NWPA 1QFPA 1INQB 2QHRL 2VXVH 3INOA 4X7SL 5KTEH 4PUBH 5FYJU 1FLRL 1A14L 4PP1D 2GTWB 5J1SC 2XWZA 1DVFD 3S37X 2XQYA 3O8XD 4NT6A 3BH9B 1N6VA 3TJHC 1FGVH 4M8QB 2XN9A 3HG1A 1MAMH 3DRTA 4K0OA 1E6JH 1BF2A 3SBWA 1UD2A 3UEQA 4IKLA 1SLXA 4G8FB 5AOIA 3C6LD 1T3FB 1NUNB 4GP8B 2BIOA 2J25A 3EG9A 1ZEAH 3DRQA 3IMSA 5EBGA 1BQLH 3ABZA 1KN4H 4MA1C 1P84J 5EULV 1Q0YH 1YY9C 1ZA6A 4GEJA 3M86A 4PG2A 4X0KB 3ZE2E 1NUGA 4PJCE 3VI3E 3LY6A 1U8PA 4ZMOA 3FQ4A 4GRMA 3ZKQD 3BGFC 1UVQA 3UTQB 3GMPA 4L8SB 4BK5C 5DHVB 4PJFE 2HXAA 3L3HA 4Z3HA 2JCCF 5TE7L 1UURA 4P59H 3OJVC 5DDHB 4PJGE 3BUYA 2AJUL 4Z1PA 1J5OL 2AFNA 4PJ8A 4D3CH 5JQIB 2QQQA 5GGVH 4YHZH 2Q0ZX 1BX2A 1PKOA 1CWVA 3A6OA 4FJ6A 3ROLA 4CVZA 1FAIL 4UU9B 5T3XH 1BM3L 2F54B 4BFFA 3EDDA 4H7VA 1AZVA 3SE8L 1UB6A 3QNXA 1QOKA 3GB7A 3RJQB 1K6QH 4JFQA 1JGVH 4NRXA 4OBSA 1V5JA 2BZCA 1XHHA 1YZZA 4DK5A 1FVEA 1P7QD 4JRXD 1QUPA 4BQCA 3LZOA 3OBAA 1XEUA 1FH5H 2CALA 1S5HB 1TSRA 1Q9OA 1N59B 4JVUA 4LXFA 3B7SA 4PS8A 1KT2A 3G6DL 3PXLA 3B6SA 1P69B 3RWFA 3B3BA 1WC7B 1KPRA 5CCGE 7PAZA 4HZ1A 1USQA 4JPIA 3LS5L 3MV9A 1BEYL 2GJ6E 4QRPA 4B5EA 4NQUA 1EUTA 4JQVA 2AK4A 5C08E 3QDAA 4AH2B 4PJXA 4AYGA 3EZ8A 1E43A 2ZWNA 4I3GA 4XB7A 3B43A 2QQNL 1BD2E 4YX2H 1E9PB 3OC8A 4YNYA 4BFJA 1DANT 1H8SA 1IKOP 2BJMH 2HSIA 1G6RA 5CLTA 2IOOA 1OD9A 1A1NA 1HX0A 2R2EA 2XYBA 1ERNA 1EUUA 1QFWI 2PO6A 2VXVL 2WVVA 5E9NA 3WDHA 4AK1A 5KTEL 5BVJA 3VFMB 1KGWA 3WY4A 4BFKA 4ABVA 2H0PA 5ITFB 3QWOB 1AY1H 3VMPA 3SO3C 1BFOA 1EFXA 4K5PA 4NC0B 1WE5A 2ZCKH 4F37K 1FGVL 1CD0A 2HG5B 1KEMH 1MAML 1TTCA 1E6JL 1U8KB 3VXRE 5I1AB 1UATA 1E3XA 3HEIB 3N41F 4CSPA 2WO3B 1J8KA 3APFA 3ZGIA 3LXCA 1HL9A 1BQLL 5F0MB 3SDXE 1KN4L 2VLJA 4PJ9C 1Q0YL 4KDTA 1I53A 1MFCH 3LH2H 4MAZA 4QXWA 3UJIH 2J43A 4G80A 3IAPA 5FX3A 5C0GA 5EUOF 1K8IB 2YSSB 4XNAA 3JV0A 2VLKE 3D07A 3M1BB 4F7KA 1IEAB 2F8IA 3D0LA 2ESVB 4EZMA 5DVMA 2OL3H 3K0WA 4P59L 3QHZH 3B7UX 4LQ1A 2YD6A 4LSQH 4FTVB 3EYOA 2ZQKA 5GGVL 4YHZL 4OLVL 3UP1A 3T0ED 2FYYA 1R3JB 3KR3L 3MI6A 5IK3A 1HCFX 5CN1A 5T3XL 2D3LA 5HYEA 1NIFA 1U33A 3KPMA 4NBYB 2NY7H 3U30B 1AXTH 1JWUB 2B2XH 3CDYA 3EO1A 3L1FA 4N1EA 4RNRA 3CXDH 4ZJ9A 3QEUA 1BOGB 4XT1C 1K6QL 1V55B 3EH1A 4MKTA 4PV1C 2HUHA 2CHWA 2YGNA 2BWDA 4G42A 3QJQB 1L3WA 4ZFGH 5HGHB 3FQUA 2DLIA 3JWDC 1D5XA 2Y6TE 5LJYH 5GGUB 3B9EA 3VXNB 5C08A 2R2BB 4LCWA 3TWCH 3MUZ1 5DRZA 4XBGA 4FFYA 2DM7A 3ETTA 3DVNB 1T2QH 1X5AA 4X5LA 5KSVA 1FNGA 3PWNB 5GHWH 3A3YB 2YA2A 3O3AA 4HIEB 4YHPA 3V5HB 1MVUA 5AQ0A 3U7WL 1KIRA 3GLDA 4FG0A 3VX1A 4ZMWA 1JXJA 4A7SA 1OE3A 2WZPA 4ZFOL 1IJ9A 5L88L 3I2CL 3EYSL 2WMPA 4YX2L 1TJIH 1R1CA 3E8UL 3UZEC 4DVBB 4LARH 2APTA 4LRIA 3RFZC 5KSAA 3M07A 2BJML 4J2XA 12E8H 1N3NA 3IAQA 1RJZA 3VXTB 4PIRF 4PJAB 5AZUA 