1ETHA

Triacylglycerol lipase/colipase complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
448
structure length
448
Chain Sequence
SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTITNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQKNILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPCPSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNVINPTLPRVGASKITVERNDGKVYDFCSQETVREEVLLTLNPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lipase activation by nonionic detergents. The crystal structure of the porcine lipase-colipase-tetraethylene glycol monooctyl ether complex.
pubmed doi rcsb
molecule tags Complex (hydrolase/cofactor)
molecule keywords TRIACYLGLYCEROL ACYL-HYDROLASE
total genus 116
structure length 448
sequence length 448
chains with identical sequence C
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 1ethA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ethA01
1F0PA 4G9GA 4KEAA 4ZGBA 5ALIA 5IVKA 4H7FA 5ALMA 2CBGA 2B9VA 4BP9A 3EQ8A 3TGLA 3IDAA 1GT6A 3RLIA 3B3QA 4UFNA 3S2ZA 4DSAA 2I3ZA 2QJWA 1XZLA 2ACKA 4KRXA 2AJLI 5EHNA 1CUDA 1CUZA 4KE6A 1N1MA 1LBTA 5LZ8A 3E1GA 2PX6A 2WIDA 1EDBA 4U2FA 5ALTA 1QMDA 2VT6A 1NO3A 4AO6A 5C8VA 4Y2VA 1K63A 5H3HA 3E3AA 3VJKA 4D9JA 2Z8XA 1LGYA 3O9VA 4QLAA 1GKLA 3D7RA 2O2IA 3C6XA 3V99A 3QMWA 1GPKA 2XUKA 1H22A 5FP0A 4OYYA 3ED1A 1E5TA 2ES4A 1EK2A 1GGVA 2XUFA 1ZI9A 1CUJA 3PICA 4JNCA 4U2DA 4W1QA 2WFMA 2RI6A 4KRYA 1H2XA 4LIPD 4Q1VA 4PF1A 2ZYSA 2XUIA 1FFAA 3V48A 3IBTA 1XZAA 5AKKA 4GDMA 2OPHA 4Q3KA 1U4NA 2I03A 2D5LA 1CUYA 2QRUA 3AINA 3FYTA 3H2IA 2H7CA 4UFPA 3U0VA 3R0VA 3D2AA 3H18A 1R9MA 4HXFB 2QXUA 3I2HA 4UFOA 5JYCA 1XZBA 3UUEA 3O9MA 4FOLA 5IVDA 1JMKC 4B0PA 1UWCA 4BB0A 5HK8A 5CT6A 4B84A 4AN1A 1N5MA 1MAAA 2QS9A 4UHBA 2XUAA 4GLBA 5DYWA 4X3CA 4NVRA 1MO2A 1W6RA 1CUSA 2PUJA 1A8SA 1AGYA 1HBJA 5HKAA 3WL6A 1Y7IA 2JGJA 4J0HA 4C01A 1ZOIA 3BF7A 4FBLA 4LKOA 4UHEA 1JJBA 1LPOA 1K4YA 2ZJ7A 3S8YA 1WHSA 2ROQA 1Q0RA 1Z68A 4G9EA 4HZGA 4ARBA 3HLKA 3AIMA 2ORYA 4OU5A 5EHXA 1XZKA 3FCYA 1AUOA 2WFLB 2H7YA 5CT8A 4FKBA 2HA5A 3C8DA 3T52A 3JWEA 5ALKA 1R1DA 4G4JA 2XQJA 1AZWA 5C7YA 1LNHA 3DLTA 4E14A 1ZD4A 1VXRA 4GBGA 3STYA 3QITA 1BU8A 1YA8A 3M81A 2AJCA 1SFRA 2WM2A 1TCBA 1BS9A 4BC0A 1XKTA 5D3ZA 5AOAA 2IIVA 3R3ZA 4X00A 5J3JA 4U2BA 3WKCA 5HQ3A 3I1IA 3WWCA 1CA1A 4IO0A 1LPSA 3ANTA 3DDUA 4HTAA 4ZV9A 2GBFA 3ESDA 1CV2A 1J2EA 4AB1A 4EY5A 3QYJA 1DWPA 5DNWA 5ALGA 5EIHA 3H2KA 2OCKA 4OD0A 4NMWA 5AKYA 3R41A 3O4IA 3V9AA 4N8EA 3G02A 1R3DA 3DL4A 3C87A 3WKBA 4AO7A 2D0DA 4DYHA 3G0BA 1XRNA 3PZWA 2HA4A 3D5EA 3I2KA 2W22A 1BCRA 1AX9A 4DSZA 5IH7A 5HCUA 2C4HA 3WIOA 1YB7A 1CVLA 4CCYB 2HFKA 3L1HA 4AX4A 5A7HA 3KXPA 4QZVA 1F0NA 5AOBA 3H1BA 3EBLA 5AK3A 4W63A 1TKRA 4Y2JA 4PO3X 3R40A 3G9XA 2XDWA 1LLFA 2ZYRA 2E3JA 2QTBA 4QWWA 4J0CA 4PSUA 3HI4A 1XROA 2IX9A 3WJ2A 1VLQA 2QXTA 3BDVA 4UUQA 2Y2UA 5I8PA 3H2JA 2G63A 2VF2A 4Q34A 1FGMA 1YCDA 3R3VA 1XZDA 3DJYA 1ZD3A 3DOIA 4MQMA 4B81A 3DQZA 5ALEA 4P9NA 1RP1A 2Y6UA 3STVA 2XMQA 4FFVA 3F8SA 5LZ9A 1XZHA 5DNUA 4CIAA 4CIBA 3R3XA 2PU5A 2JGMA 2WJ6A 3SK0A 4C89A 2WQZA 5ALXA 3WKAA 1PFQA 4WDRA 4B9EA 4LYEA 1HDEA 3A2NA 4DMFA 1GZ7A 3AJAA 3FBWA 5JZSA 1XLUA 2XE4A 3R3UA 4PSCA 3ZLVA 5ISMA 1QO9A 4BP8A 5T4FA 3IULA 3BIXA 2P8SA 1P0QA 1SCKA 5AM0A 1WB6A 2HDWA 1MX1A 2WUGA 3VXKA 5DWDA 4J03A 1CUUA 2XMCA 4ROTA 5AK6A 1H2YA 5JANA 3FVTA 2DSNA 1EHYA 1EK1A 2G5TA 2XMRA 2I3DA 2OQVA 2AJDA 5ALQA 2CKMA 5AHXA 3WIBA 1LBSA 4PNZA 2XUQA 1THTA 3DS8A 4L72A 2EDAA 4LXGA 3I2GA 2JIDA 4QWTA 3WWPA 3W9UA 3QM1A 4KJXA 3X3HA 4X71A 4HAIA 5LIPA 5FLKA 2FJPA 2QKYA 3VVLA 3K6KA 4Y2YA 3WA7A 5AKLA 5T4BA 3OM8A 4YASA 1XZGA 5LP1A 2YXPX 3QH4A 1CRLA 2PPLA 1DT5A 4E46A 1G66A 1AKNA 3W04A 4BRZA 4KE7A 1E89A 4X92A 2GYWA 1H2ZA 2XUGA 1HU9A 4XIIA 4N8SA 5AM5A 4P92A 1DX4A 3IUMA 2HU7A 1CUAA 1MPXA 2FUKA 3VKFA 1YB6A 1MAHA 1JMYA 4QA9A 1CQWA 5CMLA 1BROA 3NOXA 2PSFA 1WOMA 2PSDA 2YH2A 3FG3A 2WFZA 1WPXA 4NZZA 3LCRA 5ALOA 5BWCA 4EY8A 3H04A 2ZYIA 4QDUA 5BOVA 3ZPXA 1ZI6A 2XUDA 4Q3OA 4BTVA 3HSSA 5BV7A 4P93A 2WY6A 3AIOA 2HHAA 3I2FA 5DYYA 1ZD2P 2G4LA 4HXGA 2ZSHA 3DKKA 2B4KA 1N8QA 3ZLUA 2J4FA 1JKMA 1K8QA 1WPRA 4J0IA 4XVCA 3ICVA 1JJIA 2X76A 4F21A 3FNBA 5AKEA 1F8NA 1GXSA 5LZ7A 1ACLA 4FDMA 4GI1A 3STWA 1ODCA 4Y2UA 2AJBA 4X85A 5CT9A 1TIBA 3N2ZB 1MTZA 4BBZA 3IUJA 1VJ5A 1VKHA 5AK5A 1UOPA 1XRRA 5IKXA 4KYVA 1XQWA 3H1AA 4UBOA 4G4IA 3ILSA 1XRMA 2PVSA 3DEAA 5LZ5A 2PSHA 3W9BA 1U2EA 2J3QA 2WHQA 1UK6A 1XZMA 2XI4A 3EQ9A 1X2BA 3BJMA 3FYUC 1R88A 1VZ3A 5EIEA 2JGEA 2UZ0A 3PF9A 3GROA 3A70A 3KD2A 2C5FA 4OU4A 3WK8A 1J1IA 2GBCA 5AM2A 4AXBA 4J3JA 2XMDA 3H2HA 4KAFA 1TRHA 4UHFA 1FGTA 4UHHA 1T2NA 3IURA 1HKHA 2H9YA 2BUBA 1CUBA 1GQRA 4EZIA 2PL5A 3UMJA 1QONA 2P0MA 1UZAA 2BUCA 4U2EA 5AKHA 1QIMA 1FGRA 1VOTA 4PV7A 5T4EA 2WUFA 4OCZA 5AK4A 4K6GA 2PKYX 2C58A 4FLMA 4RNCA 2V9ZA 1W4LA 4BVKA 2IUKA 4DTCA 5SYNA 3CN9A 1GKKA 4XX1A 1QIKA 2XUPA 4GHWA 4K6HA 1O6GA 3W2TA 1JI3A 4W1RA 2QM0A 5LKRA 1XFDA 4Y2SA 3FLBA 5FXMA 1N8SA 4Y2PA 2GYVA 4H7IA 1M33A 5HQ3B 1CUXA 5JAOA 3WZLA 1TAHA 3G0GA 3SWWA 2O7RA 5K3AA 4BC1A 5JAPA 1E8MA 1QTIA 3PF8A 2XB6A 1YSCA 1LPMA 4DMCA 5HF6A 1YAHA 3O4GA 3BNBA 