1ETOA

The crystal structure of e. coli fis mutant r71l
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
87
Chain Sequence
b'DVLTVSTVDQVTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTLGNQTRAALMMGINRGTLRKKLKKYGMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 29
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etoA00
1A5JA 2CJJA 4BXXJ 2WAQN 2LP0A 2RAEA 4CYCB 2XB5A 2AHQA 3TP0A 5FJ8J 2GBYA 2HOSA 4HNVA 2N8GA 3BG9A 2O9LA 1JUPA 1ZK8A 1JJ6C 4AC0A 1B8IB 2DJNA 4MLOA 5F1JA 3A01A 5IP7J 2NS8A 3HOXJ 3B6AA 2COBA 2R92J 4CYCA 3IH2A 2XGCA 4BY7J 4EEFG 1H89C 4AYBN 3ZQIA 5M3FJ 5C44J 1W0UA 2R5ZA 3ZQCA 3S14J 2MG4A 2EBIA 1NTCA 4DZPA 2M2EA 4DZJA 5EG0A 1IDZA 1H8AC 4S0HB 2R0QC 5K7HA 2R5YA 3S2HJ 2CRGA 5EDNA 2IEKA 3G1MA 2CU7A 3OSFA 2VI6A 2DA2A 5GP9A 1DU0A 5J1UA 4A3BJ 2VUMJ 3FISA 4I76A 4C3HJ 1HF0A 5F04A 1VI0A 2JWTA 3BR0A 3A02A 1T56A 4BBRJ 1HDPA 2ECBA 2XRLA 2JA7J 2IAIA 1HOMA 1O4XA 2NS7A 4FISA 2CQXA 4JP0A 3HGGA 4LOCA 3HM5A 3O8HA 2NVYJ 5FKLA 2PMZN 3IH4A 3S2DJ 5GPAA 3GTQJ 5EZGA 5F0CA 1HDDC 1SANA 2Y9YA 2NVTJ 3S1QJ 2X6OA 3S15J 1UHSA 3BG5A 1I6HJ 2XPWA 4ABZA 2DMTA 4MFEA 1Y1WJ 2OF7A 2M0CA 3PM1A 1IDYA 2DTZA 3ZQFA 3G1OA 2EZIA 4A3EJ 3C2BA 3W6VA 2ID6A 2WV1A 4FCYA 1IV6A 2DA3A 2JA8J 1QPIA 2JA5J 4V2GA 3A03A 5FLVA 1WH5A 4V2FA 2DMQA 1GT0C 4I6ZA 5JLWA 4A3IJ 4C3JJ 2HI3A 1IGNA 1FIPA 2K40A 5FKNA 1TWAJ 5IOZA 1UMQA 2JJ7A 5FKKA 4C3IJ 2LK2A 2VKVA 5E3OA 2FD5A 2XGDA 2LD5A 2H8RA 3BR2A 1YRNB 3M3YJ 4M3BA 2X9DA 3S1MJ 5M5XJ 1ZQ3P 1MNMC 2GM4A 3S17J 1X2NA 5E3MA 1GUUA 1CQTA 4Y52J 3RZOJ 4JYKA 4A3DJ 3HBLA 1LFBA 3HOWJ 3FK6A 2NVXJ 5J3LA 3A01B 3TP3A 1UG2A 1YRNA 2L0KA 1MSFC 3PO3J 4L5EA 2DA4A 3OIOA 3Q0UA 2HXIA 4X1EA 1IG7A 1RKTA 4RBOA 3PO2J 2R5ZB 2M8GX 2K9NA 4XRSG 3B6CA 4A93J 3GTOJ 3F0CA 2IBDA 4A3GJ 3JRIA 2DMPA 4QTRA 5EG0B 2ZB9A 3UKGA 4DW6A 1QVUA 4M6VA 1B72B 2CUEA 2R5YB 4M3DA 5FLMJ 3HDDA 3NAUA 1WI3A 4A3CJ 1RR7A 3NARA 3S1RJ 2NOGA 5E3NA 1X2MA 2ME0A 2R93J 3I4NJ 3BR1A 4G12A 2EZKA 3TW7A 2AO9A 1B72A 3TEDA 4B3AA 1JTXA 1PUFA 1MH3A 5C4XJ 1OCPA 1U9OA 3BR3A 5C4JJ 1MBEA 1IC8A 3HEFA 1NK2P 1GVDA 4NDLA 2L7MP 1ZR4A 2JN6A 2MSYA 3OOUA 2G0EA 1P7JA 5J1RA 3SFIA 3LNQA 1JJ8C 2JK3A 2LR8A 1OFCX 1H88C 1BW5A 3I4MJ 4B1RA 4X6AJ 3QPLA 5IPAA 1S7EA 4A69C 4FE4A 1ETXA 1ORKA 2LLKA 5IOYA 2LY9A 4A3KJ 1K83J 1U9NA 2Y0SN 2XB0X 2EH3A 1TC3C 1TWHJ 3GTJJ 1XG1A 3GTMJ 2EZHA 2XPVA 2FX0A 3Q0VA 4W97A 1BW6A 4UUSB 1BJZA 3QPSA 2XSDC 4A3JJ 3MKLA 5M5WJ 4JX4A 1IUFA 2QCOA 1WCMJ 5M5YJ 2EZLA 1WH7A 3M4OJ 4MO7A 3WHCA 3JRCA 2CUFA 2Y9ZA 1AKHA 1EF4A 4D7NA 5EF6A 1D5YA 1AHDP 1BA5A 1JUMA 4RDUA 2YU9J 4UUSA 3WHBA 1QRYA 2K9QA 1R9TJ 4DYQA 5HODA 1ETQA 3BTJA 1JTYA 3BQYA 4FE7A 3JRFA 4QIWN 4A3FJ 4B4CA 4A3MJ 1MBGA 3HOYJ 1GV2A 1VFCA 4Y7NJ 3GTPJ 2XGEA 2P81A 3CQZJ 3O8GA 5F0HA 4XRSA 3JRAA 1IRZA 2ECCA 2ID3A 1BL0A 2MW8A 2L9RA 3RQIA 1WPKA 1HCRA 3CMYA 1RKWA 1HLVA 3Q0WA 3MN2A 1ETKA 4D5CA 2NVQJ 9ANTA 5K7ZA 2DMUA 3K7AJ 5F08A 3BG3A 2E2IJ 1Z0XA 3K2AA 5EYRA 4IHVA 3ZQLA 2TCTA 1I50J 2DA5A 2ME6A 2FJ1A 4M3GA 4XIDA 4BKXA 1WGXA 5IP6A 1OJLA 5J1YA 1JKOC 3BR5A 5IYBJ 5IP9J 5IYCJ 2VKEA 1QVTA 3JREA 1MBJA 3FKIJ 5JLXA 3BTIA 2Y2ZA 1ZR2A 1ITYA 3IH3A 3S16J 3H0GJ 3QQAA 1LE8A 2HXOA 5FKMA 5IYDJ 1P7IA 3LSRA 2XPUA 1PUFB 5EGOB 3CDLA 1JGGA 2QF7A 2DN0A 4MFDA 2HQ5A 2E19A 3ZQGA 3TW6A 4XRMA 1Q1VA 3VPRA 2Y30A 5E3LA 4QSHA 3ZOBA 1U78A 3BTLA 2LVSA 3CCYA 1ETYA 2O8KA 1DU6A 4XK4A 2H1KA 4IHXA 1FTTA 4JX6A 4AUXA 1XS9A 2HDDA 5EGOA 2E2JJ 3JRHA 2WB1N 3GTLJ 1FTZA 2EQRA 5BNGA 5DTDA 3L1PA 5EEAA 3HOZJ 3JRDA 1TWGJ 3JRBA 1I3QJ 2M9HA 3MVPA 1B8IA 4GFBA 1ETOA 2KDZA 4FTHA 3HOUJ 4DYCA 1F36A 2HOAA 3LSJA 1RESA 3GTKJ 3S1NJ 1AKHB 3GBGA 4M3FA 3DEWA 2YUSA 1FEXA 2CQQA 5EZHA 1RPWA 4IHWA 3FK7A 3OSGA 2DA7A 1VNDA 2E2HJ 1OCTC 1W0TA 2I10A 1MSEC 4XICA 2OPTA 1MBKA 2GLOA 3E7LA 1MBFA 3BTCA 2HOTA 5DS9A 2DA6A 3FIWA 1MH4A 2L7FP 1JKRC 2E1OA 2KT0A 3ZQHA 1Z77A 2LTPA 3BQZA 1GDTA 3H3VK 3SJMA 1TWCJ 1K61A 4M3EA 4D7MA 4BY1J 2W48A 2L7ZA 1FIAA 4IEJA 3LOCA 2D5VA 2M34A 2HYJA 5F27A 4DYRA 1ENHA 3LSGA 4J19A 3HKZN 2ELKA 2JA6J 1F43A 1ZKGA 2X48A 3D1NI 1RETA 2LFBA 1APLC 4C2MJ 2TRTA 1SFOJ 4UUTA 5M3MJ 3DCFA 4IHYA 5FKOA 3HOVJ 2O7OA 1T33A 2DMNA 1VF9A 2FQ4A 3Q3SA 5K7FA 1TWFJ 3SDGA 3GTGJ 1Y1VJ 3IV5A 1G2HA 1LE8B 5F0FA 4D5FA 1JKQC 5C3EJ 2Y31A 3BR6A 3HB9A 2VPRA 1A6IA 1E3OC 1LFUP 2B63J 2LKXA 1POGA 1NK3P 2R7ZJ 4BBSJ 2MGQA 1ETVA 1IJWC 1FJLA 1AU7A 1JT6A 3LSPA 1U8BA 1ZTRA 1JUSA 3JRGA 3RZDJ 1ZGWA 4MIMA 1MBHA 1XC5A 3BT9A 4A3LJ 3RKQA 4JX5A 4W1UA 1X58A 2YS9A 5GPCA 3G1LA 3JR9A 2DA1A 1JT0A 1GV5A 2K9SA 3HGYA 2JMWA 1JKPC 1ETWA
chains in the Genus database with same CATH superfamily
2CJJA 5J8CA 2WAQN 2LP0A 1W1WE 2DFIA 4RB0A 2HOSA 2CO5A 2GOMA 5DD4A 4XLNF 2MBFA 3C3WA 3TGNA 3BPXA 4LITA 2ELHA 2VBXA 5J47A 1JUPA 4KJZA 2KZVA 4AC0A 4MLOA 3RYRA 3DLAA 2LMDA 1ERDA 2NS8A 4RAYA 2ZXHA 3SQNA 3WU1B 2XGCA 3BLYA 5J4YA 4CUGA 1J75A 4AYBN 3WU0A 3ASNH 3GEZA 3ZQCA 3K1PA 5LRRA 2P5LC 2MG4A 2ZJ2A 5DV5A 3MQ0A 1NTCA 1DQUA 2V1DA 1OISA 3KP2A 4DZJA 5EG0A 3HC7A 1CF7B 1WJFA 5K7HA 1W5CC 2LC2A 4ZYAA 4HQMA 3RSNA 2CU7A 2M87A 1ZHFA 1KYZA 2VI6A 3ZMTA 5J1UA 1ON1A 2OZ6A 1LDKB 2VUMJ 4ESFA 4C3HJ 1HF0A 2X1DA 1VI0A 1Z7LA 3BR0A 1MMSA 2V79A 4BBRJ 1VQ4I 4H4KC 4IVNA 2NS7A 4R8HA 5TISC 5CVJA 2J5OA 2BOLA 3C2HA 4JP0A 2Q1ZB 1IRXA 3DF8A 4LB6B 2QSGX 4ENKA 1MJ9A 3IH4A 3R0AA 5LBQA 4RB1A 2DAOA 1IZ1A 3SZPA 4WXDA 2AXTC 2EFNA 1HDDC 2Y9YA 1MGTA 4PJ0C 1IV8A 3S15J 1F1ZA 1XN7A 1I6HJ 2XAHA 3H5RA 3QODA 2G9WA 2KL4A 1IO2A 3LA7A 4I0BA 3TBIA 2W1OA 5JI6A 1MD0A 2M0CA 2Y69H 3PM1A 1IDYA 3G1OA 2EZIA 3W6VA 4U0WA 4FCYA 2DA3A 1QPIA 5GTIC 3KZZA 2XKOA 4V2FA 5J40A 2A68F 3CCRI 4A3IJ 2K3PA 1Y8QB 5D5UB 5FKNA 1TWAJ 4L9JA 3HSEA 5D4SA 5IOZA 3S2WA 3RPQA 1OCZH 5DCFA 2K9LA 4Q4ZF 2LK2A 2VKVA 1Z21A 2L4AA 2L9NA 2H8RA 2Q2EA 2OBPA 2R7SA 4KYWA 3I59A 1IN8A 2DQRA 4YFNF 3D5RC 2NRAC 4CHUA 2KRCA 2FU4A 3DKXA 4XOTA 1XSDA 1GUUA 1XSVA 5GAHJ 1CQTA 1T2KA 4HEA2 3EDPA 1W36C 3HOWJ 3K4BA 5DUKA 1F5TA 1UG2A 3N97A 2KHMA 2O5RA 4EATA 3WTTC 3W3CA 4KFCA 2KPMA 2V26A 4RBOA 3DXJF 2M8GX 4NC7A 2F4MB 2M4KA 1UG0A 3OYLA 2DMPA 5D6EA 2ZSIB 3OYNA 4UVBA 1FC3A 4DW6A 4M6VA 1ZREA 4KUMA 1QHGA 2OCEA 2EK5A 4UHTA 3FXQA 4IHSA 2OQRA 4BHPA 3HDDA 2F5VA 1N75A 3NAUA 3ZQ7A 1VQ7I 4MNUA 5DYMA 5K5QA 2P6TA 1RR7A 2ZCWA 3NARA 3NRVA 2F6CA 1R49A 4ZH4F 4IRIA 1VTNC 2AO9A 3S32A 2HFHA 4XLFA 2XF5A 1PUFA 1FYKA 1LDJA 3LSHA 2V9VA 1MH3A 1WJBA 3ABUA 2Z3YA 1ZLKA 1R00A 2DODA 4Y4RA 2CV1A 1U9OA 1MBEA 3OR1C 1NK2P 3J7ZI 2L7MP 3D5SC 3DKWA 2PLYA 3CMAI 4U0YA 4RB3C 1N25A 1P7JA 3SFIA 3GXOA 2YX7A 1FNNA 2LR8A 4IRHA 1BOBA 1H88C 1BI2A 3CCQI 5FRNA 3I4MJ 1V4RA 3QPLA 3ZMVA 2JVGA 2XF6A 1R22A 1BIBA 2XAQA 3EYYA 1B59A 2DJIA 2STWA 1BBYA 1TC3C 2PMHA 3GZNB 3FZVA 2BZTA 2UV1A 1BR1A 2XPVA 4BQAA 4GRIA 3O6BB 2LSOA 2XSDC 2GQQA 5KCMA 2MYSA 2W24A 4A3JJ 4GDFA 5B1AH 4FX4A 4AU7A 2V7FA 1AKHA 3T5XA 1RZ4A 2JPCA 1YTYA 4N9IA 1AA7A 1D5YA 1Z3XA 1SVMA 3DPUA 4HAMA 4L9TA 4DGWB 2XAFA 3PQKA 2Z9OA 4XL9A 3WHBA 1QRYA 2K9QA 3IWZA 4YEJA 2UWMA 1R9TJ 3NWSA 2VQHA 2KRHA 2QGUA 1ZAOA 1JTYA 1WJDA 4PJLA 1XX5A 1SMTA 4FE7A 2CYYA 1GLNA 4GO1A 3FWEA 3FXMA 1ZGAA 2MD0A 2VB6A 2YR2A 4CCMA 1GV2A 1ZH5A 1G3YA 4OIPF 5EEGA 4RAFA 1EJ9A 3PJRA 3H9GA 1HQCA 5L3BA 3WTXC 2DFEA 2L9RA 1XGNA 2XAJA 5HS7A 3C2GA 2RV8A 2R7WA 3CMYA 2FF4A 3R61A 3SEQA 3OYJA 1RKWA 1HLVA 3U9GA 2LREA 2DMUA 4BL0B 5CQGA 2FBIA 3K7AJ 4MTDA 4F7ZA 4BDYA 4IHVA 3HOTA 3PSIA 3U21A 4II3A 2K4JA 4O6JA 3VYRB 1WHUA 2ME6A 1R6RA 1S6LA 2M5WA 1OJLA 1Q1HA 4CH7A 3BR5A 2A6HF 4HA8A 4B48A 3KEYA 2VKEA 1Z6RA 3VDXA 3QYFA 2IXSA 2MLKA 3S16J 1UJ8A 3E6MA 5FO5A 2ZXJA 2YSRA 2K86A 1P7IA 5E1XA 4Y13A 2MFZA 5LGNA 5IYDJ 2C6YA 2VPLA 1VZ0A 3OY9A 1LDDA 1JGGA 3KETA 4FX0A 2HQ5A 3TL4X 3OS0A 2E19A 2PI0A 1Q1VA 2KMUA 2X6YA 3VPRA 4IKFA 2Y30A 4G7HF 3V7SA 1DPUA 2MC3A 1K78B 3GUDA 4PJJA 1K4SA 3DLLF 4CZZA 2P6SA 1W4MA 2H1KA 1MDMB 2HGCA 4PDKA 4JX6A 2EV6A 2FA5A 3C1DA 2WC2A 2PBIA 3BJOA 1QBJA 2D2WA 1VQ9I 2QKMB 4ZTJA 2FMLA 3PIPF 1TWGJ 1USSA 2VBZA 4HV6A 1N77A 1ETOA 1G3SA 1OYIA 3HOUJ 1I3AA 1GHCA 4D9JA 4CA0A 2DK8A 2QWWA 1R7JA 3AG3H 1RR8C 4IJAA 3PUBA 2DOEA 5DUIA 2O3FA 3PQJA 3H9JA 1KQ9A 5HVQC 2DA7A 3CESA 2DT7B 1FP2A 2VJJA 1W0TA 3QYEA 1T0FC 2QUFA 2E35A 1MSEC 4M74A 1R5ID 2DPUA 4EM1A 5B1BH 2GLOA 3E7LA 1BM9A 2L9SA 1KQ0A 3FIWA 1Y56A 4NUBA 3UNGC 2E1OA 3BY6A 3K1MA 4XLPF 1TWCJ 2MH2A 4M3EA 2BGCA 2CSOA 1K7AA 5IT9Z 2IVMA 3HKZN 2ELKA 5D8KB 4U7BA 2BY2A 2E1MC 1F43A 2DYSH 2VBYA 4BJTA 2VKHA 4O3MA 3VYSB 2BW3A 4YELA 5A2QK 3MWMA 3MZYA 3JCUC 2HZTA 3OYAA 5GAGJ 1OKRA 3H9QA 2YX4A 4JQFA 3ABLH 2PJRA 4IHYA 1E2XA 2MD5A 1A36A 1BR4A 3ZN1A 2DCEA 2PX9A 3MMYB 2EV5A 1FSHA 3KFWX 3KCCA 3SDBA 3CUQC 1R23A 4LIVA 2HQNA 4PCQA 2XVCA 3OYKA 1WKMA 2MLGA 1SFUA 1TWFJ 5AIQA 2LRDA 3HRTA 2RGVA 2FUG2 3QAHA 4KT6A 3H5AA 3F8CA 1T39A 1XMAA 4NC8A 1LB2A 