1EUDA

Crystal structure of phosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
306
structure length
305
Chain Sequence
CSYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
total genus 113
structure length 305
sequence length 306
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eudA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eudA01
1PS8A 4PRLA 3C7AA 5JXWA 4E5MA 2Y0DA 2V7PA 2BGLA 3UH1A 3JQAD 1ZXLA 2RCYA 4Q3DA 2GN4A 3FWNA 1EUCA 5FI5A 4BNTA 2X9VA 5AOVA 3UCEA 3DOOA 2XF8A 4OOFA 3U09A 2OMEA 4QTZA 4LCEA 4NJMB 4IBOA 1CJCA 1PL8A 1YB1A 4YRDA 4AJOA 4RJTA 2FPGB 4LMPA 1P33A 3V2HA 1DXYA 1G0NA 1NFRA 2VUUA 5FYDA 1YONA 2JD0A 1N8KA 3JTMA 1HLPA 3AFMA 3AU9A 4LRSB 3FCOA 3U4DA 1DSSG 2X5JO 2YV1A 3JQ7B 3CIFA 4JP3A 1B15A 1JKIA 3PDUA 4A73A 4PFJA 5ER9A 5IZCC 3VH4A 1E3IA 4BNGA 4BGVA 4UVEA 2P5YA 4ND4A 4DC1A 3NAQA 4FPXA 4QXMA 1SC6A 3Q0EA 3RJ5A 3LLSA 2C29D 4FBGA 4OO3A 4TROA 2GGSA 2BELA 4U6QA 5IDYA 4ZVVA 1UP7A 4CMCA 1JA9A 5DOZA 2BHLA 1ADGA 1PQWA 1NASA 2Y1CA 5GY7A 1YJ8A 3ZWYA 3FR7A 4CODB 1X13A 3KUXA 5ILOA 1K2WA 5DCYA 4KZPA 3ONEA 3GOHA 2FPPA 3AUTA 1XR3A 3TWOA 4GGPA 3PWSA 4RGBA 4J2HA 4K6FA 2W8ZA 2VQ3A 3PHJA 3ANMA 5CAEA 4WASA 4CV0A 1O94A 4YT8A 2W2KA 1ISJA 2V65A 4UAGA 3VTFA 2AHRA 1PJCA 3OA0A 1ISGA 4CM8B 1PZEA 4GVXA 4JCOA 5BSGA 5CEJA 3AU8A 3FBTA 4CM7A 4M55A 5TT1A 2AXQA 5JAMA 3LU1A 3OMLA 3Q1LA 4FFOA 2R00A 4FB5A 4EW6A 4MP6A 4O0LA 3CMMA 1ML3A 3Q11A 2P68A 4R1UA 3ZWWA 2C82A 1OZAA 1Z82A 2HJSA 1BW9A 2NU6B 4RPKA 1LDEA 4WEOA 5JS6A 3GZNB 3ADOA 3JQCA 3ZWOA 3VZPA 3PYXA 3AFNA 4DIBA 3GR6A 2JFGA 3BYZA 3JQBA 3I3OA 4MVJI 3LF1A 4KQWA 3JQGB 4E33A 5TSDA 4S3MA 1H6DA 4A10A 3W4KA 3RUFA 1NHWA 2X8LA 3GNQA 4P4NA 5IZ4A 4N54A 5DCUA 4ZQGA 5HM8A 5DP2A 3AY6A 2I3GA 3QWBA 4LSWA 4A03A 1P1RA 4CV3A 1Y8QA 2G17A 2G5CA 1KY4A 2RH8A 3UW3A 1AHIA 3B1KA 1RM5A 1E7MA 3F46A 2NACA 2CVOA 2GCGA 5HBRA 4L4SA 2FSVA 4IGEA 3DO5A 1OI7A 1UXIA 1HZJA 1KIFA 5JNLA 2B4QA 4RCVA 1RM3A 2Y1DA 3E5MA 3ZCXA 1E1LA 3DZGA 3PQDA 2I9PA 1U5AA 1FDSA 1NYTA 2Q2QA 1QSGA 2AQHA 3PQFA 3OF2A 1I2CA 1N7HA 3P7MA 1AXEA 5DF1A 1L7DA 3C7CB 4MVJH 1GQYA 4CMIA 3MZ0A 4DYDA 1IHXA 1X7DA 1Z7BA 3BTSA 4R16A 3ULKA 4XD2A 2VCYA 3GAFA 3F4LA 4XIJA 5KVVA 1VI2A 1NAHA 4I9NA 2HJRA 1CF2O 1VKOA 1NTOA 1DFHA 4YWJA 4ZQFA 2OO5A 3HDQA 2O2SA 2EP5A 3OICA 1KVTA 4NHEA 5B12A 4GPD1 2PKRA 2Q2VA 1WZEA 1R0SA 1KETA 3GNSA 3DZIA 4KTVE 3ZWVA 3O03A 1B14A 2IYPA 4ESOA 1A9YA 4WCDA 1MC5A 5TC4A 3QWFA 4E2XA 2OFPA 1LRJA 4W9NA 4CV2A 1LLUA 1TLTA 4H7PA 2NVBA 4PLVA 5B4TA 4IM7A 2X23A 1SB8A 1BSVA 4FC6A 4F6CA 3PRJA 3ROPA 3WYBA 2YHIB 3P2OA 3QV1A 4MIEA 4I5EA 3C8MA 1NR7A 2UVDA 3KLMX 4BO2A 3DDNA 4KUEA 1KVUA 4HX5A 1BDBA 2QHXA 3IUPA 4ZRNA 4CM4B 2V6MA 3DTYA 1R15A 4GSLA 4IDDA 1T26A 1PWXA 3MJVA 1UAYA 3WIEA 3EVTA 3GN2A 3CMCO 1F06A 3JYPA 1KEUA 1KERA 2B5WA 3I9MA 3O4RA 2BH9A 4N7RA 3QWHA 4R54A 3PHHA 3UICA 4LVUA 3E82A 2JFHA 1NBOA 4LMRA 4Q39A 2QW8A 1Y8QB 4FGSA 2WYVA 4LW8A 3ZW9A 1F17A 4UUNA 5JMPA 3CTMA 4BO5A 1N5DA 4E12A 3DR3A 4IIUA 2HRBA 4Y8VA 4FD3A 4RPGA 1DBVO 4M8SA 4AJ1A 2SCUB 4FFPA 1NVTA 3VOSA 1NWHA 4XB1A 2O48X 3GPIA 3C85A 3NT5A 3G0OA 2BKAA 4QQRA 5CDTA 1E3LA 5LC1A 1E77A 1OBFO 4O63O 4FJ0A 5CEFA 1TVEA 2ILTA 1YBMA 3AOEC 2IODA 2DPGA 2PGLA 4DPKA 2CSUA 3WMXA 2D4AA 1C3VA 2O23A 3LT4A 3NDIA 2A9FA 4IZIA 2YQ4A 5EESA 3JQ9A 3AY3A 4ALIA 2Q49A 4BS9A 4PIVA 3WLEA 4CM8A 4BGUA 3EVNA 5CG1A 3W6ZA 2B0JA 2VYVA 4PCVA 2HO5A 2Y1EA 4XYMA 3ZHXA 3GNTA 3I83A 4QFDA 4YT5A 5C7OO 1U8XX 5DBIA 2J5KA 2GASA 