4X7BA 1RRLA 2C0QA 4B6GA 4NS4A 3E4DA 1IZ8A 3MUNA 1S8OA 1XRPA 5FRDA 2WUEA 4H18A 2OG1A 1EDDA 4C4YA 3BNCA 4F5ZA 1KU0A 1R50A 1X2EA 2HA0A 1UXOA 4XJVA 2V96A 1Y37A 1CUVA 5EHZA 5ALNA 3V1NA 2RHTA 5AICA 3V98A 4JH0A 2O7VA 4MYDA 3P2MA 1JU4A 4C88A 5AI5A 4LYDA 2WXUA 3FAKA 3JYHA 1YR2A 2Z3ZA 3QMMA 2BKLA 4UBLA 4BZZA 1EVEA 1PJAA 4CI9A 1DT3A 3C5WP 5F4ZA 3AIKA 5KWJA 1UKCA 2HFJA 3E0XA 3STUA 1KHOA 1P0IA 1CUWA 1XZEA 1FFBA 2GYUA 4LHEA 4K2AA 1EDEA 4B7ZA 3C45A 5A71A 1FGQA 4IH1A 5DYTA 5EFZA 1QIFA 2QOEA 3ESAA 1OCEA 4FLFA 2VATA 2RHWA 1GQSA 4Q3LA 2RGUA 4MEBA 2DHDA 4B85A 3RM3A 2J4CA 2XUJA 1YASA 4L9AA 1W52X 1RRHA 4E11A 1EB9A 2VT7A 3I1YA 2WG1A 1ZD5A 3PUIA 1DQYA 1K6EA 5K5EA 4UBMA 2JF0A 4K6KA 2PM8A 1JT2A 1YS1X 4E15A 3ZI7A 5ALWA 4MQLA 2I78A 1P0PA 1G4HA 4GEGA 5JD6A 4Y2RA 2VQ6A 5JD5A 5ALHA 5A2GA 3RARA 4KAJA 3F96A 3WL7A 2HL6A 3FSGA 3QPDA 3BNEA 3F67A 1Q84A 5ALZA 4ETWA 2QZPA 4NREA 4WDQA 1E8DA 4CG3A 2R8BA 4X91A 1L7QA 2BJHA 1ORVA 4J0DA 3JW8A 1YGEA 2X5XA 4A23A 1ZICA 1CQZA 2IITA 1G42A 1EA5A 4I3FA 1CLEA 2HRQA 1XRQA 4G8DA 4RE5A 4IH4A 2YASA 1MN6A 4AMZA 3K2IA 3G0CA 3I6ZA 4WHAA 1UT6A 2YYSA 2Z5GA 2C5GA 3BE8A 1OLPA 1DU4A 3HRHA 4RGYA 1IUNA 2WILA 3C5VA 3D59A 4QDZA 1BCSA 1XRLA 3DL7A 4YPVA 2CB9A 1PV1A 2HA3A 1IUOA 3D4LA 1CUCA 1A8QA 4Y2XA 3C70A 1ETHA 4F0JA 1T4MA 5JALA 1VA5A 2PBLA 4DGQA 2Z3WA 1QIEA 5IVIA 2JEYA 3H19A 2AXEA 3GZJA 5HF8A 1XZIA 3LIPA 1MJ5A 1FFCA 4WFOA 2RIPA 2GBIA 2VAXA 4QDTA 3PFCA 1USWA 5AI6A 5ALVA 1C4XA 1GPLA 1U8EA 3I2IA 1BN7A 4PSDA 1TCCA 4G5XA 5AI8A 5JAHA 3GFFA 1SOMA 2CEKA 4DLNA 5IVHA 4H7HA 4JYPA 5D3KA 1HLGA 2VA9A 5HF9A 2WU3A 2WHPB 4IHAA 1QIHA 3AFIA 1AC5A 2GZSA 3VDXA 4EY6A 4I19A 5FDFA 2BGNA 3BNDA 2FX5A 3I6YA 1IUPA 5JD4A 2OAEA 2BGRA 2WHPA 3AZPA 5AJHA 2PSJA 4N8DA 1XZJA 5D6OA 1FSSA 1RWQA 1LNSA 2VJBA 2XUHA 3WYNA 1MX9A 2HU8A 1NU6A 1EXWA 3LLCA 4HVTA 2CMFA 2VEOA 1DQZA 3CCBA 4KACA 5CH8A 2C7BA 4UHCA 1NX9A 2XLCA 1GPNA 6YASA 3BDIA 4B83A 3RKSA 2Y2VA 1DINA 2WG0A 4WFIA 4Q05A 3FCXA 3HEAA 5KREA 3IUQA 4X6XA 4AZ0A 5I7UA 5K3DA 1QJ4A 2VAVA 4EB0A 1DX6A 3HC7A 4QLOA 2VJDA 4OYLA 4M0FA 5HKBA 3SX4A 1ZIYA 3I28A 2HRRA 4UBNA 3QBJA 4MWTA 1KEZA 1VXOA 3BXPA 3DYIA 3G8YA 1KU6A 3OC0A 3CXUA 5FPPA 1QLWA 3MUOA 5C8XA 3IIIA 2HIHA 4FBMA 1CIJA 4H7EA 2ZVDA 1F8UA 5K3FA 3RK4A 3U1TA 1ZI8A 1HL7A 3D3NA 1IVYA 4YX9A 2K2QB 5LYYA 1LZLA 2Y6VA 3QMVA 3HJUA 3O0DA 1MX5A 1ODTC 5AI0A 4DIUA 1LPNA 2OCIA 4H7JA 1DWOA 1LZKA 1QM6A 4BDSA 5CTAA 3NWOA 5A7FA 2HM7A 4GW3A 4P08A 4AQDA 3FG4A 2HU5A 3HACA 4BZWA 3PFBA 2ONCA 5AO9A 4FNMA 1WB4A 1E8NA 3DKRA 4EBBA 4CCWA 2WIGA 3R3YA 4K5QA 1QIDA 2FNQA 1WB5A 1B41A 4UBIA 5CT4A 4OPMA 3NGMA 2EEPA 4EY7A 4X94A 4OSEA 4QNNA 3AZOA 5AM4A 5FPQA 1MT3A 4DM7A 1HQDA 2CZQA 4JUIA 2ECFA 2WU4A 4DMHA 2JBWA 2XMZA 3DOHA 3EQ7A 2B20A 3I6MA 1ODSA 1QIIA 5E4JA 1WM1A 4I4CA 2JGKA 5E4TA 5K3EA 4G4GA 5DTJA 3G7NA 4X93A 4BAUA 3H0CA 2AJ8A 2H1IA 3TRDA 2VSQA 3I2JA 4G8BA 4CFSA 3WLAA 3H2GA 3QZUA 4WFJA 5JAUA 3WL5A 5JZBA 3FSGD 3PDCA 3WWEA 2BCEA 5YASA 1QOZA 5JATA 2VJAA 4B9AA 4M0EA 4WY8A 5AKJA 3VJMA 3WK7A 3STXA 3WWOA 4GXNA 5CXUA 4L0CA 3VJLA 5KBYA 4J0KA 4UHDA 5AIAA 3PUHA 3K9BA 3C6YA 2WTNA 3PE6A 5EEOA 1JU3A 3FWHA 4U2CA 1J06A 3GBSA 3AUKA 3MVEA 1XZFA 5ALJA 1CUEA 3STTA 3B5EA 2OGTA 3BWXA 1ZGCA 2W6CX 4KAAA 3KWJA 4AMYA 1A88A 5AH0A 3OURA 5EGNA 5AOCA 3BF8A 1QE3A 3ANSA 1C7JA 1EI9A 3C6ZA 3EIOA 4ZV7A 4J0JA 4H0CA 5JIBA 3D2CA 5ALLA 2BUAA 1ACJA 2C0PA 4JYMA 2JGLA 2V97A 4UBJA 4QDOA 1FJ2A 3KOOA 3WQHA 3LP5A 4HRXA 2Z8ZA 1MNQA 5DJ5A 5BWBA 4S0XA 1RYYA 1JFRA 3D0KA 2OLEA 3R3WA 3WI7A 3A6ZA 3WK6A 4MJ3A 1VE6A 2HA6A 5JASA 2Y1KA 1YS2X 4V2IA 1WCYA 2CUTA 1QIGA 3CCCA 1N5RA 5DLPA 1ISPA 1BEEA 1ROVA 5FV4A 4QE3A 4X90A 1EX9A 2WIJA 3FYUB 1A8UA 5CBKA 4PW0A 2VJCA 4BVLA 2OGSA 1QIJA 3IA2A 2OAGA 3WZMA 3F9CA 4HRYA 3V92A 1SCQA 4O08A 3FOBA 4BTLA 5AI9A 1CUIA 4BYMA 3DNMA 2JGIA 1DTEA 3BJRA 4BAZA 2ZJFA 2NW6A 1OILA 4INZA 5E4YA 3QPAA 1EH5A 1UKAA 2R11A 2IUJA 3ZWQA 4GECA 4W1SA 1W75A 4RPCA 4W1PA 2QVBA 1XQXA 4MEAA 1HPLA 4N5HX 3WK4A 3M83A 4QWMA 4IH9A 4AZ3A 3O4HA 3F98A 1L7RA 4EUSA 1CEXA 4FHZA 3WKEA 3G0IA 5JZ9A 1H2WA 1FGOA 4CCYA 3KDAA 4G1FA 3KWFA 5CH5A 3VVMA 1XQYA 1UOQA 4EY4A 2WKWA 5C8ZA 2HA2A 2WTMA 5LZ4A 3TEJA 3GUUA 2XUOA 4OB8A 1UOOA 4ITVA 5CH3A 1EB8A 3FLAA 3Q8WA 3FG1A 1OXMA 1QTRA 4J0GA 3V1MA 4F60A 4ZWNA 5I9IA 1WHTA 4B82A 2JGFA 2OQIA 5SYMA 2ZSIA 4BCDA 2XLBA 1IK3A 1UK8A 4M0MA 4WY5A 3OG9A 5EHQA 1F6WA 5T4HA 5ESRA 3TJMA 2XQKA 1L7AA 1XQVA 1Y7HA 1QGED 5AKZA 1E66A 3V1LA 2BAGA 4Y2QA 3WK9A 2BFNA 2PU7A 2VTVA 4HS9A 1XLVA 3GELA 3G9UA 5HK9A 4EHBA 3VISA 1QFMA 1QZ3A 1JNQA 4U2GA 1FFEA 1TK3A 2GZRA 4C6HA 2O2HA 3GA7A 3O4JA 4ZXFA 4B0OA 3LIIA 5FKJA 4DMKA 3EF3A 4AO8A 2WUDA 4WJLA 4H7DA 4OB7A 3W06A 1CR6A 4Y7DA 1Q0ZA 3QPCA 2GBGA 3C8HA 5JARA 4BE4A 4QEKA 4J7AA 2O2GA 4DNQA 4EA6A 2OCGA 3HYSA 4X6YA 3G0DA 2DR0A 1ZIXA 5CW2A 5K3FB 4TVKA 5AKXA 1IMJA 3IB3A 3UUFA 1VE7A 3DD5A 2JEZA 1AMNA 5D7BA 3O8YA 3WJ1A 2QUBA 4QDXA 3CN7A 5C81A 3SC2A 1NU8A 4X6UA 3D2BA 3HABA 2XQGA 3FYUA 4XWGA 5HFAA 2WG2A 5A62A 3BL8A 3YASA 4A16A 4W9RA 1G5FA 1IZ7A 2XMSA 5ALYA 3M3DA 1TCAA 1TQHA 4C4ZA 3QVMA 4A5SA 3L1IA 3FLEA 3L1JA 2ACEA 1LOXA 4CG2A 4Z49A 4MWSA 4BDTA 5K3CA 2PSEA 2H7XA 1R4ZA 4Y9SA 3H17A 2WXTA 4GWLA 4CG1A 