1ETOA

The crystal structure of e. coli fis mutant r71l
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
87
Chain Sequence
DVLTVSTVDQVTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTLGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 29
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etoA00
1VF9A 3O8GA 4C3IJ 2EQRA 1QRYA 2IEKA 2B63J 2JJ7A 1T56A 5FKLA 4C3HJ 1JTXA 3JRFA 3BTCA 3HM5A 1JKRC 4CYCA 4BBSJ 1S7EA 1TWAJ 5M5YJ 2DJNA 2DA6A 3SJMA 1HF0A 3A02A 1QVTA 2XSDC 1W0UA 2LVSA 2DA2A 1AU7A 2DMPA 4M3FA 4RDUA 3S17J 4JYKA 2M34A 2K9SA 1ZK8A 2ECBA 4M3GA 4FCYA 1TC3C 3S1QJ 3JRHA 3WHBA 2KT0A 1Y1VJ 4B4CA 3OOUA 1A6IA 2E2HJ 2FD5A 5DS9A 1EF4A 4V2FA 1U9NA 5M3FJ 1E3OC 5K7HA 1IV6A 1PUFB 1IGNA 3RKQA 3S16J 1UMQA 4IHYA 1JJ8C 1MNMC 3IH4A 2OF7A 1GV5A 3JREA 3A01B 1JGGA 3HOUJ 1GDTA 2M8GX 4Y52J 1SANA 5F04A 1B8IA 4XICA 1I6HJ 2HOAA 2DMNA 2ID3A 4RBOA 1WI3A 2I10A 1NTCA 2CUFA 1MBJA 1FTZA 2M2EA 5BNGA 3DEWA 5J1YA 3BR3A 2X6OA 2EZIA 3MVPA 3JRAA 4A3BJ 1ZKGA 4BXXJ 1HCRA 4J19A 1NK3P 1WH5A 1BW5A 5EZHA 5F1JA 5C3EJ 4ABZA 3MKLA 4IEJA 5F0CA 4UUTA 2X48A 2NVQJ 4CYCB 3S2DJ 3RZOJ 1OCPA 4D5FA 2EZHA 1VFCA 2R92J 4A3DJ 3BQYA 5EGOA 1WPKA 1Z0XA 2HDDA 4B1RA 3GTMJ 5IYCJ 3M4OJ 3O8HA 4HNVA 3I4NJ 3Q0UA 4BY7J 1HDDC 2CU7A 1FTTA 2ME6A 3D1NI 3BR2A 5FJ8J 3PO3J 1GVDA 2VKEA 2H1KA 5IPAA 5M5XJ 2Y9ZA 1FEXA 4MFEA 5K7ZA 5C4XJ 3IH3A 2FJ1A 2R5YA 3B6AA 1IJWC 2GLOA 5C4JJ 1BA5A 1HDPA 2QF7A 4A3IJ 4NDLA 2W48A 2EH3A 1K83J 3ZQLA 2Y31A 3BG5A 2JA5J 1TWGJ 3HB9A 1POGA 1ITYA 4DZJA 3HOWJ 2NS8A 3WHCA 4W97A 3GTPJ 3NARA 3BR1A 5IYBJ 1D5YA 2VUMJ 1IG7A 2E1OA 5E3LA 3I4MJ 4C2MJ 3S1RJ 1ENHA 1ETQA 3HOZJ 1K61A 5E3NA 1ORKA 2COBA 5GPAA 1ZTRA 3F0CA 3S15J 2AHQA 2CRGA 1JKPC 3QPLA 5J3LA 2FX0A 2L7MP 2R5ZA 5FKKA 1TWHJ 4BKXA 1F36A 4EEFG 3SFIA 1F43A 5FLMJ 1LE8B 2NVXJ 2HXOA 1NK2P 2MW8A 2Y30A 4M3BA 1TWFJ 1AKHB 4X1EA 1IUFA 1WCMJ 5M5WJ 2DA1A 2P81A 2YUSA 3HKZN 2ID6A 5IOZA 2JWTA 5IYDJ 3G1MA 2R5YB 1CQTA 2PMZN 2M9HA 2DMTA 3FIWA 5IOYA 5EG0A 3CMYA 1YRNA 1GUUA 4FTHA 3BQZA 4AYBN 3CDLA 1O4XA 1MH3A 4A69C 5EF6A 3RQIA 3HBLA 4UUSA 1DU0A 3ZQHA 4A3GJ 1OJLA 1B72B 2AO9A 3ZQGA 1U8BA 3BR6A 3K2AA 2YU9J 3HDDA 3K7AJ 3UKGA 4FE7A 2M0CA 2TRTA 4D7NA 4DYCA 2NVYJ 3HGGA 2O9LA 3M3YJ 2VPRA 1HOMA 2CJJA 3BT9A 1JT6A 2OPTA 4M3DA 3HGYA 1Z77A 4BY1J 2NVTJ 2JN6A 3GBGA 2N8GA 3TP3A 5IP6A 4JX5A 2DMQA 4V2GA 1RKWA 1GT0C 3ZOBA 1ZGWA 3TP0A 1A5JA 3JRIA 2EZKA 1X58A 2Y9YA 3LSJA 1R9TJ 5C44J 3QQAA 1X2MA 1JKQC 4M3EA 4C3JJ 1BL0A 3IH2A 3QPSA 4MIMA 1DU6A 2G0EA 5K7FA 2LLKA 3FK6A 2NS7A 2L0KA 5E3MA 4Y7NJ 2XGCA 1IC8A 2LR8A 4XRSG 3ZQIA 5FLVA 3BTJA 2ECCA 3PM1A 4IHVA 1ETOA 2L7FP 3GTQJ 1UHSA 3JRBA 4A3KJ 2EBIA 2DTZA 2IBDA 1XG1A 2WV1A 1RESA 5EG0B 3S1MJ 4A93J 1FIAA 1JT0A 4UUSB 1IDYA 2R7ZJ 1JKOC 1FIPA 1MBGA 5M3MJ 2KDZA 3VPRA 4IHWA 3A03A 1APLC 5HODA 1B8IB 3JRDA 4MO7A 4DZPA 2ELKA 1MBHA 1JTYA 1OCTC 3FK7A 5F0HA 1X2NA 3MN2A 1JUPA 4XRSA 3W6VA 5J1UA 4D7MA 1RETA 1XC5A 1H89C 2VKVA 4QSHA 4I76A 3LSPA 4MLOA 1ETWA 2WAQN 4AC0A 2ME0A 3HOVJ 5J1RA 2HOTA 3G1OA 2X9DA 2ZB9A 5F08A 3H0GJ 1MH4A 3B6CA 1SFOJ 3GTGJ 4A3LJ 5GP9A 2CQQA 2XRLA 1HLVA 3BTLA 5EGOB 3JRGA 3JR9A 9ANTA 2MGQA 3TW6A 2LKXA 2EZLA 2Y0SN 4JP0A 2XPWA 4A3CJ 1UG2A 2XGDA 1FJLA 3BG9A 1ETKA 2H8RA 2DA4A 1G2HA 5DTDA 2QCOA 2VI6A 1I3QJ 2R93J 4D5CA 1ETYA 3OSGA 1JUSA 3DCFA 5FKMA 2O8KA 2JA6J 3Q3SA 3LSRA 3LNQA 2DMUA 2E2JJ 3BTIA 1MSFC 4X6AJ 4BBRJ 1RPWA 3BG3A 3GTKJ 2MG4A 1VNDA 1QPIA 1LFUP 5EDNA 1MBEA 4IHXA 2LP0A 4MFDA 1U9OA 1MSEC 2JA7J 2JK3A 3S1NJ 3SDGA 4FE4A 5EZGA 4W1UA 1P7IA 1WGXA 2E2IJ 2HI3A 4QTRA 1W0TA 1H8AC 3GTOJ 2LTPA 1I50J 1IDZA 3Q0VA 1RKTA 1VI0A 2LFBA 5FKNA 3CCYA 2O7OA 1Q1VA 3E7LA 4A3FJ 2DA3A 2E19A 2DA7A 3NAUA 2HYJA 2R5ZB 3PO2J 2CQXA 5JLWA 3FKIJ 5EEAA 3HEFA 5FKOA 1JUMA 4A3MJ 4GFBA 2XGEA 4JX6A 3S14J 4M6VA 5GPCA 3BR0A 2LK2A 2LY9A 3GTJJ 1U78A 3H3VK 3FISA 2GM4A 3LSGA 3HOXJ 4S0HB 1H88C 3ZQCA 2XPVA 4I6ZA 1ETXA 2L9RA 1BJZA 2WB1N 3TEDA 4LOCA 2FQ4A 1ZR2A 2HXIA 1JJ6C 3GTLJ 5F0FA 1BW6A 4B3AA 2HOSA 1LE8A 1YRNB 1OFCX 4XIDA 3L1PA 5IP7J 4DYQA 1GV2A 2RAEA 1QVUA 3BR5A 3G1LA 1AHDP 1AKHA 1ZQ3P 2D5VA 3IV5A 4XRMA 2K9NA 1ZR4A 2TCTA 3TW7A 5E3OA 3C2BA 3CQZJ 4QIWN 3OIOA 1LFBA 2YS9A 2Y2ZA 2IAIA 4DW6A 2R0QC 1P7JA 2HQ5A 2GBYA 4G12A 5IP9J 1PUFA 3HOYJ 2L7ZA 4A3EJ 2DA5A 3ZQFA 3OSFA 1B72A 3Q0WA 4XK4A 2LD5A 4FISA 2DN0A 2NOGA 5F27A 3A01A 1MBFA 2JMWA 3JRCA 4AUXA 1Y1WJ 2CUEA 2K9QA 4JX4A 3RZDJ 2JA8J 1XS9A 1IRZA 2XB5A 1ETVA 1WH7A 3S2HJ 4A3JJ 3LOCA 1RR7A 1T33A 5EYRA 5JLXA 2XPUA 4DYRA 2MSYA 2XB0X 1TWCJ 1MBKA 4L5EA 2K40A
chains in the Genus database with same CATH superfamily
3W6KB 3WG7H 2XF7A 5DUKA 2DT7B 2LF7A 2F4OB 2EQRA 3PQJA 4GRIA 1QZEA 2JJ7A 1T56A 4Z6YA 4IJAA 1UB9A 1TWAJ 1KQ9A 1VZ0A 1R6RA 2R7TA 5M5YJ 2WTEA 4HG2A 2W84A 1FBUA 2OA4A 3QU3A 1J5YA 5L3CA 2BVLA 5JHUA 1MGTA 2F4IA 1AU7A 2E1MB 3NEUA 1ZK8A 2ECBA 4IOCF 4FCYA 1KU9A 4KT5C 3OY9A 3WHBA 1Y1VJ 3CUQB 4XKCA 1A6IA 4E70A 2Z5UA 1UHMA 5M3FJ 1U9NA 4PSXA 1LNWA 2P5LC 4XORA 4ZTJA 2KJCA 1IV6A 1PUFB 2ZFWA 3EUKL 4CCNA 3RCOA 3S16J 4U7DA 2A61A 2MH9A 2QSHX 4II2A 1JJ8C 2HPMA 1R71A 2B7EA 3FXRA 1D3YA 4BE0A 2CYYA 1JGGA 1LUJB 2NAZA 5F04A 3H3ZA 2HOAA 2ID3A 1W7PA 1TQIA 4ZDOA 3IL2A 1RUNA 4OINF 1MBJA 3DKYA 4BU2A 3F22A 3ECHA 1IN4A 2X6OA 2GXAA 2V4JC 3A0BC 4BXXJ 3RPUD 1O3SA 1BI3A 3RYRA 3DEUA 2HFHA 3ZXSA 1LDDA 4ABZA 3MKLA 3K4JA 5FLXK 2P8TA 3I54A 4D1QA 1RIOH 3WE2A 1YO5C 1XX5A 4A5NA 2PJRB 4L5IA 2AXLA 4YEJA 1VFCA 2R92J 2QKLB 1WPKA 2X6WA 2KHMA 1B1BA 4EJVA 3KX2A 5GTIC 3K4LA 1TTYA 4BY7J 4BQQA 2VJ4A 3WTWC 4MGRA 4PUSA 1VQPI 2D45A 2CU7A 3A0HC 2Z9OA 3PSIA 1VQOI 4A0XA 2DODA 3WU2C 2H1KA 4XLNF 5K7ZA 5J40A 5C4XJ 2OJED 3VEPA 2W00A 4MEYF 3SDBA 2H1LA 1JXSA 2DW4A 1HDPA 4A3IJ 2QBYB 1WHUA 4HF1A 2UXXA 4DNCA 3ZQLA 2IS2A 3K1PA 4ITVA 2EWNA 4EJWA 1QHHD 2DK5A 1TWGJ 1V4RA 4F91B 2NXNB 2K3PA 4DZJA 5ICCA 2A69F 4IX7A 3KP5A 4M9SA 3P7NA 5ICEA 3KYLA 5H6RA 3NARA 5IYBJ 5B1AH 1D5YA 2VUMJ 5TISC 2QSFX 3E6DA 3V7CA 1HW1A 2LYCA 3I4MJ 3V4GA 4ZJZA 3PNTA 1ETQA 3JAMZ 4KYWA 1UJ8A 3VDXA 1K61A 4MNUA 2YPRA 3SHFA 3GFJA 4CCMA 3S15J 1R22A 3HRTA 2CRGA 2DFHA 1G3WA 1STZA 3QPLA 5FB2A 1K78B 1BJAA 4PJMA 4J00A 2Q1ZB 3CCSI 5FLMJ 2RN7A 4KA4A 2YSRA 2HXOA 3VWBA 2X0LA 2IA1A 2MW8A 2OV7A 3SZPA 2EV5A 4P9FA 1TWFJ 1KGSA 3BG7A 5KHDA 5K1YA 4BHCA 1IUFA 2CQ7A 5CVJA 2VASA 5E8GA 1Q1HA 3U9GA 5LHGA 5H6QA 4YFNF 2JWTA 1OYWA 4IO9F 5FO5A 3L00A 2MABA 3FIWA 2BY3A 2R7FA 1R1TA 1MDMA 1N77A 3HBLA 4XQFA 2I5UA 1OJLA 2DCEA 3K10A 1TNTA 3ZQGA 1U8BA 3GCMA 4L18B 4CO8A 1FBQA 1JI8A 1CF7B 4D7NA 5BS6A 4ENMA 3OR1C 1GLNA 4ZDLA 3M3YJ 1YQAA 1YLFA 2OPTA 1S8NA 3HGYA 3WTZA 1L0OC 4CCLA 3RPUA 1X1PA 3GBGA 4HPQA 1G4DA 3DBHB 4XL9A 1ZGJA 3D5LA 5FFZA 4HW0A 3TP0A 1A5JA 3KP6A 4XLEA 2VQHA 2XSJC 3LSJA 1R9TJ 2EA2A 3L2CA 2O0YA 4U0WA 1VQ9I 3K1NA 3VODA 4E4HA 4RGUA 5HNFA 5K7FA 3KP3A 2HVQA 3HRMA 3CUOA 4LG0A 3KETA 2NS7A 1R00A 2F5EA 3ZMSA 1YIJI 1KONA 4CZCA 1YJWI 2O8XA 2CW8A 4XRSG 2TDXA 2KRHA 4WX9A 4ANJA 1WJEA 3CLOA 4EMSA 3PM1A 3FHNA 2VB6A 3FHZA 2JUCA 2RREA 2QUFA 2NS0A 1UHSA 2FOWA 4PJNA 2PFBA 3GFIA 3H9QA 4C2TA 3RKYA 1FIAA 1REPC 2DOFA 2RDPA 4UUSB 1IDYA 5B1BH 1B6AA 5J4VA 2Y75A 4E7SA 3PIOF 1IW7F 5M3MJ 4GYIA 1IN7A 3PFYA 2LOOA 4NBQA 2ELHA 4BXFA 5J6XA 1APLC 1I3AA 3KFWX 1V5GA 3K4NA 3SZTA 1D0YA 1MBHA 2Q8KA 1KZHA 2HYFA 1OR7A 3MN2A 1X3WB 1JUPA 2QA4I 4RS8A 4D0PA 2ZC2A 1W36D 3PJRA 1XGSA 5IT9K 4I76A 4IF4A 4MLOA 3AL0B 1LQ1A 2JRTA 3NRVA 2ME0A 4AC0A 2ZNZA 5FRNA 1V54H 3KEOA 3H0GJ 1X3ZB 1MH4A 1TNSA 1XCVA 2LBFA 3AG4H 4WF2A 4A3LJ 3E3VA 4DIQA 1U3EM 2XRLA 1IAWA 3D0SA 3TO6A 4ZZLA 2P0WA 3JR9A 4FQGA 4A5MA 2M8EA 3TW6A 4OU0A 2LKXA 2PQ8A 1X19A 4CUGA 2Y0SN 4BACA 2O3FA 2EV0A 4RAZA 1IF1A 1FPQA 2DXIA 1FBSA 3ROUA 1UAAA 1BC8C 1FJLA 3J7YJ 5CVRA 2KLOA 2MLGA 2EIKH 2QCOA 5E1ZB 2QKMB 2VI6A 3IHUA 4A0YA 1D8JA 1OCCH 2X1DA 3F8CA 5E8IA 3KYCB 1R7JA 3ASNH 3LNQA 1TQPA 3E5QA 1YFHA 3H5RA 5ILUA 1MSFC 3G73A 4FX0A 1ZLKA 3OYJA 3WU0A 1JE8A 1RPWA 3BG3A 1T2KA 3KZZA 4RAYA 2PLYA 4BUPA 2H94A 1F4KA 3KIOA 1MJBA 1QPIA 4R1HA 1MBEA 4IHXA 2KRFA 2WB1A 1RNLA 1U9OA 2LRDA 2RV8A 2X51A 2CV0A 5HNHA 4P5OA 2GXBA 2GIZA 3I64A 5EZGA 3BC8A 4W1UA 1P7IA 5J47A 2E2IJ 3CCRI 2HU9A 1H8AC 3WGHA 3GTOJ 2RNGA 2LTPA 6PAXA 1EJ9A 2XDVA 5CJ9A 4UVAA 1VI0A 2LFBA 1OYIA 3CCYA 3OOPA 4V19K 1Q1VA 3C2HA 1UFMA 1I1GA 1T0FC 2A6EF 4KICA 3OYEA 2B9SA 2R4GA 4UXNA 3ZMTA 1T39A 4Q4ZF 4LMYA 2O6GE 5LHIA 1SFEA 1JUMA 3DXJF 2ZMEA 4BL0B 4GFBA 1PP8F 4ZYGA 1ERDA 1U5TC 4JX6A 2A6HF 2HTSA 2LY9A 3GTJJ 2VT3A 3FISA 4CCOA 2XAGA 2GM4A 3OL3A 4N4NB 3CCQI 1WWXA 4KUMA 3K6GA 4I6ZA 2R3SA 3MKZA 3EYIA 1TT5B 1ETXA 2KJBA 4KIBA 1KU2A 2EFPA 2L9RA 2WB1N 2MLKA 1X1CA 2KIFA 3TKYA 4BQOA 1ZR2A 1JJ6C 1HW5A 2L9SA 5F0FA 2V9VA 4KMFA 4XIDA 2RKHA 1P9QC 3L1PA 1MDMB 2ZFUA 1OCOH 3ZMDA 1PJRA 1QVUA 1QHGA 3M8FA 3MEXA 3ERMA 1HKSA 2K9NA 