1ETOA

The crystal structure of e. coli fis mutant r71l
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
87
Chain Sequence
DVLTVSTVDQVTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTLGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
total genus 29
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etoA00
1WGXA 4C2MJ 1IGNA 1TWFJ 1BA5A 2JA5J 3S1RJ 3JR9A 3H3VK 3IH2A 3MKLA 3FK6A 3MVPA 1DU0A 1AHDP 2JMWA 4BXXJ 2KDZA 1ENHA 1OCTC 5EDNA 2CUEA 1UG2A 5EG0B 1F36A 4G12A 2K40A 4JP0A 4B4CA 1ETQA 2Y30A 2DA6A 3G1LA 4A3IJ 4BY1J 1IRZA 2R5YA 2CQQA 1CQTA 4FCYA 3HB9A 1MH4A 3IH3A 3O8GA 1GT0C 5IYBJ 2HOTA 1NTCA 3CMYA 3VPRA 1MSEC 2ID6A 2W48A 2MW8A 2O8KA 4M3DA 1Y1VJ 3BR5A 2ZB9A 2WAQN 1QVUA 2DA2A 2NOGA 2YUSA 3G1MA 3MN2A 4A93J 4Y52J 2XRLA 3ZQFA 5DS9A 4D5FA 1P7JA 4C3JJ 3BQZA 4C3IJ 1JJ8C 1I3QJ 4XIDA 5K7HA 3BG3A 3HOXJ 1HDDC 2LFBA 1HLVA 3LSRA 5EGOB 3M3YJ 3C2BA 3GTMJ 3D1NI 5GP9A 2HDDA 1SANA 5JLWA 4L5EA 2ID3A 5K7FA 3GTQJ 3I4NJ 1GUUA 3Q0WA 2DMPA 5F0CA 5FJ8J 3BTCA 3S1MJ 2M8GX 4QTRA 2WV1A 2K9SA 5M5WJ 1OFCX 3FISA 3IV5A 5F1JA 3JRDA 1B8IB 1JJ6C 1YRNB 1ZGWA 3UKGA 2FX0A 2FD5A 4CYCB 5FLMJ 2JN6A 3S2DJ 2HOSA 2JA6J 5EZGA 2JK3A 1WI3A 1I6HJ 1F43A 3WHBA 3JRIA 2Y9ZA 4A3GJ 4XRMA 2N8GA 1MBHA 3A03A 4BBSJ 2R93J 1EF4A 1Z0XA 2JJ7A 1FJLA 4A3DJ 3RKQA 2R92J 3Q0VA 2G0EA 3HOWJ 3GBGA 5IOYA 3BQYA 3GTPJ 2RAEA 2CQXA 4FE4A 2ECBA 4JYKA 3BR3A 2VKVA 4S0HB 1IJWC 1FTTA 1TWAJ 1MBEA 1HDPA 1HOMA 5EF6A 2EH3A 1VNDA 1RR7A 3OSFA 2Y0SN 3L1PA 1SFOJ 2XPWA 3LOCA 4DYCA 3ZQCA 5FKOA 1X58A 3IH4A 1U78A 3HOYJ 4MLOA 2O7OA 1U9NA 1IUFA 2Y9YA 4XICA 2LVSA 5FKNA 1HF0A 1RKTA 2YU9J 5M5YJ 5C4JJ 3B6CA 2DA5A 2D5VA 3HGGA 4MIMA 5M3FJ 2MG4A 1ETVA 2XSDC 1W0TA 4D5CA 4C3HJ 5J1YA 1YRNA 1AKHA 1B8IA 2VI6A 1XS9A 3BR1A 1RKWA 1ZKGA 2OPTA 1A6IA 4LOCA 4Y7NJ 2MSYA 5IYDJ 1MH3A 1H88C 1BW6A 1MSFC 1WPKA 4A3EJ 2ME0A 1ETKA 2DA3A 2NS7A 2AO9A 1XC5A 2XGEA 5F08A 4D7NA 3A01B 2TRTA 5IPAA 1BJZA 3DCFA 2LK2A 3S17J 4FE7A 2NVYJ 3K7AJ 2JA8J 4A3CJ 2E1OA 2R5YB 1QVTA 1ZR4A 2CU7A 2Y2ZA 1JUPA 2IAIA 3GTOJ 2HQ5A 2E2IJ 2VUMJ 1ZK8A 1TWHJ 3ZQIA 3PO2J 2DMTA 5E3NA 2EZHA 2XB5A 4FTHA 1WH7A 4DZJA 4X1EA 3HOZJ 4UUSA 1PUFB 1Y1WJ 4V2GA 5C4XJ 2JWTA 2GM4A 4AUXA 5M5XJ 4IHYA 5IP6A 3BR0A 4A3FJ 1Q1VA 3S2HJ 4RBOA 2NVTJ 3H0GJ 3CQZJ 2EBIA 4A3BJ 2FQ4A 4M3GA 1RETA 1DU6A 3JRBA 2HXIA 4A69C 5HODA 2VPRA 2LY9A 3DEWA 3Q0UA 1LE8A 1QPIA 1VFCA 4QIWN 5GPCA 1VI0A 5M3MJ 3SFIA 4JX4A 3BTIA 1O4XA 2E19A 3BR2A 1AU7A 2EZLA 3GTGJ 1A5JA 5EZHA 5IYCJ 1OCPA 1ETYA 1E3OC 2TCTA 5EEAA 1JKQC 2L7ZA 4IEJA 2AHQA 3Q3SA 5C44J 1B72B 3RZDJ 4XRSG 2CJJA 2DMNA 2K9QA 5E3MA 2M34A 1U9OA 4M3EA 3ZQLA 5FKLA 1ZQ3P 4GFBA 4A3JJ 4UUTA 2K9NA 3G1OA 3ZQGA 1JKRC 2LTPA 3HM5A 2LLKA 1VF9A 1NK2P 2X48A 2GLOA 3W6VA 1GVDA 4DW6A 3JRAA 1JKPC 1MBJA 1JTXA 3BTLA 3B6AA 2M0CA 3LSGA 5K7ZA 3HOVJ 4B3AA 1BL0A 3TW6A 2ELKA 4MO7A 1I50J 1MNMC 4MFEA 1RPWA 2NVXJ 4A3LJ 3CDLA 2JA7J 4I6ZA 3HBLA 1NK3P 5F27A 2O9LA 1MBFA 4V2FA 1D5YA 1AKHB 1IG7A 2VKEA 1RESA 3TP0A 1WH5A 2DN0A 4CYCA 3JRGA 1LE8B 2PMZN 1ITYA 3LNQA 2I10A 4A3KJ 1GDTA 2M2EA 2CRGA 1JKOC 3M4OJ 1ZTRA 1X2MA 4AC0A 1JTYA 1JUMA 3HEFA 1IC8A 3HGYA 1B72A 3PM1A 3BTJA 3FK7A 4DYRA 2XPVA 2L0KA 5EG0A 1JT6A 2P81A 1UHSA 3BG5A 2FJ1A 2DJNA 1QRYA 2MGQA 4EEFG 3O8HA 1XG1A 2CUFA 5J3LA 5DTDA 3E7LA 3RZOJ 3BG9A 5J1RA 4W1UA 5IP9J 2R0QC 2DA4A 4I76A 1H8AC 4DYQA 3NAUA 3OSGA 2WB1N 2L7FP 3GTLJ 3HOUJ 1Z77A 2QCOA 2GBYA 3LSPA 4M3BA 2COBA 1IDYA 5FKMA 3NARA 2ECCA 2XGDA 4BBRJ 4ABZA 1G2HA 2LP0A 1FEXA 3S16J 4XRSA 3BT9A 1K61A 2X9DA 3F0CA 1JT0A 2R5ZA 1ETOA 1GV2A 3QPLA 1GV5A 1T33A 4NDLA 1H89C 5E3OA 3GTKJ 5E3LA 2HOAA 3HDDA 2L9RA 2NS8A 3K2AA 3JRCA 5GPAA 1MBGA 1IDZA 4D7MA 3I4MJ 4FISA 5C3EJ 3TW7A 4BKXA 1U8BA 1R9TJ 2DTZA 3A02A 3QPSA 4M6VA 2E2HJ 2OF7A 1S7EA 5FKKA 3JRFA 1ETWA 3TP3A 4RDUA 1BW5A 3OOUA 2KT0A 3CCYA 5JLXA 1ORKA 2XGCA 9ANTA 3PO3J 1K83J 2IEKA 3S15J 2E2JJ 2B63J 3ZQHA 3SJMA 3QQAA 2HI3A 2X6OA 4A3MJ 1P7IA 3BR6A 1LFBA 1FTZA 4W97A 4AYBN 3A01A 5FLVA 3WHCA 2IBDA 2DMUA 2XPUA 5EYRA 3LSJA 4DZPA 2H8RA 3S1NJ 4IHVA 3GTJJ 2Y31A 2M9HA 1APLC 1TWCJ 3HKZN 4XK4A 1JGGA 4B1RA 4UUSB 1PUFA 1JUSA 2L7MP 1ZR2A 2XB0X 2DA7A 2ME6A 1HCRA 1POGA 2YS9A 2EZIA 4X6AJ 4QSHA 5IP7J 2DA1A 2DMQA 2EZKA 4HNVA 1OJLA 1LFUP 4IHXA 3S14J 2NVQJ 5IOZA 1MBKA 2HYJA 5F0HA 1TC3C 4JX5A 1WCMJ 3JRHA 3JREA 1FIPA 1X2NA 3FKIJ 1FIAA 3S1QJ 1T56A 2LR8A 5F04A 1TWGJ 3RQIA 3ZOBA 4IHWA 1UMQA 2LKXA 2H1KA 2LD5A 1IV6A 4MFDA 2HXOA 2R5ZB 4J19A 5EGOA 3OIOA 3SDGA 2R7ZJ 5BNGA 1W0UA 5J1UA 3TEDA 2QF7A 4BY7J 5F0FA 2EQRA 3FIWA 1ETXA 4JX6A 4M3FA
chains in the Genus database with same CATH superfamily
2UV1A 1TWFJ 1OCCH 2JA5J 3S1RJ 1OLTA 4X0GA 3IH2A 4KIBA 4S04A 4P1WA 5J8FA 4ENKA 4AD9A 1AHDP 2JMWA 2K7LA 3WTSC 4G6DA 4ETSA 1B9MA 5EG0B 1UG2A 4FHTA 2QQAA 4Q5SF 4G12A 2FUG2 3I4PA 3G1LA 1RNLA 3P5JA 3ZR8X 4A3IJ 4RA2A 2E5ZA 3J7YJ 2V9VA 3QYFA 4FCYA 1X19A 1LKXA 4LB6B 3JW4A 4BU2A 3U1KA 4HBLA 1GT0C 1NTCA 1STZA 3CESA 4M73A 1JE8A 3GF2A 1VQ9I 1X1CA 4XM3A 3A0BC 1HQCA 4E7LA 2MW8A 4FX4A 2XDVA 1O7LA 3H9QA 2ZJPF 1J0RA 2P5LC 3FKJA 2L2OA 3E5QA 2WAQN 2QLZA 3CCRI 4Y52J 3HJEA 1GXQA 2VE9A 2VIXA 2DFFA 1EH6A 2W25A 3ZQFA 3OYCA 2LF8A 3BQZA 5BMZA 3I53A 3HPGA 1WJEA 2KPMA 2XAFA 4U88A 5DM7F 3HG9A 5JHUA 3L00A 4I01A 5DUKA 3ZRGA 3E5UA 2HDWA 2QQ9A 3C2BA 3GTMJ 4AVZA 4S05A 2J5PA 2WC2A 3DTKA 4UXNA 3K69A 2KJBA 5KAIC 4I2OA 2M45A 1ACIA 3Q0WA 1RRJA 2ESHA 1D8JA 2GZWA 3F23A 1V4RA 1RUNA 3CLOA 1E3PA 4R8HA 5FJ8J 4HZFA 5JHFA 2K9SA 3AG2H 2FXAA 2VKDA 5HS9A 1OFCX 4K2EA 3JRDA 1B8IB 1JJ6C 1ZGWA 1YW7A 2PMZA 3LSKA 4WXCA 5GTIC 2ZXIA 3JSOA 2VQGA 2LY2A 2F2EA 2QQBA 4XMYA 2R4GA 2VOPA 2JK3A 2RKHA 1ZHFA 2JT1A 3EDPA 3JRIA 1WJCA 4CZCA 2XASA 4RB3C 1GXPA 5LGNA 2PX9A 5HLGA 1DQUA 1TBXA 3ZMUA 4YIRX 1FJLA 2HOEA 2G0EA 2A6EF 2XC7A 1S5LC 2X1EA 1KA8A 1BR2A 3G71I 4CCKA 3GTPJ 1YW8A 4XLHA 3K4CA 4BE0A 3H92A 3S3MA 2BY3A 5B3SH 3IRRA 3FHZA 2VKVA 3FXQA 5DCMA 5D4SA 1FTTA 5EF6A 1R5ID 1BOAA 1F9NA 3ABTA 2ZNZA 1MMNA 1VNDA 4IVNA 2EV5A 3L1PA 2XPWA 2VODA 2L9NA 3NWSA 2EFPA 5FKOA 1X58A 2LRDA 3O2PE 5LEJA 1U78A 3HOYJ 3BC8A 2O7OA 1DPUA 1U9NA 5CKTA 5FKNA 2CW7A 1P4WA 2KJCA 3BG7A 4XLAA 1OCRH 2M7BA 1ZRFA 2BYVE 3KCCA 3OR1C 4ZZLA 2GOMA 3HGGA 2QKMB 4IOAF 1HSJA 2V9PA 4RB1A 1U5TC 2OC6A 1ETVA 2ZJQF 3VDXA 3EETA 2EIMH 2FBHA 2GOXB 4WF2A 3G6EI 2I5UA 2LYCA 3OYIA 3KYLA 4PCQA 3U2RA 1ZKGA 4HW0A 2OPTA 1CF7A 2BVLA 5B1BH 3BROA 4MGRA 1WPKA 4A3EJ 2ME0A 3KZIC 1ETKA 2KKOA 2NS7A 1VQ5I 1O7FA 1P4AA 5CQGA 3W2VA 2IS2A 2UWMA 3CLQA 2JVGA 1I1SA 2DK5A 2VPLA 2CFOA 1Z6TA 2MLGA 1QHHD 2LK2A 3W2AA 3I54A 2NVYJ 3K7AJ 4OAZA 3VOEA 2KRHA 2Y2ZA 2DYSH 3GTOJ 1YOVB 2E2IJ 1X1DA 3BCBA 2DBBA 2CQKA 1TQIA 2EZHA 1VQKI 3PUFA 5L3CA 3CCJI 1IRXA 1K79A 4NC8A 2LH9A 2OZ6A 5C4XJ 2A6TA 1K78A 2GM4A 4CCJA 1VQMI 2EB7A 3BR0A 5GAGJ 4BJ5C 2R7FA 3S2HJ 4RBOA 1LFPA 1WJBA 3H0GJ 4IHTA 5CJ9A 4A3BJ 3IKVA 4H4KC 4IRIA 3DQVC 4GO1A 4BEHA 3I0TA 1AA7A 2VT3A 5CYVA 3QWLA 1IXSB 2HXIA 4LJZF 2E7WA 2ISYA 4BYYA 5J40A 4F3QA 4ZTFA 1N77A 1P4XA 4B09A 3AKZA 2M7AA 4JX4A 1O4XA 4MQ9F 3BR2A 2DFHA 2KZGA 1OCPA 4TV7A 4HA8A 2ZSIB 3PNTA 2XAJA 5LRSA 3GO5A 2O8XA 1B72B 4XRSG 2CJJA 4A0ZA 2DU9A 3TBIA 3N05A 2HQAA 4XLNF 5E3MA 1MMDA 1WJ5A 4G6QA 2M34A 2CV1A 1BI0A 3S3NA 4XOTA 1XGNA 3H9GA 5FKLA 5ICGA 2WA0A 3BZ6A 2K9NA 1FYLA 4BHBA 3IRQA 2WAQA 2EV0A 4E7HA 4XKWA 5FD6A 1Z7UA 4GYGA 2LTPA 3BPVA 3HM5A 3WG7H 2Y69H 1VF9A 3Q5FA 2P5KA 4HX4A 2OTLI 3OYDA 4AM3A 1J2XA 1HW5A 2EFQA 5JR3A 3JRAA 2YPRA 1X3ZB 1WJFA 3B6AA 2M0CA 4L0ZB 4BQNA 3GXOA 3F72A 5K7ZA 1O3QA 4WX9A 4XLCA 4QPQA 2M3AA 3SZPA 4LD5A 4B44A 1I50J 2EWNA 3BY6A 2RN7A 2HYFA 4U7DA 4KT5C 4A3LJ 3CDLA 2V4JC 2Q2EA 2JA7J 1SMTA 5ERIA 3ROUA 1XX5A 3FXRA 3VYSB 2RREA 2DFIA 3M07A 3A1YA 3CJTB 4NB5A 1YX3A 1YG2A 1WH5A 4KA4A 2V6EA 2PMZN 3F8NA 1EH7A 3I55I 2M2EA 2NAZA 2LMDA 4IJAA 2ZO4A 2OQRA 4YEJA 2LC2A 2HFHA 2QYOA 2HGCA 2DTRA 2P0WA 3HUGA 1T98A 3GX4X 2QM3A 3BTJA 1A36A 3FK7A 2BY0A 3OV8A 4N4OB 4QLCU 5H2FC 1HW2A 2XPVA 1JT6A 1LQ1A 4A0XA 3KZZA 1UHSA 2P6TA 2M4KA 3HSEA 3CO6C 1Y0NA 2VN2A 4G7HF 1MNEA 1TTYA 2JSPA 2QSHX 2O5RA 2HKXA 1YYVA 2WAEA 3LFKA 4W1UA 2V1DA 2R0QC 3E6CC 2DA4A 5D5XB 2LNBA 4PFOA 3T0YA 5A2QZ 2R7RA 1B59A 3JSPA 4DYQA 4YIFA 2WB1N 2KLOA 2XAGA 1KU2A 3G3ZA 4MHGA 4LFUA 4CZZA 1OCOH 1XDUA 5KAFC 4M3BA 5H6QA 2K9MA 1B1BA 3VB2A 5LD2C 1I5ZA 1UCRA 1XN7A 2A69F 4Q47A 2LP0A 4GYIA 1U5TB 2QENA 4XRSA 4EVIA 1D0ZA 3CP2A 4M74A 1K61A 4G94A 2XVCA 2AQFA 3LA7A 3OMYA 1S7OA 4YFKF 2VE8A 3QPLA 5ED4A 1H89C 3WTZA 2Q0OA 3V8KA 5J4YA 1W1WE 2HOAA 2BGCA 1I1GA 3F6OA 1PP8F 3TW7A 1FP2A 4BKXA 2HZDA 2LREA 1HKQA 1ZRDA 1Z9CA 2LBFB 1D5VA 2CMPA 2DTZA 3A02A 2ADUA 4PJMA 4E4HA 4PDKA 3OYNA 4HNTA 4ITVA 5E17F 4OOIA 4ZDPA 5BPIA 3TDUC 2LY1A 2MD5A 1U3EM 2DPDA 4YG2F 3L2WA 1ZG3A 5L3EA 1MDMB 3FDYA 2F5FA 2IEKA 4KN7X 2B63J 3ZQHA 4A5NA 2HI3A 