5DBFA 5DOVA 3LC7O 5KNLA 3F1KA 1EE9A 1ZJZA 3O9ZA 4MKZA 3D5QA 3INTA 1IPFA 1QYDA 2BI7A 1UXGA 2TMGA 2X9NA 1R0LA 2E49A 4PLPA 2DBZA 3WG9A 1PU2A 3R6DA 5I7SA 4GX0A 2O3SA 3DEYX 3GDOA 3ZHBA 1WP4A 4XQGA 4GMGA 2BD0A 2CDBA 2IYOA 4JQCA 4BNFA 1WXDA 3DMTC 3AUAA 3OJ0A 2PZMA 4UEJA 2HK7A 1D1SA 5A9TA 3IKTA 4NQZA 1AUPA 1N1EA 4BNMA 2VHZA 3GGOA 4AJHA 4CLOB 4BKRA 5KTKA 3JQ7A 3FNGA 2QYTA 3BMCB 4K9DA 1PEDA 5IF3A 1P1IA 1EDOA 3BMQB 2PGDA 3BXXA 1LLDA 3DZHA 2VWGA 1GV0A 2CVZA 3O38A 3OIDA 3TN7A 3WGGA 5CHEA 1DRWA 1ZUD1 3GH3A 3RD5A 1LDBA 4RF5A 3GK3A 1H94A 5THKA 5IN4A 4BVAA 1JLLA 1HEUA 1VJ1A 2YQ5A 1VLLA 3K8ZA 4OXYA 1P9LA 1VM6A 3R3SA 3ZV6A 1DFIA 1I2BA 2Q99A 1YH3A 2O3TA 4IZHA 2NSDA 5G0TA 4R1SA 2IZZA 5A5EA 3JSAA 3H8VA 4PZDA 5BNFA 3RU9A 4GBJA 1HSOA 3PPIA 2P2SA 5ICMA 1BVUA 2X4GA 4UVHA 3B6ZA 2FPIA 2VUSA 2ZCVA 2DBRA 5H81A 3H3JA 4AFNA 3ASVA 3KETA 4AJLA 4FJ1A 1X14A 3ETGA 4P38A 3MCVA 3L6OO 3B20A 4CM4A 1IOLA 1HDRA 4J0EA 2AE1A 4QO8A 3ROQA 3TL3A 1EZ4A 5CDYA 1MG0A 5AQ1A 3JCZA 5G0SA 4E5KA 4BB5A 2VTDA 3DFUA 3HDYA 1EK5A 2EG9A 4E2YA 5C5IA 1IE3A 3WQRA 4KDFA 2IXBA 3IP1A 3IQDB 4DXHA 1A4UA 3ZI0A 4PLFA 3GA0A 5AXDA 3AI3A 3W8EA 1JKJA 4M49A 3GDFA 3OHSX 3M2PA 4CJXA 3HHPA 4YJGA 3MWDB 3L0DA 1T2AA 4NBRA 4GVLA 5TJ9A 2HUNA 1ZSNA 4IQ0A 2X5KO 4IMPA 1C1DB 1TT5A 3QJ5A 4NPCA 1NVGA 1DHTA 4RZHA 3LZ6A 4OIMA 4R51A 3DBLB 2VYNA 2HLPA 3UFXB 1ONOA 2CNBA 2Q1TA 3QSGA 3DZFA 4GKBA 3UOGA 1U3UA 5CEEA 1DIHA 2WWRA 1KOLA 2LDXA 4LRTB 5L45A 4MP3A 4CUZA 4CQLB 1E3WA 5EINA 3DB2A 3FHLA 1GUYA 2C20A 4Y6PA 4ZHSA 3ZWAA 5I7VA 2CF5A 5KVCA 3FI9A 5G4KA 5KJ1A 5K0ZA 3WGIA 1H2BA 2W4QA 3W8DA 1MLDA 3DXFA 1A5ZA 1N9GA 1QRRA 4I5FA 3B1FA 3INRA 3OM9A 4RVSA 3HB5X 2WD8A 1GEGA 5TNXA 3AOEA 4ROSA 4WKGA 3EW7A 4A7PA 4CUKA 5HS4A 1BTOA 1DIAA 3JQ6A 5F5NA 2EXXA 4BNWA 3RI3A 3I23A 1OC2A 3I9OA 1NX6A 4EUEA 1N92A 3TZCA 1SEVA 1EVYA 4Z3KA 1MFPA 4IDCA 1LDMA 2O7QA 2PZLA 4FJ2A 4JBGA 3DQPA 5CDSA 5A06A 3ZNQA 1BXGA 4EDFA 2ZB3A 5JC8A 1HE5A 5EN4A 2VNAA 5L7WA 5TRTA 4F6LA 5H83A 1V9LA 1OMOA 3ZNNA 4EYEA 2O3RA 1DIGA 3GT0A 4NBUA 1PTJA 2VHVA 3GMSA 5K6AC 2IEBA 3F5SA 3GZNA 2OBYA 4M89A 5AXAA 4D0SA 5JDIC 5JYDA 4MOWA 5DN9A 1YBVA 2Q45A 3I6IA 2P4QA 7ADHA 4JNKA 3DHEA 2XXJA 3ZW8A 1LC3A 3E48A 5U4QA 5L51A 3HADA 2FSSA 4N18A 1GY8A 2Z5LA 3F47A 3NGLA 1A7KA 5TJHA 3SJ7A 3RBZA 4XWYA 5H82A 2Y66A 4RVDA 1CQIB 4D46A 3MWEB 1Q7BA 3I9KA 4TVOA 5EERA 4DC0A 1FJHA 4JK3A 1XEAA 3IDSA 4BNYA 4EGFA 5ENVA 4BO4A 3RC1A 3ICCA 4UUOA 2TMDA 4W82A 5K6AA 2RHRA 4CL3A 1U2GA 1YL7A 2FR1A 2XPCA 3BTUA 1CETA 3NTOA 2ET6A 2ZYDA 4CMJA 4OKIA 4HP8A 4PLWA 2QX7A 2RH4A 3UHAA 1XU7A 4L0QA 3Q3CA 1LLQA 1PGNA 1ZCJA 4GWKA 2BGKA 4OQYA 4WNIA 5KJ6A 4BOYA 3AY7A 2Q50A 1UXJA 1HDYA 4C4OA 4DIOA 5KWEA 1RM4A 4QO7A 4IS2A 1XHLA 1K6XA 4IDFA 4XEHA 3JD2A 3F9IA 4II2A 5IDQA 5KJFA 2QRLA 1UUFA 1W4ZA 3PDJA 2OGUA 3PJDA 4W7HA 4G81A 3ZDFA 4Y67A 1I01A 4BKOA 5HS6A 4AJNA 1HL3A 2J3HA 3QVTA 4WPGA 3ZU3A 2WTBA 1M6HA 2DT5A 4Z0PA 4F46A 4BO6A 4N5MA 2GERA 4XYLA 1A27A 1I3MA 4RORA 2FZEA 3FF4A 5A02A 1EBUA 1BHSA 8ADHA 5IDWA 3ETEA 1QV7A 1V8BA 4CPDA 1T25A 4XYBA 4B79A 3GVHA 1YDWA 4IXTA 2C7VA 2NU8A 3VPFA 1Q0HA 1TEHA 1EK6A 4YJGB 1W0CA 3JQEA 1GTMA 1HKUA 3OFSA 3WJAA 3WFIA 1LA2A 1B8UA 3PJFA 2YW9A 3ZWMA 4PG5A 3KBOA 2IE0A 4MVJD 4RDIA 3D3WA 3L4SO 3W6UA 1R6DA 4J7CA 4MINA 1Y9AA 1ONPA 4IPTA 3GAZA 3CUKA 2QYSA 3NRCA 3AM3A 3KHUA 4WOJA 4OJNA 3RASA 1C0IA 1EBFA 3WJ7A 1DHRA 2GD1O 1XSEA 3O8QA 3ETDA 5JSFA 3JD4A 3ZWBA 1ADBA 2VT2A 1UR5A 1WWKA 2O7SA 4J91A 1MC4A 1TT7A 