4FTWA 2WIFA 1FFDA 5HZGA 4BRSA 3N0TA 1X70A 4FNGA 3HXKA 4N5IX 5CRIA 4TPKA 5CXXA 1E3QA 1UFOA 1UKBA 3G9ZA 3ICWA 3DYVA 4IQ4A 4Q82A 2OCLA 2QJRA 1VA4A 3BIWA 4X95A 5ALFA 4UPDA 1SCIA 1Q83A 3O95A 4WFKA 5FUMA 1AURA 2WSLA 3A2MA 2XMGA 3Q0TA 4H35A 2PUHA 3IVMA 3M82A 5AM1A 1UK7A 2WJ3A 2CJPA 1MNAA 1H23A 3MGAA 2XMBA 5CT5A 3AZQA 1ZGBA 2EDCA 1CUHA 2WLSA 1CUFA 2XQFA 1D07A 3ZLTA 2QMQA 2G5PA 5EIAA 2V98A 5HF5A 3T4UA 2LIPA 4KE8A 5LLSA 5FOQA 4UBKA 1ZJ4A 1ORWA 1THGA 2ZJ6A 2Q0XA 3LS2A 2DHEA 4KE9A 2FJ0A 1BE0A 5AI4A 4TGLA 1LPPA 4ARAA 4BATA 2WIKA 5AKIA 3WMRA 5K3BA 4BVJA 2SBLA 1GYGA 1YA4A 4PQEA 1EVQA 3WWDA 2HADA 2QT9A 4FLEA 1VZ2A 3G9TA 4BCBA 3OOSA 4Y2TA 3V1KA 5AIBA 1QO7A 4AN0A 1W1IA 3OTQA 1EINA 1ZJ5A 2DQZA 5HFNA 5A7GA 1J07A 4BE9A 1CUGA 3WK5A 3C43A 4FWBA 3AILA 4DNPA 2WJ4A 3A2LA 3IUNA 4L3WA 3NUZA 2OXEA 4DNOA 3OPMA 4H7KA 4YK7A 4JEIA 2XQIA 1K5PA 1QFSA 2DHCA 5ALSA 1LPBB 4ZREA 5ALPA 1UK9A 2J3DA 3C6BA 5LZ2A 1CFJA 2RAUA 1C7IA 2X8BA 5DNVA 2DQYA 1Y4KA 3FVRA 3KSRA 3WL8A 1YAJA 2QR5A 5KWIA 4LXIA 4C87A 4BAGA 3B12A 4RE6A 5ALDA 3ESCA 3HZOA 1I6WA 2ZYHA 4X97A 4B80A 5AP9A 3F97A 5JADA 1LPAB 2WFLA 4DNFA 1A7UA 1P0MA 1DWQA 4H77A 5EI5A 2DCMA 4ZRDA 1XLWA 2B61A 4BCCA 3DCNA 7YASA 1BRTA 5CURA 5LKAA 4HXEB 2HA7A 4FFWA 3ESBA 4OB6A 1XKLA 5DTIA 4G8CA 5AKGA 4OUKX 1R9NA 1XZCA 1B6GA 5A6VA 3WA6A 4LXHA 3VF1A 1MU0A 4MXDA 3WKDA 3WYDA 3W05A 4FMPA 4C4XA 1JJFA 2QUAA 4ZI5A 1SC9A 4KR0A 5E2IA 3PI6A 1W76A 2DFPA 1BN6A 5ALUA 4MYSA 5ALRA 1CPYA 3CWZB 2RONA 2OGZA 5AM3A 1U65A 3ZV7A 1O6FA 2WHRA 1AQLA 4WCVA 1BEZA 2XT0A
chains in the Genus database with same CATH superfamily
3IV7A 4G9GA 1PSWA 2XCSB 1QH0A 4DDVA 2RJNA 3FOAA 3ZNPA 3E15A 1FP7A 4RTRA 3T9BA 2ATEA 4H7FA 4C4SA 3MQ2A 3MJHA 3BD9A 5ALMA 3D6VA 5LXTA 2ZUFA 2JKVA 3HA5A 3PFGA 3SAJA 4BP9A 2XZOA 3EQ8A 3U60B 2ZXFA 4PZ0A 4ZJUA 7GPBA 3TGLA 4NV0A 3UNXA 2Q6LA 3V5NA 2CWWA 4NYIQ 2JIOA 3AEKB 1UBSB 5DTEA 4Y6RA 2HMTA 2H4FA 3BERA 3TZEA 3S2ZA 2C5SA 1JXQA 2Y3IA 5T67A 1KH1A 4H59A 3JQ9C 3EVGA 1G7CA 2AR7A 1G4AE 4M21A 3PJGA 1XZLA 4QREA 5AHKA 3IOCA 3CZRA 3Q3HA 1YC5A 5EIWA 4DANA 4ODIA 5FQOA 4YRGA 3EX7C 3COPA 1PJQA 4LDRA 1TZ2A 3M3HA 2NN3C 1N1MA 2ZJOA 3A1FA 2Z4RA 3B78A 4KMOA 4NAHA 4UEQA 4I9GA 4YYZA 4B8WA 2XYVA 1DUVG 1IQPA 2FWPA 1QO0A 4NICA 5D3QA 4DQXA 5LZ8A 5JWOA 4WTOA 4XEUA 2PX6A 4R5HA 2H1HA 1YT5A 4X1IA 1SCUA 1N6HA 1GARA 1T29A 2NVWA 1QMDA 3INGA 5ALTA 3RFUA 3ZQKA 1FMFA 1MIOA 1GKUB 2EW2A 3SBOA 1OVGA 1Y3IA 4GG1A 1O5TA 4OLJA 1HLDA 1MJNA 3ERCA 4DLRA 3IE0A 2P2DA 1Z62A 3P9IA 1YKFA 5DK4A 5FI0B 3NUGA 5F78A 3PIRA 5F3RA 3TNJA 1Z9BA 3HA2A 3IIKA 1U3FA 1VIYA 4MUYA 1M5RA 4BMYA 4P4GA 1NURA 2GOYA 2GT1A 3QNMA 4Q21A 1HF3A 1CJKC 4CL3A 5ERYA 4PU0A 3QMWA 3D4PA 4BWYA 5BUSA 3BULA 5IKOA 1WXFA 5JI3E 1H3NA 2Q2NA 3GGOA 4P5PA 1OYVA 1WSBA 2C9CA 4ESEA 3QEMB 1YDGA 2CF6A 4J6FA 2QLTA 4P4TA 5J4VA 1WAMA 2ZBPA 3LLMA 3R3HA 4Q24A 4URYR 4ZT4A 4ZA2A 1EK2A 1SUWA 1NPTO 4PWYA 4OGLA 4MW5A 5IC5A 3G1TA 4BQPA 4UAVA 1EXMA 4JNCA 4CF7A 1F20A 1V26A 5JV5A 2HD4A 4RVNA 2ABWA 3WLEA 1HV8A 1DAGA 1UUFA 1H2XA 2MMGA 1MDFA 2DTXA 3F2VA 3HRKA 1QKJA 2JANA 3ZGYA 3K0SA 2LNDA 4GMKA 1P3Y1 1NLYA 2DUMA 2WVGA 2LXNA 3KYCA 3H7AA 4Q1VA 4QX6A 1CZKA 2B9EA 2CXNA 4GU5A 1E3MA 2HHJA 3M6AA 1GNPA 5JQGF 1PZXA 1RJ9A 3JVUA 4Z2YA 3IBTA 3WJAA 3KJZA 3QTBA 3CZCA 4IWNA 4X1IB 4UATA 5B2EA 3GJTA 1FE8A 2MT9A 3DHNA 1EQUA 2R5WA 3MAAC 3NHRA 4O63O 5EQFA 1U4NA 5TPWA 1W5BA 4BPRA 5FNVB 3VV2A 5DRYA 2V7EA 4ZGGA 3BEOA 2BM8A 3K5WA 3FYTA 4MUAA 1AGNA 1RR6A 3OE1A 4LHXA 5A4MS 4AY3A 2R96A 2B4RO 4Q7KA 4A2WA 2Q4DA 1UXKA 1VPVA 2JJ2A 2JHPA 2P9ZA 4UFPA 5FTKA 3ZHUA 5JG7A 3GMTA 3AKCA 4GP9A 1YRAA 4ICIA 4BU1A 3C7CB 3AVUA 1I33A 1YMQA 3OECA 3H18A 1K5HA 4HSGA 4K3UA 1MLDA 1WCWA 2DUJA 1E4EB 2PNFA 4P53A 3GEGA 1GZ5A 3OCCA 3G59A 3WJ7A 4LNHA 2P11A 3UUEA 4DA8A 4M7WA 5E3JA 1XAJA 3ZG6A 1X74A 2WE8A 4MP3A 1O94A 1Z3CA 3A3YA 5TT1A 4BB0A 5MN4A 3OE5A 4OJQA 2DFDA 3TSCA 1CW2B 1KVTA 2WICA 5CT6A 1VRVA 2ZPUA 2YQ4A 3QHQA 5KKNB 1P3JA 3WYEA 1XL1A 1MAAA 2XNDA 5T64A 1KXJA 4S0ZA 4XQCA 4B35A 2ONJA 4BP3A 4HDMB 4AUNA 3K70B 1H4SA 4NVRA 1Z6QA 2DWPA 5IZCA 1WXQA 2JGNA 1H8EA 1DC8A 3FCAA 1FFSA 3I5MA 5BYKA 1AGYA 4TN1A 5CFQA 1KOJA 2C61A 5EJ7A 2O8BA 3CNHA 4J76A 1EHCA 2XSZA 1V7QA 2YNMA 2B92A 1DJLA 1E2MA 2JGJA 3G8AA 2F4NA 2H29A 1EGMB 3DF7A 2PWBA 4M87A 3MWGA 1M2EA 1WP4A 3QK7A 2VHWA 4GF5A 2V03A 3SEZA 1KQ3A 1MCZA 2BCJQ 2NU6A 2PMKA 4IWXA 3DBIA 1CVIA 1NF9A 3UV3A 3NC4A 2OZVA 4L5AA 2J32A 2F3PA 3FOCA 3LECA 3HB0A 3SC6A 4TWAA 1JJBA 3W2EA 4BO7A 1Y9EA 2Z04A 3E2MA 5DXFA 3EZLA 2DGDA 5C8YF 1ODIA 3MB5A 3U16A 2B83A 3T9DA 2PY6A 3AR5A 2R7MA 1FY2A 1E2IA 3JYLA 1EFKA 1E9VA 3FA2A 2B4YA 4G9EA 4NKRA 5KNBD 3OSZA 3PXBA 4JT4A 2B6NA 2A1TR 3KM0A 2UYQA 2ERYA 3GR6A 4L4XA 3URKA 4JEUA 3AB7A 4M1TA 4Y98A 4M7RA 5KOYA 1FYVA 2DBYA 3F3MA 1PZHA 2PQMA 3PVCA 4H6PA 4LJLA 5EIBC 1QP7A 1LJ8A 5EZ6B 3REGA 3KKNA 4WCDA 4ALKA 5IDWA 1MO4A 3LFUA 1U9JA 2WFLB 1W96A 3CQ9A 3ZGLA 4D0LB 4CBVA 3GAAA 5A5EA 3DH0A 1E6WA 4LI3X 5CK4A 1C9KA 1AK2A 3K0BA 5I9SA 4M98A 4EA9A 4FKBA 4NXMB 1FRZA 3MFQA 2CVZA 4J7XA 3SVZA 3JY6A 2FPIB 2ZBQA 3C8DA 3GLKA 2B5WA 2C2WA 3T52A 5TR9A 2B2CA 5ALKA 3RUHA 2QTVB 2ISSD 4LOHA 4Y6QA 1RBQA 2CK3D 3ZJ4A 5KYGA 4DLBA 2A88A 3FVVA 3TTVA 