2VKHA 1S29A 2FBIA 3WGIA 3FXKA 2F4OB 3V7SA 1LFBA 1LNWA 5LRRA 1FTZA 1ZYRF 3SFZA 2O61A 3L2QA 2VJ5A 3A01A 2OU2A 3FX3A 2DMUA 5EYRA 4DZPA 2CW0F 3LSJA 2DDAA 5IY5H 4HNUA 2R7UA 2D45A 3QRFF 2ZFUA 3BPXA 1TWCJ 3RPUD 1OPCA 2CFXA 4UUSB 1PUFA 1LDDA 4HV6A 1ZR2A 4N9IA 4JQFA 2DA7A 4U87A 2ME6A 1S8NA 5LBQA 3DEUA 1D0YA 3S2WA 4EV0A 1K4SA 1YLFA 4LB5A 3F8CA 3J7AY 3GYHX 4IHXA 3GZNB 2ISZA 4HAMA 4EJVA 2Y75A 3S8PA 4GDFA 2NVQJ 3H1CA 1K4TA 1XMAA 4PSWA 4JX5A 2XIGA 1FIPA 1X2NA 3LQQA 1SD4A 3LMMA 3FHNA 4RLQA 3RYPA 1KU7A 1FIAA 4H0EA 3S1QJ 3TOBA 2KQRA 1XSVA 1DPRA 3RQIA 4EJTA 3KP3A 3E3VA 3TOAA 2H1KA 4IF4A 3GMEA 4UB8C 5L3DA 3RPUA 1IV6A 4KMFA 3H36A 3J80Z 4J19A 1W36C 2XROA 3BLYA 3WU2C 2NNNA 5AONA 5BQTA 1QZZA 2JUCA 1FBUA 3FIWA 1XTAA 4M3FA 1SFKA 2EV6A 1IGNA 1BA5A 1REPC 3FXJA 2W4SA 2P8TA 2EFNA 2BVMA 2FE3A 2IVMA 3FK6A 2ZSHB 3DFGA 4WK8F 1Z05A 1OCTC 1B4AA 5HLHA 2QUFA 4IX7A 4A0YA 1IRZA 2CQQA 3E0JB 5BOXA 1D8KA 4KIFA 1K7AA 1CQTA 2J5OA 1V55H 4LMYA 1U5TA 2Z2SB 4EJOA 3CMYA 3F3XA 3ZN0A 1YFHA 1KZHA 2W48A 1D3YA 1LUJB 2FEZA 3OR2C 3D0SA 4DOZA 3BR5A 1RIOH 2NNYA 1G4DA 2YUSA 3MN2A 1QGPA 2PBIA 4YELA 3ZP5A 4A93J 1M1EB 2W24A 5DS9A 3FWEA 3IC7A 1P7JA 3R0AA 2H27A 4XORA 1QU3A 4BS9A 5FLXZ 4M71A 2H94A 2E34A 4PJLA 5DV5A 1IUYA 3KP5A 1XDSA 5KNLA 1HSTA 3M3YJ 5JFRA 2Q8KA 1BN5A 1B6AA 4L5EA 4XKCA 5K7FA 1FPQA 2K85A 3GEZA 1IW7F 3GTQJ 4IOCF 2DMPA 3M8FA 4EGYA 2O0YA 1SFUA 1IXRC 2X6XA 1K6YA 3RQ4A 5ICEA 3QOPA 3FISA 5F1JA 1YRNB 4BHCA 2HNHA 4P9FA 3CC4I 3CMMA 4XKBA 1NHAA 2JN6A 1KU9A 3OL3A 2PLYA 1TL8A 2JA6J 1WI3A 3REOA 5D8LB 2YR2A 4ZH4F 3CCSI 5B1AH 2E71A 2O3FA 3MKWB 2V26A 1WWXA 3SXYA 2XV4S 1Z21A 2L4AA 5EEGA 4CCNA 2JJ7A 1ZRCA 1W7PD 3OOPA 4A3DJ 3ERED 3Q0VA 1G3SA 3IAS2 1IF1A 3GBGA 4UB6C 3R60A 2L9SA 3W6KB 3RKXA 2EINH 1JI8A 2X6WA 2RAEA 4FE4A 2ECBA 2VBWA 1IN7A 3BR3A 5DYMA 4S0HB 1BC7C 1IJWC 1TWAJ 1MBEA 4ZTJA 4LLNA 2RV8A 1HDPA 2M8EA 4BJTA 3WTXC 3MZHA 4OIQF 1DGWY 1RR7A 4U0VA 2Y0SN 3QAHA 2RVCA 4BEHB 2GWRA 3LOCA 3KP7A 2PJRB 4QWQA 2WBMA 5FFZA 3D5LA 5ICFA 1FNNA 4KISA 3P9KA 1O3TA 1MKMA 1IUFA 2Y9YA 1CGPA 4LK0F 2OZUA 2YU9J 5CVUA 3G2BA 3B6CA 1MGTA 4BXUA 3PIOF 2HTJA 4MIMA 2EIJH 3CUQC 4ESBA 5JI6A 2WTEA 4LIVA 2QZ8A 2MG4A 2VXDA 1IN4A 1LJ9A 1S6LA 2F6CA 3HTUA 3VYTB 2VL8A 4PK4A 3CCLI 2STWA 1XS9A 1Y39A 4G9YA 3SQNA 2P4WA 2X51A 2YSRA 1RKWA 3PNYA 3WU1B 3IKTA 3LSIA 1WQ2A 1JGSA 1WFXA 2X1DA 3PQKA 5IYDJ 1MH3A 2CSOA 1BW6A 3FBIB 1XCBA 3HZJA 3TDZC 1YJNI 1S3JA 1MSFC 2V9KA 1HBXG 1Z1DA 2W00A 3GFLA 1U0JA 1IO2A 2UZKA 2JUGA 4NBQA 3MD2A 2BY1A 1T6SA 5F08A 2TRTA 5IPAA 4UVCA 4WCGA 1TQPA 4HLXA 4CXFA 2XAQA 1WHUA 4A3CJ 3K4LA 5E1WA 4KT6A 3PSIA 1QVTA 2CU7A 2JRMA 4F55A 1JUPA 4MEYF 2H1LA 2VUMJ 3UR3C 3U21A 1ZK8A 1TWHJ 3ZQIA 3ZMZA 2MFZA 1BIBA 2RC4A 3VWBA 5DM6F 4MTDA 3W3CA 3VODA 1Z3XA 3TO7A 2XB5A 1G8XA 1GVJA 2W82A 2Z1DA 1R22A 4F7ZA 2FMYA 5E79C 1MNDA 1TLHB 3OWTA 2DO7A 3MFKA 4G7OF 3N4MA 2DOEA 4RS8A 4C2TA 4V2GA 2FQ3A 1PDNC 5EEHA 2JWTA 3L2RA 4IHYA 4KDPA 5IP6A 1FOXA 1TW2A 2GXGA 4M9ZA 3CQZJ 1SVMA 2EBIA 1VQLI 1RETA 1K6OA 3CMEI 3BDDA 2OCEA 3OYAA 5ICCA 5HODA 2VPRA 3DEWA 2DLLA 5FD5A 2W85A 5GPCA 1A04A 3T8TA 3K4KA 1YX5A 3SFIA 3AG1H 2EK5A 2E19A 3CUQB 1J9IA 2EZLA 2K4BA 2MC4A 5EZHA 2P7VB 1BI2A 5J6XA 1E3OC 2NRAC 1JKQC 4HQMA 4NNJA 3F8MA 3Q3SA 5ILUA 4HOBA 3RZDJ 2NVUB 2DMNA 2DOAA 3HL2A 5CVJA 2PQ8A 1U9OA 1I3AA 2HEOA 1V5GA 1O3RA 1ZQ3P 1AWCA 4UUTA 3IWFA 3G1OA 3ZQGA 2HDCA 2X6YA 2X1CA 3J80K 2PMUA 1PVEA 1YO5C 4M72A 4XL9A 4ZDLA 3SZGA 3GFMA 3PUBA 1S7AA 4LITA 4AIHA 4B47A 3K4NA 2KRFA 1DP3A 4DW6A 3W2WA 1MBJA 3ZMVA 1JKPC 2HTSA 3LSGA 4RMNA 3N97A 3HKZA 1E3HA 3KP2A 2EIKH 2IGOA 4I02A 4B3AA 5B5EC 2IS6A 4N0BA 3QYEA 2G7HA 2ZXWH 3RPQA 2JVHA 4OMZA 4B43A 1ZG1A 3SZTA 4MFEA 2NVXJ 5DD8A 2E7XA 2FA5A 1PUEE 4N4NB 1NK3P 3NRVA 4CH7A 1OISA 4JOMA 1KQ8A 4RAYA 1IG7A 3BCAA 1R5HA 2KL4A 3TP0A 4OWRB 5CVIA 5KHDA 4C2UA 2L9VA 2DN0A 3I9V2 3JRGA 3CCEI 3R6SA 2Z99A 1ITYA 1QZEA 3V7RA 3TO9A 2VQCA 4V19K 2R7DA 4GGGA 1ERDA 1ZTRA 1X2MA 4FETA 4ENJA 1ZELA 2DXIA 4ENNA 1HXDA 1JTYA 1IC8A 2ETHA 3PM1A 2OTJI 4IL6C 3GWZA 4DYRA 4L0YB 3C2HA 2L0KA 5EG0A 3K1MA 1VTNC 1C0WA 1AOYA 1T38A 2PN6A 3QYBA 4OMYA 2C6YA 5FFXA 1MMGA 3EQLF 1J75A 4CHUA 2V7FA 3E7LA 3BG9A 5J1RA 1BR4A 3K70C 4GCVA 4I76A 3SEZA 3CJRB 4U7BA 3KP6A 4BXFA 1BI3A 1DP7P 2DQLA 2A05A 3GTLJ 3HOUJ 4Y15A 5E1ZB 3QU3A 2QCOA 3WE2A 3TL4X 2DODA 2V79A 3JCUC 3QPHA 2COBA 2KIUA 1IDYA 2MH9A 4BDYA 5FKMA 3NARA 4Z6YA 2GA2A 3MZ8A 5TISC 3DPUA 4ABZA 2MABA 2EJRA 4M9XA 3CCMI 1XB4A 3EUAA 1BI1A 3I5UA 1FEXA 3ESWB 1FP1D 4LLLA 5GADJ 1I27A 1G59A 3C3WA 1ETOA 3OS1A 5LHHA 2FU4A 5FROA 4NDLA 3HUGB 3GTKJ 3DKYA 2CS3A 3CJQB 1TZLA 2W1OA 3NQOA 4XN0A 4R79A 3HSRA 1RC9A 1IDZA 5DCFA 4D7MA 4BE2A 3I4MJ 4FISA 4O6JA 6PAXA 1LDJA 2D1HA 4LLGF 3G4SI 1KYWA 5F6FA 2BXYA 1ON1A 3DWLE 2Q2EB 3QPSA 3L2UA 2VB6A 2H8WA 1ETWA 3TP3A 2GQQA 3OYEA 3MAJA 5FB2A 2IGMA 1R1TA 4XNFA 1SAUA 2ZMEB 1ORKA 3LL7A 5HVQC 3PO3J 4FX0A 3GZ6A 3SJMA 2ESNA 3QQAA 1UFMA 3RIRA 3BR6A 1VQNI 5HS7A 2P7CB 5CVVA 3K9TA 5FLVA 3WHCA 2XPUA 1X3WB 3AL0B 5D6FA 1FWZA 3FXMA 3GTJJ 4RAGA 2ZMEA 1UELB 3I59A 3U1DA 3AAFA 2R7VA 3V8LA 2GIVA 3P9IA 1T08B 2IGKA 4CICA 2VJJA 2IS4A 1JUSA 3CD6I 4YFNF 2KMUA 3CTAA 3RCOA 1XSDA 2YS9A 3ZXSA 2EZIA 4EGZA 4X6AJ 5E20A 2LBFA 2DMQA 2EZKA 2NOJB 3I59B 5J8CA 3W6JB 5D5WB 3OY9A 1LFUP 2QBYB 5LFAA 4EJUA 1IZ1A 1MBKA 3MZYA 2HYJA 4E7JA 2NXNB 1BR1A 3TKYA 3ZPLA 2CQNA 5KVRA 2I8DA 2CQ7A 2PEXA 3K10A 1Z91A 2ZCWA 3TMOA 3ZOBA 1UMQA 2JA2A 4L18B 3H9JA 4BH9A 2HWVA 3SDGA 4F92B 5EGOA 1W0UA 2PJRA 2LKPA 1F5TA 4L9NA 2QF7A 4BY7J 1IN8A 3WGGA 4L5JA 4JX6A 5H6RA 4M6YA 1WGXA 3DXJF 3FM5A 4RAFA 4BL0B 3JR9A 3K70D 2Z9OA 3H3VK 3RYRA 2VQLA 4PJNA 3LWFA 3MKLA 4BDZA 1W4MA 3DKXA 3M7GA 4BXXJ 2KDZA 2QGUA 3RSNA 1X1AA 4O5VA 3LFUA 2L3DA 1FOWA 2CUEA 1JHHA 4AWXB 4B8XA 5EDNA 2FOWA 1F36A 1MDMA 2K40A 1KYZA 3AG4H 4DJAA 2Y30A 2RNJA 4FASD 4L9VA 3C7JA 4NQWB 3V42A 1EJ9A 2UXNA 1D1CA 1R23A 3RKYA 3M8EA 2HYGD 3ABMH 4A2UA 3SHFA 3VEPA 4WXHA 4KITB 4P5OA 3C2GA 3HB9A 1MZBA 1KGSA 1MH4A 3IH3A 3O8GA 3OS0A 5IYBJ 2HOTA 3VSLA 2W84A 2PFBA 2O6GE 1Y8QB 3GFIA 1YIOA 1Y1VJ 3FF5A 4M3DA 2ZB9A 3QPTA 1R49A 1EA3A 2KZVA 1XGOA 2DA2A 2NOGA 3G1MA 5LGTA 3OYJA 2QA4I 2WAFA 1FT9A 1O3SA 1TNSA 1O57A 5AIQA 4C3JJ 3DPLC 4C3IJ 1JJ8C 1I3QJ 2BHYA 4XIDA 2OBPA 3DP7A 4HF0A 3GFJA 2Z16A 3BOQA 3BG3A 1H9TA 3HOXJ 5FRMA 2W57A 3LSRA 4BQQA 1QO0D 4RGSA 1ODDA 1I6XA 5JVTA 5EGOB 5AIPA 4WWCA 3BZKA 3D1NI 3WE3A 1OMIA 2LOOA 1SANA 4LG3A 4J01A 2HDDA 3CMAI 2AQEA 2ID3A 4PGHA 3HPHA 1SAXA 1SEUA 2HR3A 2KIMA 3DLLF 3S1MJ 2M8GX 4OAYA 2IXSA 4XOPA 3DBHB 3JTGA 3A0HC 3K1PA 5M5WJ 3IV5A 2LDUA 1BBYA 4DIQA 2H6BA 3UKGA 1WRJA 4AIKA 2FD5A 4CYCB 4UV8A 1FYKA 5FLMJ 2KHMA 3S2DJ 2QWWA 4LGWA 1J59A 1F43A 3MKYB 2MYSA 3WHBA 4XLPF 4MNUA 4ZJZA 3I64A 3D5RC 2HPIA 4PJ0C 3DBLB 2N8GA 4G6TB 1V5FA 4EM0B 1MBHA 4HSTA 1VQ7I 4BBSJ 3J7AO 1EF4A 1Z3YA 1X1BA 3RKQA 1ZGJA 2DJIA 3HOWJ 5IOYA 2L4MA 2F4MB 2VOOA 2R7WA 1SVOA 4RGUA 2D2WA 2JTVA 2DCEA 1SMYF 2CQXA 3K0LA 4UVAA 5D4RA 3KEQA 3WTVC 1RUOA 2YX4A 2IP2A 3OSFA 3OYHA 1ZN2A 1YS7A 4AU7A 2TDXA 4DYCA 3AFHA 3F9KA 2ZNYA 4MLOA 2RGVA 2DW4A 3O3KA 1RKTA 5M5YJ 3UNGC 2VJIA 1TT5B 2IT0A 2QSGX 1USSA 2ZJRF 2VBZA 2DA5A 1G6NA 4ZDOA 4IPAA 3U9GA 3CC2I 1UHMA 2FMLA 5M3FJ 2BHZA 5K5QA 3DBRB 4CYDA 2IS1A 1R1VA 3HRSA 5DD4A 4D5CA 3AL0C 5HDGA 4L9JA 2VI6A 3G73A 3BR1A 5GAHJ 1GLNA 3H5NA 4IXAA 4RAZA 4LK1F 3OS2A 3ZMSA 1LPQA 1A6IA 3L09A 4LOCA 4Y7NJ 2MSYA 2ZKZA 3CCQI 2R3SA 4UV9A 3WU0A 1H88C 3BJAA 3BP8A 3DPTA 4II3A 2MA3A 3SYTA 1R7JA 4G7ZF 4BUPA 2M5WA 3OYMA 3RKWA 1XC5A 4C30A 5HDNA 2BE5F 2ELJA 2K4JA 3A01B 2OAZA 3LAJA 3WG9A 4I0BA 3KPHA 5D8KB 4A6EA 2R7QA 3S17J 4FE7A 2E1OA 2M87A 4XR6A 2IAIA 5HLIA 1XPXA 1Q1HA 2DOFA 3QP5A 2RNGA 3LAPA 3WTUC 2COMA 1TW3A 5E3NA 2OV7A 1IN5A 3I3LA 3F8BA 4X1EA 3HOZJ 1X3UA 5LLQA 1OQYA 4KFCA 1DUXC 3H5RA 1Y1WJ 3KEYA 4R1HA 1IRGA 4QPOA 3E97A 4CCOA 2JPBA 2XF6A 3KZYA 4BGDA 5J4VA 3MEXA 2XKPA 3H5AA 3E6MA 4CA0A 1ULYA 4OIRF 3DU5A 1DU6A 4AIDA 1QPIA 2LY9A 1MIJA 3Q0UA 1LE8A 2R7SA 2V1UA 1VFCA 1E0EA 2L54A 3GLXA 1CF7B 1ZAOA 2KDOA 1XGMA 3CO7C 5JVGF 1T0FC 3FZVA 4KICA 5E1XA 5HDKA 4XRFA 1AU7A 3FMQA 2E35A 3GTGJ 4RLFA 5IYCJ 1ETYA 4DGWB 3T1BA 5EEAA 2L7ZA 4IEJA 2IGNA 3IUOA 3PIPF 5L3FA 1T95A 3WTTC 2K9QA 4KNYA 4XSXF 1I39A 3ZQLA 3M8JA 3F8FA 4GFBA 2HVRA 1BIAA 3ZN1A 2XRNA 1V5EA 4YIIA 3FXLA 4P9UA 2HQNA 1JKRC 1XGSA 2LLKA 4XSZF 4CDGA 1NK2P 4KMUX 1OR7C 4AIJA 3QODA 1R5GA 4MEXF 3BTLA 4M6XA 2OQGA 2BW3A 3HOVJ 1G3YA 4RGXA 1YTYA 1BL0A 3TW6A 3QOEA 2A6HF 2BEOA 4WXDA 1G3WA 2XF7A 2WB1A 3ELKA 1RPWA 1Y6IA 4KIGA 4I6ZA 2HVSA 2XHKA 4L9TA 3H35A 5F27A 4Q4ZF 1MBFA 1W7PA 4V2FA 1D5YA 1P92A 2DK8A 2B7EA 1VQPI 3JAMK 3X2QH 4KUMA 1S72I 1LE8B 5IT9K 2CW8A 3LNQA 1IN6A 2I10A 5F1RA 2CV0A 3I58A 1EKEA 1GDTA 3E1SA 2CRGA 4AC0A 3AG3H 2MD0A 3T8RA 1JUMA 5LHGA 4HX8A 