1U3EM 4ON0A 1G2HA 1LE8B 2KIQA 3V8LA 2AQFA 2PMZA 2RN7A 2OA4A 1NG7A 3JAMZ 2E7XA 2PQ8A 3OIQA 1ETVA 4ENNA 3J81Z 1AU7A 1FJLA 4EJVA 1JT6A 1ZYRF 3LSPA 4UB8C 1QQIA 1JE8A 3V8JA 2FOKA 4MIMA 1XC5A 1YW7A 3RKQA 1X58A 2DU9A 5GAEJ 3QRFF 3NWTA 3QOEA 4BACA 1JT0A 2K9SA 1J2XA 1RC9A 1JKPC 5E17F 1A5JA 2VL8A 4A6DA 1D0YA 4MEXF 5FJ8J 3WTYC 3I56I 2GBYA 1T0FA 3A4CA 3BG9A 3K2ZA 2O9LA 2ZBKA 3CP8A 1B8IB 2DJNA 3A01A 2EWNA 3HOXJ 3V8KA 2COBA 3K0LA 4DOZA 2R92J 1TT0A 2KQRA 3F9KA 1SFXA 1ZGJA 3I64A 4EEFG 1H89C 2DPDA 5FD6A 3E5XA 5M3FJ 1W0UA 4E7IA 3VYUB 1YLFA 1FBUA 4LK0F 1ZG5A 1YS7A 3S14J 2EBIA 2K27A 3OIPA 2EILH 3U1DA 2K5CA 1AOYA 2HNHA 2JUCA 1P4XA 2HR3A 1OLTA 3IAS2 4QWQA 2CRGA 2UUZA 2IEKA 2MABA 1R1TA 1RNLA 5BQTA 5GP9A 4BQOA 4A3BJ 2UXNA 3BG7A 2GA1A 1BN5A 4I76A 4KDPA 3KEQA 3ZN0A 2JWTA 3G3ZA 3L2VA 2OCCH 1Z7UA 3AG2H 3CUQA 3WTWC 4P55A 3L2CA 2ECBA 2XUBA 2JA7J 2IAIA 2VQGA 4OIRF 3D5LA 1ZRFA 2LBFA 1PDNC 3HHHA 2XROA 2CQXA 3D0SA 3M1EA 1RUNA 3ULQB 3SYTA 1RI7A 2XSJC 3NQOA 1SEUA 1IF1A 1HXDA 3HXLA 1MKMA 3MKYB 5ICFA 3H5NA 4IHTA 2CQNA 5EZGA 5F0CA 1SANA 3HYIA 5HS8A 1A35A 2NVTJ 2KIMA 1HBXG 3DFGA 1O3RA 1QZEA 4ABZA 5H6QA 3OV8A 3HIFA 3BROA 1Y1WJ 3B73A 5AONA 2FEZA 4AVPA 1RIOH 4A3EJ 4G6QA 3FXKA 3C2BA 3M8JA 3B02A 2ID6A 1XCBA 3JW4A 1YIJI 1TBXA 1YS6A 1IV6A 2A6EF 5TRDA 2OD5A 2GAUA 2FNPA 1WH5A 3T0YA 3JSOA 1VQNI 2M4GA 4KN7X 1IGNA 3LQRA 1FIPA 5CLSA 5EJCA 4KA4A 1X3ZB 2K40A 1UMQA 2OU2A 5FKKA 4C3IJ 5E3OA 2FD5A 2V6EA 3CO7C 2ZJRF 1QHHD 4U7DA 1X3WB 4E7ZA 3BR2A 3M3YJ 3FM3A 2JSPA 2XIGA 3EETA 3TO7A 2E34A 4RA2A 3N05A 4PSWA 5M5XJ 1ZQ3P 5ILUA 3BCAA 2GM4A 2Z99A 1MJAA 1X1CA 3I71A 1LNWA 5GADJ 3CCMI 4C30A 1HKTA 2VODA 4N4NB 1X1DA 2VQLA 3ZMZA 3TP3A 2BY1A 2GXAA 1YX3A 3FHNA 5E8GA 4L5EA 1OYYA 3RTRA 2OJED 2A3SA 2NYXA 4X1EA 1V3FA 3O3KA 2HU9A 3IKVA 3PO2J 1SD5A 1OCRH 2WY7Q 1HSTA 1M1EB 3JRIA 3DKYA 5EG0B 3UKGA 2H8WA 3G4SI 2VBWA 4PFPA 2R7RA 3AL0C 2CUEA 5FLMJ 2X4HA 4HSRA 2QQ8A 2BXYA 2Y0MA 1WJEA 2DK5A 3IUOA 1WI3A 1A6QA 2R4GA 3LL7A 3VSKA 4F3QA 1SAXA 2KRFA 5E3NA 5CYVA 3EUHC 4U0VA 1ZN2A 3W6KB 3LAPA 4KN4X 2WAFA 1W36D 3BR1A 2KJCA 1K6OA 2V4JC 4OWRB 4L9NA 5LRSA 2WWYA 5B5EC 3CTAA 3DEUA 2IW5A 1JGSA 3LSTA 5CPRB 2HVQA 3FDYA 2HPIA 5LLQA 2EFPA 1GVDA 4U87A 3Q5FA 3F8MA 2H6CA 4ETSA 5FGMA 1LUJB 2JPBA 3PNTA 3HPHA 1P4WA 4ASNA 2NVUB 2MSYA 3CP2A 2D1VA 3LNQA 1JJ8C 5BPDA 1SD7A 3OYBA 1YE9A 4PGGA 2ZSHB 4X6AJ 5IPAA 3ZP5A 1S7EA 4A69C 2F48A 2KISA 5IOYA 2LY9A 4A3KJ 3T1BA 4J00A 1PYVA 2Y0SN 2WA0A 2ZNYA 3V42A 2XC7A 2EH3A 3CC2I 2BV6A 2IGKA 5D5VB 4MEYF 3GTJJ 1TL8A 4HF0A 4XR6A 1K6YA 1BC7C 2FX0A 4ITVA 2HEOA 2QBYA 1BW6A 1P9QC 1ON2A 1BJZA 3QPSA 3MKLA 1ZLJA 4CCLA 2LF8A 5M5YJ 2EZLA 3RIRA 3WHCA 4P5OA 2Y9ZA 3ERMA 4BQQA 1EF4A 4E6KG 2O03A 3A1YA 5EF6A 3L7WA 1LEBA 3KP7A 3BOQA 1AHDP 2W84A 4IRGA 4XLCA 3DBHB 1L3LA 1U0JA 2M1BA 2WB1A 2YU9J 3CCLI 1Z3YA 4I09A 4IZZA 3IWFA 4KMUX 3GZ6A 3RDIA 5ICCA 3BTJA 3WTUC 2Q2EB 3JRFA 5HDGA 3I59B 1SMYF 4UB6C 2B9SA 3I58A 4I7HA 1U2WA 4A3MJ 4ANJA 3LA2A 5D5XB 1SAUA 2DW4A 1TQPA 3GTPJ 2XGEA 4HNUA 4XNFA 3O8GA 2ZFUA 4XRSA 1BI3A 3RQIA 2YPRA 2QKLB 2M0MA 3DU6A 3EUHA 3PNVA 4FHTA 2DFFA 3KLNA 4OIQF 1ONVA 2F2EA 2GOXB 2VC1A 3EQLF 1O3SA 1XSXA 2ETHA 3OYDA 1MNEA 4M73A 4D5CA 3KP3A 3KP4A 3FXRA 4WX9A 3OYEA 1R71A 2YU3A 2V1UA 4OAZA 3HTUA 1W5TA 3K2AA 5EYRA 4A0XA 2VJ4A 1KZHA 4F93B 3MEXA 2TCTA 4CO8A 1I50J 3MCZA 3UR3C 1YO5C 1WSUA 2AQEA 4S04A 2A5YB 3QYBA 4CXFA 5IP6A 3MD2A 4IO9F 1JKOC 1S9HA 3ONQA 3RPUA 5CVVA 4B47A 3JREA 3CD6I 1S7OA 1N78A 1ZR2A 2HTJA 2E1NA 3OR2C 2H27A 3FXLA 1X1PA 1SFEA 3QQAA 4YIRX 4CCOA 1P4AA 3LSRA 1PUFB 5FLXZ 2UXXA 1U8RA 3M07A 1WZ2A 4HF1A 3CDLA 5FB2A 1E3HA 1BJAA 5E79C 3M7GA 3ZQGA 2HZDA 3TW6A 4XRMA 1B9MA 4BS9A 5E3LA 4QSHA 3ZOBA 1U78A 2LVSA 3CCYA 4XORA 1A04A 2Q0OA 4DBRA 4XK4A 1UELB 3CCUI 4FASD 1XS9A 1IN5A 3KEOA 3F8BA 5LEKA 5ICGA 3FMSA 4IOCF 1FTZA 3GTLJ 1UFMA 2M30A 2R7DA 1OR7C 1E3PA 4CGZA 2FRHA 4JOMA 4LG0A 3T8TA 4HNTA 2Z33A 4P1WA 5EEAA 3L2RA 4G8XA 3TO9A 4Y15A 2R7UA 1I3QJ 1HW1A 4AIKA 3S3MA 1RUOA 2IRFG 3MVPA 4LB5A 3OOPA 4BYYA 2DI3A 2VJ5A 2KLOA 1XGSA 4WK8F 2A07F 2P7VB 3KP5A 1LKXA 4MQVA 1RESA 1HKQA 1AKHB 4M3FA 3DEWA 3KYDB 5LHHA 2CQQA 5EZHA 4IHWA 2WAQA 3PFYA 3RYPA 1VNDA 2ESHA 3AFHA 2MH9A 2I10A 5F1RA 1B1BA 1R5GA 4M6XA 2OPTA 1KA8A 3E5UA 1MBKA 3EYIA 3WG9A 3MFKA 3BJAA 3BTCA 3HHGA 4ENJA 2HOTA 2EIJH 4PUSA 1R4NB 2DOAA 2DA6A 4HYEA 4I0AA 3E0JB 3QU3A 4HOBA 5LD2C 2L7FP 2K4BA 4GYIA 3GFIA 3DBRB 1Z77A 2LTPA 2LY1A 3BQZA 5JFRA 4KMFA 1YHQI 3H3VK 3IP4B 5HLTA 3SJMA 1K61A 1FY7A 1SD6A 4AYBA 2W48A 3LOCA 5L3DA 4XM3A 2EFQA 1J09A 2HYJA 2OUMA 3T8RA 4CYDA 1ENHA 4DYRA 4J19A 2OTJI 2VN2A 1X19A 3MKZA 2JA6J 1ZARA 2WAEA 3ASOH 1RETA 1TZLA 2LFBA 5TGTA 3GLXA 4BH9A 1APLC 2VOPA 4C2MJ 4LLLA 2QQ9A 2CUZA 2QSFX 5DDGA 3I5UA 5E20A 2GIVA 3IHUA 5L3FA 4A6EA 4RB2C 2QA4I 2FXAA 1D1AA 2P7CB 3DCFA 1ODDA 1E17A 4XQFA 2IS1A 1IUYA 3GVAA 4NQWB 3RKWA 3E6DA 3GCMA 3MZ8A 2VOOA 4UY8I 4UNOA 1DPRA 1VF9A 3QWLA 3K4KA 3K10A 1XPXA 3FMQA 4LMYA 5K7FA 4ENMA 3GTGJ 3CZ6A 2D45A 1Y1VJ 4P96A 1X1BA 1X4OA 4R79A 3M9AA 1IRFA 3WTZA 1OR7A 3IV5A 1SFKA 5C3EJ 2IP2A 3ZMSA 3HB9A 2VPRA 3CO6C 3VFZA 4NQWA 2LKXA 1FP1D 1NK3P 2R7ZJ 4BBSJ 2MGQA 5KAIC 4G7OF 1MW7A 3KLOA 1O7LA 2F5DA 3LMMA 1O57A 3CDIA 4D0PA 1U8BA 1YI2I 4HW0A 1MBHA 3BT9A 3BC8A 2R7TA 3MZHA 1V5FA 2A05A 4W1UA 2OAZA 3K4NA 4M72A 1P92A 3HGYA 3WTSC 2JMWA 4Q47A 1FOKA 3GWZA 2ZJQF 1S8NA 1FT9A 1WQ2A 2RAEA 4RGUA 1EV7A 2AHQA 4L9VA 2F5FA 1DUXC 1IXSB 1TQIA 2R7QA 4RGXA 4HNVA 1VQMI 2N8GA 1WFXA 2DQLA 5FROA 4B8XA 1R1VA 1ZK8A 3LQQA 1JJ6C 3O2PE 2PMUA 3A2KA 4WWCA 5F1JA 4IF4A 5IP7J 3DPTA 2HVSA 3WTVC 1YW9A 3B6AA 1NG6A 2DDBA 3IH2A 4XKWA 1DDNA 2CS3A 3K4CA 3F22A 2BBYA 3OWTA 3RKXA 5C44J 5B66C 2XRNA 2R5ZA 2W00A 4UV8A 1FSEA 2WTEA 1BR2A 1G3TA 2EA4A 2M2EA 1TNSA 3VSLA 1KU2A 3HZJA 4S0HB 4HDVA 1H8AC 2R5YA 5LHGA 1L0OC 1QPMA 1UAAA 5EDNA 4LK1F 3G1MA 2V9PA 3I54A 3OSFA 2G7UA 2DA2A 4QLCU 2QQBA 3IL2A 1DU0A 1PP7U 1LEAA 2VT3A 1Z05A 3S3OA 3GW2A 3CMEI 3E6CC 3A0HC 1GXPA 1K79A 2G7HA 1JHFA 2ELJA 1ZELA 2DT6A 5F04A 4E7JA 5FFXA 3R4KA 2RVCA 4BE1A 2FSWA 3A02A 2STTA 3MKWB 3W2VA 2A61A 1B6AA 2HTSA 4L5JA 1EA3A 1HDPA 2XRLA 2JVHA 2ZC2A 3CF5F 1A31A 5IT9K 3L9FA 1HOMA 3LFUA 3TO6A 4A5MA 4FISA 4A0YA 3J7AO 3HGGA 4EQQA 3HM5A 3N4MA 3QU6A 2HS5A 2NVYJ 2BW3B 2L02A 3P9IA 1PVEA 3F21A 1GVJA 3F6OA 2XF7A 4DJAA 1XDUA 3S2DJ 1WJCA 2RKHA 2J5PA 5GPAA 2NNYA 1W7PB 2JRTA 3GTQJ 1FWZA 2I8DA 2PJRB 3F23A 1FX7A 2NAZA 2XAUA 2K85A 3OL3A 5FRMA 4XLEA 2H6BA 2DMTA 1QA6A 4FETA 4ZYHA 2OF7A 4E7KA 2DTZA 3FBNB 2DT5A 2EIKH 2VONA 1W7PA 5KK1A 4LG3A 1P6RA 2QENA 3K70C 2UZKA 4IQJA 1V54H 2HDCA 2JA8J 2JA5J 2VQCA 4V2GA 3DEEA 4B3XA 1JXSA 3A03A 5FLVA 1VQ8I 1FOYA 3JAMK 4YFXF 1OPCA 1UHMA 2Y48A 5JVGF 3J81K 5HOOA 5BPIA 2X6XA 4N9HA 2W7NA 4I6ZA 1FYMA 3OL4A 3J80Z 1Y6IA 2OC6A 3R60A 4AIDA 4S05A 3WE2A 3ROUA 2ZNZA 1UB9A 2XGDA 2CH0A 2L01A 2HQRA 4HSTA 3LAJA 3SEZA 1TP4A 2L5QA 4HBLA 3S1MJ 1K4TA 4CDGA 2ZXWH 2M7AA 2QM3A 1YOVB 1YIOA 4XBFA 4EJOA 1MNMC 4LLNA 3ZGKA 2VXDA 5E3MA 4Y52J 3AKZA 2R7VA 3BPVA 3RZOJ 4JYKA 4A3DJ 3HBLA 3RI4A 3GX4X 3FK6A 3H36A 1VQOI 5HLGA 3A01B 5FFZA 4YIFA 1MSFC 3SXYA 4ZYGA 2FOWA 2DTRA 4L0YB 3C18A 2L9VA 4AWXB 1TTYA 3HPGA 3OS2A 1RKTA 1I5ZA 2IJLA 4XRSG 3B6CA 1LJ9A 4ESJA 3FMRA 3F0CA 2IBDA 2GIZA 1F4KA 4QTRA 4YFKF 2R7FA 2VLAA 2E1MB 3TOAA 3CCJI 1UZCA 1FOXA 3KX2A 4M3DA 3BP8A 1WVRA 1XMXA 2ZMEC 5CJ9A 4AM3A 2BE5F 4A3CJ 2VE8A 2NOGA 3CF2A 3S3NA 2R93J 2HOEA 3HRSA 5H2FC 4G12A 4C9YA 3DU5A 2B0LA 2EZKA 3TW7A 4BDZA 2V9KA 3DPLC 2DFHA 2AS5F 3KZIC 3CUQB 5CQEA 1OCOH 1J59A 5E18F 4BJ5C 1OCPA 4DNCA 5K5OA 5C4JJ 1V5GA 2RQQA 1T08B 3G2BA 2LBFB 4NDLA 2CUJA 2HKOA 3EUAA 3CCEI 1HKSA 3K4JA 3AAFA 1PJRA 3H35A 3H0DA 2CFOA 1D8KA 1ZR4A 2JN6A 3IRRA 1D1BA 2G0EA 5J1RA 1HW5A 2KIFA 2BXZA 1Z6TA 2JK3A 3I4PA 1BW5A 4HPQA 4DQ2A 5JR3A 2TDXA 3Q9VA 1ETXA 2LLKA 3CJRB 4RLFA 4EJWA 1R5HA 5K1YA 2A69F 3K1NA 1XG1A 5J4VA 1OQYA 2EZHA 2MA3A 3Q0VA 4W97A 5F6FA 5FD5A 4CICA 1YQAA 4JX4A 4PJNA 1IUFA 1WH7A 3OYFA 3M4OJ 4MO7A 1G6NA 3ELKA 5HNFA 1X4PA 4FQGA 2PJPA 2IGMA 1S7AA 3M8EA 4D7NA 1SVLA 1WJ5A 4IL6C 1BA5A 4I98B 5HDKA 2WY8Q 1JUMA 2ZMEB 4GCVA 5E1WA 3RPUD 4HDUA 2LDUA 4II2A 1QU3A 2RC4A 2V6CA 3BQYA 5ED4A 1Y0NA 3ABKH 3ZQQA 3HSFA 3IKTA 2O8XA 1O7FA 1MBGA 2VKDA 4PGHA 2R7XA 3EPZA 3WGIA 2O6GE 2D1HA 2ZMEA 5LEJA 1RRJA 3LWFA 4XSXF 1FBSA 3CQZJ 1QO0D 3JRAA 1IRZA 5E8IA 1BL0A 5D4RA 3PUFA 2KZGA 5D8LB 1IW7F 1WPKA 1JHHA 4J01A 4ZTFA 4QPOA 2KDOA 3DV8A 3Q0WA 2NVQJ 3VOEA 3OYHA 1OCCH 5K7ZA 3P9CA 5DCMA 2M45A 1V55H 2HDWA 2VJIA 5F08A 4PK4A 3R0JA 3BG3A 4JK1X 4DBQA 4OMZA 2RNGA 2E2IJ 4Z2YA 1G8XA 4Z6YA 1IAWA 3CLOA 3JTGA 2DYRH 2JTVA 1LQ1A 4UVCA 1E0EA 4M3GA 4XIDA 4I99C 4BKXA 3KZYA 4B43A 3L2WA 2E71A 3HJEA 4HV5A 1TNTA 5IP9J 3HKZA 2I5UA 1QVTA 1XTAA 5CVUA 3FKIJ 3CJNA 1D1CA 3DTEA 2IA2A 4YG2F 5L3GA 