4G4JA 3I0MA 1OFIA 2YFHA 4GQAA 3DLTA 3GIDA 4C29A 3TDNA 2IKQA 4OL9A 1LLQA 2J07A 3E9QA 1DO0A 4TZKA 5LP6F 3LUKA 2CDCA 4TKZA 1KRXA 3STYA 1CQIA 1V1JA 2FEPA 3QITA 5BQPA 4NBWA 2WMNB 1M76A 3A1TA 5HOQA 4JBGA 5GOZA 3DFFA 4WESA 1JH9A 1BS9A 3F7OA 3WB0A 4BC0A 4F4CA 3H9JA 3U13A 3RVLA 1U8ZA 4G81A 1BDHA 1KK1A 2BZGA 1JEJA 1D0VA 3OAAD 4R2JA 4WE3A 1FX0B 3AM1A 4MGHA 2YIJA 2C4VA 1XALA 4P1ZA 2IA5A 1JLLB 2HK7A 2VUTA 5E6SA 5J3JA 4J3FA 2XXJA 3I1IA 3DO8A 1Z8FA 2I29A 3G2LA 2FPXA 1JL3A 2I4MA 4GKBA 1Z4LA 1Z38A 2GN4A 5C1BA 2GKSA 3DAYA 1VE1A 3C3KA 2YC2C 2ODPA 1LQTA 4FDTA 4EVIA 2YDYA 5A04A 1QDEA 1NOKA 2RARA 2F1RA 2QMEA 2R84A 1FNMA 2XVZA 1RKQA 4XX0B 3RDPA 1SEVA 3PLNA 2XIJA 2OR3A 3CA8A 3QYJA 4ND8A 3O03A 4D46A 1AOXA 5DNWA 2C2ZA 3UMSA 4E2FA 1EG7A 3LPCA 3H2BA 1ZVVA 1EFVB 4N7JA 2XRMA 3BE6A 1XNHA 5AKYA 1IDOA 3OQOA 2CXOA 2C3PA 3JVVA 3PHBE 4QXMA 4DY6A 1BGXT 3OLYA 4GZ5A 1N9GB 1AXEA 1JA0A 1EP3B 2YZNA 2D8MA 1SJ9A 4AO7A 4YMTA 2W98A 3I2KA 3KYDB 2W22A 3D8BA 1BCRA 3UH0A 5ITZA 1AX9A 5EERA 2PTGA 3NHAA 1JKJB 2FFRA 3DC7A 2XCTB 4LF4B 3P4XA 4MYTA 5IH7A 1HG0A 4MPDA 4TLEA 4AKGA 3IQHX 2C9MA 5AXAA 2JAUA 3LQ2A 1B00A 3I34X 2HFKA 2MIIA 1GPH1 4HI0E 1KGSA 3RSHA 2Q8NA 3KAKA 2XD4A 1RLMA 4RF4A 3RAFC 2B2XA 2CVFA 2AOTA 2PKQP 4IIXA 1W49A 3WBBA 1X14A 4QZVA 1F0NA 1LKZA 5U4XA 1HE3A 4D9CA 4IPTA 3T3OA 1H5UA 1MGPA 2GCEA 3LC7O 1JEQB 4IDDA 4M22A 3HUEA 4MVJA 4XIFA 3RNOA 3CR7A 1TKRA 1PR9A 2J0EA 4GBJA 2JLCA 3N2YA 3TZBA 4QT4A 3G9XA 3HKBB 1UPUA 1XZQA 2Q9CA 3ITEA 5JMPA 1S4MA 3W6ZA 3FIJA 1J21A 2E3JA 3UWPA 4TS1A 5DISB 4EPTA 3H4VA 1TA0A 4J0CA 4PS0A 4QWWA 5E1BA 1J8VA 1FPMA 2WHEA 1J2YA 1DTWB 2ECQA 1RM4A 1TCVA 3NHLA 2YXEA 2PNJA 1FNSA 1DKPA 2I67A 2PJUA 3HI4A 1E4OA 1LK0A 1U8CB 3B60A 3PEEA 4L8FA 4Y9UA 3NCTA 2N47A 2QTWB 4L7QA 1I1OA 2IODA 3KC2A 2QN2A 5EVJA 3WJ2A 1HRKA 4ED9A 1GVNB 3WOVA 5C0OE 4F8JA 3QELA 5F1KA 4N12A 1ZM9A 1GAQA 1XU9A 2QXTA 2Z0MA 3P7MA 3AI2A 2W2LD 3TSZA 4AJLA 4XWYA 3GH1A 3M9LA 4CLEA 4GGMX 2OV2A 4MR7B 3QEKA 4CMIA 4W5TA 3GA0A 2GN0A 1P1JA 1RWVA 4PZZA 2COKA 3NG1A 3IALA 1IUKA 1Z2OX 1TADA 3MGGA 1IOZA 1XGKA 2IBMA 3VKHA 4NPAA 5HIJA 4FUQA 2FP4B 2D7CA 3BHMA 5F33A 3EIHA 4HRVA 1N2XA 2NT4A 4G01B 4RFSA 4ATNA 4MQFA 1XX6A 3IEIA 3DVAB 2R8XA 3GCXA 2RGNA 5ALEA 4JN6B 3OPYI 2ODEA 1KQFA 2J31A 4D4LA 4B7UA 4BY9E 2GRAA 3TB6A 2WQ6A 5DHSA 1PFVA 2Y6UA 3E22A 1V8OA 3QBEA 5DHPA 3PYLA 2SKEA 3CX6A 4Z9FA 3ROFA 1L7NA 1YI0A 3S4YA 1SBNE 5DSZA 1SQSA 1ZXXA 4FFVA 5IUKC 2I2WA 1NW7A 2HO5A 4GC9A 4YFYA 4JU9A 3RE1A 5C2JB 5LQJA 3AW9A 4B7CA 1E2HA 3GLIA 1N9ZA 1G1AA 3NKFA 3PGXA 1UKZA 2PH7A 2EKPA 4WXRA 2OGWA 1MGOA 3PUWA 2JGMA 3WLLA 4H3VA 4QNMA 3OJ0A 3JD2A 3ZR4B 2GHTA 3DEYX 2WQZA 4KN5A 3N53A 2QENA 4TYMA 1O9GA 5JTTA 1KZ4A 4UW9A 3PV0A 1RTKA 1HC7A 3TW6A 3C39A 4BASA 1PFQA 4WDRA 3NKVA 4B9EA 2ODNA 4JITA 1DSSG 1E7YA 2Z6VA 4TRMA 4BMVA 3TDKA 2CXHA 1W5TA 4HBGA 1ZEJA 1A4RA 2WVJA 1POXA 3V2GA 3VC2A 3IP8A 4NCKA 1GR1A 1XLUA 1SQ5A 1NVEA 2PD6A 3EEYA 4JUBA 2HBZA 1XL0A 2C57A 1CDZA 2ZUTA 1PZEA 2BVNA 4BP8A 1VDMA 3BIXA 4KLRA 4MI6A 1SCKA 2CBZA 2HDWA 3JARA 3KR2A 5UKDA 5KNCH 3HU5A 1MX1A 2WUGA 4MWOA 5WRFA 4A8JB 4FOOA 2XMCA 4ROTA 1RZUA 5EIFA 3VC7A 3ZKWA 1XCPA 1H2YA 2IELA 3NTXA 3FPHA 3PFFA 4W5JA 4KPFC 3DUWA 2ZIZA 4FJ0A 4PGMA 4QT0A 1XJWA 4INJA 3A4MA 2DUNA 2A86A 2AOVA 2XMRA 3FUVA 2OMEA 2JI6A 1KYZA 2IHUA 2YJ3A 3QX3A 4WADA 4KUGA 4BS9A 3BL5A 2VDMB 4JI7B 5T5QA 2CKMA 3K0CA 4X63A 4UCQA 1UFQA 4NOKA 1LRKA 1GPAA 4ZCIA 2G88A 1T2AA 1FVHA 2PVPA 2IXGA 1M3SA 2H2FA 4PNZA 1Y89A 3DS8A 3TIGA 5THXA 4AY4A 3F8TA 2GXAA 2I2DA 2XE7A 3GVCA 4L72A 1Q20A 1JIIA 1DCTA 2JIDA 1QV9A 2XDQA 3GG2A 1LQ2A 2FDRA 3NB0A 1DL5A 3WWPA 2B8JA 3W9UA 2GF0A 1XWFA 1ULZA 3Q7QA 2XB9A 3L41A 1GN9A 3QHAA 4DT1B 5F7OA 2GKGA 2VC2B 1D6MA 3UWKA 3H6KA 1B76A 3ZCSA 4ZIRB 1QM5A 1CF4A 4HAIA 2EV9A 2V4ZA 5F5LA 3CVJA 4D74A 5LIPA 1MHTA 1YK0A 3C8ZA 3QE9Y 1E1CB 2I6SA 4K28A 2JIQA 1SN7A 2Z83A 4F5DA 3WA7A 3C4JA 5AKLA 1F06A 4OQZA 2HYDA 3DEIA 1ZW6A 1WSAA 2IX3A 3D0RA 2Y0DA 3GRRA 4BO3A 10MHA 4IYJA 5L95A 3NFRA 4QQ8A 4DBVO 2I6QA 3CH6A 4X54A 5JO9A 5E2BA 2M6RA 2YXPX 2EQ5A 4NZMA 3QH4A 1V96A 1CRLA 4FFBA 4S24A 4UM8B 5JH7F 1YHNA 2RGNC 4HB2A 5CNIA 3C5HA 2BYTA 1EWTA 1J9ZA 1DEOA 1N2CE 2HXGA 4ENRA 3BGIA 2C4TA 4INAA 1G66A 3K1JA 1VHLA 1ZUNA 2ZQZA 1IU9A 1EFLA 2RGDA 2NSYA 4EAAA 2H8KA 1FL9A 1RADA 1AKNA 3CLTC 1AHPA 2CXTA 5K6AA 4PZDA 4B2LA 5HA5A 2C1EA 1WZEA 1DJQA 2GYWA 3RU3A 1CX9B 4DS3A 1X0XA 3M49A 2X3YA 5TGZA 1GQOA 4CWAA 2R1VA 1DVRA 5ERXA 1VCMA 4UREA 2RK4A 3KBOA 1FS6A 3PYMA 4NJMB 4JLUA 4Q3EA 5AVVA 2DOKA 2FAXA 2YJNA 1ESMA 5AM5A 2R751 3AGQA 4YCAA 3EMBA 1DX4A 1JDBC 2NO7A 4JX8A 3QQPA 3TPFA 2IYQA 1HFEL 2WIBA 1OTYA 3DCYA 1JEYB 1E5DA 2JHFA 3FX2A 2JNWA 4HT3B 1Y48E 1M2OB 3NVDA 2H54A 3QTLA 5BNIA 3VKFA 3FFWA 4DNXA 1AZTA 3O7WA 3EYWA 3BJIC 1DAPA 5DPMA 5IDQA 1UFRA 1S8FA 1NJFA 1MAHA 1E1DA 2A1UB 1JMYA 2OC4A 3PR2B 1DJPA 4YACA 3N2NA 4L4YA 5HZHA 4C5BA 1BX0A 1VI6A 4RKEA 3VR3A 3HDHA 4WAUA 5FTMA 1KF0A 2BZSA 3L7DA 4YVFA 2VHYA 5EHIA 3M5CA 2EZ9A 4PAGA 2G77B 2J9YB 2QW8A 2R1TB 2PSFA 5EZ5A 4RTQA 3WWZA 2PSDA 1J70A 4NV1A 1T1SA 4LX8A 4X7MA 1TJYA 1NATA 3BSWA 3QKRA 1R16A 1EVYA 4DR5B 2NXJA 5KU7A 2VYNA 3LCRA 4OOEA 2DHRA 3DO6A 4MVJF 2VRCD 5G0UA 1FVFA 2BFCA 