2X6TA 3JQ9C 4BO3A 1HE4A 4A27A 4YRAA 3PWKA 1PQUA 3S8MA 4WGGA 1U9JA 1QKIA 1MA0A 4EZBA 1FDVA 1T2FA 3V2GA 4BIIA 5I9LA 4J4TA 3I1JA 3JQ8B 5K9ZA 2Y0EA 1V3VA 4ALKA 4NI5A 1JDJA 3JQAB 5TLSA 2IXAA 2C07A 1A71A 4HNHA 1GCOA 3PGXA 4PN3A 3ONDA 2NU6A 4P4LA 3I4CA 1P0CA 4D45A 2BF7A 4B8WA 2VZ8A 3L9WA 3PYLA 1K5HA 4JLWA 1A4IA 3V1YA 3OEWA 4JBIA 3ONFA 3QRWA 2JHFA 4CM1A 1D1TA 4DPLA 4ALJA 3JQFA 1X0VA 3F6YA 3KEOA 4IUYA 3FBGA 1X7GA 1YVEI 4H3VA 3STHA 3TDKA 2HK8A 5CG2A 4GH5A 2GF2A 3IL2A 4R9SA 3VZSA 4BNZA 1DIBA 7MDHA 4NNJA 2PY6A 2FP4A 1NQAO 1BXGB 4XA8A 4ALNA 2ZTVA 2BFOA 3OBBA 4X54A 1GCUA 2GDZA 3TOZA 1GYQA 5KKCA 2FPPB 4EEZA 4RF3A 3WGZA 5AXCA 4HFJA 2O3UA 4XYEA 1PGJA 4BNLA 4EEXA 5FWNA 4HV4A 1ORRA 1GPDG 2FR8A 2UYYA 2O3JA 3CINA 5B4UA 2VUTA 2PD3A 2IZ1A 4CLXA 3KSZO 2J3IA 4ZRMA 2Y1FA 2YDYA 3NTRA 3OJFA 2NLOA 3HFSA 1EQUA 5DNAA 2D0IA 3E8XA 1XIVA 4ZGWA 1SOVA 1Y7TA 2ZB4A 2EGHA 1N9GB 4OSOA 2X1HA 4F3YA 3V5NA 4J6FA 4G2NA 4WLUA 1TB4A 1U7TA 2I66A 2AEFA 2PTGA 1JVBA 4B3IA 1KS9A 3DBRA 1ZIDA 2OHXA 3EAGA 3UAGA 2JAPA 2JL1A 2QQ5A 3IMFA 8LDHA 2EKPA 2RHCA 1UDBA 3D4PA 3GRPA 1XLTA 3PIIA 1KVQA 2CD9A 3PFFA 4AJPA 4FS3A 1XA0A 3PZBA 4JN6B 1HF3A 4ZN6A 3WWYA 2J8ZA 1QG6A 2OZPA 2B4TO 2NWQA 2Q4BA 4FCCA 2JD1A 4ND5A 4Z0HO 3LF2A 2BGMA 4XYGA 1LI4A 2ZIZA 3EZYA 2B5VA 1KEPA 2QZZA 2VWPA 3E9MA 4I5GA 1H0KA 4DA9A 4YJFB 2JCVA 1XDWA 2NU7A 2Z1MA 1QYWA 1ADCA 3ZU5A 3LDHA 2J6IA 2GLXA 1NP3A 3D1LA 3GVCA 3H9EO 4TKMA 4Y9DA 3VAZA 3WX0A 4P8RA 1LQUA 4WLOA 2IDZA 3UVEA 1R4MB 2H63A 4HFRA 4AJ2A 3QWIA 2X86A 1RKXA 1CDOA 1YKFA 4ZQEA 3U49A 1BMDA 3PEFA 3DMYA 2X0IA 3WQSB 2VWHA 2WEKA 4ND1A 1ULUA 5EIOA 2NTVA 2ZK7A 4NU6A 4M54A 1PZFA 3U62A 4XDYA 5CPBA 4AJJA 4QSMA 3UCXA 2XXBA 3GVPA 1M76A 1O6ZA 4E4YA 1UZLA 5B4VA 4G5HA 1UXKA 1HLDA 2UAGA 3ZV5A 3DC2A 4XX0B 5KVQA 2AW5A 3WWZA 2CFCA 1SO8A 1GYRA 2DAPA 3D4OA 5ITWA 1C14A 4XGNA 2VZ0A 2WYWA 5T67A 1RJWA 2D5AA 4PLGA 4XQEA 4NR0A 5FI3A 3H9UA 2V6FA 3UCFA 1YO6A 3A1NA 5AXBA 1VSVA 4E30A 2Y1OA 1KVRA 3GDGA 3ZZNA 3BZUA 4E3ZA 4I9UA 1ZK3A 1SZJG 1KY5A 1F8GA 3E18A 3VKVA 2BMAA 5F1PA 1G1AA 2BI8A 2NTNA 2QRKA 1SNYA 1EE2A 4YT4A 4IJVA 2WDZA 4J1QA 1VRWA 1B16A 3GEGA 4GLOA 3TSCA 4WUVA 1ZXBA 2GN6A 3PHIA 4FFLA 3M1LA 3HNPA 1C1XB 2HMWA 1JVSA 2GPTA 4YXFA 4MJLA 1ZEMA 1SAYA 1O5IA 1U3WA 3DTTA 4UVIA 3NTQA 2WE8A 3WR5A 1I36A 3DZKA 2WJPA 1DB3A 3GMDA 4U6SA 4DGSA 5FFFA 4UULA 4FIZA 1FF9A 2EV9A 3HG7A 1HWYA 1MP0A 1NM5A 3KSDO 5T64A 2HCTA 3QIVA 4YAEA 2C5EA 2J3KA 3L6DA 4NMHA 4UUMA 1ZH8A 5L53A 1ISMA 1CQIA 4J1TA 1SPXA 4RLHA 2VYVD 4BKQA 4WLNA 2GN8A 9LDTA 2H9IA 2FP4B 3BHJA 2NVWA 1GYPA 4IINA 1GQ2A 2Q2WA 4JROA 4DIFA 1Q2XA 5JCJA 4J4BA 1E6WA 3NDRA 4XDZA 1Q1NA 3N7UA 1AXGA 2C7GA 1GFSA 2FOIA 1GAEO 4UUPA 3AUUA 1KEVA 1B8VA 3GY0A 3WGOA 4YQZA 4CM9A 1ZO8A 5ITVA 1E7RA 2F1KA 4IXWA 4J16A 1MG5A 3CEAA 3DBHA 1ZVMA 3CSDA 2O50A 3NGXA 3BMQA 4PG4A 4BMSA 2WM3A 3DBRB 2CUKA 4CL8A 3S55A 2G82A 2H1SA 5KJCA 2CF6A 4L76A 5GZ1A 2AEMA 3QVWA 1PSDA 4OH1A 4WJZA 3LC1O 4CLEA 5A1TA 3W4IA 1DAPA 5I9NA 4JIGA 3K5PA 4D0RA 5C7LO 4IJKA 5CP8A 1E7SA 1HXHA 1HETA 2PR2A 9LDBA 3GVIA 1ZK0A 3C7DB 4I08A 4BNIA 1VC2A 4CLRB 1YBAA 4D79A 2AQ8A 4RPHA 5BSHA 4JJGA 3DOJA 4GI2A 1NHGA 3N74A 4EJ0A 4HWKA 1HDGO 5CDUA 1UXHA 4UREA 4K26A 5BR7A 3M2TA 3QVXA 5LCXA 3EUWA 3HQ4O 4PRKA 1AN9A 1E0DA 4BNUA 4CMAA 2GZ3A 1T2CA 3NEPX 4M1QA 4E13A 4K28A 2NU8B 4J0FA 3ZHYA 1LC0A 1EMDA 3UGKA 1Q0LA 2AG8A 2BLLA 1NVMB 2VZ9A 5EQDA 4BKPA 4UEOA 4D3DA 1DJQA 3ZNOA 2EW8A 5BT9A 4YAGA 1K6IA 1V35A 2ZTUA 1S7CA 3BAZA 