3FUJA 3OX8B 3FRPB 3IDNA 4YDZA 5DO2C 3ZY7A 3N50A 1Z9SB 3BYYA 5C0FA 4L9LA 1PW3A 2ADIB 1FGNH 4P3WA 5BRZD 3L3OB 3BMVA 3ALXA 2XHNA 5DS8B 2ZCKL 3GMOB 3IM1A 1KTDB 3GXIA 3MNVA 1JN6A 3CX2A 3G5VA 3NABH 1D2PA 2EYTA 4HK0B 2VLKA 3T0VA 1TETH 1KYDA 1PPIA 4Y2NA 1DUZA 2G3XA 5FFGA 3IU4H 3NMEA 4C54A 3LH2L 1MFCL 3QQ3A 3SE4A 3CSTA 3UJIL 4NO5A 3JVGC 2R23A 3BIBX 2ED7A 4FTDA 1ZANL 1QAWA 3EGDA 1DANU 3GGWB 3QEQE 3ECBB 2K7PA 2WKGA 4M7JL 3K8MA 5SWQA 3U48A 3WFEH 4U1JB 3QHZL 3MRGA 2W9DH 1A6VH 4K5MA 4LSQL 5I26A 1HWHB 3ARFC 2H1LM 3CXHK 2YRZA 1FF5A 2AZUA 2NNXA 2XG5B 3SKNA 4KK6D 3L9YA 5AW2B 3FHQA 3FB6A 4ZZKA 2ZG3A 1AXTL 4PSRA 4I18A 3CXDL 3N44F 2OMVA 3EJZD 2JIXB 4BFRA 4N0FA 1L0PA 5CLZA 1MFNA 3TC9A 1QSVA 1IB5A 2N1KA 3F12B 3OKLB 2C1OA 3MRIB 3C09C 4JVPA 5HJ3B 4PS3A 5I6LA 2A5UA 3NVQA 3WTVA 4PI2A 4GRLD 4TUKH 2QPSA 5D7IA 2GUOA 3TWCL 4CL7A 1JYWA 4A2MA 4MGXA 3N55A 5IEHB 3IJ8A 4D8PB 3DX8A 5T1LB 1Y18A 3QDMD 2CSPA 1S9XA 2ICWI 1T2QL 3AUWB 3R06B 4LSDA 4RMTA 5I6OA 4R4FH 1HESA 2EVIA 3IS0X 3VO0A 5K9OA 1HC1A 2OQJB 5CD3A 4MNQB 1IKFH 1ZA3B 2OI9C 4M4RA 3NCFB 4CVWA 1NGQH 4KKPA 1DQJB 1CYXA 1JWMA 5HHME 4TQPA 2XKSA 4OT1H 3BVTA 1FFQA 3TA4D 2PWDA 1MJUH 1CDUA 2WINB 4E36A 2WKOF 3CK0L 3T6XA 5PCYA 2E6PA 2EIKB 1ZHLA 2FSDA 1PYWB 1XL6A 3QIWA 4KU1A 4LHUD 2YUXA 4Y2DC 2QTVA 3QFJE 4Q6IC 3AG2B 1RY7B 3FKUS 1YEKL 1IJNA 1W0VA 4FL4C 1FGNL 5C0BD 1KELH 1AQMA 4OGYH 3JV4A 1JD7A 4ELMB 4G43A 1I85A 1UD5A 4YSTA 3ML9A 2P8LB 1TETL 2FWSA 4NPYB 1G7LB 3QWQB 4JFYB 4N2FA 2XBTA 4RFEA 1KY6A 2IANE 4I3SH 1NEPA 3IU4L 4WW1B 3AXHA 4ACTA 2FECI 3IJEB 4KKCC 3S34L 5DJDB 4IOSD 1M2VA 5I23A 2C7UA 2AF2A 3VXOB 1KIQB 2PF6A 3Q2NA 2I60H 1GR7A 3X2QB 2O1AA 4Y4FD 3ZL4H 4DAGH 5HPMB 1AGEA 3VW3L 2XACC 2OMNA 4UINH 4A2DA 1B2YA 5ESAB 1A6AA 4DFIA 1UD4A 2OJEA 1N19A 2ENYA 2JLLA 2W9DL 3BPLB 5IQMA 3K4DA 2J73A 4WKXA 1JDDA 4UM8A 3OV6A 3WY1A 2VABB 3MFFA 4HU2A 1CTMA 5FEBA 2WWMD 3IYLW 2FJGB 5E9DE 2BSRB 4U1IB 2HKFL 4MD4B 5DZLA 2WXNA 1OAUH 2NCEA 3J7HA 1JZ7A 5JYLA 5E6IC 4DGWC 1MLCA 3UO8B 1RZJH 5IHHA 1JD9A 4H88H 2NRDA 1AMYA 3IPBA 4M61A 5EV7A 3QXUA 4J1UA 3GJFK 1WTGT 2VDRH 4ABUA 3K6DA 1OGSA 4UQ9A 4TUKL 3JQOB 1FE8H 3ARXA 1EHNA 1JUFB 2NUPA 1OANA 1EHAA 2B5IB 5IJKC 2V5RA 4KJWD 3I02B 4KXAA 4R4FL 2YUZA 4X99A 3MZGB 5LBSL 5CBEB 3MRHA 5JNYB 1Q1JH 1DVZA 4GSDL 1XF3A 2ZJSH 4FF9A 1V7MH 1NGQL 4XO9A 4PRPD 3EGXB 5F7FA 4KAQH 5KUMA 2DH2A 4GFXA 1BJ1J 1SXNA 2DZEA 2H3NA 3MAWA 1MJUL 4LSUH 2KMWA 5K1NA 4S2SA 4APQD 2A0LC 1E5UI 32C2A 2EDBA 2KZWA 4KK9C 4FERA 4TN9A 3BEWB 2XTJC 1ODAA 1QNIA 5H2BA 4ZFOB 3VYPA 2F8XC 4AYMC 3SKUD 4FFZA 4I9WD 5SWSB 3G5YB 1C12B 2YK1L 3HRZC 4UANA 2H9GA 3QUMH 3P11H 1MVFA 3IDIA 2YD1A 2V5MA 2VITA 4W6WB 3SYAA 3BIKA 1W6LA 4E0RA 1G7PA 4U1SA 1GOGA 