3K4JA 4CCLA 1B72A 3F6VA 4I7HA 3C18A 3QP6A 2BY2A 4DNCA 2VT2A 2ZFWA 3BG5A 2FJ1A 2JQ7A 2LF7A 3E6BA 2XF5A 3B02A 1XG1A 3GW2A 3RZOJ 5DTDA 4ZYEA 2OD5A 1LB2A 4IQ4A 1E17A 4CCMA 3K4MA 2A5WA 1USTA 5TGTA 2QKLB 3OSGA 1MJBA 2L7FP 2EA2A 3VSKA 1P9QC 1Z77A 2GBYA 4B3XA 3LSPA 2IRFG 4KYWA 3OYFA 3NWTA 2IA0A 3JTHA 1P6RA 2ECCA 2XGDA 4PSXA 1PYVA 4IZZA 1A35A 4RB0A 2VC1A 3BZCA 4IQJA 3R0JA 1JXSA 3BT9A 5FO5A 4L5IA 3EUHC 1SC7A 2X9DA 2PMHA 4Y17A 4E7KA 1XCVA 4FQGA 4JK1X 3I71A 2OA4A 4IHSA 1GV5A 3KYDB 2HU9A 1NH3A 3Q9VA 5E3OA 1KONA 3HSFA 1QPMA 2DT7B 2L9RA 3KFWX 3PL8A 2NS8A 3JRCA 2JSCA 1MBGA 1Z67A 3CJNA 4NUBA 2XKOA 1P2FA 1U8BA 3LSMA 1FSHA 2DDBA 1R9TJ 1IRFA 3PFIA 5D5UB 4M6VA 1HC8A 4P55A 1PJRA 2WY8Q 3SDBA 2OF7A 5FKKA 1ZLJA 3E6DA 5FRNA 3JRFA 2V6CA 4Y13A 2Y48A 4Z2YA 4RDUA 1ONVA 1BW5A 5H20A 2PI0A 4HRIA 4LIUA 2KT0A 2F5VA 3CUQA 5JLXA 3CCUI 2XGCA 9ANTA 5GAEJ 1K83J 3S15J 2KFDA 5KK1A 2E2JJ 4XQFA 3WTWC 3I56I 3D5SC 2A3SA 2BOLA 2VLAA 1P7IA 3RTRA 4F91B 3KIOA 5DCMB 1VQ8I 3KE2A 3LQRA 5FGMA 5K1YA 3S1NJ 1U8RA 1OYIA 2BV6A 2ZJ2A 2Y31A 2CWEA 1APLC 1FMVA 3ABUA 3V7CA 5LEKA 4OIPF 2QVOA 1JGGA 4XK4A 3BJOA 1FBSA 1FYMA 1W5CC 3E5XA 2AS5F 3FXUA 2XB0X 1ZH5A 3C1DA 4GRIA 4ZC3A 4HNVA 4AYBA 2DI3A 4E70A 3S14J 5IOZA 1TP4A 2XAUA 4E6KG 3CDHA 2KIQA 4O3MA 3JRHA 3JREA 4IRHA 3OYBA 4G8XA 4HQEA 1LVAA 1T56A 2LR8A 4DQ2A 5F04A 3ERMA 1R6RA 4KN4X 2LKXA 1FC3A 2LD5A 1U6GA 1UJ8A 4MFDA 2HXOA 2R5ZB 2K9LA 4EJWA 2IPQX 3OIOA 2WV0A 2QEXI 5J1UA 2CUZA 1YIJI 3F22A 5F0FA 2EQRA 1K78B 1ETXA 4D1QA 2E36A 5DEQA 3OYLA 4C2MJ 1V54H 3GLLA 4HEA2 1TQMA 3L9FA 4A5MA 4DBQA 3HHHA 3OYKA 3EPZA 1J7KA 3EUHA 3O6BB 3EUKL 3K4BA 4PFPA 2BZTA 3MVPA 1X4OA 1DU0A 2DAOA 2UUZA 4ASNA 2Z5UA 4PGGA 4RM2A 1ENHA 1UB9A 4HX7A 2CV2A 2KRCA 2MC3A 1BJAA 2EA4A 4IKFA 4JP0A 2RQQA 2X85A 2ZMEC 3ECOA 1ETQA 3GCMA 1Z7LA 4B4CA 2G9WA 2DA6A 4ON0A 2QBYA 4BY1J 2KIFA 4AVPA 2R5YA 2DQRA 4BNCA 1N25A 3H0DA 1YQAA 4MQVA 3IWZA 3M9AA 2VASA 1QQIA 1N78A 3VPRA 4A12A 1MSEC 2ID6A 3MWMA 5HNFA 3OYGA 4I09A 4M9SA 4OINF 2O8KA 3HTSB 4P96A 2EFOA 1FMWA 2K3FA 5CQEA 1FZPB 5J47A 2L02A 1ZLKA 2DPUA 1F1ZA 1ZARA 2H6CA 1QVUA 3LA2A 2A68F 2R7TA 1TT0A 2XRLA 2X4HA 1RR8C 1H0MA 4D5FA 4ZYAA 2OJED 2PJPA 2HZTA 1XSXA 4I98B 2JZYA 5K7HA 1UHWA 2P6SA 5ILSA 2VXZA 2K3PA 3DV8A 1HDDC 2LFBA 1HLVA 2GIZA 3R4KA 2ZBKA 1SVLA 3P9CA 2A5YB 5GP9A 1WI9A 1OKRA 1OCZH 5JLWA 1VQ6I 2RQPA 3I4NJ 1GUUA 2E1MB 3RDIA 1R36A 3LA3A 5F0CA 4YRVA 3H3ZA 1T8IA 3PSFA 3BTCA 2Z33A 4CUGA 4UNOA 2K86A 2AXTC 5E8IA 2WV1A 4QTRA 3MCZA 3B73A 3CCVI 1G3TA 4UHTA 3L2CA 3OIPA 4II2A 4ZZDA 2FX0A 2YU3A 2IA2A 2VBYA 3IP4B 3DTEA 2M1BA 1XMXA 1FX7A 5L3BA 2HOSA 2JRTA 2A61A 5EZGA 4J00A 1I6HJ 5F64A 3WTYC 2Y9ZA 2DT5A 4A3GJ 4RGRA 4ZYGA 4XRMA 1IV8A 5TJJA 1KQ0A 1R71A 3A03A 1L3LA 2DYRH 2R93J 2WADA 1Z0XA 2R92J 2LSOA 4ENMA 4I99C 3BQYA 1QHGA 1NG7A 2X0LA 4NHJA 4JYKA 1YJ9I 3GZ5A 3A2KA 1FSEA 1W5SA 2A07F 1WSUA 2E1NA 1R00A 2F48A 1HOMA 1N75A 4UVBA 3KLOA 4F93B 3J81K 2EH3A 2O03A 1HKTA 2BXZA 1SFOJ 3ZQCA 3IH4A 1EV7A 4C9YA 2VQHA 3J7ZI 2NYXA 4XICA 2LVSA 1HF0A 1HA8A 2CYYA 5LHIA 2ELHA 1Y0UA 3CF5F 5C4JJ 4UY8I 2Q1ZB 4HG2A 2XSJC 4OIOF 2IJLA 4KJZA 2D5VA 3WODF 1WVRA 3L7WA 1D1BA 2XSDC 1W0TA 2AXLA 4C3HJ 3QU6A 3DU6A 5J1YA 1VQOI 1YRNA 1AKHA 2NS0A 1B8IA 3IAM2 3HOSA 3RJPA 5IT9Z 1R4MB 1EH8A 3VYUB 4BJ6C 2ZXHA 3HRUA 2GAUA 2E1MC 3R61A 3ZMTA 5A2QK 3M1CA 1SD7A 2DA3A 1YE9A 2L01A 3ASNH 4CGZA 2AO9A 3HHGA 4CO8A 2M0MA 2MBFA 3IHUA 4IRGA 2XGEA 4IO9F 4D7NA 1YHQI 2KISA 3L2VA 1BJZA 3ABKH 2WY7Q 4ESFA 3DCFA 2YX7A 2EFWA 2LKSA 1PP7U 2JA8J 3CDIA 2HPMA 1KU3A 2R5YB 1ZR4A 2ZC2A 1HW1A 3SEQA 2B9SA 2HQ5A 3DKWA 1NG6A 3PO2J 2DMTA 4RB2C 3S93A 4EM1A 4E7IA 4FTHA 1WH7A 2CH0A 3ABLH 4DZJA 2CG4A 4NQWA 1MMSA 4UUSA 1PUFB 3ZCOA 3P7NA 4BACA 4AUXA 5M5XJ 4EATA 2EPFA 4F52A 4A3FJ 1Q1VA 3T5XA 5LGUA 2NVTJ 2XGXA 5CVRA 2FQ4A 4M3GA 4Y3OA 4YFXF 5D5VB 1IAWA 3JRBA 4XLFA 1W7PB 3J81Z 2ICWG 4A69C 1QNTA 1LVKA 2CUJA 3PNVA 3ZQQA 4QIWN 2D1VA 1VI0A 2STTA 2IW5A 5M3MJ 3OL4A 3BTIA 1A5JA 3HC7A 4EM2A 2V1NA 3DEEA 3FMRA 1UZCA 4GXOA 2TCTA 5GTHC 2AHQA 5C44J 1A31A 2Y0SA 4XLEA 4B48A 5ILVA 1LDKB 3ULQB 5EJCA 3CUOA 4M3EA 5DDGA 1Y56A 5E18F 4A3JJ 3ECHA 5KCMA 2FNPA 3WGHA 2R7OA 4ESJA 2M30A 2UXXA 3BG6A 4BAYA 1VQ4I 1LEBA 2FSWA 3NEUA 2VBXA 1UAAA 1HKSA 2Z3YA 1MJAA 2GXAA 1RI7A 4U0YA 3IL2A 2X48A 4Y33A 1MJ9A 4CSWA 3KETA 2GLOA 1OYWA 2L5QA 3W6VA 4HF1A 1GVDA 3TO6A 1WZ2A 2VONA 1YS6A 1JTXA 4XKVA 5E8GA 1Z6RA 4EQQA 5BPDA 1YW9A 4BQOA 3VYRB 1SFEA 4LG0B 2FF4A 2ELKA 2Y0MA 4HYEA 4MO7A 3BWGA 5HNHA 1MNMC 2V1XA 2WWYA 3KYCB 3HRTA 3KLNA 2KP6A 3ZMDA 3V8JA 4D9JA 3HBLA 4XONA 2F4IA 4MTEA 4HDUA 2O9LA 1JHFA 1AKHB 2VC0A 2VKEA 1D0XA 1RESA 3HXLA 3M1EA 1FY7A 1WJAA 1DGRM 4JBAA 4CYCA 2XAHA 4D0PA 1R1UA 4HV5A 1MD0A 1T0FA 4A3KJ 2ACJA 4U0WA 3K1NA 1UG0A 4EMSA 1T2KA 1JKOC 3M4OJ 2OUMA 1X1PA 1OYYA 3LSTA 4E7ZA 3V4GA 3HEFA 2CO5A 1H9GA 3HGYA 3DF8A 4PUSA 1MW7A 1BC8C 3ONQA 4PZJA 2P81A 4ZYDA 3GVAA 3RI4A 2DJNA 2ZXJA 1QRYA 2MGQA 3ASOH 5CLSA 1YI2I 2CGPA 3MMYB 4EEFG 3O8HA 5J3LA 2CUFA 4A6DA 3PJRA 3TQNA 2K02A 5IP9J 1RZ4A 3H3UA 2RDPA 5D6EA 2QQ8A 1J5YA 1BOBA 4HPQA 1J09A 2JPCA 3CC7I 1H8AC 3NAUA 3MQ0A 2H09A 4PJJA 3F21A 2FOKA 1XD7A 4NC6A 2F5DA 1ON2A 3FXOA 1VZ0A 2M4GA 2R7XA 3KEOA 4BBRJ 3EYYA 5HOOA 3HYIA 1G2HA 4LG0A 3S16J 1V3FA 5DUIA 3FM3A 3VFZA 3DTIA 3F0CA 1JT0A 2R5ZA 2HKOA 1XMKA 1GV2A 1T33A 1FOKA 3DLAA 4FT8A 5E3LA 4DBRA 1KQ9A 1U2WA 5K5RA 2IA1A 2G7UA 3ZGKA 3HDDA 3K2AA 4OU0A 1B9NA 3JAMZ 5GPAA 2XUBA 5C3EJ 2HVQA 1D1AA 4N9HA 2QSFX 1WKMA 2HS5A 1QZYA 3S32A 3CZ6A 2FBKA 3FBNB 1LEAA 4NC7A 4Q48A 3FMSA 3MKZA 2E2HJ 1S7EA 4RM3A 4HF2A 1W36D 1ZREA 3TGNA 4UUVA 4E7SA 3OOUA 1SD6A 2VJ4A 1QA6A 1T39A 3HIFA 3K6GA 1IXCA 3CCYA 1FLIA 5HS8A 4BQAA 1SD5A 3PQJA 3KX2A 4I0AA 1ZGAA 2X6OA 3BJ6A 3CP8A 4A3MJ 5K5OA 4W97A 4HLYA 2F5CA 5TRDA 1GHCA 3A4CA 3KP4A 4AYBN 4ANJA 5B66C 2E5NA 2F5EA 4HSRA 2IBDA 2GA1A 2K27A 2H8RA 3EYIA 5CPRB 4IHVA 2DT6A 3COAC 3GUDA 4BHPA 1BM9A 2M9HA 1TNTA 3HKZN 4Y4RA 4B1RA 2E1CA 1ZG5A 2OCCH 1WJDA 2L7MP 2MLKA 3K2ZA 1HCRA 1POGA 2DFEA 3HRMA 1SFXA 2E60A 1DDNA 1FBQA 4QSHA 2FNAA 1E2XA 3Q9SA 3ZQ7A 2DA1A 5IP7J 1W5TA 1OJLA 3S3OA 1QBJA 1X4PA 4BE1A 3CF2A 3OIQA 5F0HA 1S9HA 1TC3C 1Y8RB 1A6QA 2BBYA 1WCMJ 1R58A 5IT3A 2HQRA 2W7NA 2P5VA 2GXBA 3FKIJ 1R4NB 2EILH 1MMAA 2MH2A 1YITI 1TWGJ 3ML6A 4IHWA 5L3GA 5FLXK 1L0OC 3ISPA 2LG4A 4XBFA 5BS6A 1F4KA 1FOYA 1YJWI 2L7KA 3PFYA 2R7ZJ 5BNGA 3LSHA 2PG4A 4HDVA 1OR7A 3TEDA 2FRHA 2BW3B 2K5CA 4ZYHA 2B0LA 3HOTA 4XN3A 5HLTA
chains in the Genus database with same CATH topology
1WGXA 4C2MJ 1IGNA 1TWFJ 1BA5A 2JA5J 3S1RJ 3JR9A 3H3VK 3IH2A 3MKLA 3FK6A 3MVPA 1DU0A 1AHDP 2JMWA 4BXXJ 2KDZA 1ENHA 1OCTC 5EDNA 2CUEA 1UG2A 5EG0B 1F36A 4G12A 2K40A 4JP0A 4B4CA 1ETQA 2Y30A 2DA6A 3G1LA 4A3IJ 4BY1J 1IRZA 2R5YA 2CQQA 1CQTA 4FCYA 3HB9A 1MH4A 3IH3A 3O8GA 1GT0C 5IYBJ 2HOTA 1NTCA 3CMYA 3VPRA 1MSEC 2ID6A 2W48A 2MW8A 2O8KA 4M3DA 1Y1VJ 3BR5A 2ZB9A 2WAQN 1QVUA 2DA2A 2NOGA 2YUSA 3G1MA 3MN2A 4A93J 4Y52J 2XRLA 3ZQFA 5DS9A 4D5FA 1P7JA 4C3JJ 3BQZA 4C3IJ 1JJ8C 1I3QJ 4XIDA 5K7HA 3BG3A 3HOXJ 1HDDC 2LFBA 1HLVA 3LSRA 5EGOB 3M3YJ 3C2BA 3GTMJ 3D1NI 5GP9A 2HDDA 1SANA 5JLWA 4L5EA 2ID3A 5K7FA 3GTQJ 3I4NJ 1GUUA 3Q0WA 2DMPA 5F0CA 5FJ8J 3BTCA 3S1MJ 2M8GX 4QTRA 2WV1A 2K9SA 5M5WJ 1OFCX 3FISA 3IV5A 5F1JA 3JRDA 1B8IB 1JJ6C 1YRNB 1ZGWA 3UKGA 2FX0A 2FD5A 4CYCB 5FLMJ 2JN6A 3S2DJ 2HOSA 2JA6J 5EZGA 2JK3A 1WI3A 1I6HJ 1F43A 3WHBA 3JRIA 2Y9ZA 4A3GJ 4XRMA 2N8GA 1MBHA 3A03A 4BBSJ 2R93J 1EF4A 1Z0XA 2JJ7A 1FJLA 4A3DJ 3RKQA 2R92J 3Q0VA 2G0EA 3HOWJ 3GBGA 5IOYA 3BQYA 3GTPJ 2RAEA 2CQXA 4FE4A 2ECBA 4JYKA 3BR3A 2VKVA 4S0HB 1IJWC 1FTTA 1TWAJ 1MBEA 1HDPA 1HOMA 5EF6A 2EH3A 1VNDA 1RR7A 3OSFA 2Y0SN 3L1PA 1SFOJ 2XPWA 3LOCA 4DYCA 3ZQCA 5FKOA 1X58A 3IH4A 1U78A 3HOYJ 4MLOA 2O7OA 1U9NA 1IUFA 2Y9YA 4XICA 2LVSA 5FKNA 1HF0A 1RKTA 2YU9J 5M5YJ 5C4JJ 3B6CA 2DA5A 2D5VA 3HGGA 4MIMA 5M3FJ 2MG4A 1ETVA 2XSDC 1W0TA 4D5CA 4C3HJ 5J1YA 1YRNA 1AKHA 1B8IA 2VI6A 1XS9A 3BR1A 1RKWA 1ZKGA 2OPTA 1A6IA 4LOCA 4Y7NJ 2MSYA 5IYDJ 1MH3A 1H88C 1BW6A 1MSFC 1WPKA 4A3EJ 2ME0A 1ETKA 2DA3A 2NS7A 2AO9A 1XC5A 2XGEA 5F08A 4D7NA 3A01B 2TRTA 5IPAA 1BJZA 3DCFA 2LK2A 3S17J 4FE7A 2NVYJ 3K7AJ 2JA8J 4A3CJ 2E1OA 2R5YB 1QVTA 1ZR4A 2CU7A 2Y2ZA 1JUPA 2IAIA 3GTOJ 2HQ5A 2E2IJ 2VUMJ 1ZK8A 1TWHJ 3ZQIA 3PO2J 2DMTA 5E3NA 2EZHA 2XB5A 4FTHA 1WH7A 4DZJA 4X1EA 3HOZJ 4UUSA 1PUFB 1Y1WJ 4V2GA 5C4XJ 2JWTA 2GM4A 4AUXA 5M5XJ 4IHYA 5IP6A 3BR0A 4A3FJ 1Q1VA 3S2HJ 4RBOA 2NVTJ 3H0GJ 3CQZJ 2EBIA 4A3BJ 2FQ4A 4M3GA 1RETA 1DU6A 3JRBA 2HXIA 4A69C 5HODA 2VPRA 2LY9A 3DEWA 3Q0UA 1LE8A 1QPIA 1VFCA 4QIWN 5GPCA 1VI0A 5M3MJ 3SFIA 4JX4A 3BTIA 1O4XA 2E19A 3BR2A 1AU7A 2EZLA 3GTGJ 1A5JA 5EZHA 5IYCJ 1OCPA 1ETYA 1E3OC 2TCTA 5EEAA 1JKQC 2L7ZA 4IEJA 2AHQA 3Q3SA 5C44J 1B72B 3RZDJ 4XRSG 2CJJA 2DMNA 2K9QA 