4AICA 4D42A 1B0AA 3EZLA 4CQLA 4DVJA 3PVZA 2ZJ1A 1I0ZA 4CMGA 2GN9A 4ZJUA 4ONEA 4PLCA 3ZU4A 2D2IA 2R2GA 4C7KA 3WXBA 1VL0A 1YGYA 3SJUA 2BFMA 3JV7A 3RFVA 1VPDA 2DFDA 3ITKA 3MTGA 4GL4A 3KO8A 4RF2A 1DIRA 4CQMB 1SBYA 1TT5B 1X0XA 1Y8RA 2OORA 1LJ8A 1P77A 1R66A 1Y9EA 3GFGA 1GZ3A 5JDCA 1RM0A 4CM5A 1YOVA 3HN7A 3HB4X 1Z45A 2GO1A 1LDNA 5L7TA 3QWAA 3E1KA 4BGEA 3RBXA 4IMRA 3G1UA 1L7EA 1T1SA 2BFAA 3CPSA 4B4UA 1GEEA 5L95A 3QVSA 2JFFA 3H2SA 2B4RO 3TPCA 4KMSA 4B3JA 2AE2A 5EJ2A 3L6EA 5EQFA 2YYYA 1JTVA 2YJZA 4RVUA 3JQFC 3VVCA 3KYBA 3WFJA 3ASUA 4I8XA 3PHGA 1WVGA 1YWGO 5COBA 2VWQA 3HN2A 3GHYA 4Q3EA 4J9UE 4NFYA 4KTTE 4Z9YA 3ENKA 1A7AA 1M67A 2E37A 4BNKA 1M75A 3MWEA 3JYLA 4WNCA 4W6ZA 1BWSA 4RVFA 1ZW1A 1HE2A 3SEFA 3MOIA 2QIOA 4FSHA 5EMHA 4L74A 3T7EA 3F1LA 1B8PA 1H6CA 5BQFA 1ZMTA 4XGKA 3DONA 3ICPA 4AG3A 2WD7B 4XIYA 3H65A 3RKUA 3CE6A 1ULSA 4HUJA 2QG4A 1QP8A 1P1HA 4JJFA 3N58A 5BNIA 2AMFA 2FHSA 4U0KA 3GC6A 5JY6A 1JLLB 4DQXA 1Q7GA 3ZH2A 3CXRA 3NYWA 4MVJF 1QMGA 4CUJA 2B37A 4H16A 5DCWA 1WDKA 3KYDA 1ZK1A 4J3FA 4CR7A 1YB5A 5IFLA 5T6BA 3FPLA 4EBFA 4EJMA 5G0VA 5IXSA 1PL7A 1ENZA 4ZU3A 1ZZEA 6LDHA 1M6WA 2X58A 3TRIA 2DC1A 1X1TA 4L4RA 1PJ3A 2Z95A 4XCVA 1VSUA 1H6BA 4CMBA 1U7HA 2Y99A 1SEPA 2EWMA 4YQYA 4C7JA 1XELA 2Q1WA 3HJAA 4PG6A 1U3VA 4BNJA 1ZK2A 4QECA 1GD1O 2Y0CA 2B83A 1C0KA 2GR9A 5EPOA 5DZSA 4KP7A 3SVTA 1DOHA 4ID9A 1NPTO 1HDCA 3BMOA 2C2YA 1DC5A 4E5YA 4OMUA 1K0UA 3EMKA 1FDWA 1Z7EA 3PFWO 1O8CA 4II3A 5AYVA 5I7EA 3NUGA 1YQXA 2NADA 1VKNA 1B2LA 3C1OA 2I99A 3WIDA 1P0FA 4GX2A 2ZYAA 5ICSA 3F3SA 1MXHA 2A35A 1I5RA 2VRCD 2NV6A 1ZSYA 3I9NA 3WQQA 1H9BA 3TQHA 1OFGA 3DBHB 3VKUA 4R1NA 2HMUA 1AGNA 4WLVA 4CM6A 4YBZA 1I33A 4ZICA 4BO9A 2D8AA 1MB4A 3UXYA 1N1GA 1NPYA 1U4SA 1VE9A 2JHGA 3U4HA 2P91A 4Y6RA 2DVMA 4R9RA 1PZHA 1DC3A 4FOOA 1D7OA 3AWDA 2PA3A 1M2WA 2FRDA 1CYDA 2H5LA 2NTJA 2I67A 3GF4A 4KUGA 5EL0A 3K30A 4GKVA 3P2YA 1E1MA 1ISIA 5DBGA 2YFHA 1V3UA 4XQCA 4PLYA 1PR9A 2PNFA 1IZ0A 2YHUA 5L4SA 1O9BA 4HFNA 2UV8A 3KOUA 1FDUA 1T2DA 1KEWA 3OJLA 4MDHA 5C3MA 5JW6A 3OIGA 4MVJA 4KOAA 3S2GA 1H93A 3LVFO 3D3WB 3RWBA 1GDHA 1Y1PA 1UJMA 3NJ4A 5ER6A 5TS3A 1IHYA 3BTOA 3W8FA 5A03A 3E9NA 3FR8A 5I9MA 5GZ3A 1YXMA 1YS4A 1P45A 1I3KA 5DULA 2P9GA 4O5OA 3FNHA 5IJZA 4PLTA 1Y8RB 4ZD6A 2F00A 2X7HA 2EP7A 3L07A 3KSUA 2E82A 1AE1A 1VJ0A 2FPGA 2AQIA 3QHAA 1V0JA 3AOGA 4IJUA 1KC1A 4DREA 4YAIA 1E7YA 1E3EA 1DRVA 3PZRA 2JJYA 1DAOA 3VH1A 3WYCA 2DTEA 1NAIA 5DT9A 4E21A 1PJSA 1PL6A 4GX1A 2D3TA 3UF0A 2DQ4A 3ON5A 1UP4A 4K6CA 3TL2A 5C37A 2Q4EA 3DBVO 3K2EA 1WNTA 3JYNA 2X0JA 4CQMD 4JXKA 2FR0A 4XX0A 5L9AA 1VL8A 2IZ0A 3JD3A 3TZ6A 1ENPA 5MGBA 4MPDA 1GV1A 1IPEA 2O4UX 4OGWA 3HFGA 4BNNA 1F8FA 1LNQA 4L8VA 1BRMA 3L77A 4DQVA 4BUCA 2JAHA 1MFZA 2WSBA 2OXIA 4LN1A 5B1YA 3GG9A 4TRNA 3BTVA 1DJNA 2NQTA 1VJTA 4NDNE 3EGOA 4WE3A 4ILKA 1HRDA 3MJ4A 1HE3A 2WE7A 4P4GA 2X0NA 1ISFA 3IIEA 4B4OA 4ITUA 1ZSVA 3ST7A 4YRBA 6ADHA 2ZTLA 4AJIA 1I2ZA 1LX6A 1B26A 1D3AA 1H6AA 3ZV3A 2EHDA 2XAAA 4A2CA 5JY1A 1WZIA 3P19A 1R4NB 3C24A 1UDCA 2RAFA 1NWCA 1DC6A 2YFQA 4MIOA 4JX8A 5L4NA 1X15A 3T7CA 3TFOA 3DOCA 5KVSA 1MV8A 3AUSA 4M86A 1BW9B 1MXFA 2PKQP 5MDHA 4GAEA 4NU5A 3E9QA 1JN0A 3HWRA 1L1FA 1FXSA 3VDQA 1XU9A 1WLYA 1SMKA 2HMVA 2CY0A 2PWZA 2PD4A 1A9ZA 1YL6A 1GADO 3GQVA 4OSPA 3VVBA 2OBNA 1PGQA 4YR9A 4NFSA 3Q6IA 3A06A 2C0CA 2RBEA 3DL2A 4WCFC 3G49A 4L75A 4GWGA 1GZ4A 4K1LA 4Y6SA 2EEZA 4YAKA 1GR0A 4CLOA 3WLFA 5CAEB 4A0SA 1J4AA 4BNXA 1E1KA 4BL5A 3SLKA 1QV6A 1XQ6A 