2MC3A 3TW7A 5K5QA 3CQZJ 2P7VB 3DF8A 3S8PA 5HDNA 3HSEA 4HNTA 2IAIA 1FY7A 4CHUA 5LGNA 2R0QC 2E1CA 1P7JA 1XDUA 5B3SH 2OCEA 3CCEI 3BDDA 1PUFA 2L7ZA 1ACIA 2F5DA 3ZQFA 4ESFA 1S3JA 3RDIA 1B72A 1Z7UA 2LKPA 4HSTA 3ABKH 2NOGA 1MBFA 2JMWA 3ZR8X 1SD6A 2CUJA 2QM3A 3L2QA 2PMZA 3FX3A 2EFNA 2IGKA 3ABTA 2R7OA 4XNFA 2JA8J 3NWSA 2P7CB 2V26A 1IRZA 2WBMA 3A4CA 1ETVA 1FX7A 1WH7A 2LDUA 4HX7A 4KIGA 3S2HJ 2QZ8A 3MMYB 3LOCA 3LSHA 1T33A 4LG0B 5EYRA 3T8RA 5DDGA 3PUFA 3L2UA 1LKXA 2MSYA 1VQ6I 2NYXA 3G3ZA 4I0AA 1AHDP 2K40A 4RM3A 4C3IJ 1Y39A 1Y0NA 4RLFA 1ZH5A 4BE2A 2BYVE 1QRYA 3MCZA 3P5JA 4Q5SF 1RR8C 1JTXA 3HM5A 5LRSA 1S7EA 1SEUA 3O2PE 2VQGA 4LFUA 2Z16A 3SJMA 4N4OB 2COMA 3V8KA 2ESHA 1Y56A 2VJ5A 3RKXA 1QVTA 3BG6A 5HVQC 5EJCA 1ZN2A 2DJIA 1J09A 3S17J 5D5UB 4JYKA 4A12A 1AOYA 2CG4A 2K9SA 4I7HA 3VYUB 1TC3C 3S1QJ 3ZPLA 4B4CA 2MC4A 2ZSHB 2E2HJ 3DTIA 1ZHFA 5DS9A 1EF4A 3LA7A 4RLQA 4Y3OA 4U7BA 4V2FA 3J81K 2JVHA 1E3OC 2QGUA 2QBYA 3G71I 3V42A 5FGMA 1UMQA 2VKDA 3MAJA 3MQ0A 3CZ6A 3JAMK 3C1DA 2OF7A 1GV5A 3OYIA 4NHJA 1KU3A 4B47A 4EM2A 1SFKA 2EFOA 5ICGA 4YFKF 1B8IA 2LBFB 4RBOA 4ON0A 3SZGA 2F6CA 2B0LA 2L02A 2VOPA 2FBIA 3M9AA 1FTZA 2M2EA 4ZTFA 1MMNA 2JA2A 5J1YA 4G7OF 1LEAA 5IT9Z 3FXUA 2EZIA 4G6QA 2DFEA 1ZKGA 5D8KB 4F52A 1IXCA 2LKSA 2Y0MA 1D1AA 1YS7A 3CJNA 5GAEJ 2LMDA 1IRGA 2HKOA 3C2GA 3ABUA 3HPHA 3S3OA 4HZFA 1BW5A 2G7HA 1TW3A 3PUBA 4RB0A 1K78A 5F0CA 1OYYA 3DU5A 3WTVC 2IT0A 1I5ZA 1H0MA 1DQUA 4Q48A 3ZQQA 2EZHA 4A3DJ 2M4KA 2BHZA 3WU1B 2NOJB 3K2ZA 3CMEI 2HDDA 3IRQA 3O8HA 2HWVA 2NVUB 3Q0UA 5ED4A 4M73A 3BZKA 3GO5A 1FTTA 4HAMA 3D1NI 3I3LA 1GVDA 4DJAA 2E7WA 5IPAA 2Y9ZA 4Q47A 4I09A 4BS9A 1FEXA 2W82A 3IH3A 3UR3C 3DBLB 2KIMA 2KKOA 3ZQ7A 4AVZA 3E6BA 4EM0B 3MKYB 2IS1A 1Z21A 1J75A 5L3GA 1USTA 3H92A 1TQMA 4F92B 5C4JJ 3S32A 2EH3A 4G6TB 1IZ1A 2MFZA 2DPDA 4UUVA 5CPRB 5TJJA 4BAYA 2JA5J 1FP2A 3WTXC 1YI2I 1S5LC 4XLHA 4E7HA 4EGYA 1ITYA 3HOWJ 5LGTA 4HF0A 2W24A 1QPMA 1XDSA 3BR1A 1EA3A 2OAZA 2W25A 3CP8A 2V6EA 5E3LA 3OYHA 2GA1A 4S05A 2ZMEB 4RB3C 2V9KA 1BR4A 4WXHA 4KDPA 2F4MB 2Q0OA 1ORKA 4UB6C 1ZTRA 2EIJH 2XAJA 3Q9VA 5LLQA 3GZ6A 3K4BA 2KIUA 1JKPC 5J3LA 3F8BA 2R5ZA 5FKKA 1TWHJ 4KT6A 4EEFG 3KYDB 4C30A 2CV1A 1QGPA 3L2RA 4XRFA 1WZ2A 1F43A 3ABLH 4QWQA 3ZMUA 2NVXJ 1G6NA 4DBRA 1WQ2A 3BZCA 1VQ5I 5IT3A 1XN7A 2L4MA 5HDGA 1A31A 2BV6A 2Y30A 3LFKA 1BM9A 4B8XA 3DPLC 1YJNI 1K6OA 1KA8A 4X1EA 1SC7A 1E17A 2R7QA 2YUSA 4C9YA 4RA2A 2ID6A 1PUEE 3SEQA 2E5NA 5LD2C 1FMVA 5IYDJ 3G1MA 4GXOA 2KPMA 5IOYA 3CMYA 2L5QA 3QYEA 2JT1A 3CDLA 4D9JA 4U0YA 1OCZH 3OYKA 1S7OA 4UUSA 2ESNA 3ZQHA 3HOTA 2XROA 3AG2H 3KEQA 2FU4A 1B72B 4UHTA 1ZGAA 3BR6A 3JW4A 2YU9J 3HDDA 5KAFC 1DGRM 1PYVA 4CSWA 2K86A 1S72I 3JCUC 3Q9SA 4FE7A 4LG3A 1Z7LA 2TRTA 1R36A 3HSFA 2HOEA 2NVYJ 4N9IA 3HGGA 5L3FA 4EATA 1HOMA 1R1VA 2MYSA 1O3TA 4BY1J 1Z77A 5LRRA 4ZH4F 1EH8A 2DDBA 3QPTA 4JOMA 3TP3A 2C6YA 4JX5A 2DMQA 1RKWA 3W2VA 2LG4A 4IVNA 1KU7A 4XBFA 3ZOBA 4QPQA 2EK5A 3GEZA 3OS0A 1ZGWA 2QQBA 5GADJ 1ZRFA 3JRIA 3I71A 2Y9YA 2UXNA 2MD0A 3VYSB 4A6DA 3OS2A 2A68F 3NWTA 1XMXA 1JKQC 2VPLA 1FOYA 4M3EA 1ZG5A 1CGPA 2HPIA 3IAM2 2HQRA 4MIMA 3F23A 2G0EA 5AIQA 1DU6A 2OZ6A 3FK6A 1G3YA 2JPCA 2YX4A 4BJ6C 5HS7A 3IWZA 3F3XA 2XGCA 1XGOA 2V79A 3TO7A 3ZQIA 4Y17A 5L3EA 2BHYA 4IHVA 3BPXA 2CS3A 2L7FP 3GTQJ 3DTKA 3KP4A 3MZYA 1ON2A 3VFZA 4YIRX 2DTZA 2EIMH 4UVBA 1XG1A 2WV1A 3H5AA 2BOLA 3ONQA 1DUXC 2DLLA 3KCCA 1LFPA 4EVIA 1JT0A 2HDWA 3H36A 4PGGA 3TOBA 1P92A 3J7AY 3CESA 5CYVA 3QAHA 3CO7C 3QYFA 5HODA 1B8IB 3WTUC 4ETSA 2EFQA 2K85A 1TZLA 3J81Z 1A35A 1OCTC 5F0HA 2V1UA 1TP4A 1YIOA 1V5EA 4WXDA 2K4BA 2K02A 1TLHB 3W6VA 2JZYA 3IC7A 3L9FA 4D7MA 4PSWA 4IHTA 2FSWA 1XC5A 3LFUA 2AQFA 3LSPA 2MH2A 3E0JB 4DQ2A 3NQOA 5J1RA 3G1OA 3PQKA 3J80K 2RNJA 3B6CA 1ZAOA 2L4AA 3CMMA 3FBIB 3KLOA 3IKVA 4FETA 2E35A 2HQNA 3W6JB 1OISA 1SVMA 5CVIA 4OIPF 1BBYA 1HC8A 2CQQA 1BN5A 3ERED 2Z2SB 1MD0A 3T1BA 2Z33A 3KEYA 1GVJA 1BI0A 2EZLA 4LITA 2QYOA 2PG4A 4A3CJ 4X0GA 3K4CA 1F5TA 2JUGA 3CJQB 4HBLA 3UNGC 4CICA 2GWRA 1UG2A 2HZDA 2XAUA 3AKZA 2H8RA 2DA4A 2KMUA 2XV4S 1G2HA 1GHCA 1FYLA 4HA8A 2GOXB 2O8KA 5J8FA 3Q3SA 2EA4A 4AIKA 1NHAA 2KZVA 4BBRJ 2X1EA 3W3CA 1J7KA 5E18F 3GF2A 3TQNA 1F1ZA 4XSXF 3GTKJ 2ZJ2A 2MG4A 2ZJPF 2O61A 3CCUI 3QP5A 4O5VA 5ILVA 1R1UA 2P5VA 4P96A 2JTVA 2IS4A 4MFDA 5EEHA 1SFUA 5F6FA 2JVGA 3ZGKA 1DP7P 3S1NJ 2K9LA 3GMEA 3EUHC 2M87A 1FOKA 4XOPA 2HI3A 5LHHA 3E6CC 4ESJA 1BOAA 3Q0VA 3E5UA 4DOZA 2VBWA 2WADA 4AIHA 4K2EA 2IGMA 3GZNB 5DYMA 2FUG2 3REOA 3L2VA 3CF5F 4A3FJ 2E19A 3N97A 2DFFA 3BLYA 2FE3A 2HYJA 4ZDPA 2R5ZB 3M8EA 2STTA 4A6EA 5JLWA 1XB4A 3FKIJ 1NH3A 5DUIA 1A36A 2QEXI 4E7ZA 1C0WA 3CTAA 1RZ4A 5HDKA 1J59A 1BR1A 3DV8A 3TOAA 2A5WA 3HTUA 3ML6A 2ZJRF 3VOEA 1TL8A 1N25A 3H3UA 3RTRA 3U1KA 2LK2A 3IAS2 2H8WA 2XVCA 4IRIA 3IUOA 1YE9A 3LSGA 1H88C 3ZQCA 2F5CA 4JBAA 5CQGA 1T95A 1BJZA 3TEDA 4LOCA 1YW9A 4QLCU 2HXIA 4BHPA 4Y15A 2X85A 5FROA 2CSOA 3FBNB 4B3AA 1LE8A 4FASD 4HX8A 4XKVA 1YW8A 3U1DA 3CJRB 3ZRGA 5TGTA 1EKEA 3OYGA 2W57A 4L9NA 1UELB 4RB2C 5DM7F 4PFPA 2STWA 3TGNA 5HS9A 3IV5A 4ZYHA 4TV7A 4XRMA 1VTNC 1ZR4A 5E3OA 3GZ5A 1D8KA 3C2BA 2A07F 4HRIA 2AQEA 4QIWN 2YS9A 2YR2A 1ZRDA 3R61A 4YIFA 3EPZA 1WRJA 4NC7A 1BI2A 3BOQA 2CMPA 3SQNA 5HLTA 2HQ5A 1ZARA 2WY8Q 2KISA 3I0TA 4L9VA 4A3EJ 4BGDA 5D5VB 4EV0A 1XSDA 3HL2A 3OSFA 5D6EA 2M4GA 4FISA 2DN0A 1RUOA 5F27A 1S6LA 1YS6A 2X6YA 3FXJA 1SMYF 4AUXA 4PGHA 2XIGA 2ZXJA 2XUBA 2K9QA 4XR6A 5BPDA 4AYBA 1XS9A 2FEZA 1KQ8A 3Q5FA 1RI7A 3QU6A 1RR7A 2HNHA 1ONVA 2XPUA 4I98B 4KFCA 4DYRA 2KZGA 1WKMA 3OIQA 1BIBA 1XGMA 3RKWA 1TWCJ 2VONA 1S29A 1S7AA 3H1CA 5CLSA 2L2OA 1FSHA 4YIIA 2B63J 4C3HJ 3BTCA 4BBSJ 4RAFA 2HZTA 3ZN1A 4BH9A 1O7FA 3COAC 2L9NA 3IWFA 3F6OA 2DA6A 2CWEA 2FBHA 1XSXA 4OAZA 4PJ0C 1HF0A 3GYHX 3KZYA 4OMYA 1T0FA 1OR7C 2K27A 2HR3A 3IP4B 1Z91A 3FMSA 1W0UA 2LVSA 1YG2A 2CW7A 2DA2A 4M3FA 1ZG3A 3D5SC 2M34A 3C7JA 3LMMA 1MNEA 1D1BA 1U6GA 4RGXA 4M3GA 3OYCA 1IN5A 3JSOA 3TDUC 2KT0A 3RIRA 2XGXA 2P5KA 1T6SA 1U5TA 1XTAA 2WC2A 3FXKA 3O6BB 5K7HA 2CFXA 2HKXA 4WWCA 5E79C 1IGNA 3RKQA 3L09A 4IHYA 3GFMA 4E7JA 1BIAA 3IH4A 1R5HA 2XF5A 3K4MA 3H9JA 4O3MA 4IZZA 1WSUA 1GDTA 1UZCA 1SANA 1MNDA 5JVTA 4XICA 1I6HJ 2DMNA 1ULYA 4CA0A 1WI3A 3M1EA 2I10A 1NTCA 4F7ZA 1IXRC 1DGWY 5BNGA 2GOMA 3DEWA 3RYPA 4WCGA 2BGCA 1FOWA 4KISA 3MVPA 4A3BJ 3OYLA 4J19A 3J80Z 1NK3P 1PDNC 1FZPB 2H6CA 2F2EA 5F1JA 1DDNA 1MIJA 3GXOA 3I59A 2FXAA 1IRXA 1LJ9A 3GVAA 4IEJA 4ENJA 2DQRA 3EETA 4IQ4A 4U0VA 2X48A 5FFXA 4AIDA 3P9KA 3VYTB 1IV8A 2FNPA 5GTHC 4CYCB 3L2WA 2NVQJ 3RPQA 4E7LA 5DCFA 5L3BA 2NRAC 3BQYA 5EGOA 1Z0XA 1FMWA 4B1RA 3QP6A 4HNVA 2WAQA 4B3XA 4G7HF 1OMIA 2WV0A 4ENNA 1OPCA 3LAJA 2ME6A 4IL6C 3BR2A 5FJ8J 4EM1A 2W1OA 2IW5A 4CXFA 2K3FA 1SD5A 3G2BA 4MFEA 4I99C 4EJOA 4CYDA 2ELJA 5ILSA 1N78A 1P4XA 1UG0A 2WY7Q 3B6AA 4Z2YA 1IJWC 3EYYA 4CCJA 1ZG1A 4OIOF 1BA5A 2QF7A 4NDLA 4XMYA 2W48A 4GYGA 3AAFA 2ZJQF 1MW7A 1K83J 3AG3H 1R4MB 2I8DA 3X2QH 2QQ9A 3BG5A 4I02A 4L5JA 1WJFA 1X4OA 1POGA 1QO0D 2NS8A 2AS5F 1TW2A 5B5EC 2E60A 5IY5H 3BPVA 2E1OA 3FXOA 4NB5A 2JSPA 2CV2A 3H9GA 1LDJA 3S1RJ 3F6VA 3HOZJ 4KNYA 1X3UA 5E3NA 2COBA 3MD2A 5E1XA 2CFOA 3ABMH 5GPAA 2FMYA 1IN6A 2AHQA 4F3QA 1YJ9I 3F9KA 2CO5A 4AD9A 4MTEA 4NUBA 4BKXA 2E1MC 3K9TA 3N4MA 1FNNA 1HSJA 1P4WA 1LE8B 1SD7A 2M7AA 2MBFA 3CUQC 3VSKA 1NK2P 1W36C 4M3BA 1LVKA 3HUGB 5A2QZ 1SVLA 2EJRA 3I9V2 4YRVA 2DDAA 3DLAA 1MMSA 1E3PA 1Y0UA 2H09A 1XPXA 5LEKA 2XASA 3OYFA 5IOZA 2ZKZA 5FD5A 3M8JA 4KJZA 2R5YB 4XLAA 2PMZN 2M9HA 2DMTA 2GAUA 4PDKA 4UY8I 1YRNA 1B59A 1SVOA 2L01A 5H2FC 1O4XA 1K4SA 1MH3A 4A69C 4M9ZA 4ASNA 1G3TA 1DU0A 1HQCA 2JRMA 3BZ6A 5GAHJ 2M30A 3K2AA 2IGNA 3K7AJ 3UKGA 3LSTA 2M0CA 2XHKA 4IRHA 4CDGA 4DYCA 4KMUX 4XKWA 1V5FA 2VPRA 2VOOA 1JT6A 5K5RA 1FYMA 5F1RA 2JN6A 4HEA2 3F8MA 4XONA 5J4YA 4M72A 3HZJA 2EPFA 4AIJA 2BE5F 1Z05A 5IP6A 3GW2A 3BROA 5EEGA 2EZKA 4HF2A 4U88A 2KFDA 4M74A 2LY1A 3T0YA 5D4SA 5HLGA 2LREA 4RM2A 1I39A 3EQLF 3QWLA 1W1WE 3U2RA 1EH6A 3IH2A 3QPSA 1FOXA 3HXLA 3LSIA 2LLKA 3MFKA 4WK8F 3CC7I 3GLXA 1FP1D 2VJJA 3FMQA 2L0KA 3OR2C 1X1AA 4ESBA 1JHFA 2DFIA 5E3MA 4NC6A 3FWEA 1IC8A 2LR8A 3CLQA 2FOKA 2ECCA 4Y4RA 3HRSA 3K1MA 2PI0A 2R7DA 2VXZA 1BI1A 1SD4A 2YU3A 2PX9A 2DOEA 4HLYA 5KNLA 3JRBA 4BEHA 2EBIA 4A3KJ 4OMZA 2IBDA 4OIRF 1U5TB 1XMAA 4R8HA 1RESA 1RC9A 1J2XA 5EG0B 3BJAA 1BC7C 4A93J 1ODDA 3QPHA 5CVVA 1S9HA 2LSOA 5CQEA 3WE3A 1EV7A 1JKOC 3RQ4A 5HLHA 1MBGA 4B48A 5JHFA 2KIQA 2VQCA 3A03A 4HNUA 1XSVA 1Z3YA 1SAXA 3N05A 3HYIA 3JRDA 4MO7A 4DZPA 2ELKA 3I4PA 3PNVA 1JTYA 3E5XA 3FK7A 4ZYAA 4HV5A 3I55I 3DPTA 4CZZA 4MHGA 3U21A 4GDFA 2IP2A 2BBYA 5J1UA 3IKTA 2L9VA 4MQVA 1RETA 1H89C 2VKVA 1R58A 2OQRA 1ETWA 1I27A 3KP7A 5CVUA 2UZKA 2VE8A 2HOTA 2Q2EB 2X9DA 4BE1A 2BZTA 2ZB9A 5F08A 3I59B 2QSGX 2QVOA 4UVCA 5H20A 