3MYYA 2RHGB 3A06A 2COUA 3OSUA 2GF2A 4L8LA 4TRRA 4F6LA 5LQAA 2J3EA 5ES3A 2XUDA 4DLTA 5L7TA 3SBDA 5DCYA 3BRQA 3L43A 4XRRA 4DCMA 1NUTA 3BFJA 2Q0SA 1ZD1A 5BV7A 2WY6A 2HQSA 3CPJB 4JMPA 5GM1A 4XVHA 3ZXSA 1QWSA 3MSCA 3OUTA 3Q3GE 4DXHA 5IN4A 2MSCB 1DWUA 4IGAA 1FB5A 4Y0VA 5H3CA 5K2OA 5CX4A 3L04A 4KXUA 1E62A 3NQ41 1NZFA 2BF4A 4CKXA 2HU2A 1JGTA 3DKKA 3FY4A 3V7UA 3ZWWA 4F4UA 2VF4X 5KOJB 2G9RA 2J4FA 1U8XX 2BZ0A 3HY6A 3FAZA 1H2RS 3DDWA 4FYWA 3N58A 4DC9A 2R85A 5GQSA 1OLSB 4RX1A 3GRFA 5CUQA 3UMGA 1WPRA 5JC8A 5LM3A 1D03A 4J0IA 3AKZA 2GJ4A 2GM5A 4MLDA 4CUZA 4XVCA 3PDIA 5CA0B 1T5TA 2P75A 4UTRA 3ICVA 1JJIA 3TRJA 3VQTA 1QE5A 3OO0A 3FNBA 4F21A 4F3KA 3R7WB 4GYKA 4RGQA 2O2DA 2YHIA 3GRZA 4HTFA 2W2OA 1WMSA 3B8EA 3ZDFA 3STWA 3MBIA 3CCFA 3ITNA 3PFIA 5EL0A 2R25B 2PKQO 3HPRA 2DU8A 4OJTA 3K16A 1M2VB 1G6OA 2G83A 4KX3A 1ODCA 3SQOA 5JT1A 1M2WA 4X85A 3WDKA 3OX2A 4QBTA 2P90A 1E1QA 5DF1A 1TIBA 2NYVA 2AR0A 2AMLA 1Q1BA 3ZW8A 1O0SA 3IJRA 1TU4A 4LJ7A 4UPVA 3V4SA 2NP7A 4PRZA 1XF1A 1J0BA 1QHIA 2R8PA 3A11A 3U7HB 1P8AA 1UZNA 4O4LF 3SYRA 1VKHA 1JV2B 3KXIA 4RD6A 1R4MB 3LWZA 1IVNA 2VQDA 1S3IA 3CRQA 3EY4A 1V11B 3FNFA 4DYVA 1QGAA 3CRRA 4X8MA 2AVDA 5TQ0B 3UTDA 1UADA 5DGCA 2MCFA 3TR0A 4AG5A 2R6CA 3DEFA 1WTCA 4KQ2A 4UBOA 4X41A 4G4IA 3ADCA 3CKMA 1WX1A 5EWJB 4HNVA 1SKBA 2PVSA 1V11A 2JB9A 3DEAA 4DJEC 4PX2A 5J47A 4KOAA 3U4QB 2AIRA 3HFSA 4HLCA 2PSHA 3W9BA 1NYTA 4RHXA 1U2EA 4NYMQ 4B6OA 3M1IA 4KNWA 1XZMA 4LSMA 3UKOA 1QWOA 1NVKA 2DETA 1NW8A 4MX8A 5FI3A 2IHNA 2PKEA 2O4UX 4ZEXA 2HLNA 2UZ0A 3S7ZA 1CY2A 3JQBA 1LX6A 2FMTA 4FIDA 3I72A 3VNVA 2ANBA 5CHYA 3QJ5A 4AQ7A 3UJ9A 2QP4A 2YW2A 5FPTA 3TX2A 2R6JA 1U0JA 4J3JA 1K68A 3H2HA 2IY9A 4WMLA 1NP7A 5JNVA 3W8RA 1PFUA 2FSSA 1W1WA 2HJGA 2X9VA 4KG7A 3DNPA 1FGTA 3JTMA 4UHHA 4TWRA 2SKDA 1T2NA 3Q3EA 4CIDA 2HLDD 4NU5A 5AOVA 1XXHB 3ENZA 1LK7A 4C6TB 1CUBA 1GQRA 2C3MA 4B79A 2PL5A 3IXLA 2O1SA 3ISVA 4NU0A 1QONA 3UMJA 4EZIA 1A5AB 2PYZA 1NGSA 1X7YA 1CY1A 1GZ3A 3IP1A 4MGKR 3M6LA 4P3XA 2N9UA 2QYOA 1QIMA 1DDOA 2H2DA 1VOTA 4MUFA 1VFNA 3KELA 5AKHA 1KZHA 2H9IA 1P0CA 2FX2A 4B6QA 5GTDA 1Z5ZA 4PV7A 1UBMS 5T4EA 2WUFA 1M74A 2NAFA 3OPYA 1E99A 2O8FB 1MW8X 3ITDA 3OIUA 2PKYX 3EARA 2OMKA 4JSRA 3MTDA 1JIXA 4RNCA 4XQEA 5C3MA 3DZGA 2DQ4A 4A8PA 4LN1A 2VDLB 5IJ0B 2VWPA 2CZCA 3K1AA 3ZDDA 2IUKA 3I9V6 1MO5A 4G97A 3KKZA 4OQ4A 13PKA 5E9JA 4BLOA 3NDPA 1PT8A 3AETB 4HN9A 4MCIA 1U0HC 2EGGA 1V1MB 1WJGA 4RCVA 1QIKA 2ZETA 721PA 1O6GA 3PB3A 3KNZA 4V03A 3U1VA 3DD1A 1KJQA 4KKVA 2LKDA 5K03A 5LLDA 1RP7A 2J3HA 4TVBA 1RPNA 1R15A 2QM0A 3LCMA 3UWOA 4AG3A 1P39A 4HVLA 5LKRA 4QICA 3O8OB 1ZA1A 2QTAA 1OUMA 4X60A 3R0IA 1XVTA 1YZKA 2NZYA 2I6UA 2ZT5A 2ZUWA 1OGJA 3H7IA 1I4OA 1K8RA 3KQVA 3LP8A 4O02B 5EQTA 3ROEA 3TCXB 4C4AA 4JHLA 4DLWA 1US8B 4OQNA 1X80A 2HC9A 2YOHA 3LL4A 3EXEB 4GVPA 3H0EA 3AWDA 3H5AA 3UC5A 2Q6IA 1JHZA 1QF9A 3S1SA 3N9IA 3ZVRA 4JSTA 2PS9A 3MRXA 1X1TA 4QHTA 4GX2A 1LBQA 3CLSD 3EFEA 3UBTA 2PLFA 5JMWA 4BC1A 4C6TA 3ZWPA 4GGOA 3BKXA 3CC8A 4ZU6X 4HQOA 4MIEA 2C84A 2UUBB 3K6SA 1U2PA 4X45A 1BFDA 2JGDB 2XB6A 2AMFA 4DBLC 4EKDA 1Y1SA 3PHGA 2A5LA 1SA0A 2NTYC 3RS7A 1X3SA 1TEZA 5TQ0A 4OQLA 1QYWA 5EKUA 8OHMA 3DE2X 4FHFA 3OTHA 3KR9A 1PR5A 1II8A 3GYGA 3PRJA 1FNCA 2H2WA 4TV8B 1B42A 2NXNA 2XE8A 2V74B 2ST1A 1Y5MA 2CNDA 3L0OA 2ID7A 1XRPA 2XTAA 3I9JA 3IJPA 4PLZA 1Y42X 5FRDA 2WUEA 1ETUA 3KOYA 2DUUA 4H18A 4Q39A 5TF4A 3Q8KA 1FW6A 1YL5A 2FR1A 3V2IA 4HK4A 5I45A 2WKRA 1NSFA 1SUCA 3ZBUA 1DJNA 3HVRA 3NO4A 5HGXA 2GK3A 2IXDA 5JSKA 2R65A 4A6DA 3W9SA 5A9SB 2PIAA 2RJOA 2Y1WA 2CNWA 3NONA 3OJFA 4LDNA 3T8YA 5JISA 4WPGA 4RIEA 1OREA 3CKLA 4XJVA 1DXHA 2FP3A 3FNGA 1Y8QB 3ZHTA 3HN6A 9MHTA 3M1YA 4BNDB 1YRHA 2CJXA 3RHZA 1RXWA 2BTQB 1ZVJA 3T5DA 3PSHA 4F3RA 1RVDA 3H9GA 3L06A 1CUVA 3C2QA 2XADA 4RORA 4BIIA 5EHZA 1QS0A 2EWWA 1HA3A 1UM9B 4ILEA 1XEAA 4AJOA 4EYGA 2HIMA 3N86A 4F5YA 4F56A 2QUKA 3BRSA 4I1PA 3KKKA 4D02A 3ZJTA 4MPTA 3KHKA 5AICA 5EUMA 1OLOA 3V33A 1NHWA 3O4RA 3IH5A 5GPBA 5DHRA 2IDJA 3IKMB 2VNJA 3QFRA 4TVSA 1GFIA 1HTTA 4RJKA 1PG0A 1FYWA 3VFDA 4PQRA 4ZAFA 4MW1A 5DLEA 4EQ6B 2IP2A 2P6RA 3QWIA 5JQWA 3VI4B 4G0NA 4G0OA 4Q5IA 4XPIA 2VDKB 4AUEA 4L4SA 2Z3ZA 3LUPA 1GPWB 2FF7A 4X61A 3S99A 4R6WA 4C0XA 3R23A 4AECA 4RTNA 5C9ZA 3M5PA 4NCBA 4H15A 3ROKA 4X1OA 5KDDA 2PL9A 1BS2A 5ILQA 4BZZA 1PJAA 1JG6A 3P9YA 2FSIA 3H6GA 2W4QA 3K09A 4WZBE 3AIKA 1IY9A 5G2OA 1UKCA 1P9WA 3FR7A 2HFJA 5KWJA 1YR6A 3RYCB 5JSZA 3ZK7A 5IZ4A 1CUWA 2B2NA 2A0XA 5K20A 1OFUX 1QQTA 4UDOA 3K53A 5CCEA 5BUZA 3TWOA 3GEIA 4CM7A 1JQBA 3VBCA 2VQSA 4LHEA 2PH1A 3N70A 4ZVKA 3ZC3A 2Y1DA 3WGYA 3AG5A 5FUQA 1M83A 2XTZA 1OFTA 2BM0A 2JC3A 1Q57A 3FSRA 3MT7A 2IC5A 1NRJB 4O4JF 1VJ1A 4P22A 1GQFA 3ESAA 2ZRKA 3CG0A 3F6CA 3OWHA 5A4FS 1YFLA 1UWVA 2ZANA 1UFVA 4RO0A 4EBFA 1C14A 4OMCA 4MQFB 2AZDA 4JX9A 4BRWA 1YZLA 2XT6A 4LRTB 4E5KA 1Z2CA 3SC4A 1YJBA 1DFGA 2Q5CA 3C3PA 4JGBA 4FLFA 4D9EA 2VATA 1XTPA 1T6NA 3WWYA 1GQSA 1D4AA 3OOYA 1CK4A 1MRNA 1G2QA 4QOGA 1HETA 4Q1EA 4MEBA 2OZLB 2F62A 4QGAA 4ZYZA 2J09A 3B1XA 3TGWA 5HX7A 1ISRA 2R47A 4RTJA 5LA6A 1ZNYA 1C2TA 1JKIA 2PKXA 2XTJA 3PE4A 3LPDA 4HLDA 3GHHA 1OLXB 3RM3A 1NJ6A 2YWBA 1LI7A 3CZMA 5TEWA 3IOBA 1Q0QA 4L9AA 2YS6A 4WA8A 2QRNA 