3WYEA 4CMKA 5F1OA 2VOJA 3DHYA 3BMOB 1M66A 4FFMA 2V6GA 1H9AA 4E0BA 3PTZA 3NT2A 5L3ZA 2XOXA 5ES3A 4DLAA 1QYCA 1C0PA 1QXSA 3D64A 3KRTA 1EFKA 1JAYA 3X2FA 3H4VA 3VDRA 1PJ4A 4MVJM 4QT0A 1WW8A 3OA2A 4BNHA 1PX0A 2J5QA 3S2EA 1P1JA 3G79A 3I6QA 1YQGA 4E32A 3Q2IA 2PZJA 4XKJA 2IEDA 1P44A 3ROKA 1I10A 1LU9A 3K2BA 2J3JA 3U4CA 5JMWA 1QYVA 2JCYA 1EUZA 1XCBA 1EVJA 2DU8A 4LSMA 5T5QA 5J23A 5G4LA 2HKIA 4W9NC 3INGA 1EQ2A 1GUFA 3H7AA 4OAQA 2VYND 4XR4A 1K89A 4MVJP 4E6PA 3U0BA 3Q9NA 1FDTA 5BNTA 3C1AA 1JWBB 4OXKA 3PLRA 1EUCB 4RPJA 3VPHA 2SCUA 3DMTA 4R4JA 4IJWA 4GMFA 4MO2A 5T8KC 3JQ8A 1X1EA 3OSUA 1R4NA 3VH3A 3FTPA 4I9HA 3PK0A 4MVJG 3WBBA 4D7AA 5F21A 3IKVA 3FWZA 1H2HA 4AJKA 3WSWA 2ZTMA 3U4IA 4BV9A 2NVUA 1ADFA 3VPGA 3IUSA 2O2YA 5GMOA 1Z74A 2PH3A 4TRJA 2HMTA 1DDOA 3I9JA 4J90A 1JAXA 3HDJA 1UP6A 4FGWA 3VZQA 1AHHA 2GUGA 1Y6JA 4Q3AA 4ZQBA 3HSKA 1Y81A 3UKOA 3WICA 1CWUA 5TT0A 2FPIB 4FQ8A 2DUWA 2OL4A 3BA1A 4ZA2A 3TZKA 3VTZA 5THQA 2W2LD 1W73A 1YOVB 4LVCA 1Q0QA 4IDEA 2QRJA 2DM6A 3I5MA 3LT2A 3A4VA 3BMNB 1KYQA 1XQ1A 2BFPA 4FR5A 1U2DA 2E6UX 4DMMA 3CKYA 2VHYA 3JQGA 4BQPA 1F14A 1JKFA 3VZRA 3RC2A 2B36A 3QE3A 1NQOA 2CZCA 5A3JA 2G0TA 1O95A 1QLJA 3SC4A 1WPQA 3DAGA 4YCAA 2PV7A 3ADPA 3S1LA 1XGKA 4OHUA 4YB8A 2DPHA 4JP2A 4YA6A 3AJRA 3ORFA 4RL6A 3IJRA 5TF4A 5TQVA 1YE3A 1LSUA 1E5QA 5A3VA 3KV3O 3ZV4A 1PIWA 5COAA 4KWIA 4JGBA 1Y5MA 2UUPA 3D5TA 2G1UA 2PLAA 1Z6ZA 3VPXA 3ZWPA 1RWBA 2Q1SA 2ZB8A 1K6JA 4Z9FA 4RLSA 5BSEA 4PVDA 3X2EA 4Z6KA 1IB6A 3QP9A 4TWRA 4O59O 4FFNA 4CM9D 4DQUA 5A9RA 4DWVA 3RFXA 2JCXA 4CLRA 2EKQA 2BRUA 3T4EA 1U5CA 3D0OA 4AL4A 1MGOA 3WOHA 4N5LA 1ONNA 3RIHA 3OQ6A 2A4KA 2NU9B 3LQFA 1YB4A 2DUUA 3B70A 3ZWXA 1CERA 4DLBA 1F12A 4D44A 2WMDA 5JAZA 4R68A 4UVGA 3JYQA 4RVHA 3KYCB 1J0XO 4YJFA 1U4OA 4NJOA 4Z3DA 3GLQA 5U9CA 3RKRA 1P31A 1UH5A 2Y93A 1NXQA 3ANNA 5KCZA 4Y98A 4XRRA 4D43A 2VRBA 5JPIA 4RQTA 3KYDB 4BQRA 3MJCA 4CM3A 4NJMA 1ZJYA 3WNQA 2D5CA 1CQJA 4Q3CA 3PGJA 3F4BA 4YACA 2A92A 3PIDA 2PKQO 5HTOA 5HA5A 3TFQA 1B3BA 4QEDA 3ZGYA 4E2ZA 2HRZA 1LDGA 2E48A 4NH4A 3FTNA 4HFMA 1I3NA 3TF5A 4XJSA 2FN7A 3WNVA 2ZCUA 5HRUA 4GX5A 5TIIA 1HSZA 1R0KA 2I76A 5JCXA 4FC7A 1PJQA 1SB9A 4AJ4A 4F45A 1XWFA 4L9RA 1NNUA 2PFGA 1KBZA 1CIVA 2IRWA 2NU9A 3AI2A 1ZFNA 4MVJE 3PJEA 2JD2A 5KJEA 3V1UA 2I5PO 5CDGA 3UN1A 5HWSA 1EVIA 4PVCA 3S2IA 4YEDA 3RFTA 2D1YA 4B3HA 5LDHA 3HUDA 1IL0A 1QR6A 3JYOA 1BG6A 2ZB7A 2PGJA 2HK9A 5JDIA 3K96A 1OAAA 4J1NA 1ZNQO 1PJLA 1LDYA 3WS7A 4BGIA 4NFHA 2ZATA 2O4CA 4FN4A 2CDAA 5TX7A 3FPCA 5I7FA 3UUWA 3NX4A 5TGDA 4R41A 3COSA 2JKVA 4QFCA 3C3XA 3GUCA 3LK7A 2YUTA 1D4FA 1BDMA 1P74A 4FDAA 5IXYA 1EUDA 1R37A 2X22A 4MP8A 4NBWA 3HZZA 1E3WB 4XZ3A 3MJTA 1E92A 3NT4A 3OP4A 4YTEA 3H5AA 3RQSA 3K6JA 4D3FA 1HTBA 1ZKMA 4YJDA 3K73O 1I8TA 2VNSA 3EK2A 3TZHA 3VPSA 4R3WA 5A05A 1GUZA 2Y68A 4KQXA 3LSYA 1PWZA 3JQAA 3A9WA 2VT3A 3OQBA 4PGFA 4WOKA 3WDSA 4RF4A 1K3TA 2QZ9A 1SCUB 2Q1UA 4PG7A 3R1IA 4ND3A 1H5QA 4J7UA 4OQZA 2P9EA 2X5OA 2OOSA 4EUHA 3CZMA 4LISA 3BMNA 3TNLA 3VH2A 1LLCA 5JYEA 5U1PA 2VHWA 5AVOA 4PZCA 2W2LA 2ZYGA 4IDBA 3RUEA 4WK6A 2ZQZA 3O8QB 3TZQA 4B4VA 4IDGA 4IQ8A 1EVZA 4DTIA 1A72A 3QLJA 1OOEA 4OXNA 4R01A 4OM8A 1IULA 3SBOA 5IZCA 2HU2A 3EY4A 5GZ6A 4DLLA 1LRKA 2NUAB 1Z75A 2D59A 2X9GA 2I3AA 3E5RA 1DLJA 1R16A 1T2EA 3RBVA 5IDXA 1LQTA 2A94A 4R1TA 3U5TA 2OUIA 3V8BA 1P1KA 1HYEA 3NJ8A 4INAA 4U0JA 4HNGA 2R00C 2VRCA 4U8GA 4BNVA 1R4MA 3BIOA 3JD1A 3D4NA 1GL3A 3G1TA 3A28A 2Y1GA 3V2UA 5FEUA 1LEHA 3GN1A 1P1FA 2FZWA 