1WCBA 1HCYA 2FIKA 3K2UH 4OCLC 4Q4IA 4OGYL 4AGQA 5JHDB 3U4EA 3VD9A 1UQSA 1J5HA 3DDFA 2C1PA 4FQHA 5JXEC 3P3RA 1IM9A 3LPWA 3UBGA 4LPCA 4Z7NE 4Z3FA 3VD1A 3IGAB 4XNMA 4KX8A 3KYKH 5KYWB 4MWFB 3CH1B 2DIBA 4I3SL 1HKFA 4I1PA 3SDDB 3PL6C 1FG2B 2W1NA 1FZMB 4TPRH 2XTLA 4W70A 3WSQH 2PXYC 5GGSA 5DVOA 4MNGE 1XF1A 4DPBX 4R6UA 1WGVA 2ZXAA 5E9DA 2ADFH 2I60L 2ZZUT 3QORD 4ZAKD 3UIZA 2VXTH 2GB2A 3ZL4L 5CIPH 3U6RB 4L37B 4ONGL 4Y2LA 1IEBA 1SLUA 2VSKB 4GAYB 2VMFA 2NX5D 5DQJB 2NZ9C 4GIPD 4Y4KA 2M8XA 4XVJH 3ZBMA 1IBFA 3UAJD 5TE4H 4MZ2A 3ZKXC 3EHBC 3KPRD 3U9WA 4FQXC 1IIKA 1PZAA 2GY5A 3V5DB 4N6QA 1ACYH 1PD1A 1RZJL 5FYKH 3LRHA 3PWJB 2BRRH 4JZJC 1YNLH 4BIKA 3MROA 4EI6B 4NZDA 5DEZA 4IRJB 3LZNA 1H3WM 4JDVB 1KYOK 4UQ2B 2Z34A 5GRVL 3QJRB 3CFMA 3PJSB 2VDRL 2ADGB 1OTUD 4NNXB 2EUWA 4ENED 3AB0B 4Y9BA 4Y7MA 3L6FB 3PWLA 4DZBB 4PGCB 2PMZA 1I7ZA 4NDMB 1YMMA 2EKJA 4B53A 1U58B 1XXFC 5HYQA 3ULVH 1AXSB 3OKKA 2OW6A 1OSZA 3QG6A 3D52A 1IGML 3UTPD 2P5WA 3IMTA 3JTBA 4PGJA 2ZJSL 4ENZA 2P80A 1AE6H 2JFCA 3C60A 2AVGA 1V7ML 4LSVH 4ZQKB 2YEZB 3SKJH 4X98A 4KAQL 1F8TH 4ELMF 2Q86B 4PYGA 2AGJL 3B56A 4LSUL 2AV7A 3WDIA 3NBNA 4TLTA 3EJJX 3KEHA 3DGGA 4Q2ZB 5F7UA 5JOFA 3UTTB 1NAMH 4PVNA 3WN5B 1LVEA 1E4KC 3OL2A 4F9PC 3QUML 3P11L 3QUZB 5A16B 4UOZA 4I5BA 3MHZA 2CK2A 2DWDA 2HT3C 5FGBC 3N5AA 2R7EB 1TZOA 4JFTA 1HTYA 4HFWA 4FX5A 1BXAA 2XFXB 3K4AA 1FFRA 3GXPA 1E3ZA 4UM9B 3ATEA 4N2CA 3B9KA 3KYKL 1J5DA 2AI0H 4NQED 4L1TA 4IOFD 2AZAA 2IDQA 4Y5VB 3SKOB 1HHJB 3RL2B 3CSPA 5GRXG 3FCTB 4QRQA 5J1AA 5GSRA 4TPRL 3LNHA 1Z5YD 3WSQL 1JRHI 1ECYA 3V95A 2ADFL 3UTSE 2A1WH 4G8EA 1JV5B 4N0UE 3QSKB 2W80C 4QKTA 5F89A 4FNSA 1ZLWH 4JFHE 4ABWA 3B7TA 5ISZA 1NDMA 2YC1B 3GKZA 2IV9A 4KPHH 3HTLX 3QUYC 4U7SA 5DJ8A 4XVJL 3WS3A 5JPNC 5TE4L 1BQUA 3EDFA 3IKKA 4KJQD 4NQTA 1BQHA 1OB1A 4PRHB 5F6IB 2B59B 2GFBB 2ZSWB 3DUSA 1A6ZB 4QF1B 1MFDL 1ACYL 3RVXC 1ZHNA 5ID1B 4IBVA 3KGRA 5DQ9A 5FYKL 1GGCH 1YNLL 1IC7H 1ILSA 3SJVB 5J9PB 5ABDE 1HQRB 4HLZG 4Q7DA 2FL5A 4HUKB 4HYTB 1G7MB 1LO0H 4U4BA 5J12C 3DURA 3VFSA 4K5OA 1NFDB 3UGEA 3BDYH 3JWNC 3DA0A 5BZXA 3C8DA 2APSA 1G7QB 1SDDB 1L0YA 1ZJAA 5FAAA 5AWNH 1TTFA 1FNLA 5E99H 2QR0A 2NCMA 1N10A 1REIA 2IDUA 2WM0A 4MLSA 1O7DE 1X5GA 4K73A 1JF1B 3X1BA 2CGZA 1BSIA 3F8UB 5CGBA 3QEHB 4LSVL 1UT1A 5GZNA 3SKJL 3UZQA 1DL7L 1SXSA 3ILQC 3LSOB 2K4WA 2WLLB 1IM3A 1GZQA 3IB4A 3MRKA 3PJLA 4PAZA 1HQ4B 4MJJA 4KOBA 2ADJB 1MQ8A 5EC1B 1OK8A 4Q8BA 4YBQC 3BH4A 2LVCA 3VGAC 1NZRA 2EECA 3EADA 3N42F 3IEAA 4MQTB 3C6LA 1CDIA 3L95B 5B22A 2CO2A 3HS0C 5D7JA 5LBVA 3NIFF 3K4ZA 1EXGA 3LZFH 4N22A 4N0CC 3T1FA 3LKOA 1SY6A 3F7PC 2ZWKA 4WQOA 3P3TA 2PCYA 3DSNB 4E5XG 3JV6B 3AAZA 2KPWA 4PJIF 1NCOA 4U6VH 1AGBB 2D0HA 4FA7B 3BJLA 4BSWB 