2HXOA 2L4MA 5ICEA 4HRIA 2OTLI 2HYFA 2VE9A 4CCKA 5EGOB 5LGTA 3I55I 2QF7A 2DN0A 2COMA 4MFDA 3J7YJ 2VC0A 1X1AA 3FXUA 2LY2A 2P8TA 3DP7A 3K69A 4M9SA 4XN0A 1S29A 4Q48A 4C2TA 4OINF 1LVAA 3BTLA 1QNTA 3H92A 1H9TA 4F92B 4IHXA 2X1EA 4NB5A 2ZFWA 2E5NA 3FBIB 1F9NA 1FTTA 3Q9SA 2ISYA 1FMVA 5EGOA 2HDDA 4BU2A 1SC7A 1IRGA 1ZRDA 1YJNI 3ZRGA 3JRHA 2NXNB 2EQRA 5BNGA 2ZKZA 1MNDA 4OOIA 1MMDA 3AG1H 5JVTA 4IOAF 3HOZJ 3JRDA 4EM0B 4AVZA 2HVRA 4GFBA 1R36A 4A0ZA 2QBYB 4FTHA 3CDHA 3I53A 5DD8A 2A6TA 4HZFA 2HOAA 2XAGA 1J5YA 4LIUA 3ZXSA 1MJBA 1FEXA 3VYTB 2DBBA 2ESNA 5KVRA 1RPWA 2P4WA 4EGZA 3FHZA 3FK7A 4E7SA 2NOJB 3F3XA 4HF2A 3ZR8X 5ERIA 4M6YA 2BHZA 1CF7A 2GA2A 4XICA 3GLLA 4ZJZA 1H0MA 5TJJA 4EVIA 2MC4A 2KKOA 1MBFA 2QSHX 3K4MA 4GGGA 5L3EA 5DS9A 3WGHA 1W5SA 2FNAA 4XLHA 3E97A 2CGPA 3AL0B 3CJTB 4I2OA 1JKRC 3CUOA 2M7BA 2KT0A 3K6GA 5BMZA 4PSXA 2Z5UA 4CCJA 3GYHX 4WXCA 2L7ZA 2RQPA 5HLHA 3G71I 2L54A 2M34A 2CW8A 5F27A 1IN7A 1Y8RB 3I0TA 3LSGA 1ZKGA 2X48A 3P7NA 4Y17A 3V4GA 3A0BC 1I6XA 2TRTA 1SFOJ 5HNHA 1EH8A 1R4MB 4E7LA 5KHDA 2XV4S 1BOAA 4U88A 4ESBA 1Z67A 1VQPI 4E7HA 5FKOA 4I02A 4BUPA 3PNYA 2L3DA 3P9KA 3ABMH 2PG4A 4RS8A 2O7OA 1G3WA 2FQ4A 5B3SH 2QYOA 1STZA 2XASA 2RDPA 1SVOA 3PL8A 3SDGA 2PFBA 5LHIA 4HLYA 1REPC 1Y39A 3QP6A 2W82A 2EA2A 4D1QA 3GZ5A 5F0FA 1DGRM 1JKQC 2E60A 2Y31A 5FLXK 3OYIA 1LFUP 2B63J 2Z1DA 3HRUA 1POGA 5KNLA 2W85A 1TW3A 2CWEA 3WG7H 5BS6A 4DIQA 2K9MA 4WCGA 1VQ5I 1JUSA 4KT5C 5CVIA 1BI0A 1ZGWA 4A3LJ 1BIAA 2LKSA 2V1NA 4XKCA 2BVMA 2YS9A 5GPCA 2ADUA 3VB2A 2BEOA 4PJMA 1KGSA 3JR9A 1YYVA 4A12A 2QVOA 2W4SA 1VQLI 3IAM2 1QZZA 1ETWA 1FOWA 2HWVA 4BXXJ 2Z2SB 4H0EA 4CYCB 2XB5A 3TP0A 4PZJA 2E1CA 4I01A 3KP6A 5CKTA 3L00A 3WE3A 3BZ6A 4LG0B 4A5NA 3ECHA 1WJAA 3GFLA 4RAGA 2HYGD 3C7JA 2F5CA 4ZDPA 3L2UA 4HX7A 1YG2A 1KONA 3DTKA 2QZ8A 1SD4A 2LOOA 4EM2A 4CYCA 4YIIA 4EGYA 1KU9A 1O3QA 2CV2A 2LKPA 3PSFA 4BY7J 1EKEA 2ACJA 1IXCA 3ZQIA 5DM7F 1CGPA 1PUEE 1U6GA 3MAJA 2CW7A 3OS1A 1T8IA 3HL2A 4DZPA 1EH6A 2L7KA 3F8NA 1IDZA 2R0QC 3S2HJ 3VEPA 4XN3A 4P9FA 4PFOA 1W7PD 2FQ3A 3TMOA 1JI8A 4V19K 1WRJA 4CCNA 1Z9CA 2X51A 4ZYDA 3FISA 1OYWA 2BY0A 3OYMA 3TDZC 3RQ4A 3SZGA 4ZYEA 4XKBA 3CC7I 3F6VA 1T56A 1QGPA 4WF2A 3HTSB 5L3CA 5JHFA 1D8JA 3COAC 2X85A 3OMYA 1O4XA 3QPTA 3H3ZA 4RM2A 4LOCA 3X2QH 3O8HA 1FBQA 4L0ZB 5FKLA 2PMZN 4WXHA 3JSPA 1H9GA 2ICWG 1G4DA 4F91B 1MZBA 3TOBA 2JQ7A 4HX4A 3E5QA 4ZDOA 2NS0A 3S1QJ 2X6OA 4Y3OA 1XMKA 4E4HA 1UHSA 3BG5A 4GYGA 3SZTA 2LNBA 2XPWA 2KIUA 2XGXA 4XRFA 4MFEA 3LFKA 3GFJA 2X6WA 3ZQFA 3E3VA 4UV9A 1AWCA 1ZRCA 2WV1A 3ECOA 4KISA 4UVAA 2H09A 1UHWA 3LSMA 4HQEA 1MMNA 1S3JA 2DMQA 1GT0C 3AG4H 5JLWA 2EJRA 3TQNA 4MGRA 4C3JJ 4JBAA 2HI3A 4O5VA 3HG9A 3KYLA 3CC4I 1NH3A 1J9IA 2DLLA 2Y0SA 4XLAA 3LA3A 2JJ7A 3KE2A 4LLGF 3ZPLA 1XCVA 3FKJA 2LD5A 3GO5A 4BAYA 4KIBA 1YRNB 2P5VA 1XGOA 4M3BA 2CFXA 2X9DA 1S5LC 3R6SA 2H1LA 4UUVA 2XKPA 1HA8A 2OV7A 2ZO4A 4RMNA 1LFPA 3S17J 1X2NA 3K70D 5DEQA 1DP7P 1LFBA 2F4IA 1XGMA 2X0LA 2NVXJ 5J3LA 4G94A 3L2QA 2BYVE 4AIJA 1IXRC 2L0KA 1YRNA 4L18B 2Y75A 1O3TA 3PO3J 1KYWA 2DA4A 2JSCA 3OIOA 3Q0UA 4MTEA 2HXIA 4IX7A 4NBQA 1IG7A 2FMYA 3ABTA 3SFZA 2R5ZB 2K9NA 3FM5A 4ZZDA 4K2EA 1B4AA 3FXJA 3GTOJ 4A93J 4OU0A 1I27A 4A3GJ 3S93A 2FBKA 2ZB9A 5E1ZB 1QVUA 2PEXA 2HKXA 4LJZF 4Y33A 1B72B 2CMPA 2R5YB 1XB4A 3RCOA 3CCVI 5D5WB 3S1RJ 2IS4A 4IQ4A 1X2MA 2ME0A 2QEXI 2AXLA 4BHCA 1TQMA 3I4NJ 1KU3A 4ZC3A 4IPAA 1B72A 4BXFA 1TLHB 2Z16A 4B3AA 1JTXA 2P5KA 3TEDA 2OQGA 5C4XJ 2GWRA 4EJUA 4EV0A 2F5EA 3HSRA 3BR3A 4RAZA 3HEFA 1IC8A 2K3FA 4KIFA 4M9XA 3CCSI 3TDUC 1K78A 3OOUA 4RLQA 4B09A 3QPHA 4LGWA 5H6RA 1MDMA 2XDVA 2O61A 1OFCX 4BE0A 2E36A 4BJ6C 2GXGA 2IPQX 2DDAA 4B1RA 3QP5A 4L5IA 3DWLE 4FE4A 4F55A 4HX8A 1ORKA 3DQVC 3U2RA 1T98A 5J8FA 1K83J 1U9NA 2X1CA 2XB0X 4BE2A 5HDNA 2V1XA 1TWHJ 1U5TC 1FPQA 3ERED 5H20A 4E70A 3GTMJ 4UUSB 5M5WJ 1XD7A 4OIOF 1J0RA 1WCMJ 2CG4A 2QCOA 3JRCA 3H3UA 2CUFA 2EINH 3K4LA 4XOPA 3ZMDA 5JHUA 1G59A 1MMGA 2L2OA 3E6BA 4HLXA 2PN6A 3BDDA 4ZZLA 3JTHA 4M9ZA 4CZCA 2JZYA 3HUGB 4YRVA 3J80K 2VXZA 4HG2A 4RDUA 4UUSA 1FZPB 2ISZA 1IN6A 1I39A 4NNJA 2CW0F 2BY3A 4DYQA 1EH7A 5HODA 1YJ9I 2W57A 1ETQA 3GFMA 3WODF 1DP3A 3BG6A 5ILSA 3M1CA 4QIWN 1S72I 2JUGA 4A3FJ 3HUGA 4LFUA 4B4CA 3W2AA 3BCBA 5LGUA 3HOYJ 1PP8F 4GXOA 1VFCA 3IRQA 4XKVA 3GMEA 4Y7NJ 2P81A 1VQKI 1T38A 2IGNA 5F0HA 2ECCA 1T6SA 2ID3A 4KITB 1Z1DA 2MW8A 2R7OA 3KPHA 3EUKL 3M8FA 3ZCOA 5HS9A 1YJWI 2H94A 2FE3A 5IT3A 5CVRA 4MHGA 1I1SA 1YX5A 3CLQA 1HCRA 2F4OB 1T95A 3MN2A 2IT0A 1ETKA 5A2QZ 9ANTA 2M3AA 2E5ZA 4RGSA 4G7ZF 2EB7A 5J6XA 1FMWA 1Z0XA 5BOXA 2B7EA 3TKYA 1U5TB 2DXIA 3ZQLA 3SHFA 2DA5A 4AIHA 5KAFC 2RNJA 2BHYA 2EIMH 4XMYA 1R1UA 1TW2A 3WU2C 2FJ1A 5DM6F 1WGXA 3NEUA 3ISPA 5J1YA 4MQ9F 2IS2A 5IYBJ 5IYCJ 2HQAA 3KYCB 2VASA 1MBJA 5JLXA 1I1GA 1B9NA 3BTIA 2W25A 2Y2ZA 2E7WA 1ITYA 2LYCA 3IH3A 4NHJA 2GXBA 3H0GJ 4N4OB 1LE8A 5FKMA 1U5TA 3IC7A 2XPUA 1YITI 3DBLB 3CMMA 2Q8KA 1NHAA 4EMSA 4NC6A 1LPQA 4QPQA 1D0ZA 3HRMA 2NNNA 2KJBA 1J7KA 3S8PA 2R3SA 4XSZF 4G6DA 6PAXA 2WV0A 1ETYA 5EEHA 2O8KA 1Z91A 1DU6A 4KICA 4R1HA 3DTIA 4AUXA 5D6FA 2E2JJ 2QQAA 1HC8A 2WB1N 2LG4A 3J7AY 2ZXIA 3L09A 5DTDA 3WGGA 3H1CA 1OMIA 3L1PA 2DO7A 1UCRA 3BZKA 4BGDA 4BHBA 3JRBA 2M9HA 1B8IA 2JA2A 5F64A 3QOPA 2KDZA 2EFOA 2IA0A 4IXAA 3E1SA 4DYCA 1F36A 3BZCA 4TV7A 1BI1A 5HLIA 1IN4A 3LSJA 3S1NJ 3GTKJ 2DOFA 3GBGA 1WWXA 1TT5B 1XDSA 2YUSA 3PIOF 4EJTA 4AD9A 4ZDLA 1YFHA 1KQ8A 3F8FA 3OSGA 4BXUA 3GF2A 2WBMA 2VT2A 2OZUA 3G6EI 2E2HJ 1ACIA 5LFAA 1VQ6I 1OCTC 2XHKA 1D3YA 4RGRA 1ZG1A 1KU7A 1D5VA 1C0WA 4B44A 1ZG3A 3V7CA 3I3LA 3RKYA 2ZJPF 2P0WA 2KFDA 2CQKA 4BQNA 1MH4A 3ESWB 4FT8A 4LD5A 1DGWY 1GXQA 3ZQHA 4KNYA 2BVLA 2JT1A 3P5JA 1GDTA 3FXOA 3W6JB 1LVKA 1R58A 3OYGA 4D7MA 4BY1J 4IEJA 1FIAA 4N0BA 2D5VA 3ZMUA 4A2UA 3LSIA 2VIXA 3W2WA 2HPMA 3CJQB 1YW8A 2LF7A 5AIPA 3OYCA 4UXNA 5ILVA 1QZYA 4RM3A 4F52A 3V7RA 5K5RA 2WADA 2IGOA 3D1NI 4Q5SF 1P2FA 4OAYA 1V5EA 2GZWA 5DCMB 4UUTA 1ULYA 5M3MJ 2A5WA 3I9V2 2EFWA 5IY5H 3HOVJ 1HSJA 1USTA 3F72A 4M71A 3BJ6A 1T33A 2QLZA 2DMNA 1X3UA 3Q3SA 3VODA 4G9YA 4C2UA 3K9TA 3PFIA 4KIGA 4CSWA 3U1KA 4P9UA 1FYLA 1MMAA 2CQ7A 3ML6A 3HOSA 3BWGA 4BEHB 2IA1A 2LH9A 2RREA 1BC8C 2EV0A 3VWBA 3RJPA 1D0XA 4X0GA 4D5FA 2M8EA 3FF5A 3BR6A 5GTHC 1E3OC 1A6IA 2K7LA 4BNCA 1FLIA 1WI9A 2IS6A 4XONA 2KP6A 1IJWC 3REOA 3G73A 1Y0UA 3FX3A 1ZTRA 3JRGA 2EPFA 3RZDJ 2CV0A 2O0YA 4BEHA 2FBHA 1MIJA 4JX5A 3KIOA 3LSKA 2JRMA 1HW2A 3G1LA 2DA1A 2K02A 1GV5A 4OMYA 4G6TB
chains in the Genus database with same CATH topology
1A5JA 2CJJA 4BXXJ 2WAQN 2LP0A 2RAEA 4CYCB 2XB5A 2AHQA 3TP0A 5FJ8J 2GBYA 2HOSA 4HNVA 2N8GA 3BG9A 2O9LA 1JUPA 1ZK8A 1JJ6C 4AC0A 1B8IB 2DJNA 4MLOA 5F1JA 3A01A 5IP7J 2NS8A 3HOXJ 3B6AA 2COBA 2R92J 4CYCA 3IH2A 2XGCA 4BY7J 4EEFG 1H89C 4AYBN 3ZQIA 5M3FJ 5C44J 1W0UA 2R5ZA 3ZQCA 3S14J 2MG4A 2EBIA 1NTCA 4DZPA 2M2EA 4DZJA 5EG0A 1IDZA 1H8AC 4S0HB 2R0QC 5K7HA 2R5YA 3S2HJ 2CRGA 5EDNA 2IEKA 3G1MA 2CU7A 3OSFA 2VI6A 2DA2A 5GP9A 1DU0A 5J1UA 4A3BJ 2VUMJ 3FISA 4I76A 4C3HJ 1HF0A 5F04A 1VI0A 2JWTA 3BR0A 3A02A 1T56A 4BBRJ 1HDPA 2ECBA 2XRLA 2JA7J 2IAIA 1HOMA 1O4XA 2NS7A 4FISA 2CQXA 4JP0A 3HGGA 4LOCA 3HM5A 3O8HA 2NVYJ 5FKLA 2PMZN 3IH4A 3S2DJ 5GPAA 3GTQJ 5EZGA 5F0CA 1HDDC 1SANA 2Y9YA 2NVTJ 3S1QJ 2X6OA 3S15J 1UHSA 3BG5A 1I6HJ 2XPWA 4ABZA 2DMTA 4MFEA 1Y1WJ 2OF7A 2M0CA 3PM1A 1IDYA 2DTZA 3ZQFA 3G1OA 2EZIA 4A3EJ 3C2BA 3W6VA 2ID6A 2WV1A 4FCYA 1IV6A 2DA3A 2JA8J 1QPIA 2JA5J 4V2GA 3A03A 5FLVA 1WH5A 4V2FA 2DMQA 1GT0C 4I6ZA 5JLWA 4A3IJ 4C3JJ 2HI3A 1IGNA 1FIPA 2K40A 5FKNA 1TWAJ 5IOZA 1UMQA 2JJ7A 5FKKA 4C3IJ 2LK2A 2VKVA 5E3OA 2FD5A 2XGDA 2LD5A 2H8RA 3BR2A 1YRNB 3M3YJ 4M3BA 2X9DA 3S1MJ 5M5XJ 1ZQ3P 1MNMC 2GM4A 3S17J 1X2NA 5E3MA 1GUUA 1CQTA 4Y52J 3RZOJ 4JYKA 4A3DJ 3HBLA 1LFBA 3HOWJ 3FK6A 2NVXJ 5J3LA 3A01B 3TP3A 1UG2A 1YRNA 2L0KA 1MSFC 3PO3J 4L5EA 2DA4A 3OIOA 3Q0UA 2HXIA 4X1EA 1IG7A 1RKTA 4RBOA 3PO2J 2R5ZB 2M8GX 2K9NA 4XRSG 3B6CA 4A93J 3GTOJ 3F0CA 2IBDA 4A3GJ 3JRIA 2DMPA 4QTRA 5EG0B 2ZB9A 3UKGA 4DW6A 1QVUA 4M6VA 1B72B 2CUEA 2R5YB 4M3DA 5FLMJ 3HDDA 3NAUA 1WI3A 4A3CJ 1RR7A 3NARA 3S1RJ 2NOGA 5E3NA 1X2MA 2ME0A 2R93J 3I4NJ 3BR1A 4G12A 2EZKA 3TW7A 2AO9A 1B72A 3TEDA 4B3AA 1JTXA 1PUFA 1MH3A 5C4XJ 1OCPA 1U9OA 3BR3A 5C4JJ 1MBEA 1IC8A 3HEFA 1NK2P 1GVDA 4NDLA 2L7MP 1ZR4A 2JN6A 2MSYA 3OOUA 2G0EA 1P7JA 5J1RA 3SFIA 3LNQA 1JJ8C 2JK3A 2LR8A 1OFCX 1H88C 1BW5A 3I4MJ 4B1RA 4X6AJ 3QPLA 5IPAA 1S7EA 4A69C 4FE4A 1ETXA 1ORKA 2LLKA 5IOYA 2LY9A 4A3KJ 1K83J 1U9NA 2Y0SN 2XB0X 2EH3A 1TC3C 1TWHJ 3GTJJ 1XG1A 3GTMJ 2EZHA 2XPVA 2FX0A 3Q0VA 4W97A 1BW6A 4UUSB 1BJZA 3QPSA 2XSDC 4A3JJ 3MKLA 5M5WJ 4JX4A 1IUFA 2QCOA 1WCMJ 5M5YJ 2EZLA 1WH7A 3M4OJ 4MO7A 3WHCA 3JRCA 2CUFA 2Y9ZA 1AKHA 1EF4A 4D7NA 5EF6A 1D5YA 1AHDP 1BA5A 1JUMA 4RDUA 2YU9J 4UUSA 3WHBA 