4AM3A 3QOPA 1DPRA 2VODA 4E7IA 3M07A 3S3NA 5GP9A 3DTEA 2QLZA 4IPAA 2D1HA 3SFZA 5EGOB 1WJDA 3I53A 4KITB 4BJ5C 3JRGA 9ANTA 3CF2A 2BW3A 5JFRA 1AA7A 4XLCA 2KDOA 3LA2A 2XF6A 2XGDA 3P9IA 2ZO4A 2RQPA 2Y48A 2X6XA 5DEQA 4OIQF 5DTDA 3R0JA 2VBXA 4G9YA 2R93J 3JTHA 3WTTC 1O3RA 1JUSA 5FKMA 1D0XA 1ZELA 4A2UA 2JA6J 3LSRA 3CDIA 2DMUA 4UV8A 2E2JJ 3BTIA 3F8FA 2H6BA 5D5XB 4DGWB 3K70C 2QQAA 1YOVB 1VNDA 3CO6C 2BY0A 2DT6A 1LFUP 5EDNA 2LP0A 5L3DA 2JA7J 2M1BA 1MSEC 2X1CA 4LB6B 1E2XA 1MMAA 1V3FA 2VBYA 2WA0A 3OMYA 3SDGA 1X1BA 2PEXA 3KZIC 1K7AA 1J0RA 1ON1A 4B44A 2MA3A 3A2KA 4CCKA 2R7XA 1W0TA 2DPUA 4XN0A 1YHQI 1I50J 3ISPA 1RKTA 5FKNA 3PIPF 3L7WA 2DA3A 4ZYEA 2DA7A 3NAUA 4IQJA 2HDCA 1VQLI 4FT8A 3WTYC 1XCBA 1UHWA 2CQXA 2ZXHA 4KIFA 3PO2J 4RB1A 3CCLI 5EEAA 2O5RA 3HEFA 5FKOA 2IGOA 2UV1A 1IN8A 1RRJA 3FM3A 1Z6RA 3DFGA 2XGEA 1SFXA 4AVPA 4M6VA 4PCQA 3E97A 2J5PA 5GPCA 3BR0A 2A3SA 1P6RA 3G4SI 3MKWB 3HOXJ 2XPVA 3HJEA 4HDUA 4R79A 1E0EA 2VQLA 4XOTA 1TT0A 2FQ4A 3M1CA 2K9MA 3FZVA 3HOSA 3RSNA 2HOSA 1YRNB 3DU6A 2PN6A 1D5VA 4NNJA 1QA6A 4IXAA 1OLTA 2P6TA 2L54A 4B09A 2LC2A 3EDPA 3BR5A 3G1LA 2W7NA 1AKHA 3V7SA 3ELKA 2KP6A 5DD4A 3AL0C 4ZC3A 1W4MA 1LFBA 2VN2A 4LK1F 3OYDA 1QNTA 3T8TA 3OV8A 2GXGA 3W2WA 3OS1A 5JI6A 2E5ZA 4YELA 2GBYA 1DPUA 4LLNA 3HOYJ 5CKTA 2DI3A 3CCJI 2DA5A 2LY2A 2FQ3A 5AIPA 4L0YB 3Q0WA 4XK4A 4HX4A 2LD5A 4L0ZB 2Y69H 4M71A 1X1DA 1LDKB 3JRCA 1T08B 5FD6A 4BXUA 4MEXF 4JX4A 4LIVA 3DKWA 3HSRA 2CQKA 2V1XA 3VYRB 2V9PA 4Y33A 4BNCA 2JSCA 2WAFA 3G6EI 3K0LA 5JLXA 3LAPA 2G7UA 1FT9A 2ISZA 1MBKA 4IHSA 2VKHA 1VF9A 3AG1H 3O8GA 3CMAI 3ESWB 3EUHA 2LF8A 2IEKA 4IRGA 3HG9A 5FKLA 3JRFA 1JKRC 4BEHB 4CYCA 3MWMA 4XKBA 5ICFA 2ZBKA 2DJNA 4OWRB 3A02A 2GIVA 2HTJA 3O3KA 2V7FA 1VQ4I 3FM5A 2DO7A 3T5XA 2XSDC 3V8JA 4ZYDA 1O57A 2CW0F 3HHHA 4O6JA 4DBQA 2DMPA 1Y8QB 4RDUA 2R7WA 4UNOA 3BY6A 2EB7A 1X4PA 2ISYA 2RVCA 3VB2A 3DLLF 4OOIA 2IS6A 3JRHA 2DAOA 1IXSB 3PFIA 3M7GA 1YYVA 5D8LB 4PZJA 3OOUA 1PP7U 2FD5A 1E3HA 1BOBA 4CGZA 4P55A 3KP2A 3GLLA 2QQ8A 2VC1A 1Y8RB 2ETHA 1LEBA 1Z3XA 1YX3A 1MNMC 3CC2I 4Y13A 1R23A 3JREA 4F55A 4HQEA 3A01B 3QRFF 3HOUJ 2M8GX 4Y52J 5JR3A 2DK8A 4RAGA 4I0BA 4LJZF 3R4KA 5HS8A 2CUFA 4BDZA 2D2WA 2K7LA 4LB5A 4WXCA 3HIFA 3SXYA 3CCMI 3BR3A 1TBXA 2BVMA 4XM3A 3JRAA 1VQMI 2R7RA 3I5UA 3P9CA 1HCRA 3H0DA 2BW3B 2PJPA 5A2QK 1WH5A 2ZXWH 1W5TA 1Y6IA 5EZHA 2RC4A 5C3EJ 2ACJA 1HA8A 1MKMA 3F21A 5TRDA 3OYAA 1R5GA 3SYTA 4UUTA 3V8LA 3S2DJ 2E36A 1H9TA 3RZOJ 1O3QA 1OCPA 1K4TA 4D5FA 3MZHA 2LNBA 5BPIA 3GTMJ 5IYCJ 5D6FA 3M4OJ 3I4NJ 1FC3A 2ADUA 4LGWA 1H9GA 3HUGA 2VC0A 2L3DA 2EINH 1HDDC 1D0ZA 4XLPF 3OYMA 2M3AA 3PO3J 1LPQA 1QZZA 3HHGA 5BOXA 1XGNA 2VKEA 5M5XJ 2BEOA 4UV9A 3S2WA 2FJ1A 3CCVI 1QBJA 3LA3A 2R5YA 2DOAA 1U8RA 3LL7A 2GLOA 4BQNA 2V6CA 2OQGA 4NQWA 1USSA 2W85A 2XAQA 2JQ7A 2O03A 2Y0SA 3CP2A 4QPOA 3PL8A 2GZWA 2Y31A 5DM6F 3LQQA 5AONA 2IA0A 1PVEA 3HKZA 2OUMA 1HKQA 3HB9A 3WHCA 2DYRH 4W97A 1HKTA 1YTYA 1W7PB 3GTPJ 4EJTA 1K79A 3PNYA 1IG7A 3HPGA 1NG7A 1I6XA 5BQTA 2F5FA 4C2MJ 1ENHA 3H5NA 3RJPA 4H0EA 1YITI 3A1YA 2PMHA 1G3SA 1GXQA 3S93A 3WGGA 4H4KC 2IPQX 3F0CA 4ZZDA 1D1CA 3LSMA 2M7BA 2FX0A 5ERIA 2L7MP 3QODA 1OCRH 4ENKA 4HOBA 1WJ5A 1F36A 5KVRA 4EJUA 2GQQA 1Z1DA 4II3A 3SFIA 1WFXA 2M5WA 3LSKA 3B73A 2LH9A 2VXDA 4JQFA 1VQ8I 3ZN0A 3IRRA 1FLIA 4XLFA 4E6KG 2P4WA 2L7KA 4G7ZF 2CGPA 2FNAA 1AKHB 2RGVA 2PBIA 3FXQA 2UWMA 5JVGF 3S3MA 1WCMJ 5M5WJ 2BY1A 5FLXZ 4BYYA 2DA1A 2P81A 3HKZN 1Z67A 3CC4I 4M6YA 3E6MA 2IXSA 3FXLA 2Z3YA 3LWFA 4GO1A 1CQTA 4GCVA 1WVRA 5EG0A 1IRFA 2G9WA 1GUUA 4FTHA 3BQZA 4AYBN 3C3WA 3TL4X 5GAGJ 1R49A 5EF6A 3RQIA 4FX4A 3KPHA 1FSEA 3LQRA 1VQNI 3KE2A 4N0BA 3BCAA 4A3GJ 3BJOA 2AO9A 1QZYA 1AWCA 4BQAA 3CDHA 2DTRA 5BMZA 5DCMA 3ZCOA 2K4JA 2DU9A 3WG9A 3F72A 1KYWA 1HSTA 3C18A 1I1SA 1XD7A 4LD5A 4G94A 3AFHA 4B43A 2O9LA 4CH7A 1ZRCA 4UB8C 2CH0A 2CJJA 3BT9A 1OQYA 4M3DA 2NVTJ 3BCBA 4M6XA 1BR2A 4U87A 3QOEA 2H27A 4M9XA 2N8GA 2R7SA 3OYBA 2KL4A 1QQIA 1QU3A 4V2GA 2ZCWA 1KQ0A 1GT0C 1Z9CA 2OU2A 4RGSA 3FF5A 2Q2EA 3ZMZA 1X58A 2E34A 4PFOA 5LEJA 5C44J 1L3LA 5B66C 3QQAA 2IJLA 1X2MA 3CD6I 3WGIA 4C3JJ 1WJCA 1R4NB 3GUDA 2E7XA 2VIXA 4EQQA 1BL0A 2HGCA 1ZYRF 2OBPA 3GX4X 1XMKA 1G8XA 4Y7NJ 5FRMA 1W5CC 2XKOA 1LVAA 5FLVA 4G8XA 3BTJA 2QWWA 3DQVC 1ETOA 4MTDA 3CJTB 2ZXIA 2OZUA 1T8IA 3HTSB 4LLLA 1WJBA 1ZREA 2HQAA 3R0AA 1MZBA 5E1WA 1ZLJA 3R6SA 3S1MJ 3J7ZI 2IRFG 1M1EB 4HLXA 3OWTA 3OYNA 2R7ZJ 2HS5A 1FIPA 2KDZA 1IO2A 2ZMEC 4NC8A 4HV6A 3VPRA 4IHWA 2V1DA 1MMGA 4YG2F 2R7VA 4HSRA 2K5CA 4S04A 2A6TA 3CUQA 5DV5A 3V7RA 1B9NA 1X2NA 2IA2A 1F9NA 5LGUA 2KRCA 2BXYA 4XRSA 1FWZA 4F93B 4KN4X 4FHTA 2CQNA 3JTGA 1T38A 1MMDA 4QSHA 2WAQN 3HOVJ 1MJ9A 1A04A 2UUZA 2RQQA 4PJLA 3K69A 2NNYA 3RI4A 3K4KA 1SFOJ 5E17F 3GTGJ 2HYGD 2E71A 4JK1X 3HRUA 3E1SA 3QYBA 1G59A 1P2FA 2EV6A 2W4SA 2ZNYA 1HLVA 2D1VA 3R60A 3FDYA 1JGSA 3BTLA 3F8NA 5HLIA 1HW2A 2A05A 3ASOH 4KN7X 3K70D 3DPUA 3D5RC 2VLAA 2DYSH 2MGQA 2VJIA 2CUZA 4L9JA 2AXTC 3PSFA 5DD8A 2NNNA 1YX5A 3OL4A 3DBRB 4JP0A 2XPWA 2EFWA 4IKFA 4P9UA 3BG9A 1VQKI 1ETKA 2OCCH 4YFXF 1EH7A 2FMLA 1I3QJ 4BJTA 1ETYA 2FF4A 3DCFA 2FA5A 2ICWG 4D5CA 3OSGA 2PJRA 2OC6A 3DWLE 2Z99A 4XN3A 2YX7A 3MZ8A 4EGZA 3WODF 4NQWB 4X6AJ 2A5YB 1KYZA 3FKJA 4RGRA 2VE9A 2JPBA 2DQLA 3VSLA 4AU7A 4BHBA 2VL8A 2M45A 4AWXB 1N75A 1WJAA 4G6DA 4PK4A 3I56I 1T98A 1P4AA 3TO9A 2JK3A 5D5WB 4L9TA 4IOAF 4OAYA 3OIPA 4HYEA 4FE4A 4LLGF 5F64A 1LB2A 1WGXA 1NG6A 1SMTA 4QTRA 5D4RA 2QENA 3TMOA 1IDZA 3FMRA 2DT5A 2O7OA 2FBKA 2XKPA 3E7LA 1U0JA 5LFAA 2XRNA 3KLNA 4LK0F 2P6SA 3ZMVA 3ECOA 4N9HA 1VQ7I 1MJAA 2V1NA 3DEEA 2E1NA 3GWZA 1A6QA 1W7PD 4A3MJ 3I58A 2M0MA 2XAHA 3S14J 3FXMA 5KK1A 1B4AA 1U78A 3H3VK 1R5ID 1K6YA 4E7KA 4S0HB 4A0ZA 2OTJI 1SAUA 1DP3A 3DKXA 4LIUA 3ULQB 1HXDA 1OKRA 3WTSC 1WI9A 4GGGA 3DP7A 2WWYA 3GTLJ 1BW6A 2GA2A 1OFCX 3JSPA 5IP7J 5K5OA 2F48A 1GV2A 2WAEA 4DYQA 3BP8A 4HQMA 2RAEA 5E20A 2OD5A 1HBXG 1O7LA 2F5VA 1U2WA 2HVSA 4I01A 5LBQA 1ZQ3P 2PMUA 2D5VA 1IUYA 5DCMB 2FRHA 2ZSIB 1B9MA 4MQ9F 2R7UA 4BDYA 5J8CA 1UCRA 2TCTA 1V55H 4PJJA 4XSZF 3OIOA 4HDVA 2VBZA 2Y2ZA 3BWGA 4DW6A 2KQRA 2BXZA 4G12A 4P1WA 5IP9J 3EUAA 5HOOA 1YW7A 5KCMA 1J9IA 3H35A 2XC7A 3ZP5A 3W2AA 2EILH 3A01A 1GXPA 1CF7A 3BJ6A 2HEOA 3TBIA 2X4HA 1Y1WJ 4RMNA 2CUEA 2IVMA 4J01A 1FYKA 2DBBA 3RZDJ 5KAIC 1W5SA 2OTLI 2BY2A 2XB5A 2J5OA 4C2UA 4A3JJ 2MD5A 2XAFA 3B02A 2Z1DA 4I2OA 3TDZC 2HVRA 1Z6TA 3GFLA 1JHHA 3J7AO 3SEZA 2VT2A 2XB0X 4L5EA 3HC7A
chains in the Genus database with same CATH topology
1VF9A 3O8GA 4C3IJ 2EQRA 1QRYA 2IEKA 2B63J 2JJ7A 1T56A 5FKLA 4C3HJ 1JTXA 3JRFA 3BTCA 3HM5A 1JKRC 4CYCA 4BBSJ 1S7EA 1TWAJ 5M5YJ 2DJNA 2DA6A 3SJMA 1HF0A 3A02A 1QVTA 2XSDC 1W0UA 2LVSA 2DA2A 1AU7A 2DMPA 4M3FA 4RDUA 3S17J 4JYKA 2M34A 2K9SA 1ZK8A 2ECBA 4M3GA 4FCYA 1TC3C 3S1QJ 3JRHA 3WHBA 2KT0A 1Y1VJ 4B4CA 3OOUA 1A6IA 2E2HJ 2FD5A 5DS9A 1EF4A 4V2FA 1U9NA 5M3FJ 1E3OC 5K7HA 1IV6A 1PUFB 1IGNA 3RKQA 3S16J 1UMQA 4IHYA 1JJ8C 1MNMC 3IH4A 2OF7A 1GV5A 3JREA 3A01B 1JGGA 3HOUJ 1GDTA 2M8GX 4Y52J 1SANA 5F04A 1B8IA 4XICA 1I6HJ 2HOAA 2DMNA 2ID3A 4RBOA 1WI3A 2I10A 1NTCA 2CUFA 1MBJA 1FTZA 2M2EA 5BNGA 3DEWA 5J1YA 3BR3A 2X6OA 2EZIA 3MVPA 3JRAA 4A3BJ 1ZKGA 4BXXJ 1HCRA 4J19A 1NK3P 1WH5A 1BW5A 5EZHA 5F1JA 5C3EJ 4ABZA 3MKLA 4IEJA 5F0CA 4UUTA 2X48A 2NVQJ 4CYCB 3S2DJ 3RZOJ 1OCPA 4D5FA 2EZHA 1VFCA 2R92J 4A3DJ 3BQYA 5EGOA 1WPKA 1Z0XA 2HDDA 4B1RA 3GTMJ 5IYCJ 3M4OJ 3O8HA 4HNVA 3I4NJ 3Q0UA 4BY7J 1HDDC 2CU7A 1FTTA 2ME6A 3D1NI 3BR2A 5FJ8J 3PO3J 1GVDA 2VKEA 2H1KA 5IPAA 5M5XJ 2Y9ZA 1FEXA 4MFEA 5K7ZA 5C4XJ 3IH3A 2FJ1A 2R5YA 3B6AA 1IJWC 2GLOA 5C4JJ 1BA5A 1HDPA 2QF7A 4A3IJ 4NDLA 2W48A 2EH3A 1K83J 3ZQLA 2Y31A 3BG5A 2JA5J 1TWGJ 3HB9A 1POGA 1ITYA 4DZJA 3HOWJ 2NS8A 3WHCA 4W97A 3GTPJ 3NARA 3BR1A 5IYBJ 1D5YA 2VUMJ 1IG7A 2E1OA 5E3LA 3I4MJ 4C2MJ 3S1RJ 1ENHA 1ETQA 3HOZJ 1K61A 5E3NA 1ORKA 2COBA 5GPAA 1ZTRA 3F0CA 3S15J 2AHQA 2CRGA 1JKPC 3QPLA 5J3LA 2FX0A 2L7MP 2R5ZA 5FKKA 1TWHJ 4BKXA 1F36A 4EEFG 3SFIA 1F43A 5FLMJ 1LE8B 2NVXJ 2HXOA 1NK2P 2MW8A 2Y30A 4M3BA 1TWFJ 1AKHB 4X1EA 1IUFA 1WCMJ 5M5WJ 2DA1A 2P81A 2YUSA 3HKZN 2ID6A 5IOZA 2JWTA 5IYDJ 3G1MA 2R5YB 1CQTA 2PMZN 2M9HA 2DMTA 3FIWA 5IOYA 5EG0A 3CMYA 1YRNA 1GUUA 4FTHA 3BQZA 4AYBN 3CDLA 1O4XA 1MH3A 4A69C 5EF6A 3RQIA 3HBLA 4UUSA 1DU0A 3ZQHA 4A3GJ 1OJLA 1B72B 2AO9A 3ZQGA 1U8BA 3BR6A 3K2AA 2YU9J 3HDDA 3K7AJ 3UKGA 4FE7A 2M0CA 2TRTA 4D7NA 4DYCA 2NVYJ 3HGGA 2O9LA 3M3YJ 2VPRA 1HOMA 2CJJA 3BT9A 1JT6A 2OPTA 4M3DA 3HGYA 1Z77A 4BY1J 2NVTJ 2JN6A 3GBGA 2N8GA 3TP3A 5IP6A 4JX5A 2DMQA 4V2GA 1RKWA 1GT0C 3ZOBA 1ZGWA 3TP0A 1A5JA 3JRIA 2EZKA 1X58A 2Y9YA 3LSJA 1R9TJ 5C44J 3QQAA 1X2MA 1JKQC 4M3EA 4C3JJ 1BL0A 3IH2A 3QPSA 4MIMA 1DU6A 2G0EA 5K7FA 2LLKA 3FK6A 2NS7A 2L0KA 5E3MA 4Y7NJ 2XGCA 1IC8A 2LR8A 4XRSG 3ZQIA 