3FU0A 1WZKA 3UTSA 4H8QA 4EDWH 1M9WA 1R6VA 3QUGA 3KLHC 4PRIE 3HBQA 4OGZA 3W11D 3Q2VA 3U1SH 5DJ2B 4C47A 1PCXA 4AGOA 5F1NA 1ETA1 2YGOA 4BQ8A 1PAZA 4JG1H 4PJDF 3VFTA 2Y69B 4GI8A 3H9SB 3QC6X 3T08A 1JF6A 3ETBJ 2CPCA 3RL1A 2ESVD 2JNZA 1N2RA 2DAVA 4YXHH 3CQFA 2GJZB 4KPHL 3ZDXB 2UY6A 1DCLA 3A23A 3OXSB 4NC2B 4G1MA 4XNDA 1EIBA 5KVDE 3D3VB 4D9QD 1ZHBA 3MREB 3VI4A 4GUPA 5F97E 4PJ7A 1UFUA 3ZL1A 4Z7OE 2VW7A 2FUQA 1ES0A 3B2XA 3K1KC 4TMPA 5ALBH 3TA3B 2BY2A 4PVBA 4GG6B 4WK0B 3TONA 1CXEA 1JCVA 1IC7L 3HE7D 3L5WB 1MRCH 1W91A 1KBKA 2XJKA 5HDRA 2BIIA 1OALA 4MSWA 1DN0B 3RWEA 5CZKA 3OKEA 3WIIL 4G7YL 3D85A 4TM9A 3WFCH 2P43B 5T5FA 2VDRB 3DHMA 4ANKA 3E2HB 5AWNL 5KN5B 4RFNB 4J3SA 4N8PA 5LG1A 1TF4A 1UEMA 5LNDA 3V9CA 5FF6A 4YR6A 1CGWA 2WXPA 2E4FA 4B95C 2X4UB 3ZE1B 1CDCA 3PREA 2HP4A 1NWOA 1II4E 4TSBL 3JZYA 2X4NA 4K07A 5C0IB 4OZIB 1OCZB 1P4LA 2LVEA 3RTLA 3QULB 1O9VA 4HP5A 4LKCA 2F53E 3H7BB 2OMTB 2HX7A 5AVTB 1SN0A 4NN7C 2Y1VA 2W9EH 5F9WB 1AHWB 5IB3A 1FFNB 1Z9NA 1ND0A 1G9NC 1UH2A 2JKIS 2X0WA 1IAKA 4PJHB 2J8UB 2I9TB 4XPAL 3H42H 3LZFL 2ID5A 4JM2C 3CPUA 3QUMB 1KF9B 4MJ5B 1D9KD 3OZKA 5CBAA 4L1SA 1BZ7A 1G0XA 1E5ZA 3V0FA 4AQ1B 1UOVA 1WIUA 2BCKB 4U6VL 1XGUB 4EDWL 4JZNB 1J5IA 1WFOA 1TZHB 1C08A 3RNQA 1X44A 3KNBB 5FYKU 3HAEH 3OHXC 2Z31B 4JJ5B 1V3MA 2R56H 3U1SL 1IQDB 3L1EA 4M1CD 2GIYA 3MACH 4OVVA 1TQCC 3N40P 1CZ8H 1LEKB 1RZ7L 4UWQB 2N4IA 2ROYA 4JG1L 2NW2A 2I25N 1UB5B 2BFVL 4L1HA 2UXVA 3SDAA 4HUXA 5CM1A 4QUOA 2H45A 2AK1H 4HX1A 5CIPB 3BSHA 3HG0A 4Z7IA 2LHAA 1MCWW 3T4YA 4ZUUB 4K8RD 4WHTA 1E50A 3P0GB 4JR9H 1ZLVH 4AVIA 4FXGA 4BZYA 1T1YA 4XOAA 4YGVB 1MEXL 1AP2A 3QZBA 5ALBL 1OT4A 3WEXB 1T6VN 3LEXA 3Q1SH 2WQ8A 1NBZB 3WNKA 3UJTH 4C56D 1TKWB 4RGMC 4LDCA 2K9FB 2YHGA 4IRSB 1ZDSA 2WLYA 3R8QA 3WFCL 4WO0A 2JB5H 3TBTA 1PLGH 1T0NB 1QWHA 1GRWA 4LIQE 2X6MA 3OR6A 4I0CC 4JCWA 4W4OA 3SGKA 4FS0A 1J05A 4NQCA 2BH0A 4BWTA 3VXQA 3BQUB 2DLHA 3RWJA 4Z7AA 4LESA 1T4KA 1XB6A 2G30A 4WI8A 5EIQA 3SBWC 1GGYA 1PZSA 3RU8H 3SE3A 1TPXB 3TVMB 3GO1H 1XGPB 1T0OA 3S4SA 4ONHB 2VYRE 3FHAA 3MLYH 2NY0C 2PETA 4XODA 1GC1H 3QIUD 5E2JA 1F58H 3V7AG 4WTZA 2W9EL 1NFIA 1RSYA 5DO8A 1MFVA 4YZWA 5H35A 5FB8A 1P5UB 4NWTH 1FZOB 1BVOA 5IEKA 1U8NB 2IFGA 1RXLA 2VL5A 3WIHH 4JFXA 5KS9F 3MLTB 3BGMB 2QPDB 2VAJA 3OWEA 1BXXA 4XMTA 4JX0A 5EIIA 1MRFH 3VUAA 3D2UA 4X6BA 1CFTB 4AUUA 4XMUA 3CLEL 4QRAA 5AOJA 4DUXA 4G7VH 4AT6A 4TUJB 2I5YH 4TYUA 4UTCA 5GGRB 2VXQA 1U92B 4DO5A 5A2IH 1RJCA 2R39A 2R56L 1WFUA 3VQLA 3IETA 3MACL 4G8IA 4UB0H 4MBOA 2DEXX 5ICXB 3DARA 3MCKA 3O2DH 5J6HA 3MRPB 4R83A 1A6WH 2O6CA 5JMOC 1IGTB 4JREB 3HKZA 2JJTC 4AXWB 4L3CB 2RA1A 3V5KB 2HLFC 2HA1A 4FNLH 1B0RA 3GDBA 1Q94A 5LN4A 3KWXA 2LR4A 2DWEA 5IROD 1KG0A 2OX5A 