5E3MA 2M34A 1U9OA 4M3EA 3ZQLA 5FKLA 1ZQ3P 4GFBA 4A3JJ 4UUTA 2K9NA 3G1OA 3ZQGA 1JKRC 2LTPA 3HM5A 2LLKA 1VF9A 1NK2P 2X48A 2GLOA 3W6VA 1GVDA 4DW6A 3JRAA 1JKPC 1MBJA 1JTXA 3BTLA 3B6AA 2M0CA 3LSGA 5K7ZA 3HOVJ 4B3AA 1BL0A 3TW6A 2ELKA 4MO7A 1I50J 1MNMC 4MFEA 1RPWA 2NVXJ 4A3LJ 3CDLA 2JA7J 4I6ZA 3HBLA 1NK3P 5F27A 2O9LA 1MBFA 4V2FA 1D5YA 1AKHB 1IG7A 2VKEA 1RESA 3TP0A 1WH5A 2DN0A 4CYCA 3JRGA 1LE8B 2PMZN 1ITYA 3LNQA 2I10A 4A3KJ 1GDTA 2M2EA 2CRGA 1JKOC 3M4OJ 1ZTRA 1X2MA 4AC0A 1JTYA 1JUMA 3HEFA 1IC8A 3HGYA 1B72A 3PM1A 3BTJA 3FK7A 4DYRA 2XPVA 2L0KA 5EG0A 1JT6A 2P81A 1UHSA 3BG5A 2FJ1A 2DJNA 1QRYA 2MGQA 4EEFG 3O8HA 1XG1A 2CUFA 5J3LA 5DTDA 3E7LA 3RZOJ 3BG9A 5J1RA 4W1UA 5IP9J 2R0QC 2DA4A 4I76A 1H8AC 4DYQA 3NAUA 3OSGA 2WB1N 2L7FP 3GTLJ 3HOUJ 1Z77A 2QCOA 2GBYA 3LSPA 4M3BA 2COBA 1IDYA 5FKMA 3NARA 2ECCA 2XGDA 4BBRJ 4ABZA 1G2HA 2LP0A 1FEXA 3S16J 4XRSA 3BT9A 1K61A 2X9DA 3F0CA 1JT0A 2R5ZA 1ETOA 1GV2A 3QPLA 1GV5A 1T33A 4NDLA 1H89C 5E3OA 3GTKJ 5E3LA 2HOAA 3HDDA 2L9RA 2NS8A 3K2AA 3JRCA 5GPAA 1MBGA 1IDZA 4D7MA 3I4MJ 4FISA 5C3EJ 3TW7A 4BKXA 1U8BA 1R9TJ 2DTZA 3A02A 3QPSA 4M6VA 2E2HJ 2OF7A 1S7EA 5FKKA 3JRFA 1ETWA 3TP3A 4RDUA 1BW5A 3OOUA 2KT0A 3CCYA 5JLXA 1ORKA 2XGCA 9ANTA 3PO3J 1K83J 2IEKA 3S15J 2E2JJ 2B63J 3ZQHA 3SJMA 3QQAA 2HI3A 2X6OA 4A3MJ 1P7IA 3BR6A 1LFBA 1FTZA 4W97A 4AYBN 3A01A 5FLVA 3WHCA 2IBDA 2DMUA 2XPUA 5EYRA 3LSJA 4DZPA 2H8RA 3S1NJ 4IHVA 3GTJJ 2Y31A 2M9HA 1APLC 1TWCJ 3HKZN 4XK4A 1JGGA 4B1RA 4UUSB 1PUFA 1JUSA 2L7MP 1ZR2A 2XB0X 2DA7A 2ME6A 1HCRA 1POGA 2YS9A 2EZIA 4X6AJ 4QSHA 5IP7J 2DA1A 2DMQA 2EZKA 4HNVA 1OJLA 1LFUP 4IHXA 3S14J 2NVQJ 5IOZA 1MBKA 2HYJA 5F0HA 1TC3C 4JX5A 1WCMJ 3JRHA 3JREA 1FIPA 1X2NA 3FKIJ 1FIAA 3S1QJ 1T56A 2LR8A 5F04A 1TWGJ 3RQIA 3ZOBA 4IHWA 1UMQA 2LKXA 2H1KA 2LD5A 1IV6A 4MFDA 2HXOA 2R5ZB 4J19A 5EGOA 3OIOA 3SDGA 2R7ZJ 5BNGA 1W0UA 5J1UA 3TEDA 2QF7A 4BY7J 5F0FA 2EQRA 3FIWA 1ETXA 4JX6A 4M3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGX A;  4C2M J;  1IGN A;  1TWF J;  1BA5 A;  2JA5 J;  3S1R J;  3JR9 A;  3H3V K;  3IH2 A;  3MKL A;  3FK6 A;  3MVP A;  1DU0 A;  1AHD P;  2JMW A;  4BXX J;  2KDZ A;  1ENH A;  1OCT C;  5EDN A;  2CUE A;  1UG2 A;  5EG0 B;  1F36 A;  4G12 A;  2K40 A;  4JP0 A;  4B4C A;  1ETQ A;  2Y30 A;  2DA6 A;  3G1L A;  4A3I J;  4BY1 J;  1IRZ A;  2R5Y A;  2CQQ A;  1CQT A;  4FCY A;  3HB9 A;  1MH4 A;  3IH3 A;  3O8G A;  1GT0 C;  5IYB J;  2HOT A;  1NTC A;  3CMY A;  3VPR A;  1MSE C;  2ID6 A;  2W48 A;  2MW8 A;  2O8K A;  4M3D A;  1Y1V J;  3BR5 A;  2ZB9 A;  2WAQ N;  1QVU A;  2DA2 A;  2NOG A;  2YUS A;  3G1M A;  3MN2 A;  4A93 J;  4Y52 J;  2XRL A;  3ZQF A;  5DS9 A;  4D5F A;  1P7J A;  4C3J J;  3BQZ A;  4C3I J;  1JJ8 C;  1I3Q J;  4XID A;  5K7H A;  3BG3 A;  3HOX J;  1HDD C;  2LFB A;  1HLV A;  3LSR A;  5EGO B;  3M3Y J;  3C2B A;  3GTM J;  3D1N I;  5GP9 A;  2HDD A;  1SAN A;  5JLW A;  4L5E A;  2ID3 A;  5K7F A;  3GTQ J;  3I4N J;  1GUU A;  3Q0W A;  2DMP A;  5F0C A;  5FJ8 J;  3BTC A;  3S1M J;  2M8G X;  4QTR A;  2WV1 A;  2K9S A;  5M5W J;  1OFC X;  3FIS A;  3IV5 A;  5F1J A;  3JRD A;  1B8I B;  1JJ6 C;  1YRN B;  1ZGW A;  3UKG A;  2FX0 A;  2FD5 A;  4CYC B;  5FLM J;  2JN6 A;  3S2D J;  2HOS A;  2JA6 J;  5EZG A;  2JK3 A;  1WI3 A;  1I6H J;  1F43 A;  3WHB A;  3JRI A;  2Y9Z A;  4A3G J;  4XRM A;  2N8G A;  1MBH A;  3A03 A;  4BBS J;  2R93 J;  1EF4 A;  1Z0X A;  2JJ7 A;  1FJL A;  4A3D J;  3RKQ A;  2R92 J;  3Q0V A;  2G0E A;  3HOW J;  3GBG A;  5IOY A;  3BQY A;  3GTP J;  2RAE A;  2CQX A;  4FE4 A;  2ECB A;  4JYK A;  3BR3 A;  2VKV A;  4S0H B;  1IJW C;  1FTT A;  1TWA J;  1MBE A;  1HDP A;  1HOM A;  5EF6 A;  2EH3 A;  1VND A;  1RR7 A;  3OSF A;  2Y0S N;  3L1P A;  1SFO J;  2XPW A;  3LOC A;  4DYC A;  3ZQC A;  5FKO A;  1X58 A;  3IH4 A;  1U78 A;  3HOY J;  4MLO A;  2O7O A;  1U9N A;  1IUF A;  2Y9Y A;  4XIC A;  2LVS A;  5FKN A;  1HF0 A;  1RKT A;  2YU9 J;  5M5Y J;  5C4J J;  3B6C A;  2DA5 A;  2D5V A;  3HGG A;  4MIM A;  5M3F J;  2MG4 A;  1ETV A;  2XSD C;  1W0T A;  4D5C A;  4C3H J;  5J1Y A;  1YRN A;  1AKH A;  1B8I A;  2VI6 A;  1XS9 A;  3BR1 A;  1RKW A;  1ZKG A;  2OPT A;  1A6I A;  4LOC A;  4Y7N J;  2MSY A;  5IYD J;  1MH3 A;  1H88 C;  1BW6 A;  1MSF C;  1WPK A;  4A3E J;  2ME0 A;  1ETK A;  2DA3 A;  2NS7 A;  2AO9 A;  1XC5 A;  2XGE A;  5F08 A;  4D7N A;  3A01 B;  2TRT A;  5IPA A;  1BJZ A;  3DCF A;  2LK2 A;  3S17 J;  4FE7 A;  2NVY J;  3K7A J;  2JA8 J;  4A3C J;  2E1O A;  2R5Y B;  1QVT A;  1ZR4 A;  2CU7 A;  2Y2Z A;  1JUP A;  2IAI A;  3GTO J;  2HQ5 A;  2E2I J;  2VUM J;  1ZK8 A;  1TWH J;  3ZQI A;  3PO2 J;  2DMT A;  5E3N A;  2EZH A;  2XB5 A;  4FTH A;  1WH7 A;  4DZJ A;  4X1E A;  3HOZ J;  4UUS A;  1PUF B;  1Y1W J;  4V2G A;  5C4X J;  2JWT A;  2GM4 A;  4AUX A;  5M5X J;  4IHY A;  5IP6 A;  3BR0 A;  4A3F J;  1Q1V A;  3S2H J;  4RBO A;  2NVT J;  3H0G J;  3CQZ J;  2EBI A;  4A3B J;  2FQ4 A;  4M3G A;  1RET A;  1DU6 A;  3JRB A;  2HXI A;  4A69 C;  5HOD A;  2VPR A;  2LY9 A;  3DEW A;  3Q0U A;  1LE8 A;  1QPI A;  1VFC A;  4QIW N;  5GPC A;  1VI0 A;  5M3M J;  3SFI A;  4JX4 A;  3BTI A;  1O4X A;  2E19 A;  3BR2 A;  1AU7 A;  2EZL A;  3GTG J;  1A5J A;  5EZH A;  5IYC J;  1OCP A;  1ETY A;  1E3O C;  2TCT A;  5EEA A;  1JKQ C;  2L7Z A;  4IEJ A;  2AHQ A;  3Q3S A;  5C44 J;  1B72 B;  3RZD J;  4XRS G;  2CJJ A;  2DMN A;  2K9Q A;  5E3M A;  2M34 A;  1U9O A;  4M3E A;  3ZQL A;  5FKL A;  1ZQ3 P;  4GFB A;  4A3J J;  4UUT A;  2K9N A;  3G1O A;  3ZQG A;  1JKR C;  2LTP A;  3HM5 A;  2LLK A;  1VF9 A;  1NK2 P;  2X48 A;  2GLO A;  3W6V A;  1GVD A;  4DW6 A;  3JRA A;  1JKP C;  1MBJ A;  1JTX A;  3BTL A;  3B6A A;  2M0C A;  3LSG A;  5K7Z A;  3HOV J;  4B3A A;  1BL0 A;  3TW6 A;  2ELK A;  4MO7 A;  1I50 J;  1MNM C;  4MFE A;  1RPW A;  2NVX J;  4A3L J;  3CDL A;  2JA7 J;  4I6Z A;  3HBL A;  1NK3 P;  5F27 A;  2O9L A;  1MBF A;  4V2F A;  1D5Y A;  1AKH B;  1IG7 A;  2VKE A;  1RES A;  3TP0 A;  1WH5 A;  2DN0 A;  4CYC A;  3JRG A;  1LE8 B;  2PMZ N;  1ITY A;  3LNQ A;  2I10 A;  4A3K J;  1GDT A;  2M2E A;  2CRG A;  1JKO C;  3M4O J;  1ZTR A;  1X2M A;  4AC0 A;  1JTY A;  1JUM A;  3HEF A;  1IC8 A;  3HGY A;  1B72 A;  3PM1 A;  3BTJ A;  3FK7 A;  4DYR A;  2XPV A;  2L0K A;  5EG0 A;  1JT6 A;  2P81 A;  1UHS A;  3BG5 A;  2FJ1 A;  2DJN A;  1QRY A;  2MGQ A;  4EEF G;  3O8H A;  1XG1 A;  2CUF A;  5J3L A;  5DTD A;  3E7L A;  3RZO J;  3BG9 A;  5J1R A;  4W1U A;  5IP9 J;  2R0Q C;  2DA4 A;  4I76 A;  1H8A C;  4DYQ A;  3NAU A;  3OSG A;  2WB1 N;  2L7F P;  3GTL J;  3HOU J;  1Z77 A;  2QCO A;  2GBY A;  3LSP A;  4M3B A;  2COB A;  1IDY A;  5FKM A;  3NAR A;  2ECC A;  2XGD A;  4BBR J;  4ABZ A;  1G2H A;  2LP0 A;  1FEX A;  3S16 J;  4XRS A;  3BT9 A;  1K61 A;  2X9D A;  3F0C A;  1JT0 A;  2R5Z A;  1ETO A;  1GV2 A;  3QPL A;  1GV5 A;  1T33 A;  4NDL A;  1H89 C;  5E3O A;  3GTK J;  5E3L A;  2HOA A;  3HDD A;  2L9R A;  2NS8 A;  3K2A A;  3JRC A;  5GPA A;  1MBG A;  1IDZ A;  4D7M A;  3I4M J;  4FIS A;  5C3E J;  3TW7 A;  4BKX A;  1U8B A;  1R9T J;  2DTZ A;  3A02 A;  3QPS A;  4M6V A;  2E2H J;  2OF7 A;  1S7E A;  5FKK A;  3JRF A;  1ETW A;  3TP3 A;  4RDU A;  1BW5 A;  3OOU A;  2KT0 A;  3CCY A;  5JLX A;  1ORK A;  2XGC A;  9ANT A;  3PO3 J;  1K83 J;  2IEK A;  3S15 J;  2E2J J;  2B63 J;  3ZQH A;  3SJM A;  3QQA A;  2HI3 A;  2X6O A;  4A3M J;  1P7I A;  3BR6 A;  1LFB A;  1FTZ A;  4W97 A;  4AYB N;  3A01 A;  5FLV A;  3WHC A;  2IBD A;  2DMU A;  2XPU A;  5EYR A;  3LSJ A;  4DZP A;  2H8R A;  3S1N J;  4IHV A;  3GTJ J;  2Y31 A;  2M9H A;  1APL C;  1TWC J;  3HKZ N;  4XK4 A;  1JGG A;  4B1R A;  4UUS B;  1PUF A;  1JUS A;  2L7M P;  1ZR2 A;  2XB0 X;  2DA7 A;  2ME6 A;  1HCR A;  1POG A;  2YS9 A;  2EZI A;  4X6A J;  4QSH A;  5IP7 J;  2DA1 A;  2DMQ A;  2EZK A;  4HNV A;  1OJL A;  1LFU P;  4IHX A;  3S14 J;  2NVQ J;  5IOZ A;  1MBK A;  2HYJ A;  5F0H A;  1TC3 C;  4JX5 A;  1WCM J;  3JRH A;  3JRE A;  1FIP A;  1X2N A;  3FKI J;  1FIA A;  3S1Q J;  1T56 A;  2LR8 A;  5F04 A;  1TWG J;  3RQI A;  3ZOB A;  4IHW A;  1UMQ A;  2LKX A;  2H1K A;  2LD5 A;  1IV6 A;  4MFD A;  2HXO A;  2R5Z B;  4J19 A;  5EGO A;  3OIO A;  3SDG A;  2R7Z J;  5BNG A;  1W0U A;  5J1U A;  3TED A;  2QF7 A;  4BY7 J;  5F0F A;  2EQR A;  3FIW A;  1ETX A;  4JX6 A;  4M3F A; 
#chains in the Genus database with same CATH topology