5FLVA 3BTJA 2ECCA 3PM1A 4IHVA 1ETOA 2L7FP 3GTQJ 1UHSA 3JRBA 4A3KJ 2EBIA 2DTZA 2IBDA 1XG1A 2WV1A 1RESA 5EG0B 3S1MJ 4A93J 1FIAA 1JT0A 4UUSB 1IDYA 2R7ZJ 1JKOC 1FIPA 1MBGA 5M3MJ 2KDZA 3VPRA 4IHWA 3A03A 1APLC 5HODA 1B8IB 3JRDA 4MO7A 4DZPA 2ELKA 1MBHA 1JTYA 1OCTC 3FK7A 5F0HA 1X2NA 3MN2A 1JUPA 4XRSA 3W6VA 5J1UA 4D7MA 1RETA 1XC5A 1H89C 2VKVA 4QSHA 4I76A 3LSPA 4MLOA 1ETWA 2WAQN 4AC0A 2ME0A 3HOVJ 5J1RA 2HOTA 3G1OA 2X9DA 2ZB9A 5F08A 3H0GJ 1MH4A 3B6CA 1SFOJ 3GTGJ 4A3LJ 5GP9A 2CQQA 2XRLA 1HLVA 3BTLA 5EGOB 3JRGA 3JR9A 9ANTA 2MGQA 3TW6A 2LKXA 2EZLA 2Y0SN 4JP0A 2XPWA 4A3CJ 1UG2A 2XGDA 1FJLA 3BG9A 1ETKA 2H8RA 2DA4A 1G2HA 5DTDA 2QCOA 2VI6A 1I3QJ 2R93J 4D5CA 1ETYA 3OSGA 1JUSA 3DCFA 5FKMA 2O8KA 2JA6J 3Q3SA 3LSRA 3LNQA 2DMUA 2E2JJ 3BTIA 1MSFC 4X6AJ 4BBRJ 1RPWA 3BG3A 3GTKJ 2MG4A 1VNDA 1QPIA 1LFUP 5EDNA 1MBEA 4IHXA 2LP0A 4MFDA 1U9OA 1MSEC 2JA7J 2JK3A 3S1NJ 3SDGA 4FE4A 5EZGA 4W1UA 1P7IA 1WGXA 2E2IJ 2HI3A 4QTRA 1W0TA 1H8AC 3GTOJ 2LTPA 1I50J 1IDZA 3Q0VA 1RKTA 1VI0A 2LFBA 5FKNA 3CCYA 2O7OA 1Q1VA 3E7LA 4A3FJ 2DA3A 2E19A 2DA7A 3NAUA 2HYJA 2R5ZB 3PO2J 2CQXA 5JLWA 3FKIJ 5EEAA 3HEFA 5FKOA 1JUMA 4A3MJ 4GFBA 2XGEA 4JX6A 3S14J 4M6VA 5GPCA 3BR0A 2LK2A 2LY9A 3GTJJ 1U78A 3H3VK 3FISA 2GM4A 3LSGA 3HOXJ 4S0HB 1H88C 3ZQCA 2XPVA 4I6ZA 1ETXA 2L9RA 1BJZA 2WB1N 3TEDA 4LOCA 2FQ4A 1ZR2A 2HXIA 1JJ6C 3GTLJ 5F0FA 1BW6A 4B3AA 2HOSA 1LE8A 1YRNB 1OFCX 4XIDA 3L1PA 5IP7J 4DYQA 1GV2A 2RAEA 1QVUA 3BR5A 3G1LA 1AHDP 1AKHA 1ZQ3P 2D5VA 3IV5A 4XRMA 2K9NA 1ZR4A 2TCTA 3TW7A 5E3OA 3C2BA 3CQZJ 4QIWN 3OIOA 1LFBA 2YS9A 2Y2ZA 2IAIA 4DW6A 2R0QC 1P7JA 2HQ5A 2GBYA 4G12A 5IP9J 1PUFA 3HOYJ 2L7ZA 4A3EJ 2DA5A 3ZQFA 3OSFA 1B72A 3Q0WA 4XK4A 2LD5A 4FISA 2DN0A 2NOGA 5F27A 3A01A 1MBFA 2JMWA 3JRCA 4AUXA 1Y1WJ 2CUEA 2K9QA 4JX4A 3RZDJ 2JA8J 1XS9A 1IRZA 2XB5A 1ETVA 1WH7A 3S2HJ 4A3JJ 3LOCA 1RR7A 1T33A 5EYRA 5JLXA 2XPUA 4DYRA 2MSYA 2XB0X 1TWCJ 1MBKA 4L5EA 2K40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF9 A;  3O8G A;  4C3I J;  2EQR A;  1QRY A;  2IEK A;  2B63 J;  2JJ7 A;  1T56 A;  5FKL A;  4C3H J;  1JTX A;  3JRF A;  3BTC A;  3HM5 A;  1JKR C;  4CYC A;  4BBS J;  1S7E A;  1TWA J;  5M5Y J;  2DJN A;  2DA6 A;  3SJM A;  1HF0 A;  3A02 A;  1QVT A;  2XSD C;  1W0U A;  2LVS A;  2DA2 A;  1AU7 A;  2DMP A;  4M3F A;  4RDU A;  3S17 J;  4JYK A;  2M34 A;  2K9S A;  1ZK8 A;  2ECB A;  4M3G A;  4FCY A;  1TC3 C;  3S1Q J;  3JRH A;  3WHB A;  2KT0 A;  1Y1V J;  4B4C A;  3OOU A;  1A6I A;  2E2H J;  2FD5 A;  5DS9 A;  1EF4 A;  4V2F A;  1U9N A;  5M3F J;  1E3O C;  5K7H A;  1IV6 A;  1PUF B;  1IGN A;  3RKQ A;  3S16 J;  1UMQ A;  4IHY A;  1JJ8 C;  1MNM C;  3IH4 A;  2OF7 A;  1GV5 A;  3JRE A;  3A01 B;  1JGG A;  3HOU J;  1GDT A;  2M8G X;  4Y52 J;  1SAN A;  5F04 A;  1B8I A;  4XIC A;  1I6H J;  2HOA A;  2DMN A;  2ID3 A;  4RBO A;  1WI3 A;  2I10 A;  1NTC A;  2CUF A;  1MBJ A;  1FTZ A;  2M2E A;  5BNG A;  3DEW A;  5J1Y A;  3BR3 A;  2X6O A;  2EZI A;  3MVP A;  3JRA A;  4A3B J;  1ZKG A;  4BXX J;  1HCR A;  4J19 A;  1NK3 P;  1WH5 A;  1BW5 A;  5EZH A;  5F1J A;  5C3E J;  4ABZ A;  3MKL A;  4IEJ A;  5F0C A;  4UUT A;  2X48 A;  2NVQ J;  4CYC B;  3S2D J;  3RZO J;  1OCP A;  4D5F A;  2EZH A;  1VFC A;  2R92 J;  4A3D J;  3BQY A;  5EGO A;  1WPK A;  1Z0X A;  2HDD A;  4B1R A;  3GTM J;  5IYC J;  3M4O J;  3O8H A;  4HNV A;  3I4N J;  3Q0U A;  4BY7 J;  1HDD C;  2CU7 A;  1FTT A;  2ME6 A;  3D1N I;  3BR2 A;  5FJ8 J;  3PO3 J;  1GVD A;  2VKE A;  2H1K A;  5IPA A;  5M5X J;  2Y9Z A;  1FEX A;  4MFE A;  5K7Z A;  5C4X J;  3IH3 A;  2FJ1 A;  2R5Y A;  3B6A A;  1IJW C;  2GLO A;  5C4J J;  1BA5 A;  1HDP A;  2QF7 A;  4A3I J;  4NDL A;  2W48 A;  2EH3 A;  1K83 J;  3ZQL A;  2Y31 A;  3BG5 A;  2JA5 J;  1TWG J;  3HB9 A;  1POG A;  1ITY A;  4DZJ A;  3HOW J;  2NS8 A;  3WHC A;  4W97 A;  3GTP J;  3NAR A;  3BR1 A;  5IYB J;  1D5Y A;  2VUM J;  1IG7 A;  2E1O A;  5E3L A;  3I4M J;  4C2M J;  3S1R J;  1ENH A;  1ETQ A;  3HOZ J;  1K61 A;  5E3N A;  1ORK A;  2COB A;  5GPA A;  1ZTR A;  3F0C A;  3S15 J;  2AHQ A;  2CRG A;  1JKP C;  3QPL A;  5J3L A;  2FX0 A;  2L7M P;  2R5Z A;  5FKK A;  1TWH J;  4BKX A;  1F36 A;  4EEF G;  3SFI A;  1F43 A;  5FLM J;  1LE8 B;  2NVX J;  2HXO A;  1NK2 P;  2MW8 A;  2Y30 A;  4M3B A;  1TWF J;  1AKH B;  4X1E A;  1IUF A;  1WCM J;  5M5W J;  2DA1 A;  2P81 A;  2YUS A;  3HKZ N;  2ID6 A;  5IOZ A;  2JWT A;  5IYD J;  3G1M A;  2R5Y B;  1CQT A;  2PMZ N;  2M9H A;  2DMT A;  3FIW A;  5IOY A;  5EG0 A;  3CMY A;  1YRN A;  1GUU A;  4FTH A;  3BQZ A;  4AYB N;  3CDL A;  1O4X A;  1MH3 A;  4A69 C;  5EF6 A;  3RQI A;  3HBL A;  4UUS A;  1DU0 A;  3ZQH A;  4A3G J;  1OJL A;  1B72 B;  2AO9 A;  3ZQG A;  1U8B A;  3BR6 A;  3K2A A;  2YU9 J;  3HDD A;  3K7A J;  3UKG A;  4FE7 A;  2M0C A;  2TRT A;  4D7N A;  4DYC A;  2NVY J;  3HGG A;  2O9L A;  3M3Y J;  2VPR A;  1HOM A;  2CJJ A;  3BT9 A;  1JT6 A;  2OPT A;  4M3D A;  3HGY A;  1Z77 A;  4BY1 J;  2NVT J;  2JN6 A;  3GBG A;  2N8G A;  3TP3 A;  5IP6 A;  4JX5 A;  2DMQ A;  4V2G A;  1RKW A;  1GT0 C;  3ZOB A;  1ZGW A;  3TP0 A;  1A5J A;  3JRI A;  2EZK A;  1X58 A;  2Y9Y A;  3LSJ A;  1R9T J;  5C44 J;  3QQA A;  1X2M A;  1JKQ C;  4M3E A;  4C3J J;  1BL0 A;  3IH2 A;  3QPS A;  4MIM A;  1DU6 A;  2G0E A;  5K7F A;  2LLK A;  3FK6 A;  2NS7 A;  2L0K A;  5E3M A;  4Y7N J;  2XGC A;  1IC8 A;  2LR8 A;  4XRS G;  3ZQI A;  5FLV A;  3BTJ A;  2ECC A;  3PM1 A;  4IHV A;  1ETO A;  2L7F P;  3GTQ J;  1UHS A;  3JRB A;  4A3K J;  2EBI A;  2DTZ A;  2IBD A;  1XG1 A;  2WV1 A;  1RES A;  5EG0 B;  3S1M J;  4A93 J;  1FIA A;  1JT0 A;  4UUS B;  1IDY A;  2R7Z J;  1JKO C;  1FIP A;  1MBG A;  5M3M J;  2KDZ A;  3VPR A;  4IHW A;  3A03 A;  1APL C;  5HOD A;  1B8I B;  3JRD A;  4MO7 A;  4DZP A;  2ELK A;  1MBH A;  1JTY A;  1OCT C;  3FK7 A;  5F0H A;  1X2N A;  3MN2 A;  1JUP A;  4XRS A;  3W6V A;  5J1U A;  4D7M A;  1RET A;  1XC5 A;  1H89 C;  2VKV A;  4QSH A;  4I76 A;  3LSP A;  4MLO A;  1ETW A;  2WAQ N;  4AC0 A;  2ME0 A;  3HOV J;  5J1R A;  2HOT A;  3G1O A;  2X9D A;  2ZB9 A;  5F08 A;  3H0G J;  1MH4 A;  3B6C A;  1SFO J;  3GTG J;  4A3L J;  5GP9 A;  2CQQ A;  2XRL A;  1HLV A;  3BTL A;  5EGO B;  3JRG A;  3JR9 A;  9ANT A;  2MGQ A;  3TW6 A;  2LKX A;  2EZL A;  2Y0S N;  4JP0 A;  2XPW A;  4A3C J;  1UG2 A;  2XGD A;  1FJL A;  3BG9 A;  1ETK A;  2H8R A;  2DA4 A;  1G2H A;  5DTD A;  2QCO A;  2VI6 A;  1I3Q J;  2R93 J;  4D5C A;  1ETY A;  3OSG A;  1JUS A;  3DCF A;  5FKM A;  2O8K A;  2JA6 J;  3Q3S A;  3LSR A;  3LNQ A;  2DMU A;  2E2J J;  3BTI A;  1MSF C;  4X6A J;  4BBR J;  1RPW A;  3BG3 A;  3GTK J;  2MG4 A;  1VND A;  1QPI A;  1LFU P;  5EDN A;  1MBE A;  4IHX A;  2LP0 A;  4MFD A;  1U9O A;  1MSE C;  2JA7 J;  2JK3 A;  3S1N J;  3SDG A;  4FE4 A;  5EZG A;  4W1U A;  1P7I A;  1WGX A;  2E2I J;  2HI3 A;  4QTR A;  1W0T A;  1H8A C;  3GTO J;  2LTP A;  1I50 J;  1IDZ A;  3Q0V A;  1RKT A;  1VI0 A;  2LFB A;  5FKN A;  3CCY A;  2O7O A;  1Q1V A;  3E7L A;  4A3F J;  2DA3 A;  2E19 A;  2DA7 A;  3NAU A;  2HYJ A;  2R5Z B;  3PO2 J;  2CQX A;  5JLW A;  3FKI J;  5EEA A;  3HEF A;  5FKO A;  1JUM A;  4A3M J;  4GFB A;  2XGE A;  4JX6 A;  3S14 J;  4M6V A;  5GPC A;  3BR0 A;  2LK2 A;  2LY9 A;  3GTJ J;  1U78 A;  3H3V K;  3FIS A;  2GM4 A;  3LSG A;  3HOX J;  4S0H B;  1H88 C;  3ZQC A;  2XPV A;  4I6Z A;  1ETX A;  2L9R A;  1BJZ A;  2WB1 N;  3TED A;  4LOC A;  2FQ4 A;  1ZR2 A;  2HXI A;  1JJ6 C;  3GTL J;  5F0F A;  1BW6 A;  4B3A A;  2HOS A;  1LE8 A;  1YRN B;  1OFC X;  4XID A;  3L1P A;  5IP7 J;  4DYQ A;  1GV2 A;  2RAE A;  1QVU A;  3BR5 A;  3G1L A;  1AHD P;  1AKH A;  1ZQ3 P;  2D5V A;  3IV5 A;  4XRM A;  2K9N A;  1ZR4 A;  2TCT A;  3TW7 A;  5E3O A;  3C2B A;  3CQZ J;  4QIW N;  3OIO A;  1LFB A;  2YS9 A;  2Y2Z A;  2IAI A;  4DW6 A;  2R0Q C;  1P7J A;  2HQ5 A;  2GBY A;  4G12 A;  5IP9 J;  1PUF A;  3HOY J;  2L7Z A;  4A3E J;  2DA5 A;  3ZQF A;  3OSF A;  1B72 A;  3Q0W A;  4XK4 A;  2LD5 A;  4FIS A;  2DN0 A;  2NOG A;  5F27 A;  3A01 A;  1MBF A;  2JMW A;  3JRC A;  4AUX A;  1Y1W J;  2CUE A;  2K9Q A;  4JX4 A;  3RZD J;  2JA8 J;  1XS9 A;  1IRZ A;  2XB5 A;  1ETV A;  1WH7 A;  3S2H J;  4A3J J;  3LOC A;  1RR7 A;  1T33 A;  5EYR A;  5JLX A;  2XPU A;  4DYR A;  2MSY A;  2XB0 X;  1TWC J;  1MBK A;  4L5E A;  2K40 A; 
#chains in the Genus database with same CATH topology