1QRYA 2K9QA 1R9TJ 4DYQA 5HODA 1ETQA 3BTJA 1JTYA 3BQYA 4FE7A 3JRFA 4QIWN 4A3FJ 4B4CA 4A3MJ 1MBGA 3HOYJ 1GV2A 1VFCA 4Y7NJ 3GTPJ 2XGEA 2P81A 3CQZJ 3O8GA 5F0HA 4XRSA 3JRAA 1IRZA 2ECCA 2ID3A 1BL0A 2MW8A 2L9RA 3RQIA 1WPKA 1HCRA 3CMYA 1RKWA 1HLVA 3Q0WA 3MN2A 1ETKA 4D5CA 2NVQJ 9ANTA 5K7ZA 2DMUA 3K7AJ 5F08A 3BG3A 2E2IJ 1Z0XA 3K2AA 5EYRA 4IHVA 3ZQLA 2TCTA 1I50J 2DA5A 2ME6A 2FJ1A 4M3GA 4XIDA 4BKXA 1WGXA 5IP6A 1OJLA 5J1YA 1JKOC 3BR5A 5IYBJ 5IP9J 5IYCJ 2VKEA 1QVTA 3JREA 1MBJA 3FKIJ 5JLXA 3BTIA 2Y2ZA 1ZR2A 1ITYA 3IH3A 3S16J 3H0GJ 3QQAA 1LE8A 2HXOA 5FKMA 5IYDJ 1P7IA 3LSRA 2XPUA 1PUFB 5EGOB 3CDLA 1JGGA 2QF7A 2DN0A 4MFDA 2HQ5A 2E19A 3ZQGA 3TW6A 4XRMA 1Q1VA 3VPRA 2Y30A 5E3LA 4QSHA 3ZOBA 1U78A 3BTLA 2LVSA 3CCYA 1ETYA 2O8KA 1DU6A 4XK4A 2H1KA 4IHXA 1FTTA 4JX6A 4AUXA 1XS9A 2HDDA 5EGOA 2E2JJ 3JRHA 2WB1N 3GTLJ 1FTZA 2EQRA 5BNGA 5DTDA 3L1PA 5EEAA 3HOZJ 3JRDA 1TWGJ 3JRBA 1I3QJ 2M9HA 3MVPA 1B8IA 4GFBA 1ETOA 2KDZA 4FTHA 3HOUJ 4DYCA 1F36A 2HOAA 3LSJA 1RESA 3GTKJ 3S1NJ 1AKHB 3GBGA 4M3FA 3DEWA 2YUSA 1FEXA 2CQQA 5EZHA 1RPWA 4IHWA 3FK7A 3OSGA 2DA7A 1VNDA 2E2HJ 1OCTC 1W0TA 2I10A 1MSEC 4XICA 2OPTA 1MBKA 2GLOA 3E7LA 1MBFA 3BTCA 2HOTA 5DS9A 2DA6A 3FIWA 1MH4A 2L7FP 1JKRC 2E1OA 2KT0A 3ZQHA 1Z77A 2LTPA 3BQZA 1GDTA 3H3VK 3SJMA 1TWCJ 1K61A 4M3EA 4D7MA 4BY1J 2W48A 2L7ZA 1FIAA 4IEJA 3LOCA 2D5VA 2M34A 2HYJA 5F27A 4DYRA 1ENHA 3LSGA 4J19A 3HKZN 2ELKA 2JA6J 1F43A 1ZKGA 2X48A 3D1NI 1RETA 2LFBA 1APLC 4C2MJ 2TRTA 1SFOJ 4UUTA 5M3MJ 3DCFA 4IHYA 5FKOA 3HOVJ 2O7OA 1T33A 2DMNA 1VF9A 2FQ4A 3Q3SA 5K7FA 1TWFJ 3SDGA 3GTGJ 1Y1VJ 3IV5A 1G2HA 1LE8B 5F0FA 4D5FA 1JKQC 5C3EJ 2Y31A 3BR6A 3HB9A 2VPRA 1A6IA 1E3OC 1LFUP 2B63J 2LKXA 1POGA 1NK3P 2R7ZJ 4BBSJ 2MGQA 1ETVA 1IJWC 1FJLA 1AU7A 1JT6A 3LSPA 1U8BA 1ZTRA 1JUSA 3JRGA 3RZDJ 1ZGWA 4MIMA 1MBHA 1XC5A 3BT9A 4A3LJ 3RKQA 4JX5A 4W1UA 1X58A 2YS9A 5GPCA 3G1LA 3JR9A 2DA1A 1JT0A 1GV5A 2K9SA 3HGYA 2JMWA 1JKPC 1ETWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5J A;  2CJJ A;  4BXX J;  2WAQ N;  2LP0 A;  2RAE A;  4CYC B;  2XB5 A;  2AHQ A;  3TP0 A;  5FJ8 J;  2GBY A;  2HOS A;  4HNV A;  2N8G A;  3BG9 A;  2O9L A;  1JUP A;  1ZK8 A;  1JJ6 C;  4AC0 A;  1B8I B;  2DJN A;  4MLO A;  5F1J A;  3A01 A;  5IP7 J;  2NS8 A;  3HOX J;  3B6A A;  2COB A;  2R92 J;  4CYC A;  3IH2 A;  2XGC A;  4BY7 J;  4EEF G;  1H89 C;  4AYB N;  3ZQI A;  5M3F J;  5C44 J;  1W0U A;  2R5Z A;  3ZQC A;  3S14 J;  2MG4 A;  2EBI A;  1NTC A;  4DZP A;  2M2E A;  4DZJ A;  5EG0 A;  1IDZ A;  1H8A C;  4S0H B;  2R0Q C;  5K7H A;  2R5Y A;  3S2H J;  2CRG A;  5EDN A;  2IEK A;  3G1M A;  2CU7 A;  3OSF A;  2VI6 A;  2DA2 A;  5GP9 A;  1DU0 A;  5J1U A;  4A3B J;  2VUM J;  3FIS A;  4I76 A;  4C3H J;  1HF0 A;  5F04 A;  1VI0 A;  2JWT A;  3BR0 A;  3A02 A;  1T56 A;  4BBR J;  1HDP A;  2ECB A;  2XRL A;  2JA7 J;  2IAI A;  1HOM A;  1O4X A;  2NS7 A;  4FIS A;  2CQX A;  4JP0 A;  3HGG A;  4LOC A;  3HM5 A;  3O8H A;  2NVY J;  5FKL A;  2PMZ N;  3IH4 A;  3S2D J;  5GPA A;  3GTQ J;  5EZG A;  5F0C A;  1HDD C;  1SAN A;  2Y9Y A;  2NVT J;  3S1Q J;  2X6O A;  3S15 J;  1UHS A;  3BG5 A;  1I6H J;  2XPW A;  4ABZ A;  2DMT A;  4MFE A;  1Y1W J;  2OF7 A;  2M0C A;  3PM1 A;  1IDY A;  2DTZ A;  3ZQF A;  3G1O A;  2EZI A;  4A3E J;  3C2B A;  3W6V A;  2ID6 A;  2WV1 A;  4FCY A;  1IV6 A;  2DA3 A;  2JA8 J;  1QPI A;  2JA5 J;  4V2G A;  3A03 A;  5FLV A;  1WH5 A;  4V2F A;  2DMQ A;  1GT0 C;  4I6Z A;  5JLW A;  4A3I J;  4C3J J;  2HI3 A;  1IGN A;  1FIP A;  2K40 A;  5FKN A;  1TWA J;  5IOZ A;  1UMQ A;  2JJ7 A;  5FKK A;  4C3I J;  2LK2 A;  2VKV A;  5E3O A;  2FD5 A;  2XGD A;  2LD5 A;  2H8R A;  3BR2 A;  1YRN B;  3M3Y J;  4M3B A;  2X9D A;  3S1M J;  5M5X J;  1ZQ3 P;  1MNM C;  2GM4 A;  3S17 J;  1X2N A;  5E3M A;  1GUU A;  1CQT A;  4Y52 J;  3RZO J;  4JYK A;  4A3D J;  3HBL A;  1LFB A;  3HOW J;  3FK6 A;  2NVX J;  5J3L A;  3A01 B;  3TP3 A;  1UG2 A;  1YRN A;  2L0K A;  1MSF C;  3PO3 J;  4L5E A;  2DA4 A;  3OIO A;  3Q0U A;  2HXI A;  4X1E A;  1IG7 A;  1RKT A;  4RBO A;  3PO2 J;  2R5Z B;  2M8G X;  2K9N A;  4XRS G;  3B6C A;  4A93 J;  3GTO J;  3F0C A;  2IBD A;  4A3G J;  3JRI A;  2DMP A;  4QTR A;  5EG0 B;  2ZB9 A;  3UKG A;  4DW6 A;  1QVU A;  4M6V A;  1B72 B;  2CUE A;  2R5Y B;  4M3D A;  5FLM J;  3HDD A;  3NAU A;  1WI3 A;  4A3C J;  1RR7 A;  3NAR A;  3S1R J;  2NOG A;  5E3N A;  1X2M A;  2ME0 A;  2R93 J;  3I4N J;  3BR1 A;  4G12 A;  2EZK A;  3TW7 A;  2AO9 A;  1B72 A;  3TED A;  4B3A A;  1JTX A;  1PUF A;  1MH3 A;  5C4X J;  1OCP A;  1U9O A;  3BR3 A;  5C4J J;  1MBE A;  1IC8 A;  3HEF A;  1NK2 P;  1GVD A;  4NDL A;  2L7M P;  1ZR4 A;  2JN6 A;  2MSY A;  3OOU A;  2G0E A;  1P7J A;  5J1R A;  3SFI A;  3LNQ A;  1JJ8 C;  2JK3 A;  2LR8 A;  1OFC X;  1H88 C;  1BW5 A;  3I4M J;  4B1R A;  4X6A J;  3QPL A;  5IPA A;  1S7E A;  4A69 C;  4FE4 A;  1ETX A;  1ORK A;  2LLK A;  5IOY A;  2LY9 A;  4A3K J;  1K83 J;  1U9N A;  2Y0S N;  2XB0 X;  2EH3 A;  1TC3 C;  1TWH J;  3GTJ J;  1XG1 A;  3GTM J;  2EZH A;  2XPV A;  2FX0 A;  3Q0V A;  4W97 A;  1BW6 A;  4UUS B;  1BJZ A;  3QPS A;  2XSD C;  4A3J J;  3MKL A;  5M5W J;  4JX4 A;  1IUF A;  2QCO A;  1WCM J;  5M5Y J;  2EZL A;  1WH7 A;  3M4O J;  4MO7 A;  3WHC A;  3JRC A;  2CUF A;  2Y9Z A;  1AKH A;  1EF4 A;  4D7N A;  5EF6 A;  1D5Y A;  1AHD P;  1BA5 A;  1JUM A;  4RDU A;  2YU9 J;  4UUS A;  3WHB A;  1QRY A;  2K9Q A;  1R9T J;  4DYQ A;  5HOD A;  1ETQ A;  3BTJ A;  1JTY A;  3BQY A;  4FE7 A;  3JRF A;  4QIW N;  4A3F J;  4B4C A;  4A3M J;  1MBG A;  3HOY J;  1GV2 A;  1VFC A;  4Y7N J;  3GTP J;  2XGE A;  2P81 A;  3CQZ J;  3O8G A;  5F0H A;  4XRS A;  3JRA A;  1IRZ A;  2ECC A;  2ID3 A;  1BL0 A;  2MW8 A;  2L9R A;  3RQI A;  1WPK A;  1HCR A;  3CMY A;  1RKW A;  1HLV A;  3Q0W A;  3MN2 A;  1ETK A;  4D5C A;  2NVQ J;  9ANT A;  5K7Z A;  2DMU A;  3K7A J;  5F08 A;  3BG3 A;  2E2I J;  1Z0X A;  3K2A A;  5EYR A;  4IHV A;  3ZQL A;  2TCT A;  1I50 J;  2DA5 A;  2ME6 A;  2FJ1 A;  4M3G A;  4XID A;  4BKX A;  1WGX A;  5IP6 A;  1OJL A;  5J1Y A;  1JKO C;  3BR5 A;  5IYB J;  5IP9 J;  5IYC J;  2VKE A;  1QVT A;  3JRE A;  1MBJ A;  3FKI J;  5JLX A;  3BTI A;  2Y2Z A;  1ZR2 A;  1ITY A;  3IH3 A;  3S16 J;  3H0G J;  3QQA A;  1LE8 A;  2HXO A;  5FKM A;  5IYD J;  1P7I A;  3LSR A;  2XPU A;  1PUF B;  5EGO B;  3CDL A;  1JGG A;  2QF7 A;  2DN0 A;  4MFD A;  2HQ5 A;  2E19 A;  3ZQG A;  3TW6 A;  4XRM A;  1Q1V A;  3VPR A;  2Y30 A;  5E3L A;  4QSH A;  3ZOB A;  1U78 A;  3BTL A;  2LVS A;  3CCY A;  1ETY A;  2O8K A;  1DU6 A;  4XK4 A;  2H1K A;  4IHX A;  1FTT A;  4JX6 A;  4AUX A;  1XS9 A;  2HDD A;  5EGO A;  2E2J J;  3JRH A;  2WB1 N;  3GTL J;  1FTZ A;  2EQR A;  5BNG A;  5DTD A;  3L1P A;  5EEA A;  3HOZ J;  3JRD A;  1TWG J;  3JRB A;  1I3Q J;  2M9H A;  3MVP A;  1B8I A;  4GFB A;  1ETO A;  2KDZ A;  4FTH A;  3HOU J;  4DYC A;  1F36 A;  2HOA A;  3LSJ A;  1RES A;  3GTK J;  3S1N J;  1AKH B;  3GBG A;  4M3F A;  3DEW A;  2YUS A;  1FEX A;  2CQQ A;  5EZH A;  1RPW A;  4IHW A;  3FK7 A;  3OSG A;  2DA7 A;  1VND A;  2E2H J;  1OCT C;  1W0T A;  2I10 A;  1MSE C;  4XIC A;  2OPT A;  1MBK A;  2GLO A;  3E7L A;  1MBF A;  3BTC A;  2HOT A;  5DS9 A;  2DA6 A;  3FIW A;  1MH4 A;  2L7F P;  1JKR C;  2E1O A;  2KT0 A;  3ZQH A;  1Z77 A;  2LTP A;  3BQZ A;  1GDT A;  3H3V K;  3SJM A;  1TWC J;  1K61 A;  4M3E A;  4D7M A;  4BY1 J;  2W48 A;  2L7Z A;  1FIA A;  4IEJ A;  3LOC A;  2D5V A;  2M34 A;  2HYJ A;  5F27 A;  4DYR A;  1ENH A;  3LSG A;  4J19 A;  3HKZ N;  2ELK A;  2JA6 J;  1F43 A;  1ZKG A;  2X48 A;  3D1N I;  1RET A;  2LFB A;  1APL C;  4C2M J;  2TRT A;  1SFO J;  4UUT A;  5M3M J;  3DCF A;  4IHY A;  5FKO A;  3HOV J;  2O7O A;  1T33 A;  2DMN A;  1VF9 A;  2FQ4 A;  3Q3S A;  5K7F A;  1TWF J;  3SDG A;  3GTG J;  1Y1V J;  3IV5 A;  1G2H A;  1LE8 B;  5F0F A;  4D5F A;  1JKQ C;  5C3E J;  2Y31 A;  3BR6 A;  3HB9 A;  2VPR A;  1A6I A;  1E3O C;  1LFU P;  2B63 J;  2LKX A;  1POG A;  1NK3 P;  2R7Z J;  4BBS J;  2MGQ A;  1ETV A;  1IJW C;  1FJL A;  1AU7 A;  1JT6 A;  3LSP A;  1U8B A;  1ZTR A;  1JUS A;  3JRG A;  3RZD J;  1ZGW A;  4MIM A;  1MBH A;  1XC5 A;  3BT9 A;  4A3L J;  3RKQ A;  4JX5 A;  4W1U A;  1X58 A;  2YS9 A;  5GPC A;  3G1L A;  3JR9 A;  2DA1 A;  1JT0 A;  1GV5 A;  2K9S A;  3HGY A;  2JMW A;  1JKP C;  1ETW A; 
#chains in the Genus database with same CATH topology