 2UV1 A;  1TWF J;  1OCC H;  2JA5 J;  3S1R J;  1OLT A;  4X0G A;  3IH2 A;  4KIB A;  4S04 A;  4P1W A;  5J8F A;  4ENK A;  4AD9 A;  1AHD P;  2JMW A;  2K7L A;  3WTS C;  4G6D A;  4ETS A;  1B9M A;  5EG0 B;  1UG2 A;  4FHT A;  2QQA A;  4Q5S F;  4G12 A;  2FUG 2;  3I4P A;  3G1L A;  1RNL A;  3P5J A;  3ZR8 X;  4A3I J;  4RA2 A;  2E5Z A;  3J7Y J;  2V9V A;  3QYF A;  4FCY A;  1X19 A;  1LKX A;  4LB6 B;  3JW4 A;  4BU2 A;  3U1K A;  4HBL A;  1GT0 C;  1NTC A;  1STZ A;  3CES A;  4M73 A;  1JE8 A;  3GF2 A;  1VQ9 I;  1X1C A;  4XM3 A;  3A0B C;  1HQC A;  4E7L A;  2MW8 A;  4FX4 A;  2XDV A;  1O7L A;  3H9Q A;  2ZJP F;  1J0R A;  2P5L C;  3FKJ A;  2L2O A;  3E5Q A;  2WAQ N;  2QLZ A;  3CCR I;  4Y52 J;  3HJE A;  1GXQ A;  2VE9 A;  2VIX A;  2DFF A;  1EH6 A;  2W25 A;  3ZQF A;  3OYC A;  2LF8 A;  3BQZ A;  5BMZ A;  3I53 A;  3HPG A;  1WJE A;  2KPM A;  2XAF A;  4U88 A;  5DM7 F;  3HG9 A;  5JHU A;  3L00 A;  4I01 A;  5DUK A;  3ZRG A;  3E5U A;  2HDW A;  2QQ9 A;  3C2B A;  3GTM J;  4AVZ A;  4S05 A;  2J5P A;  2WC2 A;  3DTK A;  4UXN A;  3K69 A;  2KJB A;  5KAI C;  4I2O A;  2M45 A;  1ACI A;  3Q0W A;  1RRJ A;  2ESH A;  1D8J A;  2GZW A;  3F23 A;  1V4R A;  1RUN A;  3CLO A;  1E3P A;  4R8H A;  5FJ8 J;  4HZF A;  5JHF A;  2K9S A;  3AG2 H;  2FXA A;  2VKD A;  5HS9 A;  1OFC X;  4K2E A;  3JRD A;  1B8I B;  1JJ6 C;  1ZGW A;  1YW7 A;  2PMZ A;  3LSK A;  4WXC A;  5GTI C;  2ZXI A;  3JSO A;  2VQG A;  2LY2 A;  2F2E A;  2QQB A;  4XMY A;  2R4G A;  2VOP A;  2JK3 A;  2RKH A;  1ZHF A;  2JT1 A;  3EDP A;  3JRI A;  1WJC A;  4CZC A;  2XAS A;  4RB3 C;  1GXP A;  5LGN A;  2PX9 A;  5HLG A;  1DQU A;  1TBX A;  3ZMU A;  4YIR X;  1FJL A;  2HOE A;  2G0E A;  2A6E F;  2XC7 A;  1S5L C;  2X1E A;  1KA8 A;  1BR2 A;  3G71 I;  4CCK A;  3GTP J;  1YW8 A;  4XLH A;  3K4C A;  4BE0 A;  3H92 A;  3S3M A;  2BY3 A;  5B3S H;  3IRR A;  3FHZ A;  2VKV A;  3FXQ A;  5DCM A;  5D4S A;  1FTT A;  5EF6 A;  1R5I D;  1BOA A;  1F9N A;  3ABT A;  2ZNZ A;  1MMN A;  1VND A;  4IVN A;  2EV5 A;  3L1P A;  2XPW A;  2VOD A;  2L9N A;  3NWS A;  2EFP A;  5FKO A;  1X58 A;  2LRD A;  3O2P E;  5LEJ A;  1U78 A;  3HOY J;  3BC8 A;  2O7O A;  1DPU A;  1U9N A;  5CKT A;  5FKN A;  2CW7 A;  1P4W A;  2KJC A;  3BG7 A;  4XLA A;  1OCR H;  2M7B A;  1ZRF A;  2BYV E;  3KCC A;  3OR1 C;  4ZZL A;  2GOM A;  3HGG A;  2QKM B;  4IOA F;  1HSJ A;  2V9P A;  4RB1 A;  1U5T C;  2OC6 A;  1ETV A;  2ZJQ F;  3VDX A;  3EET A;  2EIM H;  2FBH A;  2GOX B;  4WF2 A;  3G6E I;  2I5U A;  2LYC A;  3OYI A;  3KYL A;  4PCQ A;  3U2R A;  1ZKG A;  4HW0 A;  2OPT A;  1CF7 A;  2BVL A;  5B1B H;  3BRO A;  4MGR A;  1WPK A;  4A3E J;  2ME0 A;  3KZI C;  1ETK A;  2KKO A;  2NS7 A;  1VQ5 I;  1O7F A;  1P4A A;  5CQG A;  3W2V A;  2IS2 A;  2UWM A;  3CLQ A;  2JVG A;  1I1S A;  2DK5 A;  2VPL A;  2CFO A;  1Z6T A;  2MLG A;  1QHH D;  2LK2 A;  3W2A A;  3I54 A;  2NVY J;  3K7A J;  4OAZ A;  3VOE A;  2KRH A;  2Y2Z A;  2DYS H;  3GTO J;  1YOV B;  2E2I J;  1X1D A;  3BCB A;  2DBB A;  2CQK A;  1TQI A;  2EZH A;  1VQK I;  3PUF A;  5L3C A;  3CCJ I;  1IRX A;  1K79 A;  4NC8 A;  2LH9 A;  2OZ6 A;  5C4X J;  2A6T A;  1K78 A;  2GM4 A;  4CCJ A;  1VQM I;  2EB7 A;  3BR0 A;  5GAG J;  4BJ5 C;  2R7F A;  3S2H J;  4RBO A;  1LFP A;  1WJB A;  3H0G J;  4IHT A;  5CJ9 A;  4A3B J;  3IKV A;  4H4K C;  4IRI A;  3DQV C;  4GO1 A;  4BEH A;  3I0T A;  1AA7 A;  2VT3 A;  5CYV A;  3QWL A;  1IXS B;  2HXI A;  4LJZ F;  2E7W A;  2ISY A;  4BYY A;  5J40 A;  4F3Q A;  4ZTF A;  1N77 A;  1P4X A;  4B09 A;  3AKZ A;  2M7A A;  4JX4 A;  1O4X A;  4MQ9 F;  3BR2 A;  2DFH A;  2KZG A;  1OCP A;  4TV7 A;  4HA8 A;  2ZSI B;  3PNT A;  2XAJ A;  5LRS A;  3GO5 A;  2O8X A;  1B72 B;  4XRS G;  2CJJ A;  4A0Z A;  2DU9 A;  3TBI A;  3N05 A;  2HQA A;  4XLN F;  5E3M A;  1MMD A;  1WJ5 A;  4G6Q A;  2M34 A;  2CV1 A;  1BI0 A;  3S3N A;  4XOT A;  1XGN A;  3H9G A;  5FKL A;  5ICG A;  2WA0 A;  3BZ6 A;  2K9N A;  1FYL A;  4BHB A;  3IRQ A;  2WAQ A;  2EV0 A;  4E7H A;  4XKW A;  5FD6 A;  1Z7U A;  4GYG A;  2LTP A;  3BPV A;  3HM5 A;  3WG7 H;  2Y69 H;  1VF9 A;  3Q5F A;  2P5K A;  4HX4 A;  2OTL I;  3OYD A;  4AM3 A;  1J2X A;  1HW5 A;  2EFQ A;  5JR3 A;  3JRA A;  2YPR A;  1X3Z B;  1WJF A;  3B6A A;  2M0C A;  4L0Z B;  4BQN A;  3GXO A;  3F72 A;  5K7Z A;  1O3Q A;  4WX9 A;  4XLC A;  4QPQ A;  2M3A A;  3SZP A;  4LD5 A;  4B44 A;  1I50 J;  2EWN A;  3BY6 A;  2RN7 A;  2HYF A;  4U7D A;  4KT5 C;  4A3L J;  3CDL A;  2V4J C;  2Q2E A;  2JA7 J;  1SMT A;  5ERI A;  3ROU A;  1XX5 A;  3FXR A;  3VYS B;  2RRE A;  2DFI A;  3M07 A;  3A1Y A;  3CJT B;  4NB5 A;  1YX3 A;  1YG2 A;  1WH5 A;  4KA4 A;  2V6E A;  2PMZ N;  3F8N A;  1EH7 A;  3I55 I;  2M2E A;  2NAZ A;  2LMD A;  4IJA A;  2ZO4 A;  2OQR A;  4YEJ A;  2LC2 A;  2HFH A;  2QYO A;  2HGC A;  2DTR A;  2P0W A;  3HUG A;  1T98 A;  3GX4 X;  2QM3 A;  3BTJ A;  1A36 A;  3FK7 A;  2BY0 A;  3OV8 A;  4N4O B;  4QLC U;  5H2F C;  1HW2 A;  2XPV A;  1JT6 A;  1LQ1 A;  4A0X A;  3KZZ A;  1UHS A;  2P6T A;  2M4K A;  3HSE A;  3CO6 C;  1Y0N A;  2VN2 A;  4G7H F;  1MNE A;  1TTY A;  2JSP A;  2QSH X;  2O5R A;  2HKX A;  1YYV A;  2WAE A;  3LFK A;  4W1U A;  2V1D A;  2R0Q C;  3E6C C;  2DA4 A;  5D5X B;  2LNB A;  4PFO A;  3T0Y A;  5A2Q Z;  2R7R A;  1B59 A;  3JSP A;  4DYQ A;  4YIF A;  2WB1 N;  2KLO A;  2XAG A;  1KU2 A;  3G3Z A;  4MHG A;  4LFU A;  4CZZ A;  1OCO H;  1XDU A;  5KAF C;  4M3B A;  5H6Q A;  2K9M A;  1B1B A;  3VB2 A;  5LD2 C;  1I5Z A;  1UCR A;  1XN7 A;  2A69 F;  4Q47 A;  2LP0 A;  4GYI A;  1U5T B;  2QEN A;  4XRS A;  4EVI A;  1D0Z A;  3CP2 A;  4M74 A;  1K61 A;  4G94 A;  2XVC A;  2AQF A;  3LA7 A;  3OMY A;  1S7O A;  4YFK F;  2VE8 A;  3QPL A;  5ED4 A;  1H89 C;  3WTZ A;  2Q0O A;  3V8K A;  5J4Y A;  1W1W E;  2HOA A;  2BGC A;  1I1G A;  3F6O A;  1PP8 F;  3TW7 A;  1FP2 A;  4BKX A;  2HZD A;  2LRE A;  1HKQ A;  1ZRD A;  1Z9C A;  2LBF B;  1D5V A;  2CMP A;  2DTZ A;  3A02 A;  2ADU A;  4PJM A;  4E4H A;  4PDK A;  3OYN A;  4HNT A;  4ITV A;  5E17 F;  4OOI A;  4ZDP A;  5BPI A;  3TDU C;  2LY1 A;  2MD5 A;  1U3E M;  2DPD A;  4YG2 F;  3L2W A;  1ZG3 A;  5L3E A;  1MDM B;  3FDY A;  2F5F A;  2IEK A;  4KN7 X;  2B63 J;  3ZQH A;  4A5N A;  2HI3 A;  2VKH A;  1S29 A;  2FBI A;  3WGI A;  3FXK A;  2F4O B;  3V7S A;  1LFB A;  1LNW A;  5LRR A;  1FTZ A;  1ZYR F;  3SFZ A;  2O61 A;  3L2Q A;  2VJ5 A;  3A01 A;  2OU2 A;  3FX3 A;  2DMU A;  5EYR A;  4DZP A;  2CW0 F;  3LSJ A;  2DDA A;  5IY5 H;  4HNU A;  2R7U A;  2D45 A;  3QRF F;  2ZFU A;  3BPX A;  1TWC J;  3RPU D;  1OPC A;  2CFX A;  4UUS B;  1PUF A;  1LDD A;  4HV6 A;  1ZR2 A;  4N9I A;  4JQF A;  2DA7 A;  4U87 A;  2ME6 A;  1S8N A;  5LBQ A;  3DEU A;  1D0Y A;  3S2W A;  4EV0 A;  1K4S A;  1YLF A;  4LB5 A;  3F8C A;  3J7A Y;  3GYH X;  4IHX A;  3GZN B;  2ISZ A;  4HAM A;  4EJV A;  2Y75 A;  3S8P A;  4GDF A;  2NVQ J;  3H1C A;  1K4T A;  1XMA A;  4PSW A;  4JX5 A;  2XIG A;  1FIP A;  1X2N A;  3LQQ A;  1SD4 A;  3LMM A;  3FHN A;  4RLQ A;  3RYP A;  1KU7 A;  1FIA A;  4H0E A;  3S1Q J;  3TOB A;  2KQR A;  1XSV A;  1DPR A;  3RQI A;  4EJT A;  3KP3 A;  3E3V A;  3TOA A;  2H1K A;  4IF4 A;  3GME A;  4UB8 C;  5L3D A;  3RPU A;  1IV6 A;  4KMF A;  3H36 A;  3J80 Z;  4J19 A;  1W36 C;  2XRO A;  3BLY A;  3WU2 C;  2NNN A;  5AON A;  5BQT A;  1QZZ A;  2JUC A;  1FBU A;  3FIW A;  1XTA A;  4M3F A;  1SFK A;  2EV6 A;  1IGN A;  1BA5 A;  1REP C;  3FXJ A;  2W4S A;  2P8T A;  2EFN A;  2BVM A;  2FE3 A;  2IVM A;  3FK6 A;  2ZSH B;  3DFG A;  4WK8 F;  1Z05 A;  1OCT C;  1B4A A;  5HLH A;  2QUF A;  4IX7 A;  4A0Y A;  1IRZ A;  2CQQ A;  3E0J B;  5BOX A;  1D8K A;  4KIF A;  1K7A A;  1CQT A;  2J5O A;  1V55 H;  4LMY A;  1U5T A;  2Z2S B;  4EJO A;  3CMY A;  3F3X A;  3ZN0 A;  1YFH A;  1KZH A;  2W48 A;  1D3Y A;  1LUJ B;  2FEZ A;  3OR2 C;  3D0S A;  4DOZ A;  3BR5 A;  1RIO H;  2NNY A;  1G4D A;  2YUS A;  3MN2 A;  1QGP A;  2PBI A;  4YEL A;  3ZP5 A;  4A93 J;  1M1E B;  2W24 A;  5DS9 A;  3FWE A;  3IC7 A;  1P7J A;  3R0A A;  2H27 A;  4XOR A;  1QU3 A;  4BS9 A;  5FLX Z;  4M71 A;  2H94 A;  2E34 A;  4PJL A;  5DV5 A;  1IUY A;  3KP5 A;  1XDS A;  5KNL A;  1HST A;  3M3Y J;  5JFR A;  2Q8K A;  1BN5 A;  1B6A A;  4L5E A;  4XKC A;  5K7F A;  1FPQ A;  2K85 A;  3GEZ A;  1IW7 F;  3GTQ J;  4IOC F;  2DMP A;  3M8F A;  4EGY A;  2O0Y A;  1SFU A;  1IXR C;  2X6X A;  1K6Y A;  3RQ4 A;  5ICE A;  3QOP A;  3FIS A;  5F1J A;  1YRN B;  4BHC A;  2HNH A;  4P9F A;  3CC4 I;  3CMM A;  4XKB A;  1NHA A;  2JN6 A;  1KU9 A;  3OL3 A;  2PLY A;  1TL8 A;  2JA6 J;  1WI3 A;  3REO A;  5D8L B;  2YR2 A;  4ZH4 F;  3CCS I;  5B1A H;  2E71 A;  2O3F A;  3MKW B;  2V26 A;  1WWX A;  3SXY A;  2XV4 S;  1Z21 A;  2L4A A;  5EEG A;  4CCN A;  2JJ7 A;  1ZRC A;  1W7P D;  3OOP A;  4A3D J;  3ERE D;  3Q0V A;  1G3S A;  3IAS 2;  1IF1 A;  3GBG A;  4UB6 C;  3R60 A;  2L9S A;  3W6K B;  3RKX A;  2EIN H;  1JI8 A;  2X6W A;  2RAE A;  4FE4 A;  2ECB A;  2VBW A;  1IN7 A;  3BR3 A;  5DYM A;  4S0H B;  1BC7 C;  1IJW C;  1TWA J;  1MBE A;  4ZTJ A;  4LLN A;  2RV8 A;  1HDP A;  2M8E A;  4BJT A;  3WTX C;  3MZH A;  4OIQ F;  1DGW Y;  1RR7 A;  4U0V A;  2Y0S N;  3QAH A;  2RVC A;  