 3W6K B;  3WG7 H;  2XF7 A;  5DUK A;  2DT7 B;  2LF7 A;  2F4O B;  2EQR A;  3PQJ A;  4GRI A;  1QZE A;  2JJ7 A;  1T56 A;  4Z6Y A;  4IJA A;  1UB9 A;  1TWA J;  1KQ9 A;  1VZ0 A;  1R6R A;  2R7T A;  5M5Y J;  2WTE A;  4HG2 A;  2W84 A;  1FBU A;  2OA4 A;  3QU3 A;  1J5Y A;  5L3C A;  2BVL A;  5JHU A;  1MGT A;  2F4I A;  1AU7 A;  2E1M B;  3NEU A;  1ZK8 A;  2ECB A;  4IOC F;  4FCY A;  1KU9 A;  4KT5 C;  3OY9 A;  3WHB A;  1Y1V J;  3CUQ B;  4XKC A;  1A6I A;  4E70 A;  2Z5U A;  1UHM A;  5M3F J;  1U9N A;  4PSX A;  1LNW A;  2P5L C;  4XOR A;  4ZTJ A;  2KJC A;  1IV6 A;  1PUF B;  2ZFW A;  3EUK L;  4CCN A;  3RCO A;  3S16 J;  4U7D A;  2A61 A;  2MH9 A;  2QSH X;  4II2 A;  1JJ8 C;  2HPM A;  1R71 A;  2B7E A;  3FXR A;  1D3Y A;  4BE0 A;  2CYY A;  1JGG A;  1LUJ B;  2NAZ A;  5F04 A;  3H3Z A;  2HOA A;  2ID3 A;  1W7P A;  1TQI A;  4ZDO A;  3IL2 A;  1RUN A;  4OIN F;  1MBJ A;  3DKY A;  4BU2 A;  3F22 A;  3ECH A;  1IN4 A;  2X6O A;  2GXA A;  2V4J C;  3A0B C;  4BXX J;  3RPU D;  1O3S A;  1BI3 A;  3RYR A;  3DEU A;  2HFH A;  3ZXS A;  1LDD A;  4ABZ A;  3MKL A;  3K4J A;  5FLX K;  2P8T A;  3I54 A;  4D1Q A;  1RIO H;  3WE2 A;  1YO5 C;  1XX5 A;  4A5N A;  2PJR B;  4L5I A;  2AXL A;  4YEJ A;  1VFC A;  2R92 J;  2QKL B;  1WPK A;  2X6W A;  2KHM A;  1B1B A;  4EJV A;  3KX2 A;  5GTI C;  3K4L A;  1TTY A;  4BY7 J;  4BQQ A;  2VJ4 A;  3WTW C;  4MGR A;  4PUS A;  1VQP I;  2D45 A;  2CU7 A;  3A0H C;  2Z9O A;  3PSI A;  1VQO I;  4A0X A;  2DOD A;  3WU2 C;  2H1K A;  4XLN F;  5K7Z A;  5J40 A;  5C4X J;  2OJE D;  3VEP A;  2W00 A;  4MEY F;  3SDB A;  2H1L A;  1JXS A;  2DW4 A;  1HDP A;  4A3I J;  2QBY B;  1WHU A;  4HF1 A;  2UXX A;  4DNC A;  3ZQL A;  2IS2 A;  3K1P A;  4ITV A;  2EWN A;  4EJW A;  1QHH D;  2DK5 A;  1TWG J;  1V4R A;  4F91 B;  2NXN B;  2K3P A;  4DZJ A;  5ICC A;  2A69 F;  4IX7 A;  3KP5 A;  4M9S A;  3P7N A;  5ICE A;  3KYL A;  5H6R A;  3NAR A;  5IYB J;  5B1A H;  1D5Y A;  2VUM J;  5TIS C;  2QSF X;  3E6D A;  3V7C A;  1HW1 A;  2LYC A;  3I4M J;  3V4G A;  4ZJZ A;  3PNT A;  1ETQ A;  3JAM Z;  4KYW A;  1UJ8 A;  3VDX A;  1K61 A;  4MNU A;  2YPR A;  3SHF A;  3GFJ A;  4CCM A;  3S15 J;  1R22 A;  3HRT A;  2CRG A;  2DFH A;  1G3W A;  1STZ A;  3QPL A;  5FB2 A;  1K78 B;  1BJA A;  4PJM A;  4J00 A;  2Q1Z B;  3CCS I;  5FLM J;  2RN7 A;  4KA4 A;  2YSR A;  2HXO A;  3VWB A;  2X0L A;  2IA1 A;  2MW8 A;  2OV7 A;  3SZP A;  2EV5 A;  4P9F A;  1TWF J;  1KGS A;  3BG7 A;  5KHD A;  5K1Y A;  4BHC A;  1IUF A;  2CQ7 A;  5CVJ A;  2VAS A;  5E8G A;  1Q1H A;  3U9G A;  5LHG A;  5H6Q A;  4YFN F;  2JWT A;  1OYW A;  4IO9 F;  5FO5 A;  3L00 A;  2MAB A;  3FIW A;  2BY3 A;  2R7F A;  1R1T A;  1MDM A;  1N77 A;  3HBL A;  4XQF A;  2I5U A;  1OJL A;  2DCE A;  3K10 A;  1TNT A;  3ZQG A;  1U8B A;  3GCM A;  4L18 B;  4CO8 A;  1FBQ A;  1JI8 A;  1CF7 B;  4D7N A;  5BS6 A;  4ENM A;  3OR1 C;  1GLN A;  4ZDL A;  3M3Y J;  1YQA A;  1YLF A;  2OPT A;  1S8N A;  3HGY A;  3WTZ A;  1L0O C;  4CCL A;  3RPU A;  1X1P A;  3GBG A;  4HPQ A;  1G4D A;  3DBH B;  4XL9 A;  1ZGJ A;  3D5L A;  5FFZ A;  4HW0 A;  3TP0 A;  1A5J A;  3KP6 A;  4XLE A;  2VQH A;  2XSJ C;  3LSJ A;  1R9T J;  2EA2 A;  3L2C A;  2O0Y A;  4U0W A;  1VQ9 I;  3K1N A;  3VOD A;  4E4H A;  4RGU A;  5HNF A;  5K7F A;  3KP3 A;  2HVQ A;  3HRM A;  3CUO A;  4LG0 A;  3KET A;  2NS7 A;  1R00 A;  2F5E A;  3ZMS A;  1YIJ I;  1KON A;  4CZC A;  1YJW I;  2O8X A;  2CW8 A;  4XRS G;  2TDX A;  2KRH A;  4WX9 A;  4ANJ A;  1WJE A;  3CLO A;  4EMS A;  3PM1 A;  3FHN A;  2VB6 A;  3FHZ A;  2JUC A;  2RRE A;  2QUF A;  2NS0 A;  1UHS A;  2FOW A;  4PJN A;  2PFB A;  3GFI A;  3H9Q A;  4C2T A;  3RKY A;  1FIA A;  1REP C;  2DOF A;  2RDP A;  4UUS B;  1IDY A;  5B1B H;  1B6A A;  5J4V A;  2Y75 A;  4E7S A;  3PIO F;  1IW7 F;  5M3M J;  4GYI A;  1IN7 A;  3PFY A;  2LOO A;  4NBQ A;  2ELH A;  4BXF A;  5J6X A;  1APL C;  1I3A A;  3KFW X;  1V5G A;  3K4N A;  3SZT A;  1D0Y A;  1MBH A;  2Q8K A;  1KZH A;  2HYF A;  1OR7 A;  3MN2 A;  1X3W B;  1JUP A;  2QA4 I;  4RS8 A;  4D0P A;  2ZC2 A;  1W36 D;  3PJR A;  1XGS A;  5IT9 K;  4I76 A;  4IF4 A;  4MLO A;  3AL0 B;  1LQ1 A;  2JRT A;  3NRV A;  2ME0 A;  4AC0 A;  2ZNZ A;  5FRN A;  1V54 H;  3KEO A;  3H0G J;  1X3Z B;  1MH4 A;  1TNS A;  1XCV A;  2LBF A;  3AG4 H;  4WF2 A;  4A3L J;  3E3V A;  4DIQ A;  1U3E M;  2XRL A;  1IAW A;  3D0S A;  3TO6 A;  4ZZL A;  2P0W A;  3JR9 A;  4FQG A;  4A5M A;  2M8E A;  3TW6 A;  4OU0 A;  2LKX A;  2PQ8 A;  1X19 A;  4CUG A;  2Y0S N;  4BAC A;  2O3F A;  2EV0 A;  4RAZ A;  1IF1 A;  1FPQ A;  2DXI A;  1FBS A;  3ROU A;  1UAA A;  1BC8 C;  1FJL A;  3J7Y J;  5CVR A;  2KLO A;  2MLG A;  2EIK H;  2QCO A;  5E1Z B;  2QKM B;  2VI6 A;  3IHU A;  4A0Y A;  1D8J A;  1OCC H;  2X1D A;  3F8C A;  5E8I A;  3KYC B;  1R7J A;  3ASN H;  3LNQ A;  1TQP A;  3E5Q A;  1YFH A;  3H5R A;  5ILU A;  1MSF C;  3G73 A;  4FX0 A;  1ZLK A;  3OYJ A;  3WU0 A;  1JE8 A;  1RPW A;  3BG3 A;  1T2K A;  3KZZ A;  4RAY A;  2PLY A;  4BUP A;  2H94 A;  1F4K A;  3KIO A;  1MJB A;  1QPI A;  4R1H A;  1MBE A;  4IHX A;  2KRF A;  2WB1 A;  1RNL A;  1U9O A;  2LRD A;  2RV8 A;  2X51 A;  2CV0 A;  5HNH A;  4P5O A;  2GXB A;  2GIZ A;  3I64 A;  5EZG A;  3BC8 A;  4W1U A;  1P7I A;  5J47 A;  2E2I J;  3CCR I;  2HU9 A;  1H8A C;  3WGH A;  3GTO J;  2RNG A;  2LTP A;  6PAX A;  1EJ9 A;  2XDV A;  5CJ9 A;  4UVA A;  1VI0 A;  2LFB A;  1OYI A;  3CCY A;  3OOP A;  4V19 K;  1Q1V A;  3C2H A;  1UFM A;  1I1G A;  1T0F C;  2A6E F;  4KIC A;  3OYE A;  2B9S A;  2R4G A;  4UXN A;  3ZMT A;  1T39 A;  4Q4Z F;  4LMY A;  2O6G E;  5LHI A;  1SFE A;  1JUM A;  3DXJ F;  2ZME A;  4BL0 B;  4GFB A;  1PP8 F;  4ZYG A;  1ERD A;  1U5T C;  4JX6 A;  2A6H F;  2HTS A;  2LY9 A;  3GTJ J;  2VT3 A;  3FIS A;  4CCO A;  2XAG A;  2GM4 A;  3OL3 A;  4N4N B;  3CCQ I;  1WWX A;  4KUM A;  3K6G A;  4I6Z A;  2R3S A;  3MKZ A;  3EYI A;  1TT5 B;  1ETX A;  2KJB A;  4KIB A;  1KU2 A;  2EFP A;  2L9R A;  2WB1 N;  2MLK A;  1X1C A;  2KIF A;  3TKY A;  4BQO A;  1ZR2 A;  1JJ6 C;  1HW5 A;  2L9S A;  5F0F A;  2V9V A;  4KMF A;  4XID A;  2RKH A;  1P9Q C;  3L1P A;  1MDM B;  2ZFU A;  1OCO H;  3ZMD A;  1PJR A;  1QVU A;  1QHG A;  3M8F A;  3MEX A;  3ERM A;  1HKS A;  2K9N A;  2MC3 A;  3TW7 A;  5K5Q A;  3CQZ J;  2P7V B;  3DF8 A;  3S8P A;  5HDN A;  3HSE A;  4HNT A;  2IAI A;  1FY7 A;  4CHU A;  5LGN A;  2R0Q C;  2E1C A;  1P7J A;  1XDU A;  5B3S H;  2OCE A;  3CCE I;  3BDD A;  1PUF A;  2L7Z A;  1ACI A;  2F5D A;  3ZQF A;  4ESF A;  1S3J A;  3RDI A;  1B72 A;  1Z7U A;  2LKP A;  4HST A;  3ABK H;  2NOG A;  1MBF A;  2JMW A;  3ZR8 X;  1SD6 A;  2CUJ A;  2QM3 A;  3L2Q A;  2PMZ A;  3FX3 A;  2EFN A;  2IGK A;  3ABT A;  2R7O A;  4XNF A;  2JA8 J;  3NWS A;  2P7C B;  2V26 A;  1IRZ A;  2WBM A;  3A4C A;  1ETV A;  1FX7 A;  1WH7 A;  2LDU A;  4HX7 A;  4KIG A;  3S2H J;  2QZ8 A;  3MMY B;  3LOC A;  3LSH A;  1T33 A;  4LG0 B;  5EYR A;  3T8R A;  5DDG A;  3PUF A;  3L2U A;  1LKX A;  2MSY A;  1VQ6 I;  2NYX A;  3G3Z A;  4I0A A;  1AHD P;  2K40 A;  4RM3 A;  4C3I J;  1Y39 A;  1Y0N A;  4RLF A;  1ZH5 A;  4BE2 A;  2BYV E;  1QRY A;  3MCZ A;  3P5J A;  4Q5S F;  1RR8 C;  1JTX A;  3HM5 A;  5LRS A;  1S7E A;  1SEU A;  3O2P E;  2VQG A;  4LFU A;  2Z16 A;  3SJM A;  4N4O B;  2COM A;  3V8K A;  2ESH A;  1Y56 A;  2VJ5 A;  3RKX A;  1QVT A;  3BG6 A;  5HVQ C;  5EJC A;  1ZN2 A;  2DJI A;  1J09 A;  3S17 J;  5D5U B;  4JYK A;  4A12 A;  1AOY A;  2CG4 A;  2K9S A;  4I7H A;  3VYU B;  1TC3 C;  3S1Q J;  3ZPL A;  4B4C A;  2MC4 A;  2ZSH B;  2E2H J;  3DTI A;  1ZHF A;  5DS9 A;  1EF4 A;  3LA7 A;  4RLQ A;  4Y3O A;  4U7B A;  4V2F A;  3J81 K;  2JVH A;  1E3O C;  2QGU A;  2QBY A;  3G71 I;  3V42 A;  5FGM A;  1UMQ A;  2VKD A;  3MAJ A;  3MQ0 A;  3CZ6 A;  3JAM K;  3C1D A;  2OF7 A;  1GV5 A;  3OYI A;  4NHJ A;  1KU3 A;  4B47 A;  4EM2 A;  1SFK A;  2EFO A;  5ICG A;  4YFK F;  1B8I A;  2LBF B;  4RBO A;  4ON0 A;  3SZG A;  2F6C A;  2B0L A;  2L02 A;  2VOP A;  2FBI A;  3M9A A;  1FTZ A;  2M2E A;  4ZTF A;  1MMN A;  2JA2 A;  5J1Y A;  4G7O F;  1LEA A;  5IT9 Z;  3FXU A;  2EZI A;  4G6Q A;  2DFE A;  1ZKG A;  5D8K B;  4F52 A;  1IXC A;  2LKS A;  2Y0M A;  1D1A A;  1YS7 A;  3CJN A;  5GAE J;  2LMD A;  1IRG A;  2HKO A;  3C2G A;  3ABU A;  3HPH A;  3S3O A;  4HZF A;  1BW5 A;  2G7H A;  1TW3 A;  3PUB A;  4RB0 A;  1K78 A;  5F0C A;  1OYY A;  3DU5 A;  3WTV C;  2IT0 A;  1I5Z A;  1H0M A;  1DQU A;  4Q48 A;  3ZQQ A;  2EZH A;  4A3D J;  2M4K A;  2BHZ A;  3WU1 B;  2NOJ B;  3K2Z A;  3CME I;  2HDD A;  3IRQ A;  3O8H A;  2HWV A;  2NVU B;  3Q0U A;  5ED4 A;  4M73 A;  3BZK A;  3GO5 A;  1FTT A;  4HAM A;  3D1N I;  3I3L A;  1GVD A;  4DJA A;  2E7W A;  5IPA A;  2Y9Z A;  4Q47 A;  4I09 A;  4BS9 A;  1FEX A;  2W82 A;  3IH3 A;  3UR3 C;  3DBL B;  2KIM A;  2KKO A;  3ZQ7 A;  4AVZ A;  3E6B A;  4EM0 B;  3MKY B;  2IS1 A;  1Z21 A;  1J75 A;  5L3G A;  1UST A;  3H92 A;  1TQM A;  4F92 B;  5C4J J;  3S32 A;  2EH3 A;  4G6T B;  1IZ1 A;  2MFZ A;  2DPD A;  4UUV A;  5CPR B;  5TJJ A;  4BAY A;  2JA5 J;  1FP2 A;  3WTX C;  1YI2 I;  1S5L C;  4XLH A;  4E7H A;  4EGY A;  1ITY A;  3HOW J;  5LGT A;  4HF0 A;  2W24 A;  1QPM