1O89A 3AM5A 3B1JA 1R12A 1NFFA 4XJTA 4DRYA 1GPJA 1PJBA 1DEHA 1YRLA 3RUCA 2Z1NA 5F3RA 5IN5A 5JAQA 2VOEA 4M87A 4YVFA 3H9QA 1V6AA 1C0LA 4WEQA 3RUHA 4DYVA 3GZ4A 3H3FA 4BV8A 4OKNA 1E7WA 3OECA 1U8FO 4O1MA 1HDZA 1DPGA 4MKXA 5JFOA 4XB2A 3KM0A 4KDEA 2W90A 4OL9A 1Z73A 2NQ8A 2ZJ0A 1TXGA 2DFVA 2B35A 1RPNA 4Z0TA 2HMSA 1YDEA 3H9JA 1BGVA 4TZKA 5L7YA 4DPMA 3ITDA 4RZIA 3DAFA 2EJWA 5KOIA 2I65A 3RU7A 4YT2A 4NBTA 2HSDA 3DHNA 3H6KA 3SLGA 1XYGA 3U9LA 3L4BA 4IDAA 4YPOA 3I9LA 3KB6A 1JW9B 4BO7A 1T24A 3GHHA 2AA3A 1I32A 4IY1A 2EW2A 2Y05A 4ALLA 4EITA 3CZRA 1IUKA 4I5DA 4JJIA 2J5RA 3PXXA 1I3LA 3LYLA 2VHXA 3LLVA 1E7QA 4G65A 4RQUA 4PG8A 2GNAA 2W98A 3IOYA 3ENNA 3FN4A 5KKAA 4XRGA 3ZHZA 3L9XA 3LC2O 3OH8A 5JO9A 5G0WA 4BO8A 2DLDA 1UZNA 4PLZA 3GGPA 3TJRA 3MEQA 4EJ6A 1LSJA 1NQTA 1C1XA 4D3SA 3T4XA 1T4DA 3KXDA 1G0OA 3JD0A 4RVGA 3RUIA 3I4FA 2HDHA 4RPLA 4WLEA 4P22A 5A9SA 1LRLA 3GG2A 4MKRA 4UVDA 3JQDA 4L4XA 1MX3A 4E2WA 3K9QO 3L4BC 1JWAB 3WBFA 1LXCA 4PLHA 3RUAA 1SOWA 1CQJB 3EYWA 3VHRA 4WCFB 2Q46A 4ALMA 2HAEA 2EIHA 4A5OA 1U3TA 1BVRA 5JLAA 1ID1A 2HQ1A 4BKUA 4YDRA 2ZQYA 4TKLA 2DTXA 2YDXA 3IP3A 3KVOA 1MUUA 1ENYA 2DBVO 3GEDA 1G6KA 4J49A 2GZ1A 2ZKLA 1TI7A 1ARZA 3ANLA 2C59A 1NPDA 2AG5A 4BO0A 1GQQA 1NQ5A 2UUOA 4TRRA 4B7XA 1T1RA 4BHTA 4TRMA 5ILGA 5I8ZA 4J7XA 3RC9A 3F5QA 3WGTA 1KC3A 2C5AA 4I1IA 3RC7A 1J49A 2OP0A 4CMHA 2UDPA 4E31A 4ND2A 2WYUA 3KLPX 2NNLD 3MJEA 4EI2A 1WDMA 4YJHA 4E5NA 5CPFA 4HXYA 2YHIA 1FK8A 3HE3A 4R5MA 2X0RA 5A5FA 5DDIP 4U7WA 2NVUB 3H9GA 4IS3A 3OEYA 5L40A 2P5UA 1XG5A 2AQKA 4FFRA 1EFLA 3SXPA 3WB9A 3OIFA 5COQA 3WGYA 5L4LA 3PLNA 2I6TA 1E3SA 1DRUA 1JQBA 3IC5A 4CQMA 1VL6A 3FNFA 3DAPA 1CRWG 3LT1A 1ISHA 3R3JA 4W7IA 4BMNA 5JO0A 3D3EA 1FMCA 4Q9NA 4B7CA 2C54A 2LDBA 1ZMOA 3AW9A 3Q9UA 3RAJA 4S1VA 2NM0A 4HY3A 4GLLA 3H5RA 4WCFA 5G2OA 3BHIA 3S2FA 2V6BA 1IYZA 5F1KA 5JC1A 3FD8A 1U28A 5T8KA 1Y5RA 1C1DA 1RYDA 3ROMA 3WSVA 4DMLA 1I24A 1PGOA 1E5LA 2FWMX 3D7LA 5A9SB 2EJVA 3BMCA 1UZMA 3MWDA 3AM4A 4ZQHA 5JCJD 1TA4A 1YJQA 1JKJB 3G17A 3GPDG 1W6UA 1NR1A 2Y67A 1HYHA 2AEJA 4DL9A 5ADHA 2GZ2A 2P4HX 3GRKA 1NFQA 1ZEJA 4XGIA 3ZWNA 3OETA 1UDAA 2H6EA 3GVXA 4MIYA 3E03A 3OJEA 3PHLA 1E6UA 3NKLA 3A14A 1HDXA 3WMWA 3AI1A 2YY7A 2YZ7A 1S6YA 5CFZA 3G3EA 1QLHA 3WTCA 3GEMA 4TVBA 4EUFA 4OOEA 1YQDA 4B4WA 1N7GA 2DKNA 2DBQA 2O3QA 1J5PA 4IGFA 4RV9A 1PQPA 4CMEA 1PJ2A 2E4AA 1EEHA 3BHMA 1IZ9A 3QQPA 3WTBA 3C1TA 4IIVA 3U3XA 1BXKA 1Q7CA 4XQ9A 3RROA 2NU7B 1YL5A 3ZN2A 4PZEA 3RUDA 1EDZA 4D41A 1IY8A 5FF9A 3V1TC 3IAHA 3ABIA 2G76A 2EF1A 4CMEC 4BMVA 2FMUA 4NK5A 1DC4A 5G0UA 1WDLA 3H5NA 3KTDA 4XR9A 5BSFA 1LSSA 2PZKA 3IJPA 3DZJA 4LGVA 4TSKA 1ZBQA 1QYXA 1PGPA 1HYGA 2DTDA 4NBVA 3QVOA 4URFA 1LSOA 1XKQA 3QA9A 3SC6A 4KWHA 2P9CA 5JE8A 4UEKA 5B37A 1LUAA 2GSDA 3OJOA 1DLIA 1OC4A 1PS0A 3CH6A 2W2KB 3KYCA 1GZ6A 5DP1A 1HZZA 3FRJA 3O26A 5I8WA 3QY9A 4LCJA 4WLFA 5T57A 2GRAA 1ENOA 4WECA 3ZU2A 4R5HA 3WGQA 4HKTA 1B7GO 1KVSA 3JQBC 5F5LA 2PD6A 4Q3BA 1J6UA 3IS3A 3PQEA 4L73A 3H2ZA 3NV9A 1X7HA 1RYEA 3E6AA 4R3NA 3ZNPA 5JDCC 4TMFA 2EKLA 4J43A 4FOSA 1O0SA 1WMBA 4HBGA 3RCBA 5C7IO 2R6JA 1PJTA 3DWFA 3EDMA 3LT0A 3QW2A 4J2OA 3PYMA 3WGHA 4TZTA 1B3RA 3M6IA 3GGGA 3R0IA 4N5NA 4QUKA 4E5PA 1F0YA 4AJEA 4CR6A 2PH5A 5A4DA 5JBIA 3RJ9A 1GU7A 3OQ1A 4JBHA 4NG5A 3FSRA 2YV3A 3MTJA 3PI7A 4CV1A 1UAGA 1N2SA 4TQGA 4R69A 5G4KB 5IAAA 4J1SA 3MOGA 1DO8A 4H15A 1SCUA 2EGGA 2C2XA 3M1AA 4DUPA 2EERA 1JU9A 3UFXA 5JAIA 3PJGA 4OYRA 3VC7A 1PR3A 4BO1A 4U5QA 4LK3A 4CR8A 