2CL7X 2QRHA 1GZHB 2DFLA 2R8RA 3A6LA 4O4IA 2KHZA 1K7YA 4LE1A 4E11A 4Q12A 2CSXA 1EFDN 3MXOA 5HBGA 1TQDA 2P4SA 4TWJA 2ONYA 3ZY5A 4D7AA 3QLTA 1QP4A 3ZDRA 1DQYA 1SBHA 2VAPA 1Z16A 1WQ4A 4LHYA 1I0IA 2HB6A 2JF0A 2PWYA 4LJYA 2MSEB 3QYFA 1YS1X 2IZ7A 4EENA 3N3AC 4JC8A 2YWRA 4YP1A 1UIMA 3DDSA 3LUHA 4I4TA 3SBXA 4L5YA 2V1UA 1JAYA 1FSFA 2WJYA 2BDUA 3JPYA 2A14A 4NBVA 4KLAA 4DRZA 2VQ6A 3KS9A 4ZHSA 3I5YA 5CNMA 1XQ9A 1FNDA 3EXIB 5A2GA 3IQEA 4I3GA 1Z34A 1RQGA 1UJCA 2PFKA 3PFNA 4KO8A 4BEJA 4E1BA 3HFGA 3VAZA 1YZHA 5JRZA 3LQ1A 5EE5B 1SUIA 4JSYA 4JIGA 4LVCA 2JGRA 2XVXA 1BGWA 1PYDA 3T1QA 1H2FA 4D4GA 1GPYA 4LGMA 2X8JA 4Z3KA 3MCVA 3COZA 2FQ1A 2EKBA 3WFZA 2OCPA 4FGUA 4NREA 3AVOA 2D4HA 1FXUA 3OOJA 3WO1A 4G2TA 5AVWA 1E8DA 1DI0A 4RMIA 2P9HA 2B8WA 1Y4UA 4OGGA 3JQGA 3RYTC 3T7IA 2PTHA 3HKDA 3QLVC 4MJXA 3UAYA 1NLUA 3UA3A 3DDNA 4OXIA 3JW8A 1IIBA 2BONA 1MORA 4A23A 4BBAA 1NBIA 1TZKA 2VP0A 1ZICA 4Q7MB 2CLSA 1VLJA 1G42A 4MMZB 1Z6PA 3ZY3A 4I3FA 2BFDB 2IPOA 5B3LA 2V6FA 1XCGB 2B3TA 3IO3A 3ZIUA 1XRQA 4F84A 3DVSX 3KJEA 4Q7QA 4WXHA 5KTSA 3W3AD 4LSZA 4B6PA 4G25A 2ZS7A 4MUXA 4B6FA 5JRDS 1XA4A 3OFSA 3HCFA 5D86A 1XYYA 2JFZA 4JXJA 1WQ3A 5ULLA 2PXXA 2VHVA 4OREX 2ZXEA 3FJ1A 5CIYA 1PL0A 4FFNA 3VYTB 2GXUA 3NIBA 1RHUA 1UPTA 4KXWA 1DEXA 1TM5E 4WHAA 2VSFA 4V24A 1ADYA 3R9IA 3H8JA 1L7EA 1U3DA 2DFNA 4OHMA 2Q3JA 5F5NA 3SFVA 1GTVA 2YMLA 3QWFA 3RSSA 2XXAA 2XR1A 3NOOA 1ZRMA 2VT2A 3HBJA 4OHCA 3RF7A 1JB1A 2PSSA 1XR3A 1TM7E 5T6MA 1W1UA 1WL8A 2GLTA 3HRHA 3NOQA 2W37A 5FTNA 4Z0HO 2PDAA 3RFCA 3AVXA 3L6UA 1ZWLA 3D59A 2ZBVA 1AKVA 4PYNA 3RJ9A 1X8KA 4NTZA 1CP2A 2IUFA 4NLLA 1H8ED 4JJAA 4TQAA 4TWIA 1IPHA 1IUOA 2ID8A 3D4LA 5IJAA 1CUCA 3K0AB 4R31A 3W5HA 4XARA 4EQ6A 1D2MA 4L8WB 5E6RA 1GG5A 4M6WB 4NEGA 4P7JA 1YB5A 2AW3A 1VA5A 4OLHA 5EJEA 4A6EA 2HBYA 2WA1A 4KMSA 4A0HA 4Z8YA 1RAFA 2ZTUA 1DKNA 1K2VN 2UUOA 3ZE8A 1KFKB 2PEZA 3H19A 4E5DA 3M4NA 1D04A 4YMVA 2XOKA 3FYCA 3ED5A 3I73A 2PEYA 1MABA 3UH1A 4B45A 1DPGA 3E9RA 4M1QA 1RZ3A 4M8IA 3AY0A 3LIPA 3CW9A 3O94A 1D9XA 2QW1A 3F9RA 3G5TA 3KTDA 1MJ5A 2LGEA 1WDTA 4OIFA 4AX8A 3L1KA 4L15A 4B71A 1H6AA 3L0PA 4ZOLF 2GFHA 2Z2JA 5DTQA 4F1JA 2ZJ0A 4YRJA 3ZCQA 8ADHA 3L7NA 5HE8A 2GBIA 1TA9A 3GLHB 2NSHA 1KIMA 1SG0A 3DE7X 5AW9A 5IT5A 1YUBA 3TLAA 1R8SA 3ZNQA 3RB8A 1OBVA 5AI6A 1FX1A 1IEXA 1MBZA 1N92A 3VPGA 4HWSA 4JI5B 1QZXA 3IOMA 5IZCC 3WXMA 2CF5A 4KRFA 1U8EA 4ZKDA 4NP6A 1IAVA 1ZCBA 2J4DA 4YRNA 2ARKA 5DGHA 5KC8A 3QA9A 2BWJA 4MQBA 1C9YA 3GFFA 1IBMB 3ZCXA 4LQDA 1A9ZA 1RRGA 2X22A 2MHCA 4RFLA 4IFIA 1Q15A 1X1DA 4K9SA 4TTTS 4D80A 2XHZA 1DTWA 1OE0A 1K0FA 3HBFA 3OEED 1EUZA 3PIDA 3NJ4A 2G9UA 5HF9A 1T6XA 2WHPB 4K6MA 2GEUA 1NT2A 3EGVA 4IHAA 2WWVD 1N2EA 4AJ4A 5F1OA 4XTCS 4KIGA 4BFSA 4LYFA 1AC5A 2WKPA 1ZRSA 2VPXA 4MDHA 1GNTA 3GLRA 2DPGA 3ODGA 4M1ZA 3BGVA 2FX5A 1AK1A 4PRLA 4HLNA 3OQNA 3FB1A 3WS7A 3AXTA 2H7VA 3R7BA 1FSGA 1YE8A 1P9LA 4MHOA 4CQMB 3P4UA 1I80A 2F67A 2C3UA 4W6QA 4D9BA 1U0OC 4FCCA 2C07A 3K4HA 1OXUA 1TECE 5KNDH 2XUHA 1LNSA 1TVCA 5DM2A 4A1OA 1O1YA 1G4UR 1Q7RA 1UCFA 3HN2A 4YHBA 2V4MA 3IAM6 1A5TA 4WXEA 3RSCA 8LDHA 5KTTA 1XJQA 2YRWA 3AHJA 3CF4A 2LIVA 1DARA 2O2CA 1QR6A 2E18A 1TTHA 2VA8A 3REQB 3ZU4A 3S8EA 4AI6A 1Z88A 2OORA 1ABFA 4YRSA 4POOA 3CEMA 1DC7A 1G3RA 1KO4A 2QIOA 4MTCA 1K27A 3RADC 4CU5A 3R4VA 2XLCA 1IZYA 4AP5A 5HUJA 2ZTLA 5EXDA 3A1UA 3T6KA 3O3OB 2OFOA 1OW3B 5I7SA 3IQXA 3K30A 4IDOA 5B1DA 5A03A 3WFJA 2UDPA 4Z4EA 3MCZA 1A9QA 1YRLA 2KE5A 2PZEA 1GNLA 3HEAA 1KE2A 1C5KA 4PSVA 2G1PA 1I2DA 3FPBA 4GO1A 4C0KA 2PHZA 4WEQA 2VQFB 4M1WA 5DHAA 2JH8A 4DB4A 2FHPA 1T8SA 4XLZA 3KQHA 4YJKA 4IQ0A 4YAKA 1OI2A 4IAOA 2BR5A 1WULS 1DX6A 4NBSA 4X24A 1EPUA 2FZWA 1HDRA 5EJ9A 4W9NA 4M0FA 1E9FA 5GV8A 2QTHA 1RPZA 5K7SA 5HKBA 4ARZA 1OI4A 1VMEA 2HNBA 2HRRA 3TKYA 1PTKA 4NNJA 2PQ0A 1U90A 3CBQA 3QBJA 3HSKA 4MRAA 4TVOA 4BMXA 2MYNA 2QVGA 3SHWA 4TLBA 3KVRA 1B8UA 2QPLA 5EE3A 4DQ0A 1L9KA 2KPOA 2B82A 2F59A 2WZBA 3BXPA 3K6RA 2Q7OE 1KU6A 2OAP1 4B2IA 3KJXA 2QYSA 4EEXA 4ZZIA 1LQUA 1IH8A 2AYXA 5B7QA 3UPTA 3BGWA 1KQPA 2QPOA 2ZYWX 4A3SA 2WD7B 2GN1A 2YRFA 4KITB 1QQ6A 4CM4B 2LDBA 2RHBA 1OD6A 1MKYA 1EWYA 1XDUA 3VDMA 2JH3A 3GVPA 4DMGA 1P5JA 3NIWA 3BJEA 4YMLA 2CV1A 5LR6A 1XAHA 2HIHA 2XNCA 4RGBA 5JVDA 4ER7A 3UJ6A 3W1WA 2XAAA 1OPRA 3HGTA 3DLIA 1XTSA 4H7EA 3OIVA 1GGNA 1U0NA 2VP5A 5KNBH 5LL6P 1MXHA 2BMWA 2IYRA 3G2IA 3KU1A 3RK4A 4FGJA 3UMVA 1ZCFA 5LUAA 5IULC 2O3TA 3O2NA 4TQUS 5DEOA 4E88A 3EAQA 1XMOB 1IVYA 4YX9A 3CUEF 3MJEA 2X5JO 1LZLA 4FFMA 4O4LB 1GRRA 5DDIP 1U2RA 5HDQA 4JC0A 4K2HA 3FE2A 5JDIA 4BMPB 3O0DA 4H1TA 3EULA 4OL0A 1Z7EA 4A26A 2QZZA 5H81A 2GD0A 2FF5A 4E32A 4CIWA 1P2DA 4KSCA 5EEGA 2EATA 4RD4A 1V9LA 2BF7A 2C9OA 2FETA 1POWA 3BAZA 1K08A 2P1RA 1LPNA 1QKKA 3E1SA 2DPXA 4WK6A 4IDFA 2V0NA 2DF8A 3M6XA 4GSYA 3UG6A 1DWOA 3I9MA 1VCOA 2AC4A 3P9NA 4RFVA 1GXSB 2OBFA 3RVSA 3SZMA 1IOLA 3NWOA 5CTAA 5A7FA 2HM7A 4YWJA 1CY0A 1XTJA 3NP9A 4N7BA 4AQDA 4BJ5A 2ID4A 1GPJA 2QN7A 5LB4A 4ZYVA 1URPA 3G89A 3SP1A 3TE6A 1OWPA 2IE0A 3OFJA 2GEBA 1OLSA 4YJGB 5CGZA 1HO3A 4BPBA 2ONCA 3FYSA 1KMMA 3KX2A 3OQVA 1N6KA 4OX9B 4MV8A 4KN9S 2V0CA 4KXLA 2XNJA 4JMLA 4L3OA 4OHVA 3GEHA 4QAQA 1KEKA 4M36A 4ARSA 3VA7A 3ND7A 2GPTA 2H57A 3RUCA 