A;  1XDS A;  3BR1 A;  1EA3 A;  2OAZ A;  2W25 A;  3CP8 A;  2V6E A;  5E3L A;  3OYH A;  2GA1 A;  4S05 A;  2ZME B;  4RB3 C;  2V9K A;  1BR4 A;  4WXH A;  4KDP A;  2F4M B;  2Q0O A;  1ORK A;  4UB6 C;  1ZTR A;  2EIJ H;  2XAJ A;  3Q9V A;  5LLQ A;  3GZ6 A;  3K4B A;  2KIU A;  1JKP C;  5J3L A;  3F8B A;  2R5Z A;  5FKK A;  1TWH J;  4KT6 A;  4EEF G;  3KYD B;  4C30 A;  2CV1 A;  1QGP A;  3L2R A;  4XRF A;  1WZ2 A;  1F43 A;  3ABL H;  4QWQ A;  3ZMU A;  2NVX J;  1G6N A;  4DBR A;  1WQ2 A;  3BZC A;  1VQ5 I;  5IT3 A;  1XN7 A;  2L4M A;  5HDG A;  1A31 A;  2BV6 A;  2Y30 A;  3LFK A;  1BM9 A;  4B8X A;  3DPL C;  1YJN I;  1K6O A;  1KA8 A;  4X1E A;  1SC7 A;  1E17 A;  2R7Q A;  2YUS A;  4C9Y A;  4RA2 A;  2ID6 A;  1PUE E;  3SEQ A;  2E5N A;  5LD2 C;  1FMV A;  5IYD J;  3G1M A;  4GXO A;  2KPM A;  5IOY A;  3CMY A;  2L5Q A;  3QYE A;  2JT1 A;  3CDL A;  4D9J A;  4U0Y A;  1OCZ H;  3OYK A;  1S7O A;  4UUS A;  2ESN A;  3ZQH A;  3HOT A;  2XRO A;  3AG2 H;  3KEQ A;  2FU4 A;  1B72 B;  4UHT A;  1ZGA A;  3BR6 A;  3JW4 A;  2YU9 J;  3HDD A;  5KAF C;  1DGR M;  1PYV A;  4CSW A;  2K86 A;  1S72 I;  3JCU C;  3Q9S A;  4FE7 A;  4LG3 A;  1Z7L A;  2TRT A;  1R36 A;  3HSF A;  2HOE A;  2NVY J;  4N9I A;  3HGG A;  5L3F A;  4EAT A;  1HOM A;  1R1V A;  2MYS A;  1O3T A;  4BY1 J;  1Z77 A;  5LRR A;  4ZH4 F;  1EH8 A;  2DDB A;  3QPT A;  4JOM A;  3TP3 A;  2C6Y A;  4JX5 A;  2DMQ A;  1RKW A;  3W2V A;  2LG4 A;  4IVN A;  1KU7 A;  4XBF A;  3ZOB A;  4QPQ A;  2EK5 A;  3GEZ A;  3OS0 A;  1ZGW A;  2QQB A;  5GAD J;  1ZRF A;  3JRI A;  3I71 A;  2Y9Y A;  2UXN A;  2MD0 A;  3VYS B;  4A6D A;  3OS2 A;  2A68 F;  3NWT A;  1XMX A;  1JKQ C;  2VPL A;  1FOY A;  4M3E A;  1ZG5 A;  1CGP A;  2HPI A;  3IAM 2;  2HQR A;  4MIM A;  3F23 A;  2G0E A;  5AIQ A;  1DU6 A;  2OZ6 A;  3FK6 A;  1G3Y A;  2JPC A;  2YX4 A;  4BJ6 C;  5HS7 A;  3IWZ A;  3F3X A;  2XGC A;  1XGO A;  2V79 A;  3TO7 A;  3ZQI A;  4Y17 A;  5L3E A;  2BHY A;  4IHV A;  3BPX A;  2CS3 A;  2L7F P;  3GTQ J;  3DTK A;  3KP4 A;  3MZY A;  1ON2 A;  3VFZ A;  4YIR X;  2DTZ A;  2EIM H;  4UVB A;  1XG1 A;  2WV1 A;  3H5A A;  2BOL A;  3ONQ A;  1DUX C;  2DLL A;  3KCC A;  1LFP A;  4EVI A;  1JT0 A;  2HDW A;  3H36 A;  4PGG A;  3TOB A;  1P92 A;  3J7A Y;  3CES A;  5CYV A;  3QAH A;  3CO7 C;  3QYF A;  5HOD A;  1B8I B;  3WTU C;  4ETS A;  2EFQ A;  2K85 A;  1TZL A;  3J81 Z;  1A35 A;  1OCT C;  5F0H A;  2V1U A;  1TP4 A;  1YIO A;  1V5E A;  4WXD A;  2K4B A;  2K02 A;  1TLH B;  3W6V A;  2JZY A;  3IC7 A;  3L9F A;  4D7M A;  4PSW A;  4IHT A;  2FSW A;  1XC5 A;  3LFU A;  2AQF A;  3LSP A;  2MH2 A;  3E0J B;  4DQ2 A;  3NQO A;  5J1R A;  3G1O A;  3PQK A;  3J80 K;  2RNJ A;  3B6C A;  1ZAO A;  2L4A A;  3CMM A;  3FBI B;  3KLO A;  3IKV A;  4FET A;  2E35 A;  2HQN A;  3W6J B;  1OIS A;  1SVM A;  5CVI A;  4OIP F;  1BBY A;  1HC8 A;  2CQQ A;  1BN5 A;  3ERE D;  2Z2S B;  1MD0 A;  3T1B A;  2Z33 A;  3KEY A;  1GVJ A;  1BI0 A;  2EZL A;  4LIT A;  2QYO A;  2PG4 A;  4A3C J;  4X0G A;  3K4C A;  1F5T A;  2JUG A;  3CJQ B;  4HBL A;  3UNG C;  4CIC A;  2GWR A;  1UG2 A;  2HZD A;  2XAU A;  3AKZ A;  2H8R A;  2DA4 A;  2KMU A;  2XV4 S;  1G2H A;  1GHC A;  1FYL A;  4HA8 A;  2GOX B;  2O8K A;  5J8F A;  3Q3S A;  2EA4 A;  4AIK A;  1NHA A;  2KZV A;  4BBR J;  2X1E A;  3W3C A;  1J7K A;  5E18 F;  3GF2 A;  3TQN A;  1F1Z A;  4XSX F;  3GTK J;  2ZJ2 A;  2MG4 A;  2ZJP F;  2O61 A;  3CCU I;  3QP5 A;  4O5V A;  5ILV A;  1R1U A;  2P5V A;  4P96 A;  2JTV A;  2IS4 A;  4MFD A;  5EEH A;  1SFU A;  5F6F A;  2JVG A;  3ZGK A;  1DP7 P;  3S1N J;  2K9L A;  3GME A;  3EUH C;  2M87 A;  1FOK A;  4XOP A;  2HI3 A;  5LHH A;  3E6C C;  4ESJ A;  1BOA A;  3Q0V A;  3E5U A;  4DOZ A;  2VBW A;  2WAD A;  4AIH A;  4K2E A;  2IGM A;  3GZN B;  5DYM A;  2FUG 2;  3REO A;  3L2V A;  3CF5 F;  4A3F J;  2E19 A;  3N97 A;  2DFF A;  3BLY A;  2FE3 A;  2HYJ A;  4ZDP A;  2R5Z B;  3M8E A;  2STT A;  4A6E A;  5JLW A;  1XB4 A;  3FKI J;  1NH3 A;  5DUI A;  1A36 A;  2QEX I;  4E7Z A;  1C0W A;  3CTA A;  1RZ4 A;  5HDK A;  1J59 A;  1BR1 A;  3DV8 A;  3TOA A;  2A5W A;  3HTU A;  3ML6 A;  2ZJR F;  3VOE A;  1TL8 A;  1N25 A;  3H3U A;  3RTR A;  3U1K A;  2LK2 A;  3IAS 2;  2H8W A;  2XVC A;  4IRI A;  3IUO A;  1YE9 A;  3LSG A;  1H88 C;  3ZQC A;  2F5C A;  4JBA A;  5CQG A;  1T95 A;  1BJZ A;  3TED A;  4LOC A;  1YW9 A;  4QLC U;  2HXI A;  4BHP A;  4Y15 A;  2X85 A;  5FRO A;  2CSO A;  3FBN B;  4B3A A;  1LE8 A;  4FAS D;  4HX8 A;  4XKV A;  1YW8 A;  3U1D A;  3CJR B;  3ZRG A;  5TGT A;  1EKE A;  3OYG A;  2W57 A;  4L9N A;  1UEL B;  4RB2 C;  5DM7 F;  4PFP A;  2STW A;  3TGN A;  5HS9 A;  3IV5 A;  4ZYH A;  4TV7 A;  4XRM A;  1VTN C;  1ZR4 A;  5E3O A;  3GZ5 A;  1D8K A;  3C2B A;  2A07 F;  4HRI A;  2AQE A;  4QIW N;  2YS9 A;  2YR2 A;  1ZRD A;  3R61 A;  4YIF A;  3EPZ A;  1WRJ A;  4NC7 A;  1BI2 A;  3BOQ A;  2CMP A;  3SQN A;  5HLT A;  2HQ5 A;  1ZAR A;  2WY8 Q;  2KIS A;  3I0T A;  4L9V A;  4A3E J;  4BGD A;  5D5V B;  4EV0 A;  1XSD A;  3HL2 A;  3OSF A;  5D6E A;  2M4G A;  4FIS A;  2DN0 A;  1RUO A;  5F27 A;  1S6L A;  1YS6 A;  2X6Y A;  3FXJ A;  1SMY F;  4AUX A;  4PGH A;  2XIG A;  2ZXJ A;  2XUB A;  2K9Q A;  4XR6 A;  5BPD A;  4AYB A;  1XS9 A;  2FEZ A;  1KQ8 A;  3Q5F A;  1RI7 A;  3QU6 A;  1RR7 A;  2HNH A;  1ONV A;  2XPU A;  4I98 B;  4KFC A;  4DYR A;  2KZG A;  1WKM A;  3OIQ A;  1BIB A;  1XGM A;  3RKW A;  1TWC J;  2VON A;  1S29 A;  1S7A A;  3H1C A;  5CLS A;  2L2O A;  1FSH A;  4YII A;  2B63 J;  4C3H J;  3BTC A;  4BBS J;  4RAF A;  2HZT A;  3ZN1 A;  4BH9 A;  1O7F A;  3COA C;  2L9N A;  3IWF A;  3F6O A;  2DA6 A;  2CWE A;  2FBH A;  1XSX A;  4OAZ A;  4PJ0 C;  1HF0 A;  3GYH X;  3KZY A;  4OMY A;  1T0F A;  1OR7 C;  2K27 A;  2HR3 A;  3IP4 B;  1Z91 A;  3FMS A;  1W0U A;  2LVS A;  1YG2 A;  2CW7 A;  2DA2 A;  4M3F A;  1ZG3 A;  3D5S C;  2M34 A;  3C7J A;  3LMM A;  1MNE A;  1D1B A;  1U6G A;  4RGX A;  4M3G A;  3OYC A;  1IN5 A;  3JSO A;  3TDU C;  2KT0 A;  3RIR A;  2XGX A;  2P5K A;  1T6S A;  1U5T A;  1XTA A;  2WC2 A;  3FXK A;  3O6B B;  5K7H A;  2CFX A;  2HKX A;  4WWC A;  5E79 C;  1IGN A;  3RKQ A;  3L09 A;  4IHY A;  3GFM A;  4E7J A;  1BIA A;  3IH4 A;  1R5H A;  2XF5 A;  3K4M A;  3H9J A;  4O3M A;  4IZZ A;  1WSU A;  1GDT A;  1UZC A;  1SAN A;  1MND A;  5JVT A;  4XIC A;  1I6H J;  2DMN A;  1ULY A;  4CA0 A;  1WI3 A;  3M1E A;  2I10 A;  1NTC A;  4F7Z A;  1IXR C;  1DGW Y;  5BNG A;  2GOM A;  3DEW A;  3RYP A;  4WCG A;  2BGC A;  1FOW A;  4KIS A;  3MVP A;  4A3B J;  3OYL A;  4J19 A;  3J80 Z;  1NK3 P;  1PDN C;  1FZP B;  2H6C A;  2F2E A;  5F1J A;  1DDN A;  1MIJ A;  3GXO A;  3I59 A;  2FXA A;  1IRX A;  1LJ9 A;  3GVA A;  4IEJ A;  4ENJ A;  2DQR A;  3EET A;  4IQ4 A;  4U0V A;  2X48 A;  5FFX A;  4AID A;  3P9K A;  3VYT B;  1IV8 A;  2FNP A;  5GTH C;  4CYC B;  3L2W A;  2NVQ J;  3RPQ A;  4E7L A;  5DCF A;  5L3B A;  2NRA C;  3BQY A;  5EGO A;  1Z0X A;  1FMW A;  4B1R A;  3QP6 A;  4HNV A;  2WAQ A;  4B3X A;  4G7H F;  1OMI A;  2WV0 A;  4ENN A;  1OPC A;  3LAJ A;  2ME6 A;  4IL6 C;  3BR2 A;  5FJ8 J;  4EM1 A;  2W1O A;  2IW5 A;  4CXF A;  2K3F A;  1SD5 A;  3G2B A;  4MFE A;  4I99 C;  4EJO A;  4CYD A;  2ELJ A;  5ILS A;  1N78 A;  1P4X A;  1UG0 A;  2WY7 Q;  3B6A A;  4Z2Y A;  1IJW C;  3EYY A;  4CCJ A;  1ZG1 A;  4OIO F;  1BA5 A;  2QF7 A;  4NDL A;  4XMY A;  2W48 A;  4GYG A;  3AAF A;  2ZJQ F;  1MW7 A;  1K83 J;  3AG3 H;  1R4M B;  2I8D A;  3X2Q H;  2QQ9 A;  3BG5 A;  4I02 A;  4L5J A;  1WJF A;  1X4O A;  1POG A;  1QO0 D;  2NS8 A;  2AS5 F;  1TW2 A;  5B5E C;  2E60 A;  5IY5 H;  3BPV A;  2E1O A;  3FXO A;  4NB5 A;  2JSP A;  2CV2 A;  3H9G A;  1LDJ A;  3S1R J;  3F6V A;  3HOZ J;  4KNY A;  1X3U A;  5E3N A;  2COB A;  3MD2 A;  5E1X A;  2CFO A;  3ABM H;  5GPA A;  2FMY A;  1IN6 A;  2AHQ A;  4F3Q A;  1YJ9 I;  3F9K A;  2CO5 A;  4AD9 A;  4MTE A;  4NUB A;  4BKX A;  2E1M C;  3K9T A;  3N4M A;  1FNN A;  1HSJ A;  1P4W A;  1LE8 B;  1SD7 A;  2M7A A;  2MBF A;  3CUQ C;  3VSK A;  1NK2 P;  1W36 C;  4M3B A;  1LVK A;  3HUG B;  5A2Q Z;  1SVL A;  2EJR A;  3I9V 2;  4YRV A;  2DDA A;  3DLA A;  1MMS A;  1E3P A;  1Y0U A;  2H09 A;  1XPX A;  5LEK A;  2XAS A;  3OYF A;  5IOZ A;  2ZKZ A;  5FD5 A;  3M8J A;  4KJZ A;  2R5Y B;  4XLA A;  2PMZ N;  2M9H A;  2DMT A;  2GAU A;  4PDK A;  4UY8 I;  1YRN A;  1B59 A;  1SVO A;  2L01 A;  5H2F C;  1O4X A;  1K4S A;  1MH3 A;  4A69 C;  4M9Z A;  4ASN A;  1G3T A;  1DU0 A;  1HQC A;  2JRM A;  3BZ6 A;  5GAH J;  2M30 A;  3K2A A;  2IGN A;  3K7A J;  3UKG A;  3LST A;  2M0C A;  2XHK A;  4IRH A;  4CDG A;  4DYC A;  4KMU X;  4XKW A;  1V5F A;  2VPR A;  2VOO A;  1JT6 A;  5K5R A;  1FYM A;  5F1R A;  2JN6 A;  4HEA 2;  3F8M A;  4XON A;  5J4Y A;  4M72 A;  3HZJ A;  2EPF