 2CJJ A;  5J8C A;  2WAQ N;  2LP0 A;  1W1W E;  2DFI A;  4RB0 A;  2HOS A;  2CO5 A;  2GOM A;  5DD4 A;  4XLN F;  2MBF A;  3C3W A;  3TGN A;  3BPX A;  4LIT A;  2ELH A;  2VBX A;  5J47 A;  1JUP A;  4KJZ A;  2KZV A;  4AC0 A;  4MLO A;  3RYR A;  3DLA A;  2LMD A;  1ERD A;  2NS8 A;  4RAY A;  2ZXH A;  3SQN A;  3WU1 B;  2XGC A;  3BLY A;  5J4Y A;  4CUG A;  1J75 A;  4AYB N;  3WU0 A;  3ASN H;  3GEZ A;  3ZQC A;  3K1P A;  5LRR A;  2P5L C;  2MG4 A;  2ZJ2 A;  5DV5 A;  3MQ0 A;  1NTC A;  1DQU A;  2V1D A;  1OIS A;  3KP2 A;  4DZJ A;  5EG0 A;  3HC7 A;  1CF7 B;  1WJF A;  5K7H A;  1W5C C;  2LC2 A;  4ZYA A;  4HQM A;  3RSN A;  2CU7 A;  2M87 A;  1ZHF A;  1KYZ A;  2VI6 A;  3ZMT A;  5J1U A;  1ON1 A;  2OZ6 A;  1LDK B;  2VUM J;  4ESF A;  4C3H J;  1HF0 A;  2X1D A;  1VI0 A;  1Z7L A;  3BR0 A;  1MMS A;  2V79 A;  4BBR J;  1VQ4 I;  4H4K C;  4IVN A;  2NS7 A;  4R8H A;  5TIS C;  5CVJ A;  2J5O A;  2BOL A;  3C2H A;  4JP0 A;  2Q1Z B;  1IRX A;  3DF8 A;  4LB6 B;  2QSG X;  4ENK A;  1MJ9 A;  3IH4 A;  3R0A A;  5LBQ A;  4RB1 A;  2DAO A;  1IZ1 A;  3SZP A;  4WXD A;  2AXT C;  2EFN A;  1HDD C;  2Y9Y A;  1MGT A;  4PJ0 C;  1IV8 A;  3S15 J;  1F1Z A;  1XN7 A;  1I6H J;  2XAH A;  3H5R A;  3QOD A;  2G9W A;  2KL4 A;  1IO2 A;  3LA7 A;  4I0B A;  3TBI A;  2W1O A;  5JI6 A;  1MD0 A;  2M0C A;  2Y69 H;  3PM1 A;  1IDY A;  3G1O A;  2EZI A;  3W6V A;  4U0W A;  4FCY A;  2DA3 A;  1QPI A;  5GTI C;  3KZZ A;  2XKO A;  4V2F A;  5J40 A;  2A68 F;  3CCR I;  4A3I J;  2K3P A;  1Y8Q B;  5D5U B;  5FKN A;  1TWA J;  4L9J A;  3HSE A;  5D4S A;  5IOZ A;  3S2W A;  3RPQ A;  1OCZ H;  5DCF A;  2K9L A;  4Q4Z F;  2LK2 A;  2VKV A;  1Z21 A;  2L4A A;  2L9N A;  2H8R A;  2Q2E A;  2OBP A;  2R7S A;  4KYW A;  3I59 A;  1IN8 A;  2DQR A;  4YFN F;  3D5R C;  2NRA C;  4CHU A;  2KRC A;  2FU4 A;  3DKX A;  4XOT A;  1XSD A;  1GUU A;  1XSV A;  5GAH J;  1CQT A;  1T2K A;  4HEA 2;  3EDP A;  1W36 C;  3HOW J;  3K4B A;  5DUK A;  1F5T A;  1UG2 A;  3N97 A;  2KHM A;  2O5R A;  4EAT A;  3WTT C;  3W3C A;  4KFC A;  2KPM A;  2V26 A;  4RBO A;  3DXJ F;  2M8G X;  4NC7 A;  2F4M B;  2M4K A;  1UG0 A;  3OYL A;  2DMP A;  5D6E A;  2ZSI B;  3OYN A;  4UVB A;  1FC3 A;  4DW6 A;  4M6V A;  1ZRE A;  4KUM A;  1QHG A;  2OCE A;  2EK5 A;  4UHT A;  3FXQ A;  4IHS A;  2OQR A;  4BHP A;  3HDD A;  2F5V A;  1N75 A;  3NAU A;  3ZQ7 A;  1VQ7 I;  4MNU A;  5DYM A;  5K5Q A;  2P6T A;  1RR7 A;  2ZCW A;  3NAR A;  3NRV A;  2F6C A;  1R49 A;  4ZH4 F;  4IRI A;  1VTN C;  2AO9 A;  3S32 A;  2HFH A;  4XLF A;  2XF5 A;  1PUF A;  1FYK A;  1LDJ A;  3LSH A;  2V9V A;  1MH3 A;  1WJB A;  3ABU A;  2Z3Y A;  1ZLK A;  1R00 A;  2DOD A;  4Y4R A;  2CV1 A;  1U9O A;  1MBE A;  3OR1 C;  1NK2 P;  3J7Z I;  2L7M P;  3D5S C;  3DKW A;  2PLY A;  3CMA I;  4U0Y A;  4RB3 C;  1N25 A;  1P7J A;  3SFI A;  3GXO A;  2YX7 A;  1FNN A;  2LR8 A;  4IRH A;  1BOB A;  1H88 C;  1BI2 A;  3CCQ I;  5FRN A;  3I4M J;  1V4R A;  3QPL A;  3ZMV A;  2JVG A;  2XF6 A;  1R22 A;  1BIB A;  2XAQ A;  3EYY A;  1B59 A;  2DJI A;  2STW A;  1BBY A;  1TC3 C;  2PMH A;  3GZN B;  3FZV A;  2BZT A;  2UV1 A;  1BR1 A;  2XPV A;  4BQA A;  4GRI A;  3O6B B;  2LSO A;  2XSD C;  2GQQ A;  5KCM A;  2MYS A;  2W24 A;  4A3J J;  4GDF A;  5B1A H;  4FX4 A;  4AU7 A;  2V7F A;  1AKH A;  3T5X A;  1RZ4 A;  2JPC A;  1YTY A;  4N9I A;  1AA7 A;  1D5Y A;  1Z3X A;  1SVM A;  3DPU A;  4HAM A;  4L9T A;  4DGW B;  2XAF A;  3PQK A;  2Z9O A;  4XL9 A;  3WHB A;  1QRY A;  2K9Q A;  3IWZ A;  4YEJ A;  2UWM A;  1R9T J;  3NWS A;  2VQH A;  2KRH A;  2QGU A;  1ZAO A;  1JTY A;  1WJD A;  4PJL A;  1XX5 A;  1SMT A;  4FE7 A;  2CYY A;  1GLN A;  4GO1 A;  3FWE A;  3FXM A;  1ZGA A;  2MD0 A;  2VB6 A;  2YR2 A;  4CCM A;  1GV2 A;  1ZH5 A;  1G3Y A;  4OIP F;  5EEG A;  4RAF A;  1EJ9 A;  3PJR A;  3H9G A;  1HQC A;  5L3B A;  3WTX C;  2DFE A;  2L9R A;  1XGN A;  2XAJ A;  5HS7 A;  3C2G A;  2RV8 A;  2R7W A;  3CMY A;  2FF4 A;  3R61 A;  3SEQ A;  3OYJ A;  1RKW A;  1HLV A;  3U9G A;  2LRE A;  2DMU A;  4BL0 B;  5CQG A;  2FBI A;  3K7A J;  4MTD A;  4F7Z A;  4BDY A;  4IHV A;  3HOT A;  3PSI A;  3U21 A;  4II3 A;  2K4J A;  4O6J A;  3VYR B;  1WHU A;  2ME6 A;  1R6R A;  1S6L A;  2M5W A;  1OJL A;  1Q1H A;  4CH7 A;  3BR5 A;  2A6H F;  4HA8 A;  4B48 A;  3KEY A;  2VKE A;  1Z6R A;  3VDX A;  3QYF A;  2IXS A;  2MLK A;  3S16 J;  1UJ8 A;  3E6M A;  5FO5 A;  2ZXJ A;  2YSR A;  2K86 A;  1P7I A;  5E1X A;  4Y13 A;  2MFZ A;  5LGN A;  5IYD J;  2C6Y A;  2VPL A;  1VZ0 A;  3OY9 A;  1LDD A;  1JGG A;  3KET A;  4FX0 A;  2HQ5 A;  3TL4 X;  3OS0 A;  2E19 A;  2PI0 A;  1Q1V A;  2KMU A;  2X6Y A;  3VPR A;  4IKF A;  2Y30 A;  4G7H F;  3V7S A;  1DPU A;  2MC3 A;  1K78 B;  3GUD A;  4PJJ A;  1K4S A;  3DLL F;  4CZZ A;  2P6S A;  1W4M A;  2H1K A;  1MDM B;  2HGC A;  4PDK A;  4JX6 A;  2EV6 A;  2FA5 A;  3C1D A;  2WC2 A;  2PBI A;  3BJO A;  1QBJ A;  2D2W A;  1VQ9 I;  2QKM B;  4ZTJ A;  2FML A;  3PIP F;  1TWG J;  1USS A;  2VBZ A;  4HV6 A;  1N77 A;  1ETO A;  1G3S A;  1OYI A;  3HOU J;  1I3A A;  1GHC A;  4D9J A;  4CA0 A;  2DK8 A;  2QWW A;  1R7J A;  3AG3 H;  1RR8 C;  4IJA A;  3PUB A;  2DOE A;  5DUI A;  2O3F A;  3PQJ A;  3H9J A;  1KQ9 A;  5HVQ C;  2DA7 A;  3CES A;  2DT7 B;  1FP2 A;  2VJJ A;  1W0T A;  3QYE A;  1T0F C;  2QUF A;  2E35 A;  1MSE C;  4M74 A;  1R5I D;  2DPU A;  4EM1 A;  5B1B H;  2GLO A;  3E7L A;  1BM9 A;  2L9S A;  1KQ0 A;  3FIW A;  1Y56 A;  4NUB A;  3UNG C;  2E1O A;  3BY6 A;  3K1M A;  4XLP F;  1TWC J;  2MH2 A;  4M3E A;  2BGC A;  2CSO A;  1K7A A;  5IT9 Z;  2IVM A;  3HKZ N;  2ELK A;  5D8K B;  4U7B A;  2BY2 A;  2E1M C;  1F43 A;  2DYS H;  2VBY A;  4BJT A;  2VKH A;  4O3M A;  3VYS B;  2BW3 A;  4YEL A;  5A2Q K;  3MWM A;  3MZY A;  3JCU C;  2HZT A;  3OYA A;  5GAG J;  1OKR A;  3H9Q A;  2YX4 A;  4JQF A;  3ABL H;  2PJR A;  4IHY A;  1E2X A;  2MD5 A;  1A36 A;  1BR4 A;  3ZN1 A;  2DCE A;  2PX9 A;  3MMY B;  2EV5 A;  1FSH A;  3KFW X;  3KCC A;  3SDB A;  3CUQ C;  1R23 A;  4LIV A;  2HQN A;  4PCQ A;  2XVC A;  3OYK A;  1WKM A;  2MLG A;  1SFU A;  1TWF J;  5AIQ A;  2LRD A;  3HRT A;  2RGV A;  2FUG 2;  3QAH A;  4KT6 A;  3H5A A;  3F8C A;  1T39 A;  1XMA A;  4NC8 A;  1LB2 A;  1U3E M;  4ON0 A;  1G2H A;  1LE8 B;  2KIQ A;  3V8L A;  2AQF A;  2PMZ A;  2RN7 A;  2OA4 A;  1NG7 A;  3JAM Z;  2E7X A;  2PQ8 A;  3OIQ A;  1ETV A;  4ENN A;  3J81 Z;  1AU7 A;  1FJL A;  4EJV A;  1JT6 A;  1ZYR F;  3LSP A;  4UB8 C;  1QQI A;  1JE8 A;  3V8J A;  2FOK A;  4MIM A;  1XC5 A;  1YW7 A;  3RKQ A;  1X58 A;  2DU9 A;  5GAE J;  3QRF F;  3NWT A;  3QOE A;  4BAC A;  1JT0 A;  2K9S A;  1J2X A;  1RC9 A;  1JKP C;  5E17 F;  1A5J A;  2VL8 A;  4A6D A;  1D0Y A;  4MEX F;  5FJ8 J;  3WTY C;  3I56 I;  2GBY A;  1T0F A;  3A4C A;  3BG9 A;  3K2Z A;  2O9L A;  2ZBK A;  3CP8 A;  1B8I B;  2DJN A;  3A01 A;  2EWN A;  3HOX J;  3V8K A;  2COB A;  3K0L A;  4DOZ A;  2R92 J;  1TT0 A;  2KQR A;  3F9K A;  1SFX A;  1ZGJ A;  3I64 A;  4EEF G;  1H89 C;  2DPD A;  5FD6 A;  3E5X A;  5M3F J;  1W0U A;  4E7I A;  3VYU B;  1YLF A;  1FBU A;  4LK0 F;  1ZG5 A;  1YS7 A;  3S14 J;  2EBI A;  2K27 A;  3OIP A;  2EIL H;  3U1D A;  2K5C A;  1AOY A;  2HNH A;  2JUC A;  1P4X A;  2HR3 A;  1OLT A;  3IAS 2;  4QWQ A;  2CRG A;  2UUZ A;  2IEK A;  2MAB A;  1R1T A;  1RNL A;  5BQT A;  5GP9 A;  4BQO A;  4A3B J;  2UXN A;  3BG7 A;  2GA1 A;  1BN5 A;  4I76 A;  4KDP A;  3KEQ A;  3ZN0 A;  2JWT A;  3G3Z A;  3L2V A;  2OCC H;  1Z7U A;  3AG2 H;  3CUQ A;  3WTW C;  4P55 A;  3L2C A;  2ECB A;  2XUB A;  2JA7 J;  2IAI A;  2VQG A;  4OIR F;  3D5L A;  1ZRF A;  2LBF A;  1PDN C;  3HHH A;  2XRO A;  2CQX A;  3D0S A;  3M1E A;  1RUN A;  3ULQ B;  3SYT A;  1RI7 A;  2XSJ C;  3NQO A;  1SEU A;  1IF1 A;  1HXD A;  3HXL A;  1MKM A;  3MKY B;  5ICF A;  3H5N A;  4IHT A;  2CQN A;  5EZG A;  5F0C A;  1SAN A;  3HYI A;  5HS8 A;  1A35 A;  2NVT J;  2KIM A;  1HBX G;  3DFG A;  1O3R A;  1QZE A;  4ABZ A;  5H6Q A;  3OV8 A;  3HIF A;  3BRO A;  1Y1W J;  3B73 A;  5AON A;  2FEZ A;  4AVP A;  1RIO H;  4A3E J;  4G6Q A;  3FXK A;  3C2B A;  3M8J A;  3B02 A;  2ID6 A;  1XCB A;  3JW4 A;  1YIJ I;  1TBX A;  1YS6 A;  1IV6 A;  2A6E F;  5TRD A;  2OD5 A;  2GAU A;  2FNP A;  1WH5 A;  3T0Y A;  3JSO A;  1VQN I;  2M4G A;  4KN7 X;  1IGN A;  3LQR A;  1FIP A;  5CLS A;  5EJC A;  4KA4 A;  1X3Z B;  2K40 A;  1UMQ A;  2OU2 A;  5FKK A;  4C3I J;  5E3O A;  2FD5 A;  2V6E A;  3CO7 C;  2ZJR F;  1QHH D;  4U7D A;  1X3W B;  4E7Z A;  3BR2 A;  3M3Y J;  3FM3 A;  2JSP A;  2XIG A;  3EET A;  3TO7 A;  2E34 A;  4RA2 A;  3N05 A;  4PSW A;  5M5X J;  1ZQ3 P;  5ILU A;  3BCA A;  2GM4 A;  2Z99 A;  1MJA A;  1X1C A;  3I71 A;  1LNW A;  5GAD J;  3CCM I;  4C30 A;  1HKT A;  2VOD A;  4N4N B;  1X1D A;  2VQL A;  3ZMZ A;  3TP3 A;  2BY1 A;  2GXA A;  1YX3 A;  3FHN A;  5E8G A;  4L5E A;  1OYY A;  3RTR A;  2OJE D;  2A3S A;  2NYX A;  4X1E A;  1V3F A;  3O3K A;  2HU9 A;  3IKV A;  3PO2 J;  1SD5 A;  1OCR H;  2WY7 Q;  1HST A;  1M1E B;  3JRI A;  3DKY A;  5EG0 B;  3UKG A;  2H8W A;  3G4S I;  2VBW A;  4PFP A;  2R7R A;  3AL0 C;  2CUE A;  5FLM J;  2X4H A;  4HSR A;  2QQ8 A;  2BXY A;  2Y0M A;  1WJE A;  2DK5 A;  3IUO