2WN3A 4K7FB 4AL8H 3WGUB 4XVUC 3KWTA 4OCXH 3GHPA 4AYFB 5HGDB 4DCQA 5A6IA 3Q1SL 2DQCL 5T3XD 2EUXA 2YZ1A 2PW1B 3TO4C 1GZHA 1TOXA 5MENB 1QNZH 4UDUB 1M05A 3UJTL 1A4CA 2JCCE 3KCWA 3F83A 4ZTEA 2W60A 4FEIA 1T0MA 1HE7A 4KKNA 2OZ4H 3RKPA 2RQ8A 3RWIB 4B0MB 2C34A 2JB5L 4WDIB 1MJ8H 2A3TA 1DBBH 5MERA 1KCBA 5GS1C 2KC0A 1VFOA 4LPVA 3GJFA 5ICZB 4AW4A 3VWKB 4JHVA 3DETC 3LKQB 5EZLA 3ET9F 5F8RC 1GYWA 3HZMA 2IAMB 1XF4A 2XJLA 3PAZA 2IH3B 3WV0A 4NZFA 3RU8L 3FQNB 5SWZA 2ZNXA 2BNUB 2O5NA 4F7CA 1Q0EA 1VIWA 3MLYL 2LLGA 3EBIA 1IIIA 2R0LL 1G9MC 1T5XB 1GC1L 2AQPA 5SWSD 1CUOA 1THCA 3DV6A 1JPFB 2Z92A 1CICC 4MCYB 5HI5D 4J23A 2Q7YA 4A38A 4HKJB 3GRWA 1Q38A 2XG4B 1GTFA 3WIHL 5E94B 5BZWB 3HFFA 3KG5A 1OWWA 1COBA 3C5SB 4KBPA 4YC2B 5KSBE 1CE1H 1HSBB 1WFTA 4HMCA 3QIBA 3QDGA 5ESVB 1MPAH 4IOSA 1MRFL 3EYVB 3C08H 1SEBB 3WFDH 1HXMA 2YZ8A 1O6SA 4PJBB 4L4TB 2LFGA 3VXPA 4S0SD 4S11A 2I5YL 4KI5C 5I6XC 4GBXD 1D7BA 2WQXA 1P7KA 5M95B 1OLZA 5EOTB 1S7WA 3WS6A 4HIHB 3SN6N 2WD0A 1O0VA 3SDDD 4F58H 3MRRA 2OYKA 5L9DL 4WUUB 2CDGB 4GINA 1KFGA 1RK1A 2NY1C 3O2DL 5DRNA 4IKJA 2IWFA 4GXUM 3KLKA 4L4VB 1A6WL 2J5LC 2BWQA 2OP4H 4H8WH 4B9FA 2I9LA 4LLMA 5INDA 2VZ3A 2FO4B 4RAUB 5B38A 4K3EH 4FNLL 3T5WA 1OY3B 4NXKA 5DEGB 5I8CB 3TESA 4IRZH 3CFEA 1CVSC 3ZDYE 1EXUB 4FULA 1KYUA 2J2ZA 4P2OB 2I7SA 4FQJH 1CF8L 5D8JH 1XGQB 3VGHA 5HGGS 3ULVF 3LB6D 4HWUA 2BRQA 3IF1B 3VRLF 3FT3A 2O61B 5EUOE 2GJRA 4LRIC 2A9CA 1BVLB 1QNZL 3FT9A 4JG0L 3S88H 3K72A 2WTOA 3CIQA 3CBRA 4W1TA 5HXMA 4YS4A 2OZ4L 3PIQB 4W68A 4OD2A 1MJ8L 4U33A 4Y19B 2YPKA 3DO3A 5D5MA 1GCFA 4APQA 1K4CA 1YEEH 3T3MB 1RP8A 4LCCC 3TJPA 3W39A 1KGXA 2X2HA 4NO2B 3IRZA 4OGQC 5KJRH 3HI5H 4X5XA 2PCFA 1SYSB 1BREA 2F08A 1VFAA 2W0LA 4ORGA 4NWUH 5EO0A 4AM0A 4Z3EA 3PFQA 2EH8H 1ZT1A 2DQTL 4UCFA 2X6UA 3UCQA 1KPVA 4GKNA 4CBPA 1C5DB 3ARRA 3CC5A 2BOCB 4ZMTA 1MJJB 2M1KA 3UTTD 1UWEH 1HEZA 5EIIB 2W07B 4UTBL 4N2OA 2X1PA 1S9VA 3FB5B 4M62H 3V8OA 5AD0A 2QFPA 4LO9A 4YHNB 4KZDL 3U7AA 3O4LB 1CE1L 3JUZA 5TDPB 3FO2A 3CNKA 1H6EA 5ID0B 1MPAL 3L3JB 4ZFZB 3VXSB 2AJ3B 3C08L 3WFDL 4HFUH 5IVXB 1OB0A 4UM9D 2BVQA 2IBGA 3HZVB 3QORA 4ERSH 4OGXH 3EJCA 2WC7A 4CVXA 1NEZG 4M48H 4HJGB 5IQ9A 3BUTA 2FEDD 5DSCB 5FR3A 1M7IA 3MNMA 4F58L 4I18C 3DHPA 1HNYA 1AD0A 3FOMB 3FH8A 2R4SL 4H1LG 4M93C 3SHSA 5TE6H 4YEFA 1WBYA 3HAEB 1PTZA 3PP3H 2PTTA 4XZUA 3DJTA 2JE8A 1KLUB 2FWUA 4AQ8A 5C2BH 1DSWA 3O6FA 2OP4L 3ARBA 4U4IA 1I8MA 1Q9WA 1H15B 2R1YB 4P2QB 5E2TL 1MCFA 5FYJE 4K3EL 3BWSA 4U1LB 3I3EA 2XNAA 4IGBB 4A7QA 2BINA 4KO9A 4IRZL 4FABH 4PRHD 2Z91B 2BVPB 5FO7B 3FU7A 1U8LA 3WMSA 5D8JL 1DLFL 3C2AH 4YAQA 2BIPA 3MCLH 3MV11 5IOPA 2Z65C 4LLDA 2BVOB 4EN3A 5A2FA 1G5AA 1KXVA 3PDGA 3QR1A 1ZGLB 3TT3H 3SJVD 3E1F1 4NO0A 