A;  4AIJ A;  2BE5 F;  1Z05 A;  5IP6 A;  3GW2 A;  3BRO A;  5EEG A;  2EZK A;  4HF2 A;  4U88 A;  2KFD A;  4M74 A;  2LY1 A;  3T0Y A;  5D4S A;  5HLG A;  2LRE A;  4RM2 A;  1I39 A;  3EQL F;  3QWL A;  1W1W E;  3U2R A;  1EH6 A;  3IH2 A;  3QPS A;  1FOX A;  3HXL A;  3LSI A;  2LLK A;  3MFK A;  4WK8 F;  3CC7 I;  3GLX A;  1FP1 D;  2VJJ A;  3FMQ A;  2L0K A;  3OR2 C;  1X1A A;  4ESB A;  1JHF A;  2DFI A;  5E3M A;  4NC6 A;  3FWE A;  1IC8 A;  2LR8 A;  3CLQ A;  2FOK A;  2ECC A;  4Y4R A;  3HRS A;  3K1M A;  2PI0 A;  2R7D A;  2VXZ A;  1BI1 A;  1SD4 A;  2YU3 A;  2PX9 A;  2DOE A;  4HLY A;  5KNL A;  3JRB A;  4BEH A;  2EBI A;  4A3K J;  4OMZ A;  2IBD A;  4OIR F;  1U5T B;  1XMA A;  4R8H A;  1RES A;  1RC9 A;  1J2X A;  5EG0 B;  3BJA A;  1BC7 C;  4A93 J;  1ODD A;  3QPH A;  5CVV A;  1S9H A;  2LSO A;  5CQE A;  3WE3 A;  1EV7 A;  1JKO C;  3RQ4 A;  5HLH A;  1MBG A;  4B48 A;  5JHF A;  2KIQ A;  2VQC A;  3A03 A;  4HNU A;  1XSV A;  1Z3Y A;  1SAX A;  3N05 A;  3HYI A;  3JRD A;  4MO7 A;  4DZP A;  2ELK A;  3I4P A;  3PNV A;  1JTY A;  3E5X A;  3FK7 A;  4ZYA A;  4HV5 A;  3I55 I;  3DPT A;  4CZZ A;  4MHG A;  3U21 A;  4GDF A;  2IP2 A;  2BBY A;  5J1U A;  3IKT A;  2L9V A;  4MQV A;  1RET A;  1H89 C;  2VKV A;  1R58 A;  2OQR A;  1ETW A;  1I27 A;  3KP7 A;  5CVU A;  2UZK A;  2VE8 A;  2HOT A;  2Q2E B;  2X9D A;  4BE1 A;  2BZT A;  2ZB9 A;  5F08 A;  3I59 B;  2QSG X;  2QVO A;  4UVC A;  5H20 A;  4AM3 A;  3QOP A;  1DPR A;  2VOD A;  4E7I A;  3M07 A;  3S3N A;  5GP9 A;  3DTE A;  2QLZ A;  4IPA A;  2D1H A;  3SFZ A;  5EGO B;  1WJD A;  3I53 A;  4KIT B;  4BJ5 C;  3JRG A;  9ANT A;  3CF2 A;  2BW3 A;  5JFR A;  1AA7 A;  4XLC A;  2KDO A;  3LA2 A;  2XF6 A;  2XGD A;  3P9I A;  2ZO4 A;  2RQP A;  2Y48 A;  2X6X A;  5DEQ A;  4OIQ F;  5DTD A;  3R0J A;  2VBX A;  4G9Y A;  2R93 J;  3JTH A;  3WTT C;  1O3R A;  1JUS A;  5FKM A;  1D0X A;  1ZEL A;  4A2U A;  2JA6 J;  3LSR A;  3CDI A;  2DMU A;  4UV8 A;  2E2J J;  3BTI A;  3F8F A;  2H6B A;  5D5X B;  4DGW B;  3K70 C;  2QQA A;  1YOV B;  1VND A;  3CO6 C;  2BY0 A;  2DT6 A;  1LFU P;  5EDN A;  2LP0 A;  5L3D A;  2JA7 J;  2M1B A;  1MSE C;  2X1C A;  4LB6 B;  1E2X A;  1MMA A;  1V3F A;  2VBY A;  2WA0 A;  3OMY A;  3SDG A;  1X1B A;  2PEX A;  3KZI C;  1K7A A;  1J0R A;  1ON1 A;  4B44 A;  2MA3 A;  3A2K A;  4CCK A;  2R7X A;  1W0T A;  2DPU A;  4XN0 A;  1YHQ I;  1I50 J;  3ISP A;  1RKT A;  5FKN A;  3PIP F;  3L7W A;  2DA3 A;  4ZYE A;  2DA7 A;  3NAU A;  4IQJ A;  2HDC A;  1VQL I;  4FT8 A;  3WTY C;  1XCB A;  1UHW A;  2CQX A;  2ZXH A;  4KIF A;  3PO2 J;  4RB1 A;  3CCL I;  5EEA A;  2O5R A;  3HEF A;  5FKO A;  2IGO A;  2UV1 A;  1IN8 A;  1RRJ A;  3FM3 A;  1Z6R A;  3DFG A;  2XGE A;  1SFX A;  4AVP A;  4M6V A;  4PCQ A;  3E97 A;  2J5P A;  5GPC A;  3BR0 A;  2A3S A;  1P6R A;  3G4S I;  3MKW B;  3HOX J;  2XPV A;  3HJE A;  4HDU A;  4R79 A;  1E0E A;  2VQL A;  4XOT A;  1TT0 A;  2FQ4 A;  3M1C A;  2K9M A;  3FZV A;  3HOS A;  3RSN A;  2HOS A;  1YRN B;  3DU6 A;  2PN6 A;  1D5V A;  4NNJ A;  1QA6 A;  4IXA A;  1OLT A;  2P6T A;  2L54 A;  4B09 A;  2LC2 A;  3EDP A;  3BR5 A;  3G1L A;  2W7N A;  1AKH A;  3V7S A;  3ELK A;  2KP6 A;  5DD4 A;  3AL0 C;  4ZC3 A;  1W4M A;  1LFB A;  2VN2 A;  4LK1 F;  3OYD A;  1QNT A;  3T8T A;  3OV8 A;  2GXG A;  3W2W A;  3OS1 A;  5JI6 A;  2E5Z A;  4YEL A;  2GBY A;  1DPU A;  4LLN A;  3HOY J;  5CKT A;  2DI3 A;  3CCJ I;  2DA5 A;  2LY2 A;  2FQ3 A;  5AIP A;  4L0Y B;  3Q0W A;  4XK4 A;  4HX4 A;  2LD5 A;  4L0Z B;  2Y69 H;  4M71 A;  1X1D A;  1LDK B;  3JRC A;  1T08 B;  5FD6 A;  4BXU A;  4MEX F;  4JX4 A;  4LIV A;  3DKW A;  3HSR A;  2CQK A;  2V1X A;  3VYR B;  2V9P A;  4Y33 A;  4BNC A;  2JSC A;  2WAF A;  3G6E I;  3K0L A;  5JLX A;  3LAP A;  2G7U A;  1FT9 A;  2ISZ A;  1MBK A;  4IHS A;  2VKH A;  1VF9 A;  3AG1 H;  3O8G A;  3CMA I;  3ESW B;  3EUH A;  2LF8 A;  2IEK A;  4IRG A;  3HG9 A;  5FKL A;  3JRF A;  1JKR C;  4BEH B;  4CYC A;  3MWM A;  4XKB A;  5ICF A;  2ZBK A;  2DJN A;  4OWR B;  3A02 A;  2GIV A;  2HTJ A;  3O3K A;  2V7F A;  1VQ4 I;  3FM5 A;  2DO7 A;  3T5X A;  2XSD C;  3V8J A;  4ZYD A;  1O57 A;  2CW0 F;  3HHH A;  4O6J A;  4DBQ A;  2DMP A;  1Y8Q B;  4RDU A;  2R7W A;  4UNO A;  3BY6 A;  2EB7 A;  1X4P A;  2ISY A;  2RVC A;  3VB2 A;  3DLL F;  4OOI A;  2IS6 A;  3JRH A;  2DAO A;  1IXS B;  3PFI A;  3M7G A;  1YYV A;  5D8L B;  4PZJ A;  3OOU A;  1PP7 U;  2FD5 A;  1E3H A;  1BOB A;  4CGZ A;  4P55 A;  3KP2 A;  3GLL A;  2QQ8 A;  2VC1 A;  1Y8R B;  2ETH A;  1LEB A;  1Z3X A;  1YX3 A;  1MNM C;  3CC2 I;  4Y13 A;  1R23 A;  3JRE A;  4F55 A;  4HQE A;  3A01 B;  3QRF F;  3HOU J;  2M8G X;  4Y52 J;  5JR3 A;  2DK8 A;  4RAG A;  4I0B A;  4LJZ F;  3R4K A;  5HS8 A;  2CUF A;  4BDZ A;  2D2W A;  2K7L A;  4LB5 A;  4WXC A;  3HIF A;  3SXY A;  3CCM I;  3BR3 A;  1TBX A;  2BVM A;  4XM3 A;  3JRA A;  1VQM I;  2R7R A;  3I5U A;  3P9C A;  1HCR A;  3H0D A;  2BW3 B;  2PJP A;  5A2Q K;  1WH5 A;  2ZXW H;  1W5T A;  1Y6I A;  5EZH A;  2RC4 A;  5C3E J;  2ACJ A;  1HA8 A;  1MKM A;  3F21 A;  5TRD A;  3OYA A;  1R5G A;  3SYT A;  4UUT A;  3V8L A;  3S2D J;  2E36 A;  1H9T A;  3RZO J;  1O3Q A;  1OCP A;  1K4T A;  4D5F A;  3MZH A;  2LNB A;  5BPI A;  3GTM J;  5IYC J;  5D6F A;  3M4O J;  3I4N J;  1FC3 A;  2ADU A;  4LGW A;  1H9G A;  3HUG A;  2VC0 A;  2L3D A;  2EIN H;  1HDD C;  1D0Z A;  4XLP F;  3OYM A;  2M3A A;  3PO3 J;  1LPQ A;  1QZZ A;  3HHG A;  5BOX A;  1XGN A;  2VKE A;  5M5X J;  2BEO A;  4UV9 A;  3S2W A;  2FJ1 A;  3CCV I;  1QBJ A;  3LA3 A;  2R5Y A;  2DOA A;  1U8R A;  3LL7 A;  2GLO A;  4BQN A;  2V6C A;  2OQG A;  4NQW A;  1USS A;  2W85 A;  2XAQ A;  2JQ7 A;  2O03 A;  2Y0S A;  3CP2 A;  4QPO A;  3PL8 A;  2GZW A;  2Y31 A;  5DM6 F;  3LQQ A;  5AON A;  2IA0 A;  1PVE A;  3HKZ A;  2OUM A;  1HKQ A;  3HB9 A;  3WHC A;  2DYR H;  4W97 A;  1HKT A;  1YTY A;  1W7P B;  3GTP J;  4EJT A;  1K79 A;  3PNY A;  1IG7 A;  3HPG A;  1NG7 A;  1I6X A;  5BQT A;  2F5F A;  4C2M J;  1ENH A;  3H5N A;  3RJP A;  4H0E A;  1YIT I;  3A1Y A;  2PMH A;  1G3S A;  1GXQ A;  3S93 A;  3WGG A;  4H4K C;  2IPQ X;  3F0C A;  4ZZD A;  1D1C A;  3LSM A;  2M7B A;  2FX0 A;  5ERI A;  2L7M P;  3QOD A;  1OCR H;  4ENK A;  4HOB A;  1WJ5 A;  1F36 A;  5KVR A;  4EJU A;  2GQQ A;  1Z1D A;  4II3 A;  3SFI A;  1WFX A;  2M5W A;  3LSK A;  3B73 A;  2LH9 A;  2VXD A;  4JQF A;  1VQ8 I;  3ZN0 A;  3IRR A;  1FLI A;  4XLF A;  4E6K G;  2P4W A;  2L7K A;  4G7Z F;  2CGP A;  2FNA A;  1AKH B;  2RGV A;  2PBI A;  3FXQ A;  2UWM A;  5JVG F;  3S3M A;  1WCM J;  5M5W J;  2BY1 A;  5FLX Z;  4BYY A;  2DA1 A;  2P81 A;  3HKZ N;  1Z67 A;  3CC4 I;  4M6Y A;  3E6M A;  2IXS A;  3FXL A;  2Z3Y A;  3LWF A;  4GO1 A;  1CQT A;  4GCV A;  1WVR A;  5EG0 A;  1IRF A;  2G9W A;  1GUU A;  4FTH A;  3BQZ A;  4AYB N;  3C3W A;  3TL4 X;  5GAG J;  1R49 A;  5EF6 A;  3RQI A;  4FX4 A;  3KPH A;  1FSE A;  3LQR A;  1VQN I;  3KE2 A;  4N0B A;  3BCA A;  4A3G J;  3BJO A;  2AO9 A;  1QZY A;  1AWC A;  4BQA A;  3CDH A;  2DTR A;  5BMZ A;  5DCM A;  3ZCO A;  2K4J A;  2DU9 A;  3WG9 A;  3F72 A;  1KYW A;  1HST A;  3C18 A;  1I1S A;  1XD7 A;  4LD5 A;  4G94 A;  3AFH A;  4B43 A;  2O9L A;  4CH7 A;  1ZRC A;  4UB8 C;  2CH0 A;  2CJJ A;  3BT9 A;  1OQY A;  4M3D A;  2NVT J;  3BCB A;  4M6X A;  1BR2 A;  4U87 A;  3QOE A;  2H27 A;  4M9X A;  2N8G A;  2R7S A;  3OYB A;  2KL4 A;  1QQI A;  1QU3 A;  4V2G A;  2ZCW A;  1KQ0 A;  1GT0 C;  1Z9C A;  2OU2 A;  4RGS A;  3FF5 A;  2Q2E A;  3ZMZ A;  1X58 A;  2E34 A;  4PFO A;  5LEJ A;  5C44 J;  1L3L A;  5B66 C;  3QQA A;  2IJL A;  1X2M A;  3CD6 I;  3WGI A;  4C3J J;  1WJC A;  1R4N B;  3GUD A;  2E7X A;  2VIX A;  4EQQ A;  1BL0 A;  2HGC A;  1ZYR F;  2OBP A;  3GX4 X;  1XMK A;  1G8X A;  4Y7N J;  5FRM A;  1W5C C;  2XKO A;  1LVA A;  5FLV A;  4G8X A;  3BTJ A;  2QWW A;  3DQV C;  1ETO A;  4MTD A;  3CJT B;  2ZXI A;  2OZU A;  1T8I A;  3HTS B;  4LLL A;  1WJB A;  1ZRE A;  2HQA A;  3R0A A;  1MZB A;  5E1W A;  1ZLJ A;  3R6S A;  3S1M J;  3J7Z I;  2IRF G;  1M1E B;  4HLX A;  3OWT A;  3OYN A;  2R7Z J;  2HS5 A;  1FIP A;  2KDZ A;  1IO2 A;  2ZME C;  4NC8 A;  4HV6 A;  3VPR A;  4IHW A;  2V1D A;  1MMG A;  4YG2 F;  2R7V A;  4HSR A;  2K5C A;  4S04 A;  2A6T A;  3CUQ A;  5DV5 A;  3V7R A;  1B9N A;  1X2N A;  2IA2 A;  1F9N A;  5LGU A;  2KRC A;  2BXY A;  4XRS A;  1FWZ A;  4F93 B;  4KN4 X;  4FHT A;  2CQN A;  3JTG A;  1T38 A;  1MMD A;  4QSH A;  2WAQ N;  3HOV J;  1MJ9 A;  1A04 A;  2UUZ A;  2RQQ A;  4PJL A;  3K69 A;  2NNY A;  3RI4 A;  3K4K A;  1SFO J;  5E17 F;  3GTG J;  2HYG D;  2E71 A;  4JK1 X;  3HRU A;  3E1S A;  3QYB A;  1G59 A;  1P2F A;  2EV6 A;  2W4S A;  2ZNY A;  1HLV A;  2D1V A;  3R60 A;  3FDY A;  1JGS A;  3BTL A;  3F8N A;  5HLI A;  