4BEH B;  2GWR A;  3LOC A;  3KP7 A;  2PJR B;  4QWQ A;  2WBM A;  5FFZ A;  3D5L A;  5ICF A;  1FNN A;  4KIS A;  3P9K A;  1O3T A;  1MKM A;  1IUF A;  2Y9Y A;  1CGP A;  4LK0 F;  2OZU A;  2YU9 J;  5CVU A;  3G2B A;  3B6C A;  1MGT A;  4BXU A;  3PIO F;  2HTJ A;  4MIM A;  2EIJ H;  3CUQ C;  4ESB A;  5JI6 A;  2WTE A;  4LIV A;  2QZ8 A;  2MG4 A;  2VXD A;  1IN4 A;  1LJ9 A;  1S6L A;  2F6C A;  3HTU A;  3VYT B;  2VL8 A;  4PK4 A;  3CCL I;  2STW A;  1XS9 A;  1Y39 A;  4G9Y A;  3SQN A;  2P4W A;  2X51 A;  2YSR A;  1RKW A;  3PNY A;  3WU1 B;  3IKT A;  3LSI A;  1WQ2 A;  1JGS A;  1WFX A;  2X1D A;  3PQK A;  5IYD J;  1MH3 A;  2CSO A;  1BW6 A;  3FBI B;  1XCB A;  3HZJ A;  3TDZ C;  1YJN I;  1S3J A;  1MSF C;  2V9K A;  1HBX G;  1Z1D A;  2W00 A;  3GFL A;  1U0J A;  1IO2 A;  2UZK A;  2JUG A;  4NBQ A;  3MD2 A;  2BY1 A;  1T6S A;  5F08 A;  2TRT A;  5IPA A;  4UVC A;  4WCG A;  1TQP A;  4HLX A;  4CXF A;  2XAQ A;  1WHU A;  4A3C J;  3K4L A;  5E1W A;  4KT6 A;  3PSI A;  1QVT A;  2CU7 A;  2JRM A;  4F55 A;  1JUP A;  4MEY F;  2H1L A;  2VUM J;  3UR3 C;  3U21 A;  1ZK8 A;  1TWH J;  3ZQI A;  3ZMZ A;  2MFZ A;  1BIB A;  2RC4 A;  3VWB A;  5DM6 F;  4MTD A;  3W3C A;  3VOD A;  1Z3X A;  3TO7 A;  2XB5 A;  1G8X A;  1GVJ A;  2W82 A;  2Z1D A;  1R22 A;  4F7Z A;  2FMY A;  5E79 C;  1MND A;  1TLH B;  3OWT A;  2DO7 A;  3MFK A;  4G7O F;  3N4M A;  2DOE A;  4RS8 A;  4C2T A;  4V2G A;  2FQ3 A;  1PDN C;  5EEH A;  2JWT A;  3L2R A;  4IHY A;  4KDP A;  5IP6 A;  1FOX A;  1TW2 A;  2GXG A;  4M9Z A;  3CQZ J;  1SVM A;  2EBI A;  1VQL I;  1RET A;  1K6O A;  3CME I;  3BDD A;  2OCE A;  3OYA A;  5ICC A;  5HOD A;  2VPR A;  3DEW A;  2DLL A;  5FD5 A;  2W85 A;  5GPC A;  1A04 A;  3T8T A;  3K4K A;  1YX5 A;  3SFI A;  3AG1 H;  2EK5 A;  2E19 A;  3CUQ B;  1J9I A;  2EZL A;  2K4B A;  2MC4 A;  5EZH A;  2P7V B;  1BI2 A;  5J6X A;  1E3O C;  2NRA C;  1JKQ C;  4HQM A;  4NNJ A;  3F8M A;  3Q3S A;  5ILU A;  4HOB A;  3RZD J;  2NVU B;  2DMN A;  2DOA A;  3HL2 A;  5CVJ A;  2PQ8 A;  1U9O A;  1I3A A;  2HEO A;  1V5G A;  1O3R A;  1ZQ3 P;  1AWC A;  4UUT A;  3IWF A;  3G1O A;  3ZQG A;  2HDC A;  2X6Y A;  2X1C A;  3J80 K;  2PMU A;  1PVE A;  1YO5 C;  4M72 A;  4XL9 A;  4ZDL A;  3SZG A;  3GFM A;  3PUB A;  1S7A A;  4LIT A;  4AIH A;  4B47 A;  3K4N A;  2KRF A;  1DP3 A;  4DW6 A;  3W2W A;  1MBJ A;  3ZMV A;  1JKP C;  2HTS A;  3LSG A;  4RMN A;  3N97 A;  3HKZ A;  1E3H A;  3KP2 A;  2EIK H;  2IGO A;  4I02 A;  4B3A A;  5B5E C;  2IS6 A;  4N0B A;  3QYE A;  2G7H A;  2ZXW H;  3RPQ A;  2JVH A;  4OMZ A;  4B43 A;  1ZG1 A;  3SZT A;  4MFE A;  2NVX J;  5DD8 A;  2E7X A;  2FA5 A;  1PUE E;  4N4N B;  1NK3 P;  3NRV A;  4CH7 A;  1OIS A;  4JOM A;  1KQ8 A;  4RAY A;  1IG7 A;  3BCA A;  1R5H A;  2KL4 A;  3TP0 A;  4OWR B;  5CVI A;  5KHD A;  4C2U A;  2L9V A;  2DN0 A;  3I9V 2;  3JRG A;  3CCE I;  3R6S A;  2Z99 A;  1ITY A;  1QZE A;  3V7R A;  3TO9 A;  2VQC A;  4V19 K;  2R7D A;  4GGG A;  1ERD A;  1ZTR A;  1X2M A;  4FET A;  4ENJ A;  1ZEL A;  2DXI A;  4ENN A;  1HXD A;  1JTY A;  1IC8 A;  2ETH A;  3PM1 A;  2OTJ I;  4IL6 C;  3GWZ A;  4DYR A;  4L0Y B;  3C2H A;  2L0K A;  5EG0 A;  3K1M A;  1VTN C;  1C0W A;  1AOY A;  1T38 A;  2PN6 A;  3QYB A;  4OMY A;  2C6Y A;  5FFX A;  1MMG A;  3EQL F;  1J75 A;  4CHU A;  2V7F A;  3E7L A;  3BG9 A;  5J1R A;  1BR4 A;  3K70 C;  4GCV A;  4I76 A;  3SEZ A;  3CJR B;  4U7B A;  3KP6 A;  4BXF A;  1BI3 A;  1DP7 P;  2DQL A;  2A05 A;  3GTL J;  3HOU J;  4Y15 A;  5E1Z B;  3QU3 A;  2QCO A;  3WE2 A;  3TL4 X;  2DOD A;  2V79 A;  3JCU C;  3QPH A;  2COB A;  2KIU A;  1IDY A;  2MH9 A;  4BDY A;  5FKM A;  3NAR A;  4Z6Y A;  2GA2 A;  3MZ8 A;  5TIS C;  3DPU A;  4ABZ A;  2MAB A;  2EJR A;  4M9X A;  3CCM I;  1XB4 A;  3EUA A;  1BI1 A;  3I5U A;  1FEX A;  3ESW B;  1FP1 D;  4LLL A;  5GAD J;  1I27 A;  1G59 A;  3C3W A;  1ETO A;  3OS1 A;  5LHH A;  2FU4 A;  5FRO A;  4NDL A;  3HUG B;  3GTK J;  3DKY A;  2CS3 A;  3CJQ B;  1TZL A;  2W1O A;  3NQO A;  4XN0 A;  4R79 A;  3HSR A;  1RC9 A;  1IDZ A;  5DCF A;  4D7M A;  4BE2 A;  3I4M J;  4FIS A;  4O6J A;  6PAX A;  1LDJ A;  2D1H A;  4LLG F;  3G4S I;  1KYW A;  5F6F A;  2BXY A;  1ON1 A;  3DWL E;  2Q2E B;  3QPS A;  3L2U A;  2VB6 A;  2H8W A;  1ETW A;  3TP3 A;  2GQQ A;  3OYE A;  3MAJ A;  5FB2 A;  2IGM A;  1R1T A;  4XNF A;  1SAU A;  2ZME B;  1ORK A;  3LL7 A;  5HVQ C;  3PO3 J;  4FX0 A;  3GZ6 A;  3SJM A;  2ESN A;  3QQA A;  1UFM A;  3RIR A;  3BR6 A;  1VQN I;  5HS7 A;  2P7C B;  5CVV A;  3K9T A;  5FLV A;  3WHC A;  2XPU A;  1X3W B;  3AL0 B;  5D6F A;  1FWZ A;  3FXM A;  3GTJ J;  4RAG A;  2ZME A;  1UEL B;  3I59 A;  3U1D A;  3AAF A;  2R7V A;  3V8L A;  2GIV A;  3P9I A;  1T08 B;  2IGK A;  4CIC A;  2VJJ A;  2IS4 A;  1JUS A;  3CD6 I;  4YFN F;  2KMU A;  3CTA A;  3RCO A;  1XSD A;  2YS9 A;  3ZXS A;  2EZI A;  4EGZ A;  4X6A J;  5E20 A;  2LBF A;  2DMQ A;  2EZK A;  2NOJ B;  3I59 B;  5J8C A;  3W6J B;  5D5W B;  3OY9 A;  1LFU P;  2QBY B;  5LFA A;  4EJU A;  1IZ1 A;  1MBK A;  3MZY A;  2HYJ A;  4E7J A;  2NXN B;  1BR1 A;  3TKY A;  3ZPL A;  2CQN A;  5KVR A;  2I8D A;  2CQ7 A;  2PEX A;  3K10 A;  1Z91 A;  2ZCW A;  3TMO A;  3ZOB A;  1UMQ A;  2JA2 A;  4L18 B;  3H9J A;  4BH9 A;  2HWV A;  3SDG A;  4F92 B;  5EGO A;  1W0U A;  2PJR A;  2LKP A;  1F5T A;  4L9N A;  2QF7 A;  4BY7 J;  1IN8 A;  3WGG A;  4L5J A;  4JX6 A;  5H6R A;  4M6Y A;  1WGX A;  3DXJ F;  3FM5 A;  4RAF A;  4BL0 B;  3JR9 A;  3K70 D;  2Z9O A;  3H3V K;  3RYR A;  2VQL A;  4PJN A;  3LWF A;  3MKL A;  4BDZ A;  1W4M A;  3DKX A;  3M7G A;  4BXX J;  2KDZ A;  2QGU A;  3RSN A;  1X1A A;  4O5V A;  3LFU A;  2L3D A;  1FOW A;  2CUE A;  1JHH A;  4AWX B;  4B8X A;  5EDN A;  2FOW A;  1F36 A;  1MDM A;  2K40 A;  1KYZ A;  3AG4 H;  4DJA A;  2Y30 A;  2RNJ A;  4FAS D;  4L9V A;  3C7J A;  4NQW B;  3V42 A;  1EJ9 A;  2UXN A;  1D1C A;  1R23 A;  3RKY A;  3M8E A;  2HYG D;  3ABM H;  4A2U A;  3SHF A;  3VEP A;  4WXH A;  4KIT B;  4P5O A;  3C2G A;  3HB9 A;  1MZB A;  1KGS A;  1MH4 A;  3IH3 A;  3O8G A;  3OS0 A;  5IYB J;  2HOT A;  3VSL A;  2W84 A;  2PFB A;  2O6G E;  1Y8Q B;  3GFI A;  1YIO A;  1Y1V J;  3FF5 A;  4M3D A;  2ZB9 A;  3QPT A;  1R49 A;  1EA3 A;  2KZV A;  1XGO A;  2DA2 A;  2NOG A;  3G1M A;  5LGT A;  3OYJ A;  2QA4 I;  2WAF A;  1FT9 A;  1O3S A;  1TNS A;  1O57 A;  5AIQ A;  4C3J J;  3DPL C;  4C3I J;  1JJ8 C;  1I3Q J;  2BHY A;  4XID A;  2OBP A;  3DP7 A;  4HF0 A;  3GFJ A;  2Z16 A;  3BOQ A;  3BG3 A;  1H9T A;  3HOX J;  5FRM A;  2W57 A;  3LSR A;  4BQQ A;  1QO0 D;  4RGS A;  1ODD A;  1I6X A;  5JVT A;  5EGO B;  5AIP A;  4WWC A;  3BZK A;  3D1N I;  3WE3 A;  1OMI A;  2LOO A;  1SAN A;  4LG3 A;  4J01 A;  2HDD A;  3CMA I;  2AQE A;  2ID3 A;  4PGH A;  3HPH A;  1SAX A;  1SEU A;  2HR3 A;  2KIM A;  3DLL F;  3S1M J;  2M8G X;  4OAY A;  2IXS A;  4XOP A;  3DBH B;  3JTG A;  3A0H C;  3K1P A;  5M5W J;  3IV5 A;  2LDU A;  1BBY A;  4DIQ A;  2H6B A;  3UKG A;  1WRJ A;  4AIK A;  2FD5 A;  4CYC B;  4UV8 A;  1FYK A;  5FLM J;  2KHM A;  3S2D J;  2QWW A;  4LGW A;  1J59 A;  1F43 A;  3MKY B;  2MYS A;  3WHB A;  4XLP F;  4MNU A;  4ZJZ A;  3I64 A;  3D5R C;  2HPI A;  4PJ0 C;  3DBL B;  2N8G A;  4G6T B;  1V5F A;  4EM0 B;  1MBH A;  4HST A;  1VQ7 I;  4BBS J;  3J7A O;  1EF4 A;  1Z3Y A;  1X1B A;  3RKQ A;  1ZGJ A;  2DJI A;  3HOW J;  5IOY A;  2L4M A;  2F4M B;  2VOO A;  2R7W A;  1SVO A;  4RGU A;  2D2W A;  2JTV A;  2DCE A;  1SMY F;  2CQX A;  3K0L A;  4UVA A;  5D4R A;  3KEQ A;  3WTV C;  1RUO A;  2YX4 A;  2IP2 A;  3OSF A;  3OYH A;  1ZN2 A;  1YS7 A;  4AU7 A;  2TDX A;  4DYC A;  3AFH A;  3F9K A;  2ZNY A;  4MLO A;  2RGV A;  2DW4 A;  3O3K A;  1RKT A;  5M5Y J;  3UNG C;  2VJI A;  1TT5 B;  2IT0 A;  2QSG X;  1USS A;  2ZJR F;  2VBZ A;  2DA5 A;  1G6N A;  4ZDO A;  4IPA A;  3U9G A;  3CC2 I;  1UHM A;  2FML A;  5M3F J;  2BHZ A;  5K5Q A;  3DBR B;  4CYD A;  2IS1 A;  1R1V A;  3HRS A;  5DD4 A;  4D5C A;  3AL0 C;  5HDG A;  4L9J A;  2VI6 A;  3G73 A;  3BR1 A;  5GAH J;  1GLN A;  3H5N A;  4IXA A;  4RAZ A;  4LK1 F;  3OS2 A;  3ZMS A;  1LPQ A;  1A6I A;  3L09 A;  4LOC A;  4Y7N J;  2MSY A;  2ZKZ A;  3CCQ I;  2R3S A;  4UV9 A;  3WU0 A;  1H88 C;  3BJA A;  3BP8 A;  3DPT A;  4II3 A;  2MA3 A;  3SYT A;  1R7J A;  4G7Z F;  4BUP A;  2M5W A;  3OYM A;  3RKW A;  1XC5 A;  4C30 A;  5HDN A;  2BE5 F;  2ELJ A;  2K4J A;  3A01 B;  2OAZ A;  3LAJ A;  3WG9 A;  4I0B A;  3KPH A;  5D8K B;  4A6E A;  2R7Q A;  3S17 J;  4FE7 A;  2E1O A;  2M87 A;  4XR6 A;  2IAI A;  5HLI A;  1XPX A;  1Q1H A;  2DOF A;  3QP5 A;  2RNG A;  3LAP A;  3WTU C;  2COM A;  1TW3 A;  5E3N A;  2OV7 A;  1IN5 A;  3I3L A;  3F8B A;  4X1E A;  3HOZ J;  1X3U A;  5LLQ A;  1OQY A;  4KFC A;  1DUX C;  3H5R A;  1Y1W J;  3KEY A;  4R1H A;  