4YHKH 3JTSA 1T7YA 2DIAA 3OWRA 4OIIH 5DYOB 1GPOL 1NCAL 2BFGA 3H85A 4Y5XA 4EI5B 3TEWA 4CC1A 4QRRB 3S88L 3QIWC 5AB1A 1HEHC 3UERA 3S48A 1DLHB 5EEXA 1I7TB 1SXAA 1F00I 3CSYB 2VDML 1JVKA 3T65B 5LDSA 3FO0H 2ZF8A 2O26U 4O51B 5FECA 1NCTA 3CGTA 4GT0A 4BCYA 2A38A 3RBGA 3HI5L 5KJRL 1UEYA 4Y1AE 1EK3A 1EEZA 3BWAB 4NKOA 3W9DB 1INQA 3WEBA 4WVRA 5GGTL 5HD8C 2P42B 1I85C 4DKEH 4DOHB 4NWUL 1U8IA 4P3CH 4MX7A 3IGLA 4GP5B 4JMXA 2EH8L 1NIDA 1NCWH 5B1BB 3VFUA 5DXWA 4ZD3H 4JUTA 3VD2A 2EEXA 3BH9A 2N0KA 3IMBA 4M8QA 2CR6A 1RUKH 4LHQB 2DQGL 3RI5K 4U0RB 2OR9H 1CL7I 5DD3H 1DBJH 4M62L 3V6FA 4I1NB 3G04B 1D6VH 3U2IA 4KY1H 4O02L 4UMGA 1Q8MA 4UIKH 5TGBB 4BXVA 4QCIB 3DUUA 4I3RH 4WV1B 3HE6C 3LPOA 4ODSL 4Z23A 1X5ZA 2FD6H 5DEFB 2G9HB 3Q44A 4HFUL 2PYEE 4PR5B 1QEXA 1X7QB 2EE3A 3MNZB 3CUPB 4Z3IA 4ERSL 3IFLH 4OZFA 2V2XA 2ZSVB 5DHVA 5BS0E 3D39E 4M48L 3NCEB 3F00A 4LOUD 5LAXA 1KGUA 2KLRA 5HHNA 5DDHA 3AQDA 1XSJA 4HG4J 4XPTL 3V4PL 3QI9D 1AZCA 2AXGA 5TE6L 3Q48A 5ETUB 1QSFB 4B27A 4Y16B 2AQ1A 1LGVA 3S5ZA 4HD5A 4UU9A 2F54A 1P84K 3NZSA 5C2BL 2UWEF 4ZO8A 4K4KA 3ARVA 3FTYA 5AVWB 2ZUYA 1EEYA 3HIZA 3B7YA 3FO1B 2EACA 1DDTA 1QYGH 2VE6B 3C8HA 1M3JA 2K70A 2UZIH 4QRSB 4Y9EA 1K72A 4FABL 4Z3GA 8FABB 3D3VD 4RMUA 4QXVA 2J44A 3IDUA 2DOCA 2J4WH 1S5HA 2YMTA 3BQVA 3QUXC 1N59A 4ALAC 4KQ3L 3MV01 5TDNB 3MCLL 3Q05A 4WFHE 5E4IA 3ZHDA 3TT3L 1TZ8A 3S96A 4YHKL 5KANI 4OIIL 4BCXA 3B2VH 1QFWH 1QRNE 2VRQA 3OLEA 5ICYB 5HHVH 4NQDD 5D70H 2OYPA 1LILA 3A0OA 2I69A 1RZFH 3F6LA 3JXAA 4AH2A 1EV2E 3ZKMC 3G6JF 3FO0L 1E9PA 3QWRD 4M7LT 1Q9KB 1TR7A 3LQAH 1GYUA 5JDSB 3P2BA 4LEEA 3QUHA 2XWRA 4GB9A 1I7RB 1QR1B 4S1SH 3QXAB 1JOIA 1OTSD 3WTSA 3E6FB 3PWPB 1A4KA 2Y3NA 3VFMA 3QISA 5HHPB 4DKEL 1G1YA 2QT6A 3TH4T 3IDXH 4UT9A 4YFDB 3PWUB 3S7GA 4GKSB 3T77B 4AE1A 3TCXA 4R7VA 3NIDF 1GVIA 2LGNA 3BSZL 4F8PA 3QQ9C 5E8NB 1RUKL 2ORBH 3CSBA 2OR9L 1FCCA 2N59A 2Q2LA 4IS6A 4C58B 5I1AA 3HB3C 2WKOA 1D6VL 2PLTA 4XTRD 4XWOC 2Q6WB 1SQ2N 4I3RL 1J8HE 4QHNA 1ET7A 1WZMA 3T8VA 1HSAB 1AKJB 1WV7T 4Y4KC 3P40A 5FUCC 5SV4A 1K8IA 4MJ6B 1UGNA 1JF5A 1RK7A 1J9RA 2Y6SD 5EU6A 2DYPA 1QSEB 2ESVA 4N2HA 1QD0A 2GQHA 2O93L 3KYOB 4X5PA 1TO4A 4FTVA 4OLUH 3CFKB 1JDAA 3OKNB 4OZ4B 2QPEB 3HVDA 4MMZA 1YPZF 2Y9RT 2FGWH 3GUTB 1UZ6F 3FO9B 2YRLA 5HVGB 1X9LA 1EHLH 5CSGA 5B4MC 1QYGL 4OCYH 3TURA 2YXWA 2UZIL 2WHVA 4G6FB 3BFQG 1QRNA 4PD4K 2BM3A 5E8EA 3RVWC 5HGHA 4ZS7H 3B9DA 1ACZA 1VERA 4BGLA 2OAAA 1YRKA 5GGUA 2A4ZA 3VXNA 2HFGL 3DX2A 2CM6A 5F21B 3VDBA 1U95A 2NW3A 1RZQA 1RI8A 4OKDA 5HVHB 2VDNH 5FXCH 3DOIA 1OV8A 1MI5A 2MSPA 1QFWL 5SV3A 4EE2A 4HA1A 4HIEA 2IDFA 5F7DB 4FI7A 5HHVL 5D70L 1XGRA 3V5HA 4POZD 5D4QA 1A1MB 3N0PB 4BYHA 3C5XA 1RZFL 3LNDA 4Z7WF 4IRSD 1QBMH 2GEEA 4J4PA 