1QIDA 4EJ2A 1SUBA 4UBIA 1G5PA 2J9FA 1O6ZA 3T54A 5KVCA 4HSEA 4F2PA 2JG3A 1FMTA 2EEPA 2Z43A 4R51A 4RVCA 4TL6A 4DUPA 2GPYA 4YAUA 2I54A 4NE2A 3HDVA 1R7RA 2CW5A 1T4CB 1FFWA 4YAJA 1R0BA 1UBNA 1T3GA 1KTVA 1ODFA 1Z4KA 4GM1A 1TO2E 1E63A 1U7HA 2IHZA 3OBIA 3DHYA 4H1HA 4TM8A 4L02A 2FZEA 1Y3CE 4UM5A 1YBHA 1SVKA 4BQFA 5IFKA 3I9NA 1GZSA 1HQDA 1GUZA 3U48A 1AUQA 5BVGA 1DKOA 1T3HA 4G0XA 5TARA 2SICE 1GYRA 3M7IA 3GFQA 3G49A 3OLXA 2DVMA 1M5UA 1AB6A 1JPJA 4DYDA 4RSRA 5EYPB 2OORC 3AHFA 3Q41A 2JBWA 2OXRA 3DOHA 3EQ7A 2BRUA 4MWZA 2PRZA 4V38A 5HIMA 1VHJA 3L3BA 4CIVA 5E4JA 4BX0A 2JGKA 4UZSA 5D3MB 1XJ5A 2NPOA 4IS2A 4MAMA 1ECCA 1DO8A 3JD4A 3Q85A 1XN1A 1RRVA 1MC1A 4Q3BA 4GD3Q 4OXQA 4QFCA 4MB0A 4H31A 3NRCA 2H1IA 4L27A 3T38A 3DDZX 4RHTA 3PEWA 3DTVB 1NV9A 2O3UA 2YXBA 1WLYA 5HMLA 4NH0A 6Q21A 4DR7B 3AY3A 2QG9A 4GM4A 4RK5A 3JYPA 3V3KA 1NI4A 1JSZA 2EERA 3BFXA 4ESOA 1NXSA 2C77A 3NM5A 2HSEA 3PWSA 4WFJA 4WASA 3SJ7A 3N0RA 1NUQA 1AIPA 3AL2A 4B7AA 4CMGA 1T4CA 3THXB 3FSGD 2QK4A 3JR7A 4UCWA 3N76A 1YZVA 2QTGA 5A02A 1QOZA 2Q6OA 1HDOA 2XRFA 3PPXA 5JATA 2ZR8A 3DHEA 1TJ5A 4B9AA 4L0QA 4RLSA 4M0EA 3PGA1 4PZEA 2Q2VA 3AR2A 1T9GS 5F7JA 1BHQ1 2VHXA 4JL8A 5TRTA 3STXA 3ORFA 3WWOA 1Q6ZA 1ML4A 4L0CA 2RFLA 3S81A 3C3DA 5KBYA 4J0KA 2C9BA 3FI0A 3M5WA 4UHDA 2OZKA 4F3NA 4IIYA 4OI4A 4R0NA 1JU3A 2BGGA 1IZ9A 1BJKA 5CLJA 5EWJA 4PTLA 3BMNB 4CQNA 3IVXA 1IXRC 1DE0A 2QQGA 1K8XB 2Q5IA 1X7ZA 3FSJX 3D5TA 3CX4A 3IPLA 3QUCA 4I1UA 1AKWA 1P5ZB 5DX1A 3M4YA 1W25A 2Y0EA 3CF0A 3N6RA 3BZBA 3VYSB 3WGOA 2PZKA 1KAHA 3G68A 1ISJA 1EP2B 1JHRA 3FH0A 4WZZA 2ZTSA 4IV0A 1NL3A 1PDWA 4MKFA 3HRIA 5JPDA 1U2GC 5IPFA 1CYDA 2OM2A 4YJHB 2AQKA 5EHNA 1NXQA 4V0RA 4LBYA 1BDMA 2YXNA 3TZHA 4M9CA 4QVIA 2UVPA 3KT6A 3CB2A 3ICCA 9GPBA 1UBTS 3OQMA 3VC1A 4LBZA 5EINA 1Q7TA 1NJ5A 3LKBA 2AUNA 4LC1A 3V8NA 1BOFA 4D9KA 1L4GA 3RFFA 4J0JA 2F64A 1CJCA 2DH5A 2H9AA 4ZOLA 3DMTA 3PNBA 2WSBA 4RXTA 5DEIA 1VG8A 1JKFA 1T5DX 3RRYA 3AESB 2QAGA 2C0PA 3SBEA 1NF2A 2VK2A 3PT9A 1ZL0A 4NE7A 1KDZA 5BN5A 1IK6A 2VDRB 3F9IA 2HSWA 4DLPA 1FJ2A 1QFYA 4G89A 4KSBA 3EG5A 1OH5A 3VKGA 4QXPA 4EG6A 2QGNA 1Z6YA 3A1DA 3FJOA 2Z8ZA 3FM9A 2J45A 3E9ZA 1B43A 3MRVA 4JVSB 1H1DA 2JIBA 5DJ5A 2VRCA 3R0ZA 2H85A 4FXOA 3TG2A 4M9UA 3UTCA 4C0SA 2BH9A 3MPUA 3VR5D 3L01A 3WRVA 1OZHA 5HVNA 1D1PA 2XBUA 3FFAA 2GTPA 5AHOA 1K3TA 1Q1GA 1QCCA 1JDJA 2NNLD 3D0KA 2EL9A 3KEOA 2OLEA 4FFPA 3FDZB 3LO5A 3R3WA 4G5RA 4GUAA 1PI3A 2R79A 4NONA 3WI7A 3A6ZA 5IG2A 4I50F 2PUVA 1VE6A 4XW2A 2C1ZA 3GZNA 4DMMA 5EXEA 2XYHA 3E9DA 3R8XA 4MRRA 4CIXA 4N48A 4KJZA 2W2PA 4QO8A 4WUTA 4ZDJA 2PGJA 1G8AA 1YS2X 2J7PA 4V2IA 2A59A 1WCYA 2P41A 1E2QA 3BRWA 4F4JA 4MYHA 2VJQA 1I10A 3LD9A 4FB4A 3CCCA 5HKOA 4UU8A 4DR4B 1XD2B 1L8OA 1BEEA 2NUPB 1GWNA 2HPHA 3H87A 3OEHA 4Z9AA 3WLTA 4ALJA 4BX9A 1LF5A 4DDTA 3BD8A 3ZV6A 2UZ4A 2WIJA 1A8UA 1MB4A 5GGYA 1C8LA 4TL7A 3USZA 2VJCA 4BVLA 3IA2A 3MG9A 3JALB 2P8JA 2CLIB 2OAGA 5C4MA 1M67A 3L7OA 3CE6A 3E03A 3EVEA 4JJEA 2GLXA 4KSYA 4Y1RB 1PKXA 5B58C 2CLMB 2OM6A 3GLGE 5JWHA 3MPOA 5JCXA 2LG7A 3VKVA 5EPEA 3CR8A 3L5KA 3GFTA 2F9MA 1CXZA 5DMHA 4NDNE 3WGKA 3PUKA 3LOPA 4Q1CA 1IQRA 1N0VC 2FUCA 1HT1E 4IW3B 4BYMA 1I2ZA 3DNMA 3ZVLA 1AF4A 1W9MA 2VF8A 2DRIA 4M7PA 5ED0A 3RKRA 1U7TA 3PNVA 5B4TA 5HJ2A 2FSPA 1J0AA 1U1CA 1OIVA 3TQHA 2MU1A 2YINC 1NQAO 1RAHA 4XM2A 4EEZA 1U0EA 2J9RA 2FDXA 2ZJFA 4O1IA 5FOXA 4YUYA 3GDWA 4D81A 2OC9A 1KEVA 1L4NA 2CLLB 2K2WA 2Y68A 4BLVA 1VCNA 3AV3A 1CY8A 1S7CA 3BMQA 3QKSB 1UKAA 3CLUD 4LMRA 4JEHA 3CH7A 4RZIA 3ZWQA 4GECA 5AVXA 1JLMA 3ODPA 1FLVA 4FYKA 4HUQA 2XZDA 5KCZA 1JQLB 1N78A 4L4ZA 4N5HX 3PXEA 3T1NA 1HM5A 3ND5A 4CETA 4J3NA 4JV5B 1A8PA 4IH9A 2YMPA 4AJEA 4EGJA 1Z37A 4M8LA 2UV8A 1L7RA 2UAGA 2WTEA 4L07A 3F5MA 4JK3A 5EJ2A 4QU9A 4ZO4A 4NMLA 4F4FA 4FINA 3QVUA 4YRZA 1GYPA 1VI5A 3LUAA 2ZR9A 2DERA 1PK9A 1IN5A 3ZOZA 3M33A 4BMSA 4YUAA 4WGGA 2IIQA 4DJ5X 3U1BA 3R5FA 4EY4A 4XGQA 4HWTA 1GNVA 1T36A 2JK0A 4K9QA 4W5HA 4NHOA 1GPDG 1GY8A 5LU9A 4H0FA 4MLZA 1OZGA 2X1VA 4B4OA 2NWQA 4S1VA 4XWAA 4BO8A 4GOXA 4N9WA 3DUFA 4OBEA 2HA2A 3ANXA 5FHQA 1N2CA 2HEGA 3KQYA 3R6GA 5LXTF 1B0UA 1LB1B 3H1PA 3ZHSA 4YUWA 2GM4A 1YBMA 3U19A 3LHIA 4KQJA 3G79A 2FQWA 4ZVRA 2OV6A 1HSOA 3SICE 2AXNA 4HVAA 4HNAB 3JALA 4JELA 1XHFA 4OB8A 1UOOA 2J9ZB 3CH5A 2GESA 3IOYA 1B74A 3P20A 4ITVA 3BVPA 1K6XA 1QBGA 3LBNA 1EFRD 2SCUA 3VR5H 5KTMA 2GWRA 3Q8WA 2O8CA 1L5GB 2GAOA 1GU1A 1U0FA 1IWBB 2VH2A 2XAUA 3ND6A 3NM4A 4MO2A 3EHEA 4H2DA 5CGQB 4M1OA 1KBOA 3T5GA 4B44A 4BQOA 2OCBA 4TMFA 1OXMA 1CNFA 3L8ZA 5REQB 4U1RA 1JIJA 3RK0A 2RGXA 4FT2A 5DIFA 4F60A 1M6VA 2XOEA 1AA6A 2YZKA 2Y76A 4LY0A 3IAS6 3BA1A 5GP1A 2I3AA 3UJ8A 2B5VA 4B82A 5I01A 5I9IA 7AT1A 1SELA 3KLBA 1DKQA 3DW3X 3JZMA 3LCUA 5TJ9A 1JJVA 4BCDA 2XLBA 1IK3A 1UK8A 3HH8A 4OAOA 5GINE 2YN4A 3JWPA 3K05A 2DPLA 4O2AB 2C7VA 1YJXA 1N2CB 5EHQA 1F6WA 4RDHA 4EG8A 1AKQA 2WV7A 5T4HA 4FHDA 1MW9X 4R41A 2Y1XA 1WXGA 3U37A 4J0EA 2NO9A 1P4SA 3FDZA 3ROZA 3LWBA 4V0MA 1Z33A 2B1QA 2G1AA 3H9BA 1T43A 5IT4A 4X65B 4LPKA 4TLCA 2V7QD 4AULA 2QD4A 4JB8A 5AW1A 2BW0A 1P1BA 1K9SA 2AD1A 2HHCA 1E66A 1VMAA 1JECA 1COZA 2J59A 3O8QB 2EZ8A 2IV3A 1V5WA 2X9QA 3LW8A 4FNOA 5LMUB 3IR7A 1I7LA 4R1TA 5BXQC 3TZLA 3FXAA 1TM2A 