1IRG A;  4QPO A;  3E97 A;  4CCO A;  2JPB A;  2XF6 A;  3KZY A;  4BGD A;  5J4V A;  3MEX A;  2XKP A;  3H5A A;  3E6M A;  4CA0 A;  1ULY A;  4OIR F;  3DU5 A;  1DU6 A;  4AID A;  1QPI A;  2LY9 A;  1MIJ A;  3Q0U A;  1LE8 A;  2R7S A;  2V1U A;  1VFC A;  1E0E A;  2L54 A;  3GLX A;  1CF7 B;  1ZAO A;  2KDO A;  1XGM A;  3CO7 C;  5JVG F;  1T0F C;  3FZV A;  4KIC A;  5E1X A;  5HDK A;  4XRF A;  1AU7 A;  3FMQ A;  2E35 A;  3GTG J;  4RLF A;  5IYC J;  1ETY A;  4DGW B;  3T1B A;  5EEA A;  2L7Z A;  4IEJ A;  2IGN A;  3IUO A;  3PIP F;  5L3F A;  1T95 A;  3WTT C;  2K9Q A;  4KNY A;  4XSX F;  1I39 A;  3ZQL A;  3M8J A;  3F8F A;  4GFB A;  2HVR A;  1BIA A;  3ZN1 A;  2XRN A;  1V5E A;  4YII A;  3FXL A;  4P9U A;  2HQN A;  1JKR C;  1XGS A;  2LLK A;  4XSZ F;  4CDG A;  1NK2 P;  4KMU X;  1OR7 C;  4AIJ A;  3QOD A;  1R5G A;  4MEX F;  3BTL A;  4M6X A;  2OQG A;  2BW3 A;  3HOV J;  1G3Y A;  4RGX A;  1YTY A;  1BL0 A;  3TW6 A;  3QOE A;  2A6H F;  2BEO A;  4WXD A;  1G3W A;  2XF7 A;  2WB1 A;  3ELK A;  1RPW A;  1Y6I A;  4KIG A;  4I6Z A;  2HVS A;  2XHK A;  4L9T A;  3H35 A;  5F27 A;  4Q4Z F;  1MBF A;  1W7P A;  4V2F A;  1D5Y A;  1P92 A;  2DK8 A;  2B7E A;  1VQP I;  3JAM K;  3X2Q H;  4KUM A;  1S72 I;  1LE8 B;  5IT9 K;  2CW8 A;  3LNQ A;  1IN6 A;  2I10 A;  5F1R A;  2CV0 A;  3I58 A;  1EKE A;  1GDT A;  3E1S A;  2CRG A;  4AC0 A;  3AG3 H;  2MD0 A;  3T8R A;  1JUM A;  5LHG A;  4HX8 A;  3K4J A;  4CCL A;  1B72 A;  3F6V A;  4I7H A;  3C18 A;  3QP6 A;  2BY2 A;  4DNC A;  2VT2 A;  2ZFW A;  3BG5 A;  2FJ1 A;  2JQ7 A;  2LF7 A;  3E6B A;  2XF5 A;  3B02 A;  1XG1 A;  3GW2 A;  3RZO J;  5DTD A;  4ZYE A;  2OD5 A;  1LB2 A;  4IQ4 A;  1E17 A;  4CCM A;  3K4M A;  2A5W A;  1UST A;  5TGT A;  2QKL B;  3OSG A;  1MJB A;  2L7F P;  2EA2 A;  3VSK A;  1P9Q C;  1Z77 A;  2GBY A;  4B3X A;  3LSP A;  2IRF G;  4KYW A;  3OYF A;  3NWT A;  2IA0 A;  3JTH A;  1P6R A;  2ECC A;  2XGD A;  4PSX A;  1PYV A;  4IZZ A;  1A35 A;  4RB0 A;  2VC1 A;  3BZC A;  4IQJ A;  3R0J A;  1JXS A;  3BT9 A;  5FO5 A;  4L5I A;  3EUH C;  1SC7 A;  2X9D A;  2PMH A;  4Y17 A;  4E7K A;  1XCV A;  4FQG A;  4JK1 X;  3I71 A;  2OA4 A;  4IHS A;  1GV5 A;  3KYD B;  2HU9 A;  1NH3 A;  3Q9V A;  5E3O A;  1KON A;  3HSF A;  1QPM A;  2DT7 B;  2L9R A;  3KFW X;  3PL8 A;  2NS8 A;  3JRC A;  2JSC A;  1MBG A;  1Z67 A;  3CJN A;  4NUB A;  2XKO A;  1P2F A;  1U8B A;  3LSM A;  1FSH A;  2DDB A;  1R9T J;  1IRF A;  3PFI A;  5D5U B;  4M6V A;  1HC8 A;  4P55 A;  1PJR A;  2WY8 Q;  3SDB A;  2OF7 A;  5FKK A;  1ZLJ A;  3E6D A;  5FRN A;  3JRF A;  2V6C A;  4Y13 A;  2Y48 A;  4Z2Y A;  4RDU A;  1ONV A;  1BW5 A;  5H20 A;  2PI0 A;  4HRI A;  4LIU A;  2KT0 A;  2F5V A;  3CUQ A;  5JLX A;  3CCU I;  2XGC A;  9ANT A;  5GAE J;  1K83 J;  3S15 J;  2KFD A;  5KK1 A;  2E2J J;  4XQF A;  3WTW C;  3I56 I;  3D5S C;  2A3S A;  2BOL A;  2VLA A;  1P7I A;  3RTR A;  4F91 B;  3KIO A;  5DCM B;  1VQ8 I;  3KE2 A;  3LQR A;  5FGM A;  5K1Y A;  3S1N J;  1U8R A;  1OYI A;  2BV6 A;  2ZJ2 A;  2Y31 A;  2CWE A;  1APL C;  1FMV A;  3ABU A;  3V7C A;  5LEK A;  4OIP F;  2QVO A;  1JGG A;  4XK4 A;  3BJO A;  1FBS A;  1FYM A;  1W5C C;  3E5X A;  2AS5 F;  3FXU A;  2XB0 X;  1ZH5 A;  3C1D A;  4GRI A;  4ZC3 A;  4HNV A;  4AYB A;  2DI3 A;  4E70 A;  3S14 J;  5IOZ A;  1TP4 A;  2XAU A;  4E6K G;  3CDH A;  2KIQ A;  4O3M A;  3JRH A;  3JRE A;  4IRH A;  3OYB A;  4G8X A;  4HQE A;  1LVA A;  1T56 A;  2LR8 A;  4DQ2 A;  5F04 A;  3ERM A;  1R6R A;  4KN4 X;  2LKX A;  1FC3 A;  2LD5 A;  1U6G A;  1UJ8 A;  4MFD A;  2HXO A;  2R5Z B;  2K9L A;  4EJW A;  2IPQ X;  3OIO A;  2WV0 A;  2QEX I;  5J1U A;  2CUZ A;  1YIJ I;  3F22 A;  5F0F A;  2EQR A;  1K78 B;  1ETX A;  4D1Q A;  2E36 A;  5DEQ A;  3OYL A;  4C2M J;  1V54 H;  3GLL A;  4HEA 2;  1TQM A;  3L9F A;  4A5M A;  4DBQ A;  3HHH A;  3OYK A;  3EPZ A;  1J7K A;  3EUH A;  3O6B B;  3EUK L;  3K4B A;  4PFP A;  2BZT A;  3MVP A;  1X4O A;  1DU0 A;  2DAO A;  2UUZ A;  4ASN A;  2Z5U A;  4PGG A;  4RM2 A;  1ENH A;  1UB9 A;  4HX7 A;  2CV2 A;  2KRC A;  2MC3 A;  1BJA A;  2EA4 A;  4IKF A;  4JP0 A;  2RQQ A;  2X85 A;  2ZME C;  3ECO A;  1ETQ A;  3GCM A;  1Z7L A;  4B4C A;  2G9W A;  2DA6 A;  4ON0 A;  2QBY A;  4BY1 J;  2KIF A;  4AVP A;  2R5Y A;  2DQR A;  4BNC A;  1N25 A;  3H0D A;  1YQA A;  4MQV A;  3IWZ A;  3M9A A;  2VAS A;  1QQI A;  1N78 A;  3VPR A;  4A12 A;  1MSE C;  2ID6 A;  3MWM A;  5HNF A;  3OYG A;  4I09 A;  4M9S A;  4OIN F;  2O8K A;  3HTS B;  4P96 A;  2EFO A;  1FMW A;  2K3F A;  5CQE A;  1FZP B;  5J47 A;  2L02 A;  1ZLK A;  2DPU A;  1F1Z A;  1ZAR A;  2H6C A;  1QVU A;  3LA2 A;  2A68 F;  2R7T A;  1TT0 A;  2XRL A;  2X4H A;  1RR8 C;  1H0M A;  4D5F A;  4ZYA A;  2OJE D;  2PJP A;  2HZT A;  1XSX A;  4I98 B;  2JZY A;  5K7H A;  1UHW A;  2P6S A;  5ILS A;  2VXZ A;  2K3P A;  3DV8 A;  1HDD C;  2LFB A;  1HLV A;  2GIZ A;  3R4K A;  2ZBK A;  1SVL A;  3P9C A;  2A5Y B;  5GP9 A;  1WI9 A;  1OKR A;  1OCZ H;  5JLW A;  1VQ6 I;  2RQP A;  3I4N J;  1GUU A;  2E1M B;  3RDI A;  1R36 A;  3LA3 A;  5F0C A;  4YRV A;  3H3Z A;  1T8I A;  3PSF A;  3BTC A;  2Z33 A;  4CUG A;  4UNO A;  2K86 A;  2AXT C;  5E8I A;  2WV1 A;  4QTR A;  3MCZ A;  3B73 A;  3CCV I;  1G3T A;  4UHT A;  3L2C A;  3OIP A;  4II2 A;  4ZZD A;  2FX0 A;  2YU3 A;  2IA2 A;  2VBY A;  3IP4 B;  3DTE A;  2M1B A;  1XMX A;  1FX7 A;  5L3B A;  2HOS A;  2JRT A;  2A61 A;  5EZG A;  4J00 A;  1I6H J;  5F64 A;  3WTY C;  2Y9Z A;  2DT5 A;  4A3G J;  4RGR A;  4ZYG A;  4XRM A;  1IV8 A;  5TJJ A;  1KQ0 A;  1R71 A;  3A03 A;  1L3L A;  2DYR H;  2R93 J;  2WAD A;  1Z0X A;  2R92 J;  2LSO A;  4ENM A;  4I99 C;  3BQY A;  1QHG A;  1NG7 A;  2X0L A;  4NHJ A;  4JYK A;  1YJ9 I;  3GZ5 A;  3A2K A;  1FSE A;  1W5S A;  2A07 F;  1WSU A;  2E1N A;  1R00 A;  2F48 A;  1HOM A;  1N75 A;  4UVB A;  3KLO A;  4F93 B;  3J81 K;  2EH3 A;  2O03 A;  1HKT A;  2BXZ A;  1SFO J;  3ZQC A;  3IH4 A;  1EV7 A;  4C9Y A;  2VQH A;  3J7Z I;  2NYX A;  4XIC A;  2LVS A;  1HF0 A;  1HA8 A;  2CYY A;  5LHI A;  2ELH A;  1Y0U A;  3CF5 F;  5C4J J;  4UY8 I;  2Q1Z B;  4HG2 A;  2XSJ C;  4OIO F;  2IJL A;  4KJZ A;  2D5V A;  3WOD F;  1WVR A;  3L7W A;  1D1B A;  2XSD C;  1W0T A;  2AXL A;  4C3H J;  3QU6 A;  3DU6 A;  5J1Y A;  1VQO I;  1YRN A;  1AKH A;  2NS0 A;  1B8I A;  3IAM 2;  3HOS A;  3RJP A;  5IT9 Z;  1R4M B;  1EH8 A;  3VYU B;  4BJ6 C;  2ZXH A;  3HRU A;  2GAU A;  2E1M C;  3R61 A;  3ZMT A;  5A2Q K;  3M1C A;  1SD7 A;  2DA3 A;  1YE9 A;  2L01 A;  3ASN H;  4CGZ A;  2AO9 A;  3HHG A;  4CO8 A;  2M0M A;  2MBF A;  3IHU A;  4IRG A;  2XGE A;  4IO9 F;  4D7N A;  1YHQ I;  2KIS A;  3L2V A;  1BJZ A;  3ABK H;  2WY7 Q;  4ESF A;  3DCF A;  2YX7 A;  2EFW A;  2LKS A;  1PP7 U;  2JA8 J;  3CDI A;  2HPM A;  1KU3 A;  2R5Y B;  1ZR4 A;  2ZC2 A;  1HW1 A;  3SEQ A;  2B9S A;  2HQ5 A;  3DKW A;  1NG6 A;  3PO2 J;  2DMT A;  4RB2 C;  3S93 A;  4EM1 A;  4E7I A;  4FTH A;  1WH7 A;  2CH0 A;  3ABL H;  4DZJ A;  2CG4 A;  4NQW A;  1MMS A;  4UUS A;  1PUF B;  3ZCO A;  3P7N A;  4BAC A;  4AUX A;  5M5X J;  4EAT A;  2EPF A;  4F52 A;  4A3F J;  1Q1V A;  3T5X A;  5LGU A;  2NVT J;  2XGX A;  5CVR A;  2FQ4 A;  4M3G A;  4Y3O A;  4YFX F;  5D5V B;  1IAW A;  3JRB A;  4XLF A;  1W7P B;  3J81 Z;  2ICW G;  4A69 C;  1QNT A;  1LVK A;  2CUJ A;  3PNV A;  3ZQQ A;  4QIW N;  2D1V A;  1VI0 A;  2STT A;  2IW5 A;  5M3M J;  3OL4 A;  3BTI A;  1A5J A;  3HC7 A;  4EM2 A;  2V1N A;  3DEE A;  3FMR A;  1UZC A;  4GXO A;  2TCT A;  5GTH C;  2AHQ A;  5C44 J;  1A31 A;  2Y0S A;  4XLE A;  4B48 A;  5ILV A;  1LDK B;  3ULQ B;  5EJC A;  3CUO A;  4M3E A;  5DDG A;  1Y56 A;  5E18 F;  4A3J J;  3ECH A;  5KCM A;  2FNP A;  3WGH A;  2R7O A;  4ESJ A;  2M30 A;  2UXX A;  3BG6 A;  4BAY A;  1VQ4 I;  1LEB A;  2FSW A;  3NEU A;  2VBX A;  1UAA A;  1HKS A;  2Z3Y A;  1MJA A;  2GXA A;  1RI7 A;  4U0Y A;  3IL2 A;  2X48 A;  4Y33 A;  1MJ9 A;  4CSW A;  3KET A;  2GLO A;  1OYW A;  2L5Q A;  3W6V A;  4HF1 A;  1GVD A;  3TO6 A;  1WZ2 A;  2VON A;  1YS6 A;  1JTX A;  4XKV A;  5E8G A;  1Z6R A;  4EQQ A;  5BPD A;  1YW9 A;  4BQO A;  3VYR B;  1SFE A;  4LG0 B;  2FF4 A;  2ELK A;  2Y0M A;  4HYE A;  4MO7 A;  3BWG A;  5HNH A;  1MNM C;  2V1X A;  2WWY A;  3KYC B;  3HRT A;  3KLN A;  2KP6 A;  3ZMD A;  3V8J A;  4D9J A;  3HBL A;  4XON A;  2F4I A;  4MTE A;  4HDU A;  2O9L A;  1JHF A;  1AKH B;  2VC0 A;  2VKE A;  1D0X A;  1RES A;  3HXL A;  3M1E A;  1FY7 A;  1WJA A;  1DGR M;  4JBA A;  4CYC A;  2XAH A;  4D0P A;  1R1U A;  4HV5 A;  1MD0 A;  1T0F A;  4A3K J;  2ACJ A;  4U0W A;  3K1N A;  1UG0 A;  4EMS A;  1T2K A;  1JKO C;  3M4O J;  2OUM A;  1X1P A;  1OYY A;  3LST A;  4E7Z A;  3V4G A;  3HEF A;  2CO5 A;  1H9G A;  3HGY A;  3DF8 A;  4PUS A;  1MW7 A;  1BC8 C;  3ONQ A;  4PZJ A;  