4MVBC 1PY9A 4U1KA 1URZA 4DJMA 5IP4A 4QPEA 5F6HI 4DVBA 3GTTA 4KROB 3X3GH 3EJUA 3LQAL 4QOKB 5HYJB 4HUWB 5DD6B 3LEVL 3OGOE 2VDMB 3VXTA 4PCKA 3FT4B 1ZT7B 5K1VA 4ZMQA 5IW6B 2GKIA 4U7KA 1PG7W 2MNUA 2OMZB 3H4FA 1WK0A 3OX8A 4JFFD 4ZMYA 4K7PL 2ARWA 5EN2B 3TVMD 3IDXL 2B9AA 3B9KC 2L7JA 3W1ZA 3BRGC 2X40A 3L3OA 4OD3H 1OSPH 1DZBA 4AQAB 3VXUB 2F7QA 1UM4H 5DS8A 4N8CL 1KTDA 5IHZA 3TF4A 2ORBL 4OFDA 3R4DA 4CU6A 1EGJH 1Q1PA 4HK0A 5IB5A 4P4RA 1OGPA 1LO3H 4NN6B 3NOIA 4G8GB 3VFWB 4E41E 2A73A 3IN0A 4WI7A 1N6QL 3QCUL 4Z78B 2AANA 2A77H 1DBMH 4ZW7A 5E03A 3A4DA 5I16B 3QZMA 3TS8A 2G0KA 4U1MB 5C0JA 3T0XA 1CQKA 4O02B 1BQHG 5DZOA 2QJDA 2QGDA 3GGWA 3AGVA 2QL1A 3ECBA 1P0SE 1BHGA 4ZZFA 4EUPH 4EDXB 4LLYB 4X0NA 2WO4A 4NBXB 4Y5YC 2VUOA 3GI9H 2JJSC 1Q0XH 1XGTA 2VDPH 4GO6B 1XV8A 3C2SA 4NKIH 4K9EC 2HKHL 5G2NA 4IJ3B 1T1WB 3ARDB 3V4PB 2QMKA 1JGLL 1CT8B 2XN1A 5JW4M 1NJ9B 4LF3A 1EHLL 3T2QA 1U8OB 1MHPH 2B8OT 2JIXA 4YH6A 4DQOH 4OVUA 2H8PB 1OP3K 4DP0X 4OCYL 4HEME 3VD4A 3F12A 5BO0D 1KJMB 4LAQH 5HJ3A 1T04A 4ZS7L 5CZXD 3L4YA 4UZGA 1DVSA 1AGFA 1SUHA 5GZNC 3WE1A 3OQ3B 4N9OB 1S2EA 5IEHA 3U36B 3N06B 4GLRI 2LW3A 5T1LA 3A24A 2VDNL 4PP1C 1EJOH 1JZ2A 1DVFC 1V10A 3O8XC 1WQVT 2OQJA 1FJ1B 2DDQH 2Y5TB 4MNQA 5EO9B 1ZTXH 15C8H 3QDJB 4IIQB 3B2DC 1QBML 4GW1B 1IILE 1WS8A 4JKPH 2H26B 3C6LC 5JMRA 2FZ3B 2WINA 3X3GL 1OCCB 3GMRB 3B2PA 2O6PA 3VWKD 1SVBA 1PYWA 4UQ3A 4AYSA 1NC4D 2ENJA 3RGVB 2JVUA 4XAKE 2IAMD 5AUMB 2FJHB 4D9LH 1E4XI 3WTUA 2H2SD 1U9KA 3CN3A 4E41A 4WY7H 2NXYB 2QSVA 1HILA 4OD3L 1ZVSB 1OSPL 3HLAA 1UM4L 2FX7L 3I6LD 1B3JA 2DY2A 1M7UA 4WNSA 1NBYA 1LJMA 4ELMA 1NBQA 2X3CA 5I75C 3KYMB 3FPYA 1LO3L 3RKDD 1MHCB 3DGCR 1G7LA 4NPYA 5CHNB 4JFYA 4AENB 4GS7B 3CDCA 3KVQA 4AYEC 2CKBH 3IJEA 2HUEA 3UGXA 4DO4A 2MIZA 3VXOA 1KIQA 3KGSA 1ZLWK 5EFIB 3NP4A 1XDTT 1U0QA 3V0GA 5EU5A 3APMA 1ED3B 1Q0XL 1YEJH 2YMOA 2VDPL 4N2DA 1YEHH 2LTQB 4HCGA 4YBLB 1YSOA 4HH9B 1P1VA 4NKIL 1MRDH 3GLZA 4WUUD 3SPVB 4AC2A 1UXMA 4YSUA 3C8KB 2FJGA 3QH3B 3NIFE 2OLDA 5E1AB 3WEAA 2XBZA 1AOHA 3HUJF 3DX0A 3OG4B 5I24A 2IV8A 1OSEA 1MNUH 3A21A 5GRJH 3MUGB 4OB5L 4WAFA 4F8QA 3T6VA 1OPGL 2EDRA 4PJIE 4Z7QB 4ZUSB 3ZO9A 1AHMA 1R33A 4LAQL 3IJHB 1XR9B 3EOAA 3VGGA 4WWKB 4Y88A 4GIOA 5D72H 1JUFA 1QABA 5IJVA 2VZTA 2XU9A 1OGAE 3I02A 2VDLL 4PJDE 5CBEA 3L9EA 2K0RA 5EOCJ 2DDQL 1ZTXL 2CK0H 2J88H 1T66D 3KL3A 3QO0A 4ODUB 4V1DB 3CXFA 3TNMB 3EGXA 1ORQA 5DF0A 3BPOB 3DXAB 2CPUA 4FNPA 2DJMA 4Y19D 2OFQA 3B4NA 3LIZH 4FMKA 3IXAB 2D3NA 3LXAA 5AW4B 3TCLB 4ZFOA 1ZVHA 3EH5B 5CMAB 2R83A 1C12A 4ELDA 2G60H 1BOYA 4KNTA 1H3PL 2YN3A 3SKMB 1UT2A 2BSSB 2QKIB 2XKNA 2Y7OA 4WY7L 2FECL 4F8NA 2HH0H 2DTSA 4DKFH 2D7NA 3BFOA 2AABH 2HMID 1NGXB 1SPDA 5JHDA 4AVHA 3EFDH 4KRPD 