1U0BB 2BAGA 1SVIA 3UPUA 1Y6FA 5IC6A 2W4MA 5ANRB 1L6IA 2XZPA 3DLHA 4LMBA 2GXQA 3U6GA 2WPNA 5F77A 2PU7A 2VTVA 3NTOA 4OYRA 1Q17A 3ZZNA 3PD0A 3UT6A 3OFNA 3VHQA 4FD3A 1V4NA 1WUTA 2IUEA 2Q3FA 3GGGA 1L3CA 2JVJA 2NUBA 5IAOA 4UAGA 4UUNA 5DKFA 2IXEA 5JBQA 2PUEA 3FRIA 2WLTA 3WGIA 3VSCA 1IHUA 1YOBA 3DOUA 1PHPA 3VR4H 4IJMA 3PU6A 1QFMA 5TJHA 1QZ3A 4LFCB 2ZAIA 4U2GA 1FFEA 1TK3A 4G67A 1C1HA 3T7KA 1A4IA 1EBBA 3GHYA 1ISMA 3GA7A 2X8WA 2FZCA 4LKRA 2IU0A 2QPTA 4B0OA 3LIIA 4XYGA 4YQEA 4DMKA 3NRJA 4AO8A 1X7WA 1Y9JA 5GM2A 4OB7A 1QGDA 1ZVQA 3R7NA 3W06A 4B43A 3GGJA 4PWZA 3S5JA 3O75A 1V7CA 3QPCA 4EUNA 4YTEA 4WJZA 4N5DA 3R6DA 4O0MA 4A27A 1TO6A 3S2SA 4BE4A 4MRVA 5LD2C 4LRQA 2O2GA 2PUGA 3VH2A 2AG0A 4TZ6A 5EVCA 4EA6A 2OCGA 4B6EA 1EUDA 3BA6A 1T9AA 2G09A 2HPVA 4JP5A 2R2GA 2DR0A 3JQEA 5CW2A 1T8UA 3DUFB 4KQCA 4YB8A 4TVKA 4Z9YA 2D0PB 4JT9A 4ZD6A 3IB3A 3UUFA 1VE7A 2VJYA 5L4LA 2ORVA 2JEZA 4KO4S 4OIMA 1WU8A 2X0EA 3GFPA 3O8YA 1L4UA 4UE3S 3RAGA 3ZNNA 1ZMRA 4OATA 4Q03A 2AE2A 2QD5A 2W0MA 4Q1AA 4QDXA 3EPLA 1WEHA 2ALJA 3HK2A 4K9DA 2GZ2A 1E3DA 2H4HA 2ZIFA 3CN7A 4L8GA 4P7BA 2MTBA 3HABA 5E1OA 3SSNA 4KOEC 1L1FA 2SHKA 4G4SP 1V16A 2HWYA 2H1SA 1RFLA 4PAQA 4AYXA 1UOEA 1JTEA 3RREA 4CLXA 1Q21A 2DFVA 3D3EA 1QPGA 1IN7A 3DOEA 5AJWA 3S68A 2D7DA 4MROA 3VC3A 3EXFA 3GL9A 4DCNA 3ADBA 2UUCB 2Q45A 4W9RA 1SXJE 3EMKA 2OZLA 2YIVX 4NFHA 4PO1A 1D8AA 1G5FA 4XUDA 1RXSA 1IZ7A 4KDCA 4BQRA 1TZCA 1SG6A 4BJ3A 1W0JA 5CFRA 1KMHB 1KI2A 4I9HA 3P9ZA 1TQHA 2JGDA 1GLGA 3MJSA 4WXPA 3MTEA 3R4CA 4NF2A 3GJQA 1U2ZA 1KZ1A 1J1ZA 5K0BA 3VU9B 1E2DA 3PCTA 4F6RB 3ZDCA 1U1IA 4PPYA 2ACEA 4RA6B 1BAPA 4ASUD 1LOXA 3VNRA 4Z49A 4YI5A 1L4YA 1ZZEA 2RKOA 4MWSA 4CM3A 1EGAA 3GVXA 3T1YB 3FLMA 2C00A 4JHXA 4JOCA 3S1AA 2ZULA 2O8FA 1O0BA 4NV3A 4R4JA 1MT0A 3MT0A 2P40A 3ZIAA 3HB7A 4I8IA 5B3KA 2BY4A 4GWLA 4K40A 4ANFA 1Y5IA 2ECOA 5TPWB 1ZMXA 5EKTA 4NJOA 1OBCA 4L9WA 1HZZA 2ERXA 1FFDA 221PA 3JAMA 1RQLA 3U3DA 1B7GO 2G0AA 3CNBA 4C0LA 2C7QA 1G7SA 4DADA 3UT5A 3EEOA 1DXQA 3F73A 3LY9A 4FDAA 3N0TA 2Q6VA 1X70A 1RKBA 2MSDB 3RC1A 3PKJA 3T1HB 1BX1A 3HXKA 4NU8X 1ZA2A 2QAGB 2PA0A 4TPKA 4UTXA 1UFOA 3QFTA 1LW6E 3FFTA 1OT5A 3HJGA 2I62A 4MUJA 4IQ4A 2OOKA 4MS1B 3UCFA 3Q5GA 4RD0A 3UC9A 2OCLA 1PJ8A 1JMVA 2CDBA 1X9IA 4BEWA 4PN3A 3MINB 4X95A 4BVBA 2JAXA 5ALFA 1X1RA 2TYSB 1J99A 2EXXA 2QHXA 4Y6LA 3SZOA 3ZEIA 3ZTYA 3DHWC 4IG9A 2HCRA 2BR4A 4PIVA 3BCHA 2F17A 3HFJA 3I9LA 4O25A 5E4FA 2AB0A 1PJZA 5COAA 3AHDA 3DBRA 4O4IF 4M7OA 5FUMA 3GLFE 4UDYX 2XMGA 1AMUA 2CY0A 4QJ4A 1U3GA 1X7YB 1JIQA 2IS1A 2PUHA 5FBHA 1MB3A 5BPHA 3K8YA 2DT8A 3EJ6A 3IVMA 3TAHA 3E82A 5FWAA 3M82A 5BVGB 1B0AA 2CUKA 3VDQA 4ND5A 1JG3A 4JLOA 2FW9A 5C35A 3RUEA 2FPLA 2JJQA 2A7QA 3H5VA 1WXIA 2QTLA 2KB0A 4IJ5A 2Z5FA 1XEXB 4HMQA 5DO9A 3QKWA 3U9TA 2JJ2D 2R7AA 3KL4A 4W9NC 2XMBA 5K6RA 4GI5A 4QQKA 3K9CA 3GLFA 1DHTA 3AUYA 3EE6A 1VHWA 1ZGBA 1FP2A 2O4CA 4NCJA 4F3TA 2WLSA 3UICA 1ESDA 1MB9A 3KBBA 4RLFA 3T1VA 2FN4A 1ZUD1 1DJMA 3TL6A 1GDDA 2A3NA 1QC5B 2H18A 3F6PA 3HCPA 4M9ZA 3R7FA 3ZLTA 4X8OA 1XTUA 2G5PA 4B34A 1RYEA 3OT1A 4RNDB 2PG3A 3EQZA 1WNTA 4PFSA 2ERCA 3BL6A 5FNZA 5LDDC 3PPVA 3W3AA 1CR4A 5KQMA 4TS3A 1O94D 1W0CA 2Y93A 1JNYA 2ASVA 4NJEA 1O96B 3TBFA 1D0SA 1V45E 3DFKA 3T4UA 2LIPA 1HI9A 4X84A 2LR0A 1SCBA 3EZ2A 3N2KB 3QIAA 2YHIB 4R1QA 4AZ3B 3D64A 4PZAA 1FXSA 3H1TA 4RKWA 4A15A 3A6EA 3IT3A 4F2WA 5FOQA 4ZMBA 4Z0PA 1WZIA 1RI5A 3GRVA 2GPJA 3GEPA 4II3A 4TWZA 3V2HA 5FA5A 2C78A 1OTHA 4ZVMA 4QUIA 3W6UA 1RWKA 3GT3A 3MEQA 4ZODA 2ZI3A 3RHTA 4EO4A 2YS7A 3QOWA 3UT5B 2PVCA 2H17A 1LNZA 2FUG1 5BV1A 1IBSA 2HMAA 4LRSB 3KQNA 1LPPA 3EWSA 5LXTB 1I01A 1RJWA 4ARAA 2QBYA 3MLBA 4BATA 2G1UA 4IHKA 5FJIA 5AKIA 1G8KA 2P9QA 3WMRA 3CRVA 2JLRA 2ZRBA 4J29A 2B25A 4D0SA 4IJWA 2I1QA 3T5CA 5FUYA 4N3GA 2IW1A 1IPEA 3L40A 4QECA 4MV7A 4YBZA 3SF8A 2NU6B 4F1WA 3TDMA 4PQEA 1XEXA 2FFBA 2ONKA 4O4JA 1JALA 2QV0A 3D4NA 4AS2A 3FB4A 2XRYA 2J5KA 3CB4A 4JVLA 1F8YA 1NUAA 3OJEA 3OOSA 4LY3A 3C4VA 1TMGE 3NHSA 1NI4B 2XOKD 3D2LA 1QVAA 1W1IA 4ER6A 2Q5JA 3JQ8A 3H3FA 3KO8A 1NT4A 5KYXB 4H6VA 5JEDA 1ZJ5A 3BS4A 2Q9AA 3PHLA 2O2SA 2EC5A 1GSIA 3EUFA 2DX7A 4NFYA 2NU9B 4EVQA 2NTNA 5HXAA 3I62A 5LNK6 2WWRA 3WMGA 2FEWB 1SKAA 2YOGA 5J2TB 3SSAA 1OYOA 4K87A 4CHTA 4L75A 1SOAA 2Z9BA 3C43A 5GONF 3OUZA 4B5KA 3VO8A 3AILA 4TKVB 4DNPA 1J2JA 4NG4A 3N5KA 3NUZA 2OXEA 2MR5A 1ZP6A 2V6JA 4M1YA 1XCMA 2BZ1A 2E9SA 2JFVA 3PDJA 4X6LA 2ZBGA 3T1OA 3OPMA 1V6CA 2IHKA 3H5WA 4W7HA 1CTQA 4TTQA 2DHCA 4QXOA 1E2UA 3E27A 3WTBA 3WNQA 2CLDX 2K6GA 2NZUG 1NN1A 1RXYA 2QN3A 1E1LA 1JSRA 3ZYZA 1UK9A 1HWYA 4BNVA 4ES6A 1J6UA 2YMQA 3C6BA 3JU3A 3K1TA 3QG1A 3CGGA 4IY1A 1TM4E 1YQWA 2AXQA 3GJ8A 1JB9A 4Q15A 3ROGA 4Z53A 1OZFA 2R1TA 1A50B 2O3SA 3N2IA 5CW1A 4YCSA 5JFOA 2EIXA 2HQOA 1Y4KA 4XJSA 1CYEA 2H11A 3ZD6A 3LKZA 3OPYB 1NW6A 2X5NA 4TXJA 4HH1A 4DLXA 4RK4A 1B14A 2QLLA 1GAEO 3WL8A 1HY3A 4U3JB 1UP6A 1G5HA 5DNYB 4LXIA 4GQIA 4C87A 1IHXA 2ACWA 5JS2A 2W2KB 4HAWA 1KEEB 2M1ZA 4YS6A 3P97A 2Z9DA 5ALDA 4OXKA 3RF6A 4IIUA 1I6WA 3Q6IA 2C97A 2V58A 2W8BA 2PKCA 1SRQA 1ZNWA 4B80A 2OO5A 3B2EA 3F97A 4HAYA 3KYCB 2PFGA 1TAQA 3R5XA 3V1TC 5IFLA 1PT7A 4QYSA 1LPAB 3SIXA 3R9WA 3GAZA 3SQNA 1AV6A 2YIDA 4PLYA 3W4IA 1DWQA