A;  1WI3 A;  1A6Q A;  2R4G A;  3LL7 A;  3VSK A;  4F3Q A;  1SAX A;  2KRF A;  5E3N A;  5CYV A;  3EUH C;  4U0V A;  1ZN2 A;  3W6K B;  3LAP A;  4KN4 X;  2WAF A;  1W36 D;  3BR1 A;  2KJC A;  1K6O A;  2V4J C;  4OWR B;  4L9N A;  5LRS A;  2WWY A;  5B5E C;  3CTA A;  3DEU A;  2IW5 A;  1JGS A;  3LST A;  5CPR B;  2HVQ A;  3FDY A;  2HPI A;  5LLQ A;  2EFP A;  1GVD A;  4U87 A;  3Q5F A;  3F8M A;  2H6C A;  4ETS A;  5FGM A;  1LUJ B;  2JPB A;  3PNT A;  3HPH A;  1P4W A;  4ASN A;  2NVU B;  2MSY A;  3CP2 A;  2D1V A;  3LNQ A;  1JJ8 C;  5BPD A;  1SD7 A;  3OYB A;  1YE9 A;  4PGG A;  2ZSH B;  4X6A J;  5IPA A;  3ZP5 A;  1S7E A;  4A69 C;  2F48 A;  2KIS A;  5IOY A;  2LY9 A;  4A3K J;  3T1B A;  4J00 A;  1PYV A;  2Y0S N;  2WA0 A;  2ZNY A;  3V42 A;  2XC7 A;  2EH3 A;  3CC2 I;  2BV6 A;  2IGK A;  5D5V B;  4MEY F;  3GTJ J;  1TL8 A;  4HF0 A;  4XR6 A;  1K6Y A;  1BC7 C;  2FX0 A;  4ITV A;  2HEO A;  2QBY A;  1BW6 A;  1P9Q C;  1ON2 A;  1BJZ A;  3QPS A;  3MKL A;  1ZLJ A;  4CCL A;  2LF8 A;  5M5Y J;  2EZL A;  3RIR A;  3WHC A;  4P5O A;  2Y9Z A;  3ERM A;  4BQQ A;  1EF4 A;  4E6K G;  2O03 A;  3A1Y A;  5EF6 A;  3L7W A;  1LEB A;  3KP7 A;  3BOQ A;  1AHD P;  2W84 A;  4IRG A;  4XLC A;  3DBH B;  1L3L A;  1U0J A;  2M1B A;  2WB1 A;  2YU9 J;  3CCL I;  1Z3Y A;  4I09 A;  4IZZ A;  3IWF A;  4KMU X;  3GZ6 A;  3RDI A;  5ICC A;  3BTJ A;  3WTU C;  2Q2E B;  3JRF A;  5HDG A;  3I59 B;  1SMY F;  4UB6 C;  2B9S A;  3I58 A;  4I7H A;  1U2W A;  4A3M J;  4ANJ A;  3LA2 A;  5D5X B;  1SAU A;  2DW4 A;  1TQP A;  3GTP J;  2XGE A;  4HNU A;  4XNF A;  3O8G A;  2ZFU A;  4XRS A;  1BI3 A;  3RQI A;  2YPR A;  2QKL B;  2M0M A;  3DU6 A;  3EUH A;  3PNV A;  4FHT A;  2DFF A;  3KLN A;  4OIQ F;  1ONV A;  2F2E A;  2GOX B;  2VC1 A;  3EQL F;  1O3S A;  1XSX A;  2ETH A;  3OYD A;  1MNE A;  4M73 A;  4D5C A;  3KP3 A;  3KP4 A;  3FXR A;  4WX9 A;  3OYE A;  1R71 A;  2YU3 A;  2V1U A;  4OAZ A;  3HTU A;  1W5T A;  3K2A A;  5EYR A;  4A0X A;  2VJ4 A;  1KZH A;  4F93 B;  3MEX A;  2TCT A;  4CO8 A;  1I50 J;  3MCZ A;  3UR3 C;  1YO5 C;  1WSU A;  2AQE A;  4S04 A;  2A5Y B;  3QYB A;  4CXF A;  5IP6 A;  3MD2 A;  4IO9 F;  1JKO C;  1S9H A;  3ONQ A;  3RPU A;  5CVV A;  4B47 A;  3JRE A;  3CD6 I;  1S7O A;  1N78 A;  1ZR2 A;  2HTJ A;  2E1N A;  3OR2 C;  2H27 A;  3FXL A;  1X1P A;  1SFE A;  3QQA A;  4YIR X;  4CCO A;  1P4A A;  3LSR A;  1PUF B;  5FLX Z;  2UXX A;  1U8R A;  3M07 A;  1WZ2 A;  4HF1 A;  3CDL A;  5FB2 A;  1E3H A;  1BJA A;  5E79 C;  3M7G A;  3ZQG A;  2HZD A;  3TW6 A;  4XRM A;  1B9M A;  4BS9 A;  5E3L A;  4QSH A;  3ZOB A;  1U78 A;  2LVS A;  3CCY A;  4XOR A;  1A04 A;  2Q0O A;  4DBR A;  4XK4 A;  1UEL B;  3CCU I;  4FAS D;  1XS9 A;  1IN5 A;  3KEO A;  3F8B A;  5LEK A;  5ICG A;  3FMS A;  4IOC F;  1FTZ A;  3GTL J;  1UFM A;  2M30 A;  2R7D A;  1OR7 C;  1E3P A;  4CGZ A;  2FRH A;  4JOM A;  4LG0 A;  3T8T A;  4HNT A;  2Z33 A;  4P1W A;  5EEA A;  3L2R A;  4G8X A;  3TO9 A;  4Y15 A;  2R7U A;  1I3Q J;  1HW1 A;  4AIK A;  3S3M A;  1RUO A;  2IRF G;  3MVP A;  4LB5 A;  3OOP A;  4BYY A;  2DI3 A;  2VJ5 A;  2KLO A;  1XGS A;  4WK8 F;  2A07 F;  2P7V B;  3KP5 A;  1LKX A;  4MQV A;  1RES A;  1HKQ A;  1AKH B;  4M3F A;  3DEW A;  3KYD B;  5LHH A;  2CQQ A;  5EZH A;  4IHW A;  2WAQ A;  3PFY A;  3RYP A;  1VND A;  2ESH A;  3AFH A;  2MH9 A;  2I10 A;  5F1R A;  1B1B A;  1R5G A;  4M6X A;  2OPT A;  1KA8 A;  3E5U A;  1MBK A;  3EYI A;  3WG9 A;  3MFK A;  3BJA A;  3BTC A;  3HHG A;  4ENJ A;  2HOT A;  2EIJ H;  4PUS A;  1R4N B;  2DOA A;  2DA6 A;  4HYE A;  4I0A A;  3E0J B;  3QU3 A;  4HOB A;  5LD2 C;  2L7F P;  2K4B A;  4GYI A;  3GFI A;  3DBR B;  1Z77 A;  2LTP A;  2LY1 A;  3BQZ A;  5JFR A;  4KMF A;  1YHQ I;  3H3V K;  3IP4 B;  5HLT A;  3SJM A;  1K61 A;  1FY7 A;  1SD6 A;  4AYB A;  2W48 A;  3LOC A;  5L3D A;  4XM3 A;  2EFQ A;  1J09 A;  2HYJ A;  2OUM A;  3T8R A;  4CYD A;  1ENH A;  4DYR A;  4J19 A;  2OTJ I;  2VN2 A;  1X19 A;  3MKZ A;  2JA6 J;  1ZAR A;  2WAE A;  3ASO H;  1RET A;  1TZL A;  2LFB A;  5TGT A;  3GLX A;  4BH9 A;  1APL C;  2VOP A;  4C2M J;  4LLL A;  2QQ9 A;  2CUZ A;  2QSF X;  5DDG A;  3I5U A;  5E20 A;  2GIV A;  3IHU A;  5L3F A;  4A6E A;  4RB2 C;  2QA4 I;  2FXA A;  1D1A A;  2P7C B;  3DCF A;  1ODD A;  1E17 A;  4XQF A;  2IS1 A;  1IUY A;  3GVA A;  4NQW B;  3RKW A;  3E6D A;  3GCM A;  3MZ8 A;  2VOO A;  4UY8 I;  4UNO A;  1DPR A;  1VF9 A;  3QWL A;  3K4K A;  3K10 A;  1XPX A;  3FMQ A;  4LMY A;  5K7F A;  4ENM A;  3GTG J;  3CZ6 A;  2D45 A;  1Y1V J;  4P96 A;  1X1B A;  1X4O A;  4R79 A;  3M9A A;  1IRF A;  3WTZ A;  1OR7 A;  3IV5 A;  1SFK A;  5C3E J;  2IP2 A;  3ZMS A;  3HB9 A;  2VPR A;  3CO6 C;  3VFZ A;  4NQW A;  2LKX A;  1FP1 D;  1NK3 P;  2R7Z J;  4BBS J;  2MGQ A;  5KAI C;  4G7O F;  1MW7 A;  3KLO A;  1O7L A;  2F5D A;  3LMM A;  1O57 A;  3CDI A;  4D0P A;  1U8B A;  1YI2 I;  4HW0 A;  1MBH A;  3BT9 A;  3BC8 A;  2R7T A;  3MZH A;  1V5F A;  2A05 A;  4W1U A;  2OAZ A;  3K4N A;  4M72 A;  1P92 A;  3HGY A;  3WTS C;  2JMW A;  4Q47 A;  1FOK A;  3GWZ A;  2ZJQ F;  1S8N A;  1FT9 A;  1WQ2 A;  2RAE A;  4RGU A;  1EV7 A;  2AHQ A;  4L9V A;  2F5F A;  1DUX C;  1IXS B;  1TQI A;  2R7Q A;  4RGX A;  4HNV A;  1VQM I;  2N8G A;  1WFX A;  2DQL A;  5FRO A;  4B8X A;  1R1V A;  1ZK8 A;  3LQQ A;  1JJ6 C;  3O2P E;  2PMU A;  3A2K A;  4WWC A;  5F1J A;  4IF4 A;  5IP7 J;  3DPT A;  2HVS A;  3WTV C;  1YW9 A;  3B6A A;  1NG6 A;  2DDB A;  3IH2 A;  4XKW A;  1DDN A;  2CS3 A;  3K4C A;  3F22 A;  2BBY A;  3OWT A;  3RKX A;  5C44 J;  5B66 C;  2XRN A;  2R5Z A;  2W00 A;  4UV8 A;  1FSE A;  2WTE A;  1BR2 A;  1G3T A;  2EA4 A;  2M2E A;  1TNS A;  3VSL A;  1KU2 A;  3HZJ A;  4S0H B;  4HDV A;  1H8A C;  2R5Y A;  5LHG A;  1L0O C;  1QPM A;  1UAA A;  5EDN A;  4LK1 F;  3G1M A;  2V9P A;  3I54 A;  3OSF A;  2G7U A;  2DA2 A;  4QLC U;  2QQB A;  3IL2 A;  1DU0 A;  1PP7 U;  1LEA A;  2VT3 A;  1Z05 A;  3S3O A;  3GW2 A;  3CME I;  3E6C C;  3A0H C;  1GXP A;  1K79 A;  2G7H A;  1JHF A;  2ELJ A;  1ZEL A;  2DT6 A;  5F04 A;  4E7J A;  5FFX A;  3R4K A;  2RVC A;  4BE1 A;  2FSW A;  3A02 A;  2STT A;  3MKW B;  3W2V A;  2A61 A;  1B6A A;  2HTS A;  4L5J A;  1EA3 A;  1HDP A;  2XRL A;  2JVH A;  2ZC2 A;  3CF5 F;  1A31 A;  5IT9 K;  3L9F A;  1HOM A;  3LFU A;  3TO6 A;  4A5M A;  4FIS A;  4A0Y A;  3J7A O;  3HGG A;  4EQQ A;  3HM5 A;  3N4M A;  3QU6 A;  2HS5 A;  2NVY J;  2BW3 B;  2L02 A;  3P9I A;  1PVE A;  3F21 A;  1GVJ A;  3F6O A;  2XF7 A;  4DJA A;  1XDU A;  3S2D J;  1WJC A;  2RKH A;  2J5P A;  5GPA A;  2NNY A;  1W7P B;  2JRT A;  3GTQ J;  1FWZ A;  2I8D A;  2PJR B;  3F23 A;  1FX7 A;  2NAZ A;  2XAU A;  2K85 A;  3OL3 A;  5FRM A;  4XLE A;  2H6B A;  2DMT A;  1QA6 A;  4FET A;  4ZYH A;  2OF7 A;  4E7K A;  2DTZ A;  3FBN B;  2DT5 A;  2EIK H;  2VON A;  1W7P A;  5KK1 A;  4LG3 A;  1P6R A;  2QEN A;  3K70 C;  2UZK A;  4IQJ A;  1V54 H;  2HDC A;  2JA8 J;  2JA5 J;  2VQC A;  4V2G A;  3DEE A;  4B3X A;  1JXS A;  3A03 A;  5FLV A;  1VQ8 I;  1FOY A;  3JAM K;  4YFX F;  1OPC A;  1UHM A;  2Y48 A;  5JVG F;  3J81 K;  5HOO A;  5BPI A;  2X6X A;  4N9H A;  2W7N A;  4I6Z A;  1FYM A;  3OL4 A;  3J80 Z;  1Y6I A;  2OC6 A;  3R60 A;  4AID A;  4S05 A;  3WE2 A;  3ROU A;  2ZNZ A;  1UB9 A;  2XGD A;  2CH0 A;  2L01 A;  2HQR A;  4HST A;  3LAJ A;  3SEZ A;  1TP4 A;  2L5Q A;  4HBL A;  3S1M J;  1K4T A;  4CDG A;  2ZXW H;  2M7A A;  2QM3 A;  1YOV B;  1YIO A;  4XBF A;  4EJO A;  1MNM C;  4LLN A;  3ZGK A;  2VXD A;  5E3M A;  4Y52 J;  3AKZ A;  2R7V A;  3BPV A;  3RZO J;  4JYK A;  4A3D J;  3HBL A;  3RI4 A;  3GX4 X;  3FK6 A;  3H36 A;  1VQO I;  5HLG A;  3A01 B;  5FFZ A;  4YIF A;  1MSF C;  3SXY A;  4ZYG A;  2FOW A;  2DTR A;  4L0Y B;  3C18 A;  2L9V A;  4AWX B;  1TTY A;  3HPG A;  3OS2 A;  1RKT A;  1I5Z A;  2IJL A;  4XRS G;  3B6C A;  1LJ9 A;  4ESJ A;  3FMR A;  3F0C A;  2IBD A;  2GIZ A;  1F4K A;  4QTR A;  4YFK F;  2R7F A;  2VLA A;  2E1M B;  3TOA A;  3CCJ I;  1UZC A;  1FOX A;  3KX2 A;  4M3D A;  3BP8 A;  1WVR A;  1XMX A;  2ZME C;  5CJ9 A;  4AM3 A;  2BE5 F;  4A3C J;  2VE8 A;  2NOG A;  3CF2 A;  3S3N A;  2R93 J;  2HOE A;  3HRS A;  5H2F C;  4G12 A;  4C9Y A;  3DU5 A;  2B0L A;  2EZK A;  3TW7 A;  4BDZ A;  2V9K A;  3DPL C;  2DFH A;  2AS5 F;  3KZI C;  3CUQ B;  5CQE A;  1OCO H;  1J59 A;  5E18 F;  4BJ5 C;  1OCP A;  4DNC A;  5K5O A;  5C4J J;  1V5G A;  2RQQ A;  1T08 B;  3G2B A;  2LBF B;  4NDL A;  2CUJ A;  2HKO A;  3EUA A;  3CCE I;  1HKS A;  3K4J A;  3AAF A;  1PJR A;  3H35 A;  3H0D A;  2CFO A;  1D8K A;  1ZR4 A;  2JN6 A;  3IRR A;  1D1B A;  2G0E A;  5J1R A;  1HW5 A;  2KIF A;  2BXZ A;  1Z6T A;  2JK3 A;  3I4P A;  1BW5 A;  4HPQ A;  4DQ2 A;  5JR3 A;  2TDX A;  3Q9V A;  1ETX A;  2LLK A;  3CJR B;  4RLF A;  4EJW