4OGAD 43CAB 3CZJA 5I17A 1WP6A 1HKLH 3PP4H 3IGAA 1RIHH 4R84A 5HDWA 3EJTA 3OMAB 3T0EC 3X12B 1ZSDB 1AO7B 1IBYA 4YSCA 4DP7X 3VA2C 4GRWF 5KYWA 1MCJA 2LU3A 1ORSB 3KLSA 3CBJB 3SDAC 1CG9B 1FZMA 4PWFA 4M4PA 3DHJA 3VXSD 5E1QA 4LLWA 2LU4A 3EJQA 2EE2A 3R0NA 4GSQA 5E2UL 3BFWA 2VM3A 4AZ8B 2WO2B 1KJ2H 2HRHA 3X1NA 2VRAA 1ZCRA 5FKPB 1T03L 4YSAA 4GAYA 4HUMB 1BZOA 4ZNCD 3ULUC 1YEJL 1YEHL 5DQJA 1CXHA 1AMXA 2OL3A 1NLBH 4NUQA 3BVVA 3IGFA 4BV1A 4X7CC 1NA8A 5TJWK 4KRMB 3X13B 4YSRA 5FM8A 5D4IA 2UZPA 2O4EA 1MNUL 2YJLA 5GRJL 1BLIA 3OJDB 4OUUB 3PWJA 4P2QD 2KQNA 3IGUA 4IRJA 3M17A 4W4OC 2F7RA 1T89A 2AXJA 3MO1A 4JDVA 3U0WH 2OULB 3VRJA 1LE5B 2NR6A 4IGBD 3PJSA 3RRQA 1Z9MA 1IZJA 3CN2A 4NNXA 4YUEH 2MHAB 2ZX5A 4TUOA 4ETQA 3F2LA 4UNTA 4DZBA 4NQXB 3BP6B 1J0YA 4NDMA 4IEFA 2GY7B 1U58A 1YY9D 3NH7H 1F0LA 4EI5D 2OW7A 2CJUH 4QRRD 2VDNB 4WTZG 1JK9B 3GZKA 5FCUH 2ZKWA 1G4MA 2Q86A 4X4ME 2XUWA 4AEFA 1E3FA 1LK2B 2WYHA 5C0GB 3ALWA 3LIZL 1FP5A 4JFUA 1O9WA 4M6AA 4Q2ZA 5BUGA 1DBAH 4L3EE 3WN5A 1M71A 5KVGE 2HZHA 1T83A 5K39B 1M53A 2NUTA 4WNJA 4R0LB 3QUZA 1OAJA 4AGNA 1U3HA 2C9UA 4B9PA 2HH0L 3AT8A 4KZEH 2Z1PA 4MYWB 2CU9A 4DKFL 2Z7YA 1DFXA 4TTGA 1S7VA 3HG5A 2AABL 3FSAA 4Q9QL 2XFXA 3MV7B 4MASA 4JHUA 3RUGB 1F1GA 1BQRA 1HKLL 1UD3A 3PP4L 4KK8C 3RTQB 1RIHL 4EEEA 5T8IA 4KK6C 3EOBA 3U9UB 4BSVA 3KW8A 4Y5VA 3SKOA 1HHJA 1A7BA 3RL2A 1I1AB 1EVTC 1L0XA 3RIAK 1EO7A 4KJYB 5CN2A 1QBLL 1KJ3H 2AERT 4BH8B 1NDGA 5I30H 3L3GA 4WI5A 2ZYIA 3MXWL 1JV5A 1CTNA 1KJ2L 2IJ0C 3TEXA 1HXYB 1MW3A 1FL3B 1TQBB 4IDLA 4K2UL 3VB9A 2N3JA 3OQRA 2UYLB 2YC1A 1F1AA 3JYBA 3BGAA 3N1FC 2CA4A 1W0WB 2Z64C 2LOEA 3IAGC 4JO3H 2HFEB 1F90L 3NFPB 1ZLVK 5F96L 1GZHC 5I0ZA 3B5TA 1QSFD 2VDPB 2EVGA 2B59A 2GFBA 2VTFA 4NHCH 4HWZB 5I71C 5KS9E 5KYXA 4PJ5D 4NNYB 1YN6B 2V2WB 2BK8A 4MZ3A 5ID1A 2MPVA 4C8XA 3EXLA 2LQRA 4JANA 3G6AA 3GLAA 5K9JH 3FMGL 3SJVA 3KPQB 1IGCH 1YNKH 4JCLA 2X53A 4W9IC 4LPUA 4E5XB 4HWEH 4NPKA 4YUEL 1FHNA 1D7FA 3DO7B 5JW5B 1NFDA 4OLZH 4HULB 4X4MA 2QGBA 2VC2H 1J8RA 2WBKA 1G7QA 1SDDA 2GIXA 3I6GA 3L81A 5E6RB 2X41A 3KHOA 4HLJA 3QCTH 3T1WA 4E9QA 3NH7L 2YPLD 1CLYH 2XRAH 4E9WA 2H1PH 3RPBA 1LYQA 1KB5H 1NCUA 5DCCA 5T5NG 4FA8A 2CJUL 4KKBD 1MCKA 2HFFB 2VDLB 4FQ2H 2B4CC 3DSFH 2EVFA 2G9KA 4J3OG 4AQEB 1YA5A 3LSOA 2C3VA 3ME0B 3X11B 3K5SA 2WLLA 1CXLA 2WWOA 3GMQB 1S7RB 2MQCA 2ADJA 4NRYB 3UDWA 4L3AA 4WZ9A 5EC1A 5DWUH 4XO3A 3ASOB 5F0PB 1SJEB 3BT2H 3G3LA 2D03H 4ZW6A 4BJLA 5C07B 1MCHA 4JRFA 1A22B 3L95A 3ZDZB 4Y4FC 1G6RL 1MSPA 4KZEL 4EAEA 5I9QC 3DX9B 5CEYB 3FBKA 4NZTH 5EOCH 5HI3D 2X6AA 3DSNA 5ANHA 2O72A 3BZFB 3H9ZA 3PQYB 3I50L 1RUPH 1J9QA 1AGBA 2GI7A 2WWMC 3B1UA 4JRXE 5D2NC 1KTKE 4BSWA 3DYPA 1TQTA 2HPTA 3ZQXA 4AZUA 2G75B 3MUUA 5AKRA