1HW2 A;  2A05 A;  3ASO H;  4KN7 X;  3K70 D;  3DPU A;  3D5R C;  2VLA A;  2DYS H;  2MGQ A;  2VJI A;  2CUZ A;  4L9J A;  2AXT C;  3PSF A;  5DD8 A;  2NNN A;  1YX5 A;  3OL4 A;  3DBR B;  4JP0 A;  2XPW A;  2EFW A;  4IKF A;  4P9U A;  3BG9 A;  1VQK I;  1ETK A;  2OCC H;  4YFX F;  1EH7 A;  2FML A;  1I3Q J;  4BJT A;  1ETY A;  2FF4 A;  3DCF A;  2FA5 A;  2ICW G;  4D5C A;  3OSG A;  2PJR A;  2OC6 A;  3DWL E;  2Z99 A;  4XN3 A;  2YX7 A;  3MZ8 A;  4EGZ A;  3WOD F;  4NQW B;  4X6A J;  2A5Y B;  1KYZ A;  3FKJ A;  4RGR A;  2VE9 A;  2JPB A;  2DQL A;  3VSL A;  4AU7 A;  4BHB A;  2VL8 A;  2M45 A;  4AWX B;  1N75 A;  1WJA A;  4G6D A;  4PK4 A;  3I56 I;  1T98 A;  1P4A A;  3TO9 A;  2JK3 A;  5D5W B;  4L9T A;  4IOA F;  4OAY A;  3OIP A;  4HYE A;  4FE4 A;  4LLG F;  5F64 A;  1LB2 A;  1WGX A;  1NG6 A;  1SMT A;  4QTR A;  5D4R A;  2QEN A;  3TMO A;  1IDZ A;  3FMR A;  2DT5 A;  2O7O A;  2FBK A;  2XKP A;  3E7L A;  1U0J A;  5LFA A;  2XRN A;  3KLN A;  4LK0 F;  2P6S A;  3ZMV A;  3ECO A;  4N9H A;  1VQ7 I;  1MJA A;  2V1N A;  3DEE A;  2E1N A;  3GWZ A;  1A6Q A;  1W7P D;  4A3M J;  3I58 A;  2M0M A;  2XAH A;  3S14 J;  3FXM A;  5KK1 A;  1B4A A;  1U78 A;  3H3V K;  1R5I D;  1K6Y A;  4E7K A;  4S0H B;  4A0Z A;  2OTJ I;  1SAU A;  1DP3 A;  3DKX A;  4LIU A;  3ULQ B;  1HXD A;  1OKR A;  3WTS C;  1WI9 A;  4GGG A;  3DP7 A;  2WWY A;  3GTL J;  1BW6 A;  2GA2 A;  1OFC X;  3JSP A;  5IP7 J;  5K5O A;  2F48 A;  1GV2 A;  2WAE A;  4DYQ A;  3BP8 A;  4HQM A;  2RAE A;  5E20 A;  2OD5 A;  1HBX G;  1O7L A;  2F5V A;  1U2W A;  2HVS A;  4I01 A;  5LBQ A;  1ZQ3 P;  2PMU A;  2D5V A;  1IUY A;  5DCM B;  2FRH A;  2ZSI B;  1B9M A;  4MQ9 F;  2R7U A;  4BDY A;  5J8C A;  1UCR A;  2TCT A;  1V55 H;  4PJJ A;  4XSZ F;  3OIO A;  4HDV A;  2VBZ A;  2Y2Z A;  3BWG A;  4DW6 A;  2KQR A;  2BXZ A;  4G12 A;  4P1W A;  5IP9 J;  3EUA A;  5HOO A;  1YW7 A;  5KCM A;  1J9I A;  3H35 A;  2XC7 A;  3ZP5 A;  3W2A A;  2EIL H;  3A01 A;  1GXP A;  1CF7 A;  3BJ6 A;  2HEO A;  3TBI A;  2X4H A;  1Y1W J;  4RMN A;  2CUE A;  2IVM A;  4J01 A;  1FYK A;  2DBB A;  3RZD J;  5KAI C;  1W5S A;  2OTL I;  2BY2 A;  2XB5 A;  2J5O A;  4C2U A;  4A3J J;  2MD5 A;  2XAF A;  3B02 A;  2Z1D A;  4I2O A;  3TDZ C;  2HVR A;  1Z6T A;  3GFL A;  1JHH A;  3J7A O;  3SEZ A;  2VT2 A;  2XB0 X;  4L5E A;  3HC7 A; 
#chains in the Genus database with same CATH homology
 1VF9 A;  3O8G A;  4C3I J;  2EQR A;  1QRY A;  2IEK A;  2B63 J;  2JJ7 A;  1T56 A;  5FKL A;  4C3H J;  1JTX A;  3JRF A;  3BTC A;  3HM5 A;  1JKR C;  4CYC A;  4BBS J;  1S7E A;  1TWA J;  5M5Y J;  2DJN A;  2DA6 A;  3SJM A;  1HF0 A;  3A02 A;  1QVT A;  2XSD C;  1W0U A;  2LVS A;  2DA2 A;  1AU7 A;  2DMP A;  4M3F A;  4RDU A;  3S17 J;  4JYK A;  2M34 A;  2K9S A;  1ZK8 A;  2ECB A;  4M3G A;  4FCY A;  1TC3 C;  3S1Q J;  3JRH A;  3WHB A;  2KT0 A;  1Y1V J;  4B4C A;  3OOU A;  1A6I A;  2E2H J;  2FD5 A;  5DS9 A;  1EF4 A;  4V2F A;  1U9N A;  5M3F J;  1E3O C;  5K7H A;  1IV6 A;  1PUF B;  1IGN A;  3RKQ A;  3S16 J;  1UMQ A;  4IHY A;  1JJ8 C;  1MNM C;  3IH4 A;  2OF7 A;  1GV5 A;  3JRE A;  3A01 B;  1JGG A;  3HOU J;  1GDT A;  2M8G X;  4Y52 J;  1SAN A;  5F04 A;  1B8I A;  4XIC A;  1I6H J;  2HOA A;  2DMN A;  2ID3 A;  4RBO A;  1WI3 A;  2I10 A;  1NTC A;  2CUF A;  1MBJ A;  1FTZ A;  2M2E A;  5BNG A;  3DEW A;  5J1Y A;  3BR3 A;  2X6O A;  2EZI A;  3MVP A;  3JRA A;  4A3B J;  1ZKG A;  4BXX J;  1HCR A;  4J19 A;  1NK3 P;  1WH5 A;  1BW5 A;  5EZH A;  5F1J A;  5C3E J;  4ABZ A;  3MKL A;  4IEJ A;  5F0C A;  4UUT A;  2X48 A;  2NVQ J;  4CYC B;  3S2D J;  3RZO J;  1OCP A;  4D5F A;  2EZH A;  1VFC A;  2R92 J;  4A3D J;  3BQY A;  5EGO A;  1WPK A;  1Z0X A;  2HDD A;  4B1R A;  3GTM J;  5IYC J;  3M4O J;  3O8H A;  4HNV A;  3I4N J;  3Q0U A;  4BY7 J;  1HDD C;  2CU7 A;  1FTT A;  2ME6 A;  3D1N I;  3BR2 A;  5FJ8 J;  3PO3 J;  1GVD A;  2VKE A;  2H1K A;  5IPA A;  5M5X J;  2Y9Z A;  1FEX A;  4MFE A;  5K7Z A;  5C4X J;  3IH3 A;  2FJ1 A;  2R5Y A;  3B6A A;  1IJW C;  2GLO A;  5C4J J;  1BA5 A;  1HDP A;  2QF7 A;  4A3I J;  4NDL A;  2W48 A;  2EH3 A;  1K83 J;  3ZQL A;  2Y31 A;  3BG5 A;  2JA5 J;  1TWG J;  3HB9 A;  1POG A;  1ITY A;  4DZJ A;  3HOW J;  2NS8 A;  3WHC A;  4W97 A;  3GTP J;  3NAR A;  3BR1 A;  5IYB J;  1D5Y A;  2VUM J;  1IG7 A;  2E1O A;  5E3L A;  3I4M J;  4C2M J;  3S1R J;  1ENH A;  1ETQ A;  3HOZ J;  1K61 A;  5E3N A;  1ORK A;  2COB A;  5GPA A;  1ZTR A;  3F0C A;  3S15 J;  2AHQ A;  2CRG A;  1JKP C;  3QPL A;  5J3L A;  2FX0 A;  2L7M P;  2R5Z A;  5FKK A;  1TWH J;  4BKX A;  1F36 A;  4EEF G;  3SFI A;  1F43 A;  5FLM J;  1LE8 B;  2NVX J;  2HXO A;  1NK2 P;  2MW8 A;  2Y30 A;  4M3B A;  1TWF J;  1AKH B;  4X1E A;  1IUF A;  1WCM J;  5M5W J;  2DA1 A;  2P81 A;  2YUS A;  3HKZ N;  2ID6 A;  5IOZ A;  2JWT A;  5IYD J;  3G1M A;  2R5Y B;  1CQT A;  2PMZ N;  2M9H A;  2DMT A;  3FIW A;  5IOY A;  5EG0 A;  3CMY A;  1YRN A;  1GUU A;  4FTH A;  3BQZ A;  4AYB N;  3CDL A;  1O4X A;  1MH3 A;  4A69 C;  5EF6 A;  3RQI A;  3HBL A;  4UUS A;  1DU0 A;  3ZQH A;  4A3G J;  1OJL A;  1B72 B;  2AO9 A;  3ZQG A;  1U8B A;  3BR6 A;  3K2A A;  2YU9 J;  3HDD A;  3K7A J;  3UKG A;  4FE7 A;  2M0C A;  2TRT A;  4D7N A;  4DYC A;  2NVY J;  3HGG A;  2O9L A;  3M3Y J;  2VPR A;  1HOM A;  2CJJ A;  3BT9 A;  1JT6 A;  2OPT A;  4M3D A;  3HGY A;  1Z77 A;  4BY1 J;  2NVT J;  2JN6 A;  3GBG A;  2N8G A;  3TP3 A;  5IP6 A;  4JX5 A;  2DMQ A;  4V2G A;  1RKW A;  1GT0 C;  3ZOB A;  1ZGW A;  3TP0 A;  1A5J A;  3JRI A;  2EZK A;  1X58 A;  2Y9Y A;  3LSJ A;  1R9T J;  5C44 J;  3QQA A;  1X2M A;  1JKQ C;  4M3E A;  4C3J J;  1BL0 A;  3IH2 A;  3QPS A;  4MIM A;  1DU6 A;  2G0E A;  5K7F A;  2LLK A;  3FK6 A;  2NS7 A;  2L0K A;  5E3M A;  4Y7N J;  2XGC A;  1IC8 A;  2LR8 A;  4XRS G;  3ZQI A;  5FLV A;  3BTJ A;  2ECC A;  3PM1 A;  4IHV A;  1ETO A;  2L7F P;  3GTQ J;  1UHS A;  3JRB A;  4A3K J;  2EBI A;  2DTZ A;  2IBD A;  1XG1 A;  2WV1 A;  1RES A;  5EG0 B;  3S1M J;  4A93 J;  1FIA A;  1JT0 A;  4UUS B;  1IDY A;  2R7Z J;  1JKO C;  1FIP A;  1MBG A;  5M3M J;  2KDZ A;  3VPR A;  4IHW A;  3A03 A;  1APL C;  5HOD A;  1B8I B;  3JRD A;  4MO7 A;  4DZP A;  2ELK A;  1MBH A;  1JTY A;  1OCT C;  3FK7 A;  5F0H A;  1X2N A;  3MN2 A;  1JUP A;  4XRS A;  3W6V A;  5J1U A;  4D7M A;  1RET A;  1XC5 A;  1H89 C;  2VKV A;  4QSH A;  4I76 A;  3LSP A;  4MLO A;  1ETW A;  2WAQ N;  4AC0 A;  2ME0 A;  3HOV J;  5J1R A;  2HOT A;  3G1O A;  2X9D A;  2ZB9 A;  5F08 A;  3H0G J;  1MH4 A;  3B6C A;  1SFO J;  3GTG J;  4A3L J;  5GP9 A;  2CQQ A;  2XRL A;  1HLV A;  3BTL A;  5EGO B;  3JRG A;  3JR9 A;  9ANT A;  2MGQ A;  3TW6 A;  2LKX A;  2EZL A;  2Y0S N;  4JP0 A;  2XPW A;  4A3C J;  1UG2 A;  2XGD A;  1FJL A;  3BG9 A;  1ETK A;  2H8R A;  2DA4 A;  1G2H A;  5DTD A;  2QCO A;  2VI6 A;  1I3Q J;  2R93 J;  4D5C A;  1ETY A;  3OSG A;  1JUS A;  3DCF A;  5FKM A;  2O8K A;  2JA6 J;  3Q3S A;  3LSR A;  3LNQ A;  2DMU A;  2E2J J;  3BTI A;  1MSF C;  4X6A J;  4BBR J;  1RPW A;  3BG3 A;  3GTK J;  2MG4 A;  1VND A;  1QPI A;  1LFU P;  5EDN A;  1MBE A;  4IHX A;  2LP0 A;  4MFD A;  1U9O A;  1MSE C;  2JA7 J;  2JK3 A;  3S1N J;  3SDG A;  4FE4 A;  5EZG A;  4W1U A;  1P7I A;  1WGX A;  2E2I J;  2HI3 A;  4QTR A;  1W0T A;  1H8A C;  3GTO J;  2LTP A;  1I50 J;  1IDZ A;  3Q0V A;  1RKT A;  1VI0 A;  2LFB A;  5FKN A;  3CCY A;  2O7O A;  1Q1V A;  3E7L A;  4A3F J;  2DA3 A;  2E19 A;  2DA7 A;  3NAU A;  2HYJ A;  2R5Z B;  3PO2 J;  2CQX A;  5JLW A;  3FKI J;  5EEA A;  3HEF A;  5FKO A;  1JUM A;  4A3M J;  4GFB A;  2XGE A;  4JX6 A;  3S14 J;  4M6V A;  5GPC A;  3BR0 A;  2LK2 A;  2LY9 A;  3GTJ J;  1U78 A;  3H3V K;  3FIS A;  2GM4 A;  3LSG A;  3HOX J;  4S0H B;  1H88 C;  3ZQC A;  2XPV A;  4I6Z A;  1ETX A;  2L9R A;  1BJZ A;  2WB1 N;  3TED A;  4LOC A;  2FQ4 A;  1ZR2 A;  2HXI A;  1JJ6 C;  3GTL J;  5F0F A;  1BW6 A;  4B3A A;  2HOS A;  1LE8 A;  1YRN B;  1OFC X;  4XID A;  3L1P A;  5IP7 J;  4DYQ A;  1GV2 A;  2RAE A;  1QVU A;  3BR5 A;  3G1L A;  1AHD P;  1AKH A;  1ZQ3 P;  2D5V A;  3IV5 A;  4XRM A;  2K9N A;  1ZR4 A;  2TCT A;  3TW7 A;  5E3O A;  3C2B A;  3CQZ J;  4QIW N;  3OIO A;  1LFB A;  2YS9 A;  2Y2Z A;  2IAI A;  4DW6 A;  2R0Q C;  1P7J A;  2HQ5 A;  2GBY A;  4G12 A;  5IP9 J;  1PUF A;  3HOY J;  2L7Z A;  4A3E J;  2DA5 A;  3ZQF A;  3OSF A;  1B72 A;  3Q0W A;  4XK4 A;  2LD5 A;  4FIS A;  2DN0 A;  2NOG A;  5F27 A;  3A01 A;  1MBF A;  2JMW A;  3JRC A;  4AUX A;  1Y1W J;  2CUE A;  2K9Q A;  4JX4 A;  3RZD J;  2JA8 J;  1XS9 A;  1IRZ A;  2XB5 A;  1ETV A;  1WH7 A;  3S2H J;  4A3J J;  3LOC A;  1RR7 A;  1T33 A;  5EYR A;  5JLX A;  2XPU A;  4DYR A;  2MSY A;  2XB0 X;  1TWC J;  1MBK A;  4L5E A;  2K40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...