4FW8A 1HT0A 5ENDA 3I52A 3DBLA 2Q3EA 4NK4A 5LDGA 3PP8A 2WD7A 5IG2A 4J4HA 2VTEA 2PK3A 1PZGA 2FY8A 4RDHA 4B7UA 4GSKA 1EUDB 1LBEA 3K92A 1BXZA 4CMIB 1E6EA 3AK4A 4W4TA 4A26A 3K31A 2B69A 4QX6A 4O6VA 3NDJA 2CDCA 3ZWCA 4GQAA 4CLHA 4NZ9A 2CVQA 1T4BA 2VN8A 3RVDA 3W1VA 1V3TA 4YAJA 2CMDA 3TOXA 4Z9XA 1ZK4A 3EC7A 1HDOA 3Q2KA 4CLDA 3DFZA 5KIAA 2OP1A 4DBZA 1PS9A 4YJHB 4AVYA 2NUAA 2POQX 1DFGA 4J9VA 5A04A 1QORA 4NIMA 4HADA 1P3DA 1WAMA 2RIRA 3GUYA 3KZVA 4GGOA 4B8ZA 1W8DA 4W99A 3FNEA 4KUHA 3GFBA 4IQGA 3SX2A 3W4JA 4DBVO 1D8AA 3EHEA 3RSHA 2YV2A 4RO0A 3KEQA 4YYZA 1I30A 1CEQA 3P5SA 3HDHA 1LTHR 1E1NA 3PWZA 1WMAA 1E3JA 4Q3NA 1U1IA 4BB6A 3DZBA 2GYYA 3MJSA
chains in the Genus database with same CATH superfamily
3IGFA 2F17A 3A1SA 1SXPA 1CC1S 3K5WA 4KI0A 4N0QA 3MS7A 4Q3DA 2DJIA 2C9BA 1EUCA 3VGJA 3M9WA 3UCEA 4OOFA 1CZHA 2EBUA 3HCEA 1U0FA 2H00A 5JJLA 4LCEA 5IBQA 5LWHA 3DQQA 5CLLA 3WLMA 4AJOA 2Q0HA 3RSZA 4LMPA 3V2HA 1MABB 4Z4HA 1G0NA 2JNWA 5ALPA 2VYFA 1BE1A 2VUUA 3FG9A 3GJQA 3O75A 4N3NA 5DYNA 1P0PA 3WY9A 2C83A 1HLPA 1BYIA 3FCOA 3H11A 4JXJA 3MERA 3SZLA 1UBLS 1JKIA 3DLPX 3MRXA 4RE5A 3ZZ0A 5ITZB 3UEOA 3VH4A 1Q3TA 2C61A 3TLZA 1BDJA 1EDDA 1XI2A 4QXMA 4R2IA 3Q0EA 2H07A 2C29D 1QE0A 3CRW1 3QUSA 4OO3A 4S12A 3I01A 1JJ7A 2GGSA 1AF4A 1ZM9A 2BELA 2IPAB 3K1AB 1UP7A 4ZALA 5IDYA 4K6MA 4CMCA 3W34A 4RMIA 4F4JA 5M2QA 1PQWA 2Y1CA 5GY7A 1YJ8A 4G0OA 3V2IA 4GO1A 2GZSA 1R6XA 2C57A 4JEMA 1FQKA 3R9WA 5KCMA 5CMLA 4GZ6A 2FPPA 4TQUS 1JLKA 3G2LA 4GGPA 4O2AF 3DBOB 1X1SA 4J2HA 2J3LA 4AUNA 4XX1A 1YVRA 4NBKA 2VQ3A 2XDAA 2C7QA 1M1NB 2H3EA 5DTJA 3CKMA 7YASA 2AHRA 1P4GA 1PJCA 3CIOA 1C3EA 3PF8A 5EUMA 1SU6A 1R5NA 4PBSA 1ISGA 1OA1A 2IP4A 2J45A 4NMWA 1D8TA 4GVXA 5CT5A 5IBPA 1X19A 2IHKA 4CM8B 3KQYA 3AU8A 5EZQA 3WWCA 5BSGA 4JI8B 1HL7A 4H1TA 2AXQA 5DB4A 1LV8A 1GLNA 3LBYA 3O7WA 2EFCB 3R5HA 2R00A 4FFOA 5LKRA 1ELOA 1WA5A 4FB5A 4EW6A 3DAOA 3CMMA 4S1PA 1VBNA 1ML3A 1WJGA 3KC2A 2PGOA 4R1UA 3QE0A 5FV7A 1Z82A 2GKOA 3SYRA 4MB2A 3TFWA 2FFBA 5JS6A 3GZNB 1XDBA 3II6X 1W5TA 1PR2A 4YPFA 2LTAA 3AFNA 3VZPA 2XQIA 4ACAA 3GR6A 3O4GA 2LPMA 4W5WA 4JYMA 3EZXA 2JFGA 1WEKA 1NV9A 2WW8A 3BYZA 1H3NA 4M0LA 3LXXA 2MSDB 4KQWA 4X94A 5C2JB 3N8HA 4S3MA 5DX8A 4A10A 1RACA 5A0FA 2AIRA 5IZ4A 4N54A 1TVCA 1BQ3A 5HM8A 5DP2A 1G8GA 1I4DD 3QKUA 3AJEA 3I0ZA 4CV3A 3MQ4A 3D6MA 1VLZA 1CUDA 1TGVA 3L3BA 3QVJA 4R83A 1Q1GA 4UXJA 3BIJA 3F3KA 1AHIA 2BEWB 4AW9A 4PQFA 2B2NA 3PNPA 2IYSA 2RB4A 3A1FA 3LCVB 2JLZA 3E9CA 4PU0A 2R25B 2WFLB 4MWSA 1PV2A 2NACA 2QVGA 3D6FA 3E84A 2XTNA 2GCGA 2ZIEA 3FRHA 3NCTA 4DRXA 1C80A 3QMVA 4L4SA 2ZSKA 4E7OA 2C2GA 2W5UA 3PD7A 1N2EA 1MO6A 3IHLA 4LVOA 1NW6A 4TUYF 3E5MA 3ZCXA 5C8DA 1E1LA 3K9BA 3DZGA 1JNYA 3ROFA 1JJIA 4ODIA 2PBRA 3KT8A 1H8HA 3BXPA 5HIIA 2C88A 3CB4A 2AQHA 4BCCA 3OF2A 4TMTA 1OQAA 1SHLA 2J5BA 2AUTA 3WBKA 2QY9A 1US8A 2CCJA 1ZU5A 3KVNA 4NATA 1K88A 1DIOB 4GEKA 2CMKA 2FSFA 4HLCA 5B58T 1U8EA 1BGXT 5CB4B 1C9MA 1NBAA 2MMCA 3P9QA 1N5JA 2YYZA 1UDRA 3ONVA 3QPDA 1IWOA 4N49A 4RV5A 5EHZA 1Z7BA 2QD5A 3MJFA 4MYTA 5JTUA 2QNIA 2EU8A 4FD2A 2IKQA 1R0BA 3PU6A 4O4IA 4KREA 4FNAA 1H4VB 1L5YA 4B84A 2HCFA 5C52B 1VKOA 1NXSA 3HP1A 4NU8X 4FYYA 4TMKA 4F9GA 4WFJA 4ZOLB 3FYUB 3C15C 3DLCA 3OICA 1YOBA 1OKKD 1PNOA 3Q5DA 4EY8A 2CL6X 4GPD1 4CL2A 4F4FA 2LGJA 3GNSA 4XJXA 4FE4A 3HKEB 1WL8A 3ZWVA 3A4MA 2D7DA 2XQGA 3M6MD 2ZRMA 3RS0A 4KHZA 1VYVA 4MTLA 2XIQA 4E51A 1A9YA 3R5KA 1FYWA 4WCDA 2WVAA 2RK6A 5TC4A 2ZJ2A 4A0QA 4I9GA 3LUKA 5ADUS 4YMVA 