2P81 A;  4ZYD A;  3GVA A;  3RI4 A;  2DJN A;  2ZXJ A;  1QRY A;  2MGQ A;  3ASO H;  5CLS A;  1YI2 I;  2CGP A;  3MMY B;  4EEF G;  3O8H A;  5J3L A;  2CUF A;  4A6D A;  3PJR A;  3TQN A;  2K02 A;  5IP9 J;  1RZ4 A;  3H3U A;  2RDP A;  5D6E A;  2QQ8 A;  1J5Y A;  1BOB A;  4HPQ A;  1J09 A;  2JPC A;  3CC7 I;  1H8A C;  3NAU A;  3MQ0 A;  2H09 A;  4PJJ A;  3F21 A;  2FOK A;  1XD7 A;  4NC6 A;  2F5D A;  1ON2 A;  3FXO A;  1VZ0 A;  2M4G A;  2R7X A;  3KEO A;  4BBR J;  3EYY A;  5HOO A;  3HYI A;  1G2H A;  4LG0 A;  3S16 J;  1V3F A;  5DUI A;  3FM3 A;  3VFZ A;  3DTI A;  3F0C A;  1JT0 A;  2R5Z A;  2HKO A;  1XMK A;  1GV2 A;  1T33 A;  1FOK A;  3DLA A;  4FT8 A;  5E3L A;  4DBR A;  1KQ9 A;  1U2W A;  5K5R A;  2IA1 A;  2G7U A;  3ZGK A;  3HDD A;  3K2A A;  4OU0 A;  1B9N A;  3JAM Z;  5GPA A;  2XUB A;  5C3E J;  2HVQ A;  1D1A A;  4N9H A;  2QSF X;  1WKM A;  2HS5 A;  1QZY A;  3S32 A;  3CZ6 A;  2FBK A;  3FBN B;  1LEA A;  4NC7 A;  4Q48 A;  3FMS A;  3MKZ A;  2E2H J;  1S7E A;  4RM3 A;  4HF2 A;  1W36 D;  1ZRE A;  3TGN A;  4UUV A;  4E7S A;  3OOU A;  1SD6 A;  2VJ4 A;  1QA6 A;  1T39 A;  3HIF A;  3K6G A;  1IXC A;  3CCY A;  1FLI A;  5HS8 A;  4BQA A;  1SD5 A;  3PQJ A;  3KX2 A;  4I0A A;  1ZGA A;  2X6O A;  3BJ6 A;  3CP8 A;  4A3M J;  5K5O A;  4W97 A;  4HLY A;  2F5C A;  5TRD A;  1GHC A;  3A4C A;  3KP4 A;  4AYB N;  4ANJ A;  5B66 C;  2E5N A;  2F5E A;  4HSR A;  2IBD A;  2GA1 A;  2K27 A;  2H8R A;  3EYI A;  5CPR B;  4IHV A;  2DT6 A;  3COA C;  3GUD A;  4BHP A;  1BM9 A;  2M9H A;  1TNT A;  3HKZ N;  4Y4R A;  4B1R A;  2E1C A;  1ZG5 A;  2OCC H;  1WJD A;  2L7M P;  2MLK A;  3K2Z A;  1HCR A;  1POG A;  2DFE A;  3HRM A;  1SFX A;  2E60 A;  1DDN A;  1FBQ A;  4QSH A;  2FNA A;  1E2X A;  3Q9S A;  3ZQ7 A;  2DA1 A;  5IP7 J;  1W5T A;  1OJL A;  3S3O A;  1QBJ A;  1X4P A;  4BE1 A;  3CF2 A;  3OIQ A;  5F0H A;  1S9H A;  1TC3 C;  1Y8R B;  1A6Q A;  2BBY A;  1WCM J;  1R58 A;  5IT3 A;  2HQR A;  2W7N A;  2P5V A;  2GXB A;  3FKI J;  1R4N B;  2EIL H;  1MMA A;  2MH2 A;  1YIT I;  1TWG J;  3ML6 A;  4IHW A;  5L3G A;  5FLX K;  1L0O C;  3ISP A;  2LG4 A;  4XBF A;  5BS6 A;  1F4K A;  1FOY A;  1YJW I;  2L7K A;  3PFY A;  2R7Z J;  5BNG A;  3LSH A;  2PG4 A;  4HDV A;  1OR7 A;  3TED A;  2FRH A;  2BW3 B;  2K5C A;  4ZYH A;  2B0L A;  3HOT A;  4XN3 A;  5HLT A; 
#chains in the Genus database with same CATH homology
 1WGX A;  4C2M J;  1IGN A;  1TWF J;  1BA5 A;  2JA5 J;  3S1R J;  3JR9 A;  3H3V K;  3IH2 A;  3MKL A;  3FK6 A;  3MVP A;  1DU0 A;  1AHD P;  2JMW A;  4BXX J;  2KDZ A;  1ENH A;  1OCT C;  5EDN A;  2CUE A;  1UG2 A;  5EG0 B;  1F36 A;  4G12 A;  2K40 A;  4JP0 A;  4B4C A;  1ETQ A;  2Y30 A;  2DA6 A;  3G1L A;  4A3I J;  4BY1 J;  1IRZ A;  2R5Y A;  2CQQ A;  1CQT A;  4FCY A;  3HB9 A;  1MH4 A;  3IH3 A;  3O8G A;  1GT0 C;  5IYB J;  2HOT A;  1NTC A;  3CMY A;  3VPR A;  1MSE C;  2ID6 A;  2W48 A;  2MW8 A;  2O8K A;  4M3D A;  1Y1V J;  3BR5 A;  2ZB9 A;  2WAQ N;  1QVU A;  2DA2 A;  2NOG A;  2YUS A;  3G1M A;  3MN2 A;  4A93 J;  4Y52 J;  2XRL A;  3ZQF A;  5DS9 A;  4D5F A;  1P7J A;  4C3J J;  3BQZ A;  4C3I J;  1JJ8 C;  1I3Q J;  4XID A;  5K7H A;  3BG3 A;  3HOX J;  1HDD C;  2LFB A;  1HLV A;  3LSR A;  5EGO B;  3M3Y J;  3C2B A;  3GTM J;  3D1N I;  5GP9 A;  2HDD A;  1SAN A;  5JLW A;  4L5E A;  2ID3 A;  5K7F A;  3GTQ J;  3I4N J;  1GUU A;  3Q0W A;  2DMP A;  5F0C A;  5FJ8 J;  3BTC A;  3S1M J;  2M8G X;  4QTR A;  2WV1 A;  2K9S A;  5M5W J;  1OFC X;  3FIS A;  3IV5 A;  5F1J A;  3JRD A;  1B8I B;  1JJ6 C;  1YRN B;  1ZGW A;  3UKG A;  2FX0 A;  2FD5 A;  4CYC B;  5FLM J;  2JN6 A;  3S2D J;  2HOS A;  2JA6 J;  5EZG A;  2JK3 A;  1WI3 A;  1I6H J;  1F43 A;  3WHB A;  3JRI A;  2Y9Z A;  4A3G J;  4XRM A;  2N8G A;  1MBH A;  3A03 A;  4BBS J;  2R93 J;  1EF4 A;  1Z0X A;  2JJ7 A;  1FJL A;  4A3D J;  3RKQ A;  2R92 J;  3Q0V A;  2G0E A;  3HOW J;  3GBG A;  5IOY A;  3BQY A;  3GTP J;  2RAE A;  2CQX A;  4FE4 A;  2ECB A;  4JYK A;  3BR3 A;  2VKV A;  4S0H B;  1IJW C;  1FTT A;  1TWA J;  1MBE A;  1HDP A;  1HOM A;  5EF6 A;  2EH3 A;  1VND A;  1RR7 A;  3OSF A;  2Y0S N;  3L1P A;  1SFO J;  2XPW A;  3LOC A;  4DYC A;  3ZQC A;  5FKO A;  1X58 A;  3IH4 A;  1U78 A;  3HOY J;  4MLO A;  2O7O A;  1U9N A;  1IUF A;  2Y9Y A;  4XIC A;  2LVS A;  5FKN A;  1HF0 A;  1RKT A;  2YU9 J;  5M5Y J;  5C4J J;  3B6C A;  2DA5 A;  2D5V A;  3HGG A;  4MIM A;  5M3F J;  2MG4 A;  1ETV A;  2XSD C;  1W0T A;  4D5C A;  4C3H J;  5J1Y A;  1YRN A;  1AKH A;  1B8I A;  2VI6 A;  1XS9 A;  3BR1 A;  1RKW A;  1ZKG A;  2OPT A;  1A6I A;  4LOC A;  4Y7N J;  2MSY A;  5IYD J;  1MH3 A;  1H88 C;  1BW6 A;  1MSF C;  1WPK A;  4A3E J;  2ME0 A;  1ETK A;  2DA3 A;  2NS7 A;  2AO9 A;  1XC5 A;  2XGE A;  5F08 A;  4D7N A;  3A01 B;  2TRT A;  5IPA A;  1BJZ A;  3DCF A;  2LK2 A;  3S17 J;  4FE7 A;  2NVY J;  3K7A J;  2JA8 J;  4A3C J;  2E1O A;  2R5Y B;  1QVT A;  1ZR4 A;  2CU7 A;  2Y2Z A;  1JUP A;  2IAI A;  3GTO J;  2HQ5 A;  2E2I J;  2VUM J;  1ZK8 A;  1TWH J;  3ZQI A;  3PO2 J;  2DMT A;  5E3N A;  2EZH A;  2XB5 A;  4FTH A;  1WH7 A;  4DZJ A;  4X1E A;  3HOZ J;  4UUS A;  1PUF B;  1Y1W J;  4V2G A;  5C4X J;  2JWT A;  2GM4 A;  4AUX A;  5M5X J;  4IHY A;  5IP6 A;  3BR0 A;  4A3F J;  1Q1V A;  3S2H J;  4RBO A;  2NVT J;  3H0G J;  3CQZ J;  2EBI A;  4A3B J;  2FQ4 A;  4M3G A;  1RET A;  1DU6 A;  3JRB A;  2HXI A;  4A69 C;  5HOD A;  2VPR A;  2LY9 A;  3DEW A;  3Q0U A;  1LE8 A;  1QPI A;  1VFC A;  4QIW N;  5GPC A;  1VI0 A;  5M3M J;  3SFI A;  4JX4 A;  3BTI A;  1O4X A;  2E19 A;  3BR2 A;  1AU7 A;  2EZL A;  3GTG J;  1A5J A;  5EZH A;  5IYC J;  1OCP A;  1ETY A;  1E3O C;  2TCT A;  5EEA A;  1JKQ C;  2L7Z A;  4IEJ A;  2AHQ A;  3Q3S A;  5C44 J;  1B72 B;  3RZD J;  4XRS G;  2CJJ A;  2DMN A;  2K9Q A;  5E3M A;  2M34 A;  1U9O A;  4M3E A;  3ZQL A;  5FKL A;  1ZQ3 P;  4GFB A;  4A3J J;  4UUT A;  2K9N A;  3G1O A;  3ZQG A;  1JKR C;  2LTP A;  3HM5 A;  2LLK A;  1VF9 A;  1NK2 P;  2X48 A;  2GLO A;  3W6V A;  1GVD A;  4DW6 A;  3JRA A;  1JKP C;  1MBJ A;  1JTX A;  3BTL A;  3B6A A;  2M0C A;  3LSG A;  5K7Z A;  3HOV J;  4B3A A;  1BL0 A;  3TW6 A;  2ELK A;  4MO7 A;  1I50 J;  1MNM C;  4MFE A;  1RPW A;  2NVX J;  4A3L J;  3CDL A;  2JA7 J;  4I6Z A;  3HBL A;  1NK3 P;  5F27 A;  2O9L A;  1MBF A;  4V2F A;  1D5Y A;  1AKH B;  1IG7 A;  2VKE A;  1RES A;  3TP0 A;  1WH5 A;  2DN0 A;  4CYC A;  3JRG A;  1LE8 B;  2PMZ N;  1ITY A;  3LNQ A;  2I10 A;  4A3K J;  1GDT A;  2M2E A;  2CRG A;  1JKO C;  3M4O J;  1ZTR A;  1X2M A;  4AC0 A;  1JTY A;  1JUM A;  3HEF A;  1IC8 A;  3HGY A;  1B72 A;  3PM1 A;  3BTJ A;  3FK7 A;  4DYR A;  2XPV A;  2L0K A;  5EG0 A;  1JT6 A;  2P81 A;  1UHS A;  3BG5 A;  2FJ1 A;  2DJN A;  1QRY A;  2MGQ A;  4EEF G;  3O8H A;  1XG1 A;  2CUF A;  5J3L A;  5DTD A;  3E7L A;  3RZO J;  3BG9 A;  5J1R A;  4W1U A;  5IP9 J;  2R0Q C;  2DA4 A;  4I76 A;  1H8A C;  4DYQ A;  3NAU A;  3OSG A;  2WB1 N;  2L7F P;  3GTL J;  3HOU J;  1Z77 A;  2QCO A;  2GBY A;  3LSP A;  4M3B A;  2COB A;  1IDY A;  5FKM A;  3NAR A;  2ECC A;  2XGD A;  4BBR J;  4ABZ A;  1G2H A;  2LP0 A;  1FEX A;  3S16 J;  4XRS A;  3BT9 A;  1K61 A;  2X9D A;  3F0C A;  1JT0 A;  2R5Z A;  1ETO A;  1GV2 A;  3QPL A;  1GV5 A;  1T33 A;  4NDL A;  1H89 C;  5E3O A;  3GTK J;  5E3L A;  2HOA A;  3HDD A;  2L9R A;  2NS8 A;  3K2A A;  3JRC A;  5GPA A;  1MBG A;  1IDZ A;  4D7M A;  3I4M J;  4FIS A;  5C3E J;  3TW7 A;  4BKX A;  1U8B A;  1R9T J;  2DTZ A;  3A02 A;  3QPS A;  4M6V A;  2E2H J;  2OF7 A;  1S7E A;  5FKK A;  3JRF A;  1ETW A;  3TP3 A;  4RDU A;  1BW5 A;  3OOU A;  2KT0 A;  3CCY A;  5JLX A;  1ORK A;  2XGC A;  9ANT A;  3PO3 J;  1K83 J;  2IEK A;  3S15 J;  2E2J J;  2B63 J;  3ZQH A;  3SJM A;  3QQA A;  2HI3 A;  2X6O A;  4A3M J;  1P7I A;  3BR6 A;  1LFB A;  1FTZ A;  4W97 A;  4AYB N;  3A01 A;  5FLV A;  3WHC A;  2IBD A;  2DMU A;  2XPU A;  5EYR A;  3LSJ A;  4DZP A;  2H8R A;  3S1N J;  4IHV A;  3GTJ J;  2Y31 A;  2M9H A;  1APL C;  1TWC J;  3HKZ N;  4XK4 A;  1JGG A;  4B1R A;  4UUS B;  1PUF A;  1JUS A;  2L7M P;  1ZR2 A;  2XB0 X;  2DA7 A;  2ME6 A;  1HCR A;  1POG A;  2YS9 A;  2EZI A;  4X6A J;  4QSH A;  5IP7 J;  2DA1 A;  2DMQ A;  2EZK A;  4HNV A;  1OJL A;  1LFU P;  4IHX A;  3S14 J;  2NVQ J;  5IOZ A;  1MBK A;  2HYJ A;  5F0H A;  1TC3 C;  4JX5 A;  1WCM J;  3JRH A;  3JRE A;  1FIP A;  1X2N A;  3FKI J;  1FIA A;  3S1Q J;  1T56 A;  2LR8 A;  5F04 A;  1TWG J;  3RQI A;  3ZOB A;  4IHW A;  1UMQ A;  2LKX A;  2H1K A;  2LD5 A;  1IV6 A;  4MFD A;  2HXO A;  2R5Z B;  4J19 A;  5EGO A;  3OIO A;  3SDG A;  2R7Z J;  5BNG A;  1W0U A;  5J1U A;  3TED A;  2QF7 A;  4BY7 J;  5F0F A;  2EQR A;  3FIW A;  1ETX A;  4JX6 A;  4M3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...