A;  1R5H A;  5K1Y A;  2A69 F;  3K1N A;  1XG1 A;  5J4V A;  1OQY A;  2EZH A;  2MA3 A;  3Q0V A;  4W97 A;  5F6F A;  5FD5 A;  4CIC A;  1YQA A;  4JX4 A;  4PJN A;  1IUF A;  1WH7 A;  3OYF A;  3M4O J;  4MO7 A;  1G6N A;  3ELK A;  5HNF A;  1X4P A;  4FQG A;  2PJP A;  2IGM A;  1S7A A;  3M8E A;  4D7N A;  1SVL A;  1WJ5 A;  4IL6 C;  1BA5 A;  4I98 B;  5HDK A;  2WY8 Q;  1JUM A;  2ZME B;  4GCV A;  5E1W A;  3RPU D;  4HDU A;  2LDU A;  4II2 A;  1QU3 A;  2RC4 A;  2V6C A;  3BQY A;  5ED4 A;  1Y0N A;  3ABK H;  3ZQQ A;  3HSF A;  3IKT A;  2O8X A;  1O7F A;  1MBG A;  2VKD A;  4PGH A;  2R7X A;  3EPZ A;  3WGI A;  2O6G E;  2D1H A;  2ZME A;  5LEJ A;  1RRJ A;  3LWF A;  4XSX F;  1FBS A;  3CQZ J;  1QO0 D;  3JRA A;  1IRZ A;  5E8I A;  1BL0 A;  5D4R A;  3PUF A;  2KZG A;  5D8L B;  1IW7 F;  1WPK A;  1JHH A;  4J01 A;  4ZTF A;  4QPO A;  2KDO A;  3DV8 A;  3Q0W A;  2NVQ J;  3VOE A;  3OYH A;  1OCC H;  5K7Z A;  3P9C A;  5DCM A;  2M45 A;  1V55 H;  2HDW A;  2VJI A;  5F08 A;  4PK4 A;  3R0J A;  3BG3 A;  4JK1 X;  4DBQ A;  4OMZ A;  2RNG A;  2E2I J;  4Z2Y A;  1G8X A;  4Z6Y A;  1IAW A;  3CLO A;  3JTG A;  2DYR H;  2JTV A;  1LQ1 A;  4UVC A;  1E0E A;  4M3G A;  4XID A;  4I99 C;  4BKX A;  3KZY A;  4B43 A;  3L2W A;  2E71 A;  3HJE A;  4HV5 A;  1TNT A;  5IP9 J;  3HKZ A;  2I5U A;  1QVT A;  1XTA A;  5CVU A;  3FKI J;  3CJN A;  1D1C A;  3DTE A;  2IA2 A;  4YG2 F;  5L3G A;  2HXO A;  2L4M A;  5ICE A;  4HRI A;  2OTL I;  2HYF A;  2VE9 A;  4CCK A;  5EGO B;  5LGT A;  3I55 I;  2QF7 A;  2DN0 A;  2COM A;  4MFD A;  3J7Y J;  2VC0 A;  1X1A A;  3FXU A;  2LY2 A;  2P8T A;  3DP7 A;  3K69 A;  4M9S A;  4XN0 A;  1S29 A;  4Q48 A;  4C2T A;  4OIN F;  1LVA A;  3BTL A;  1QNT A;  3H92 A;  1H9T A;  4F92 B;  4IHX A;  2X1E A;  4NB5 A;  2ZFW A;  2E5N A;  3FBI B;  1F9N A;  1FTT A;  3Q9S A;  2ISY A;  1FMV A;  5EGO A;  2HDD A;  4BU2 A;  1SC7 A;  1IRG A;  1ZRD A;  1YJN I;  3ZRG A;  3JRH A;  2NXN B;  2EQR A;  5BNG A;  2ZKZ A;  1MND A;  4OOI A;  1MMD A;  3AG1 H;  5JVT A;  4IOA F;  3HOZ J;  3JRD A;  4EM0 B;  4AVZ A;  2HVR A;  4GFB A;  1R36 A;  4A0Z A;  2QBY B;  4FTH A;  3CDH A;  3I53 A;  5DD8 A;  2A6T A;  4HZF A;  2HOA A;  2XAG A;  1J5Y A;  4LIU A;  3ZXS A;  1MJB A;  1FEX A;  3VYT B;  2DBB A;  2ESN A;  5KVR A;  1RPW A;  2P4W A;  4EGZ A;  3FHZ A;  3FK7 A;  4E7S A;  2NOJ B;  3F3X A;  4HF2 A;  3ZR8 X;  5ERI A;  4M6Y A;  2BHZ A;  1CF7 A;  2GA2 A;  4XIC A;  3GLL A;  4ZJZ A;  1H0M A;  5TJJ A;  4EVI A;  2MC4 A;  2KKO A;  1MBF A;  2QSH X;  3K4M A;  4GGG A;  5L3E A;  5DS9 A;  3WGH A;  1W5S A;  2FNA A;  4XLH A;  3E97 A;  2CGP A;  3AL0 B;  3CJT B;  4I2O A;  1JKR C;  3CUO A;  2M7B A;  2KT0 A;  3K6G A;  5BMZ A;  4PSX A;  2Z5U A;  4CCJ A;  3GYH X;  4WXC A;  2L7Z A;  2RQP A;  5HLH A;  3G71 I;  2L54 A;  2M34 A;  2CW8 A;  5F27 A;  1IN7 A;  1Y8R B;  3I0T A;  3LSG A;  1ZKG A;  2X48 A;  3P7N A;  4Y17 A;  3V4G A;  3A0B C;  1I6X A;  2TRT A;  1SFO J;  5HNH A;  1EH8 A;  1R4M B;  4E7L A;  5KHD A;  2XV4 S;  1BOA A;  4U88 A;  4ESB A;  1Z67 A;  1VQP I;  4E7H A;  5FKO A;  4I02 A;  4BUP A;  3PNY A;  2L3D A;  3P9K A;  3ABM H;  2PG4 A;  4RS8 A;  2O7O A;  1G3W A;  2FQ4 A;  5B3S H;  2QYO A;  1STZ A;  2XAS A;  2RDP A;  1SVO A;  3PL8 A;  3SDG A;  2PFB A;  5LHI A;  4HLY A;  1REP C;  1Y39 A;  3QP6 A;  2W82 A;  2EA2 A;  4D1Q A;  3GZ5 A;  5F0F A;  1DGR M;  1JKQ C;  2E60 A;  2Y31 A;  5FLX K;  3OYI A;  1LFU P;  2B63 J;  2Z1D A;  3HRU A;  1POG A;  5KNL A;  2W85 A;  1TW3 A;  2CWE A;  3WG7 H;  5BS6 A;  4DIQ A;  2K9M A;  4WCG A;  1VQ5 I;  1JUS A;  4KT5 C;  5CVI A;  1BI0 A;  1ZGW A;  4A3L J;  1BIA A;  2LKS A;  2V1N A;  4XKC A;  2BVM A;  2YS9 A;  5GPC A;  2ADU A;  3VB2 A;  2BEO A;  4PJM A;  1KGS A;  3JR9 A;  1YYV A;  4A12 A;  2QVO A;  2W4S A;  1VQL I;  3IAM 2;  1QZZ A;  1ETW A;  1FOW A;  2HWV A;  4BXX J;  2Z2S B;  4H0E A;  4CYC B;  2XB5 A;  3TP0 A;  4PZJ A;  2E1C A;  4I01 A;  3KP6 A;  5CKT A;  3L00 A;  3WE3 A;  3BZ6 A;  4LG0 B;  4A5N A;  3ECH A;  1WJA A;  3GFL A;  4RAG A;  2HYG D;  3C7J A;  2F5C A;  4ZDP A;  3L2U A;  4HX7 A;  1YG2 A;  1KON A;  3DTK A;  2QZ8 A;  1SD4 A;  2LOO A;  4EM2 A;  4CYC A;  4YII A;  4EGY A;  1KU9 A;  1O3Q A;  2CV2 A;  2LKP A;  3PSF A;  4BY7 J;  1EKE A;  2ACJ A;  1IXC A;  3ZQI A;  5DM7 F;  1CGP A;  1PUE E;  1U6G A;  3MAJ A;  2CW7 A;  3OS1 A;  1T8I A;  3HL2 A;  4DZP A;  1EH6 A;  2L7K A;  3F8N A;  1IDZ A;  2R0Q C;  3S2H J;  3VEP A;  4XN3 A;  4P9F A;  4PFO A;  1W7P D;  2FQ3 A;  3TMO A;  1JI8 A;  4V19 K;  1WRJ A;  4CCN A;  1Z9C A;  2X51 A;  4ZYD A;  3FIS A;  1OYW A;  2BY0 A;  3OYM A;  3TDZ C;  3RQ4 A;  3SZG A;  4ZYE A;  4XKB A;  3CC7 I;  3F6V A;  1T56 A;  1QGP A;  4WF2 A;  3HTS B;  5L3C A;  5JHF A;  1D8J A;  3COA C;  2X85 A;  3OMY A;  1O4X A;  3QPT A;  3H3Z A;  4RM2 A;  4LOC A;  3X2Q H;  3O8H A;  1FBQ A;  4L0Z B;  5FKL A;  2PMZ N;  4WXH A;  3JSP A;  1H9G A;  2ICW G;  1G4D A;  4F91 B;  1MZB A;  3TOB A;  2JQ7 A;  4HX4 A;  3E5Q A;  4ZDO A;  2NS0 A;  3S1Q J;  2X6O A;  4Y3O A;  1XMK A;  4E4H A;  1UHS A;  3BG5 A;  4GYG A;  3SZT A;  2LNB A;  2XPW A;  2KIU A;  2XGX A;  4XRF A;  4MFE A;  3LFK A;  3GFJ A;  2X6W A;  3ZQF A;  3E3V A;  4UV9 A;  1AWC A;  1ZRC A;  2WV1 A;  3ECO A;  4KIS A;  4UVA A;  2H09 A;  1UHW A;  3LSM A;  4HQE A;  1MMN A;  1S3J A;  2DMQ A;  1GT0 C;  3AG4 H;  5JLW A;  2EJR A;  3TQN A;  4MGR A;  4C3J J;  4JBA A;  2HI3 A;  4O5V A;  3HG9 A;  3KYL A;  3CC4 I;  1NH3 A;  1J9I A;  2DLL A;  2Y0S A;  4XLA A;  3LA3 A;  2JJ7 A;  3KE2 A;  4LLG F;  3ZPL A;  1XCV A;  3FKJ A;  2LD5 A;  3GO5 A;  4BAY A;  4KIB A;  1YRN B;  2P5V A;  1XGO A;  4M3B A;  2CFX A;  2X9D A;  1S5L C;  3R6S A;  2H1L A;  4UUV A;  2XKP A;  1HA8 A;  2OV7 A;  2ZO4 A;  4RMN A;  1LFP A;  3S17 J;  1X2N A;  3K70 D;  5DEQ A;  1DP7 P;  1LFB A;  2F4I A;  1XGM A;  2X0L A;  2NVX J;  5J3L A;  4G94 A;  3L2Q A;  2BYV E;  4AIJ A;  1IXR C;  2L0K A;  1YRN A;  4L18 B;  2Y75 A;  1O3T A;  3PO3 J;  1KYW A;  2DA4 A;  2JSC A;  3OIO A;  3Q0U A;  4MTE A;  2HXI A;  4IX7 A;  4NBQ A;  1IG7 A;  2FMY A;  3ABT A;  3SFZ A;  2R5Z B;  2K9N A;  3FM5 A;  4ZZD A;  4K2E A;  1B4A A;  3FXJ A;  3GTO J;  4A93 J;  4OU0 A;  1I27 A;  4A3G J;  3S93 A;  2FBK A;  2ZB9 A;  5E1Z B;  1QVU A;  2PEX A;  2HKX A;  4LJZ F;  4Y33 A;  1B72 B;  2CMP A;  2R5Y B;  1XB4 A;  3RCO A;  3CCV I;  5D5W B;  3S1R J;  2IS4 A;  4IQ4 A;  1X2M A;  2ME0 A;  2QEX I;  2AXL A;  4BHC A;  1TQM A;  3I4N J;  1KU3 A;  4ZC3 A;  4IPA A;  1B72 A;  4BXF A;  1TLH B;  2Z16 A;  4B3A A;  1JTX A;  2P5K A;  3TED A;  2OQG A;  5C4X J;  2GWR A;  4EJU A;  4EV0 A;  2F5E A;  3HSR A;  3BR3 A;  4RAZ A;  3HEF A;  1IC8 A;  2K3F A;  4KIF A;  4M9X A;  3CCS I;  3TDU C;  1K78 A;  3OOU A;  4RLQ A;  4B09 A;  3QPH A;  4LGW A;  5H6R A;  1MDM A;  2XDV A;  2O61 A;  1OFC X;  4BE0 A;  2E36 A;  4BJ6 C;  2GXG A;  2IPQ X;  2DDA A;  4B1R A;  3QP5 A;  4L5I A;  3DWL E;  4FE4 A;  4F55 A;  4HX8 A;  1ORK A;  3DQV C;  3U2R A;  1T98 A;  5J8F A;  1K83 J;  1U9N A;  2X1C A;  2XB0 X;  4BE2 A;  5HDN A;  2V1X A;  1TWH J;  1U5T C;  1FPQ A;  3ERE D;  5H20 A;  4E70 A;  3GTM J;  4UUS B;  5M5W J;  1XD7 A;  4OIO F;  1J0R A;  1WCM J;  2CG4 A;  2QCO A;  3JRC A;  3H3U A;  2CUF A;  2EIN H;  3K4L A;  4XOP A;  3ZMD A;  5JHU A;  1G59 A;  1MMG A;  2L2O A;  3E6B A;  4HLX A;  2PN6 A;  3BDD A;  4ZZL A;  3JTH A;  4M9Z A;  4CZC A;  2JZY A;  3HUG B;  4YRV A;  3J80 K;  2VXZ A;  4HG2 A;  4RDU A;  4UUS A;  1FZP B;  2ISZ A;  1IN6 A;  1I39 A;  4NNJ A;  2CW0 F;  2BY3 A;  4DYQ A;  1EH7 A;  5HOD A;  1YJ9 I;  2W57 A;  1ETQ A;  3GFM A;  3WOD F;  1DP3 A;  3BG6 A;  5ILS A;  3M1C A;  4QIW N;  1S72 I;  2JUG A;  4A3F J;  3HUG A;  4LFU A;  4B4C A;  3W2A A;  3BCB A;  5LGU A;  3HOY J;  1PP8 F;  4GXO A;  1VFC A;  3IRQ A;  4XKV A;  3GME A;  4Y7N J;  2P81 A;  1VQK I;  1T38 A;  2IGN A;  5F0H A;  2ECC A;  1T6S A;  2ID3 A;  4KIT B;  1Z1D A;  2MW8 A;  2R7O A;  3KPH A;  3EUK L;  3M8F A;  3ZCO A;  5HS9 A;  1YJW I;  2H94 A;  2FE3 A;  5IT3 A;  5CVR A;  4MHG A;  1I1S A;  1YX5 A;  3CLQ A;  1HCR A;  2F4O B;  1T95 A;  3MN2 A;  2IT0 A;  1ETK A;  5A2Q Z;  9ANT A;  2M3A A;  2E5Z A;  4RGS A;  4G7Z F;  2EB7 A;  5J6X A;  1FMW A;  1Z0X A;  5BOX A;  2B7E A;  3TKY A;  1U5T B;  2DXI A;  3ZQL A;  3SHF A;  2DA5 A;  4AIH A;  5KAF C;  2RNJ A;  2BHY A;  2EIM H;  4XMY A;  1R1U A;  1TW2 A;  3WU2 C;  2FJ1 A;  5DM6 F;  1WGX A;  3NEU A;  3ISP A;  5J1Y A;  4MQ9 F;  2IS2 A;  5IYB J;  5IYC J;  2HQA A;  3KYC B;  2VAS A;  1MBJ A;  5JLX A;  1I1G A;  1B9N A;  3BTI A;  2W25 A;  2Y2Z A;  2E7W A;  1ITY A;  2LYC A;  3IH3 A;  4NHJ A;  2GXB A;  3H0G J;  4N4O B;  1LE8 A;  5FKM A;  1U5T A;  3IC7 A;  2XPU A;  1YIT I;  3DBL B;  3CMM A;  2Q8K A;  1NHA A;  4EMS A;  4NC6 A;  1LPQ A;  4QPQ A;  1D0Z A;  3HRM A;  2NNN A;  2KJB A;  1J7K A;  3S8P A;  2R3S A;  4XSZ F;  4G6D A;  6PAX A;  2WV0 A;  1ETY A;  5EEH A;  2O8K A;  1Z91 A;  1DU6 A;  4KIC A;  4R1H A;  3DTI A;  4AUX A;  5D6F A;  2E2J J;  2QQA A;  1HC8 A;  2WB1 N;  2LG4 A;  3J7A Y;  2ZXI A;  3L09 A;  5DTD A;  3WGG A;  3H1C A;  1OMI A;  3L1P A;  2DO7 A;  1UCR A;  3BZK A;  4BGD A;  4BHB A;  3JRB A;  2M9H A;  1B8I A;  2JA2 A;  5F64 A;  3QOP A;  2KDZ A;  2EFO A;  2IA0 A;  4IXA A;  3E1S A;  4DYC A;  1F36 A;  3BZC A;  4TV7 A;  1BI1 A;  5HLI A;  1IN4 A;  3LSJ A;  3S1N J;  3GTK J;  2DOF A;  3GBG A;  1WWX A;  1TT5 B;  1XDS A;  2YUS A;  3PIO F;  4EJT A;  4AD9 A;  4ZDL A;  1YFH A;  1KQ8 A;  3F8F A;  3OSG A;  4BXU A;  3GF2 A;  2WBM A;  2VT2 A;  2OZU A;  3G6E I;  2E2H J;  1ACI A;  5LFA A;  1VQ6 I;  1OCT C;  2XHK A;  1D3Y A;  4RGR A;  1ZG1 A;  1KU7 A;  1D5V A;  1C0W A;  4B44 A;  1ZG3 A;  3V7C A;  3I3L A;  3RKY A;  2ZJP F;  2P0W A;  2KFD A;  2CQK A;  4BQN A;  1MH4 A;  3ESW B;  4FT8 A;  4LD5 A;  1DGW Y;  1GXQ A;  3ZQH A;  4KNY A;  2BVL A;  2JT1 A;  3P5J A;  1GDT A;  3FXO A;  3W6J B;  1LVK A;  1R58 A;  3OYG A;  4D7M A;  4BY1 J;  4IEJ A;  1FIA A;  4N0B A;  2D5V A;  3ZMU A;  4A2U A;  3LSI A;  2VIX A;  3W2W A;  2HPM A;  3CJQ B;  1YW8 A;  2LF7 A;  5AIP A;  3OYC A;  4UXN A;  5ILV A;  1QZY A;  4RM3 A;  4F52 A;  3V7R A;  5K5R A;  2WAD A;  2IGO A;  3D1N I;  4Q5S F;  1P2F A;  4OAY A;  1V5E A;  2GZW A;  5DCM B;  4UUT A;  1ULY A;  5M3M J;  2A5W A;  3I9V 2;  2EFW A;  5IY5 H;  3HOV J;  1HSJ A;  1UST A;  3F72 A;  4M71 A;  3BJ6 A;  1T33 A;  2QLZ A;  2DMN A;  1X3U A;  3Q3S A;  3VOD A;  4G9Y A;  4C2U A;  3K9T A;  3PFI A;  4KIG A;  4CSW A;  3U1K A;  4P9U A;  1FYL A;  1MMA A;  2CQ7 A;  3ML6 A;  3HOS A;  3BWG A;  4BEH B;  2IA1 A;  2LH9 A;  2RRE A;  1BC8 C;  2EV0 A;  3VWB A;  3RJP A;  1D0X A;  4X0G A;  4D5F A;  2M8E A;  3FF5 A;  3BR6 A;  5GTH C;  1E3O C;  1A6I A;  2K7L A;  4BNC A;  1FLI A;  1WI9 A;  2IS6 A;  4XON A;  2KP6 A;  1IJW C;  3REO A;  3G73 A;  1Y0U A;  3FX3 A;  1ZTR A;  3JRG A;  2EPF A;  3RZD J;  2CV0 A;  2O0Y A;  4BEH A;  2FBH A;  1MIJ A;  4JX5 A;  3KIO A;  3LSK A;  2JRM A;  1HW2 A;  3G1L A;  2DA1 A;  2K02 A;  1GV5 A;  4OMY A;  4G6T B; 
#chains in the Genus database with same CATH homology
 1A5J A;  2CJJ A;  4BXX J;  2WAQ N;  2LP0 A;  2RAE A;  4CYC B;  2XB5 A;  2AHQ A;  3TP0 A;  5FJ8 J;  2GBY A;  2HOS A;  4HNV A;  2N8G A;  3BG9 A;  2O9L A;  1JUP A;  1ZK8 A;  1JJ6 C;  4AC0 A;  1B8I B;  2DJN A;  4MLO A;  5F1J A;  3A01 A;  5IP7 J;  2NS8 A;  3HOX J;  3B6A A;  2COB A;  2R92 J;  4CYC A;  3IH2 A;  2XGC A;  4BY7 J;  4EEF G;  1H89 C;  4AYB N;  3ZQI A;  5M3F J;  5C44 J;  1W0U A;  2R5Z A;  3ZQC A;  3S14 J;  2MG4 A;  2EBI A;  1NTC A;  4DZP A;  2M2E A;  4DZJ A;  5EG0 A;  1IDZ A;  1H8A C;  4S0H B;  2R0Q C;  5K7H A;  2R5Y A;  3S2H J;  2CRG A;  5EDN A;  2IEK A;  3G1M A;  2CU7 A;  3OSF A;  2VI6 A;  2DA2 A;  5GP9 A;  1DU0 A;  5J1U A;  4A3B J;  2VUM J;  3FIS A;  4I76 A;  4C3H J;  1HF0 A;  5F04 A;  1VI0 A;  2JWT A;  3BR0 A;  3A02 A;  1T56 A;  4BBR J;  1HDP A;  2ECB A;  2XRL A;  2JA7 J;  2IAI A;  1HOM A;  1O4X A;  2NS7 A;  4FIS A;  2CQX A;  4JP0 A;  3HGG A;  4LOC A;  3HM5 A;  3O8H A;  2NVY J;  5FKL A;  2PMZ N;  3IH4 A;  3S2D J;  5GPA A;  3GTQ J;  5EZG A;  5F0C A;  1HDD C;  1SAN A;  2Y9Y A;  2NVT J;  3S1Q J;  2X6O A;  3S15 J;  1UHS A;  3BG5 A;  1I6H J;  2XPW A;  4ABZ A;  2DMT A;  4MFE A;  1Y1W J;  2OF7 A;  2M0C A;  3PM1 A;  1IDY A;  2DTZ A;  3ZQF A;  3G1O A;  2EZI A;  4A3E J;  3C2B A;  3W6V A;  2ID6 A;  2WV1 A;  4FCY A;  1IV6 A;  2DA3 A;  2JA8 J;  1QPI A;  2JA5 J;  4V2G A;  3A03 A;  5FLV A;  1WH5 A;  4V2F A;  2DMQ A;  1GT0 C;  4I6Z A;  5JLW A;  4A3I J;  4C3J J;  2HI3 A;  1IGN A;  1FIP A;  2K40 A;  5FKN A;  1TWA J;  5IOZ A;  1UMQ A;  2JJ7 A;  5FKK A;  4C3I J;  2LK2 A;  2VKV A;  5E3O A;  2FD5 A;  2XGD A;  2LD5 A;  2H8R A;  3BR2 A;  1YRN B;  3M3Y J;  4M3B A;  2X9D A;  3S1M J;  5M5X J;  1ZQ3 P;  1MNM C;  2GM4 A;  3S17 J;  1X2N A;  5E3M A;  1GUU A;  1CQT A;  4Y52 J;  3RZO J;  4JYK A;  4A3D J;  3HBL A;  1LFB A;  3HOW J;  3FK6 A;  2NVX J;  5J3L A;  3A01 B;  3TP3 A;  1UG2 A;  1YRN A;  2L0K A;  1MSF C;  3PO3 J;  4L5E A;  2DA4 A;  3OIO A;  3Q0U A;  2HXI A;  4X1E A;  1IG7 A;  1RKT A;  4RBO A;  3PO2 J;  2R5Z B;  2M8G X;  2K9N A;  4XRS G;  3B6C A;  4A93 J;  3GTO J;  3F0C A;  2IBD A;  4A3G J;  3JRI A;  2DMP A;  4QTR A;  5EG0 B;  2ZB9 A;  3UKG A;  4DW6 A;  1QVU A;  4M6V A;  1B72 B;  2CUE A;  2R5Y B;  4M3D A;  5FLM J;  3HDD A;  3NAU A;  1WI3 A;  4A3C J;  1RR7 A;  3NAR A;  3S1R J;  2NOG A;  5E3N A;  1X2M A;  2ME0 A;  2R93 J;  3I4N J;  3BR1 A;  4G12 A;  2EZK A;  3TW7 A;  2AO9 A;  1B72 A;  3TED A;  4B3A A;  1JTX A;  1PUF A;  1MH3 A;  5C4X J;  1OCP A;  1U9O A;  3BR3 A;  5C4J J;  1MBE A;  1IC8 A;  3HEF A;  1NK2 P;  1GVD A;  4NDL A;  2L7M P;  1ZR4 A;  2JN6 A;  2MSY A;  3OOU A;  2G0E A;  1P7J A;  5J1R A;  3SFI A;  3LNQ A;  1JJ8 C;  2JK3 A;  2LR8 A;  1OFC X;  1H88 C;  1BW5 A;  3I4M J;  4B1R A;  4X6A J;  3QPL A;  5IPA A;  1S7E A;  4A69 C;  4FE4 A;  1ETX A;  1ORK A;  2LLK A;  5IOY A;  2LY9 A;  4A3K J;  1K83 J;  1U9N A;  2Y0S N;  2XB0 X;  2EH3 A;  1TC3 C;  1TWH J;  3GTJ J;  1XG1 A;  3GTM J;  2EZH A;  2XPV A;  2FX0 A;  3Q0V A;  4W97 A;  1BW6 A;  4UUS B;  1BJZ A;  3QPS A;  2XSD C;  4A3J J;  3MKL A;  5M5W J;  4JX4 A;  1IUF A;  2QCO A;  1WCM J;  5M5Y J;  2EZL A;  1WH7 A;  3M4O J;  4MO7 A;  3WHC A;  3JRC A;  2CUF A;  2Y9Z A;  1AKH A;  1EF4 A;  4D7N A;  5EF6 A;  1D5Y A;  1AHD P;  1BA5 A;  1JUM A;  4RDU A;  2YU9 J;  4UUS A;  3WHB A;  1QRY A;  2K9Q A;  1R9T J;  4DYQ A;  5HOD A;  1ETQ A;  3BTJ A;  1JTY A;  3BQY A;  4FE7 A;  3JRF A;  4QIW N;  4A3F J;  4B4C A;  4A3M J;  1MBG A;  3HOY J;  1GV2 A;  1VFC A;  4Y7N J;  3GTP J;  2XGE A;  2P81 A;  3CQZ J;  3O8G A;  5F0H A;  4XRS A;  3JRA A;  1IRZ A;  2ECC A;  2ID3 A;  1BL0 A;  2MW8 A;  2L9R A;  3RQI A;  1WPK A;  1HCR A;  3CMY A;  1RKW A;  1HLV A;  3Q0W A;  3MN2 A;  1ETK A;  4D5C A;  2NVQ J;  9ANT A;  5K7Z A;  2DMU A;  3K7A J;  5F08 A;  3BG3 A;  2E2I J;  1Z0X A;  3K2A A;  5EYR A;  4IHV A;  3ZQL A;  2TCT A;  1I50 J;  2DA5 A;  2ME6 A;  2FJ1 A;  4M3G A;  4XID A;  4BKX A;  1WGX A;  5IP6 A;  1OJL A;  5J1Y A;  1JKO C;  3BR5 A;  5IYB J;  5IP9 J;  5IYC J;  2VKE A;  1QVT A;  3JRE A;  1MBJ A;  3FKI J;  5JLX A;  3BTI A;  2Y2Z A;  1ZR2 A;  1ITY A;  3IH3 A;  3S16 J;  3H0G J;  3QQA A;  1LE8 A;  2HXO A;  5FKM A;  5IYD J;  1P7I A;  3LSR A;  2XPU A;  1PUF B;  5EGO B;  3CDL A;  1JGG A;  2QF7 A;  2DN0 A;  4MFD A;  2HQ5 A;  2E19 A;  3ZQG A;  3TW6 A;  4XRM A;  1Q1V A;  3VPR A;  2Y30 A;  5E3L A;  4QSH A;  3ZOB A;  1U78 A;  3BTL A;  2LVS A;  3CCY A;  1ETY A;  2O8K A;  1DU6 A;  4XK4 A;  2H1K A;  4IHX A;  1FTT A;  4JX6 A;  4AUX A;  1XS9 A;  2HDD A;  5EGO A;  2E2J J;  3JRH A;  2WB1 N;  3GTL J;  1FTZ A;  2EQR A;  5BNG A;  5DTD A;  3L1P A;  5EEA A;  3HOZ J;  3JRD A;  1TWG J;  3JRB A;  1I3Q J;  2M9H A;  3MVP A;  1B8I A;  4GFB A;  1ETO A;  2KDZ A;  4FTH A;  3HOU J;  4DYC A;  1F36 A;  2HOA A;  3LSJ A;  1RES A;  3GTK J;  3S1N J;  1AKH B;  3GBG A;  4M3F A;  3DEW A;  2YUS A;  1FEX A;  2CQQ A;  5EZH A;  1RPW A;  4IHW A;  3FK7 A;  3OSG A;  2DA7 A;  1VND A;  2E2H J;  1OCT C;  1W0T A;  2I10 A;  1MSE C;  4XIC A;  2OPT A;  1MBK A;  2GLO A;  3E7L A;  1MBF A;  3BTC A;  2HOT A;  5DS9 A;  2DA6 A;  3FIW A;  1MH4 A;  2L7F P;  1JKR C;  2E1O A;  2KT0 A;  3ZQH A;  1Z77 A;  2LTP A;  3BQZ A;  1GDT A;  3H3V K;  3SJM A;  1TWC J;  1K61 A;  4M3E A;  4D7M A;  4BY1 J;  2W48 A;  2L7Z A;  1FIA A;  4IEJ A;  3LOC A;  2D5V A;  2M34 A;  2HYJ A;  5F27 A;  4DYR A;  1ENH A;  3LSG A;  4J19 A;  3HKZ N;  2ELK A;  2JA6 J;  1F43 A;  1ZKG A;  2X48 A;  3D1N I;  1RET A;  2LFB A;  1APL C;  4C2M J;  2TRT A;  1SFO J;  4UUT A;  5M3M J;  3DCF A;  4IHY A;  5FKO A;  3HOV J;  2O7O A;  1T33 A;  2DMN A;  1VF9 A;  2FQ4 A;  3Q3S A;  5K7F A;  1TWF J;  3SDG A;  3GTG J;  1Y1V J;  3IV5 A;  1G2H A;  1LE8 B;  5F0F A;  4D5F A;  1JKQ C;  5C3E J;  2Y31 A;  3BR6 A;  3HB9 A;  2VPR A;  1A6I A;  1E3O C;  1LFU P;  2B63 J;  2LKX A;  1POG A;  1NK3 P;  2R7Z J;  4BBS J;  2MGQ A;  1ETV A;  1IJW C;  1FJL A;  1AU7 A;  1JT6 A;  3LSP A;  1U8B A;  1ZTR A;  1JUS A;  3JRG A;  3RZD J;  1ZGW A;  4MIM A;  1MBH A;  1XC5 A;  3BT9 A;  4A3L J;  3RKQ A;  4JX5 A;  4W1U A;  1X58 A;  2YS9 A;  5GPC A;  3G1L A;  3JR9 A;  2DA1 A;  1JT0 A;  1GV5 A;  2K9S A;  3HGY A;  2JMW A;  1JKP C;  1ETW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...