2HK6A 2K7FA 3TIXB 3DD1A 4MMYB 1FVOA 4RTPA 4KGVA 3E9ZA 3S70A 1ZMXA 3VKGA 1W4BA 1SUFA 1PNVA 4N47A 3QKWA 4F6CA 1Z5OA 5A3QA 1M34B 1SA0A 2VA8A 3PRJA 4KE7A 2YHIB 3GRZA 4YK7A 3ROPA 5CBPA 5LLTA 1WZ2A 2PX8A 2PBLA 4TXJA 4B3FX 1NR7A 4YRSA 2HNBA 2FPMA 3KLMX 2CHFA 4TM8A 4BO2A 1IEWA 4BRSA 2QHXA 4ZRNA 3UWSA 1D9XA 4FZ5A 1RWVA 1GTRA 1T26A 1PWXA 4GP9A 4O4LF 4RJIA 1FUKA 3L8HA 1CU1A 3GN2A 5BSTA 3ZS8A 1J7JA 4MJ3A 1WXQA 3FF1A 3UICA 4EY6A 4PC6A 4GZLA 4R54A 4G1BA 4FB4A 5A5GA 5JZOA 2DKFA 2HLDD 4X90A 4CG3A 4O4HF 1SZDA 3EPRA 4R2KA 1NQUA 1Q0UA 4FGSA 3B7GA 2DUMA 1F17A 1MJGM 1Z5GA 5HCUA 4E12A 3ORYA 2PX2A 1X1RA 3OZDA 5HQJA 1D2GA 3DR3A 2FRXA 3QE2A 3B5EA 1SC4A 5CYOA 1R1DA 4RH0A 5T4EA 2C0PA 1YRQA 2XWQA 1XWIA 3GRVA 3UMRA 1NVTA 3WYFA 4DARA 2WAAA 3L7OA 5AESA 4NG4A 3BWYA 4AF7A 4EFMA 3VRHA 4O4JA 3L1KA 1Y42X 1GGKA 2BKAA 4RJLA 5LC1A 1E77A 4EARA 1G21B 4O2AB 1SKQA 2NGRA 4FJ0A 2DR2A 3C6BA 4R05A 2KS6A 2L18A 1E2FA 1DBRA 3EFOB 2R6FA 2PGLA 2CSUA 1YIDA 1C3VA 4RSMA 3LT4A 3ZCQA 4GBED 1ODIA 3EPPA 5E7JA 1QKKA 1W48A 2RB5A 1QGYA 3ZD7A 1ML4A 3AY3A 3IIJA 4LOKA 4PIVA 4ZEWA 4CDMA 5BR7A 4BLSA 3RYTC 3F73A 1U0LA 2UYGA 2GBGA 4LTDA 3TAUA 2AJ8A 2JI6A 2IZ5A 4MUAA 2HO5A 2QSUA 2JEOA 4OFXA 1PNQA 4JB0A 5CH8A 5DX1A 5DBIA 4G5FA 2XVYA 2FYTA 2GASA 4UM9D 5DBFA 5DOVA 3S2ZA 2VJBA 4EHIA 5KNLA 4ID3A 2VVTA 5KOYA 1NNLA 3LSTA 1ZJZA 4RBNA 4X8LA 2QMQA 2FG5A 1R0LA 2E49A 2X9NA 4Y2SA 2FWPA 4MUYA 2DBZA 3ZK9A 1WXHA 1KE2A 1IZZA 1AURA 3H8SA 1YE8A 5EZYF 4UBKA 1IMOA 1FPMA 2ORVA 2JCSA 3I32A 1WP4A 2XB6A 4IX9A 4UUBA 2IYOA 1Y6GA 4LDRA 3TNFA 2ZRDA 3TM5A 1DG1G 3VZCA 5ALKA 2HOQA 3FX2A 3AUAA 5HF8A 2BGWA 4GM1A 3IKTA 1AUPA 2IIBA 3LXMA 5G1NA 2VHZA 4W1QA 1Y4AE 2P62A 4BKRA 3IKMB 4U02A 2JFQA 1SUWA 3TLKA 4D8YA 5JZ9A 2PS9A 2Z04A 2O59A 3G7NA 2MWMA 2QYTA 1P4HA 2BHTA 3BMCB 4LHEA 3D6UA 3KUCA 1CZRA 1CJBA 2Z6VA 2O0LA 3G9ZA 3AERB 1CTQA 3TW6A 4CCYB 3EQ7A 2I0FA 3RYCB 3OIDA 1F3LA 1NVVQ 5CHEA 1DRWA 4LJ9A 2RIPA 3V46A 3G5MA 1LDBA 1DKLA 5JARA 5IYZB 2GTIA 2O5VA 1H94A 4EGQA 1K75A 4LMAA 3FPAA 3IR6A 3ELDA 2YQ5A 4TXNA 1VLLA 1VM6A 1ZLXA 3RSCA 1WXIA 1DFIA 3FWHA 3P2JA 4RHUA 2H17A 1AH2A 4JVLA 4R1SA 2N1MA 4UHHA 4YAWA 1ZD2P 5E1DA 5BN3A 1J07A 4Y6GB 1G42A 1JQEA 3CF2A 3KUKA 3ZR4B 2JZNA 1MO2A 4UM5A 3VV3A 3N05A 5B53A 3PPIA 2R79A 2YN4A 3IDOA 4Y2TA 5AD1A 2C84A 2JA2A 1EGHA 4ZZ1A 1UKBA 1XC7A 2FPIA 2WHPB 2ZCVA 2I6UA 3H3JA 1CF4A 3ASVA 3KETA 1G2IA 4OEHA 1J1IA 2FX2A 1XJQA 4KOEC 5AHRA 5MN5A 4F0JA 1W4CA 1A77A 3WHLA 4CM4A 1JZSA 4QO8A 1HM5A 4BWGA 3TL3A 1GQRA 1OZHA 2YZGA 4D4KA 3HBMA 2VAMA 2JFBA 5G0SA 2SKDA 3K2IA 4ZQIA 4P5EA 3OFJA 2VTDA 1U31A 1P7VA 3MCWA 4LTNA 4E2YA 2RHTA 2IWHA 3WQRA 4KDFA 2GAJA 3MTBA 2OV6A 4IXMA 5FPTA 1PG2A 4RW0A 2Q7OE 4L9SA 2QUHA 4M7RA 1OXBB 3OHSX 4M4SA 5KDDA 4AC9A 1E9AA 1ORVA 4CI0B 2OQRA 4YUAA 3UGJA 1EWRA 1Y7PA 2E21A 4FYWA 3L0DA 4YJGA 4M76B 4NBRA 5DN6A 4I6GA 3ZQJA 4D57A 4DCVA 5TJ9A 1OWPA 2NXWA 4EVQA 4B6RA 1WV1A 1I4OA 3BL8A 1U8TA 2IHUA 3L8DA 2WTUA 4OI2A 3M5WA 2AYXA 5DHQA 3M81A 4ZEOA 4DM4A 2XSZD 3ZE9A 1NVXQ 1CQXA 3E15A 4HZUA 4RZHA 1PX2A 4GP6A 2H5EA 3AJDA 3F2VA 3VSDA 2GTHA 2CNBA 4OKSA 1RQ7A 3DZFA 3P9ZA 4GKBA 4P7KA 5HDBB 3OD1A 1DIHA 3PNBA 2WWYA 1QHIA 4CUZA 3N2GB 4OJQA 3UK7A 2ZANA 1WZUA 4RKEA 5EINA 1T9BA 4O1IA 2Q1XA 4ZTZB 1I2MA 1K7YA 4JUDX 2CF5A 4QDXA 5KVCA 3BPSA 1R8XA 3FI9A 3H1FA 1EIZA 2QRNA 4JBYA 5G4KA 1U6IA 3OZWA 4C4PA 3UB4A 3KHSA 2GM9A 3W8DA 4EZEA 2C9MA 3LBFA 4GNRA 4I5FA 1MQSA 3OM9A 2ZROA 1GEGA 1CR2A 3HO8A 1KMCA 4F5DA 5JROA 1YR1A 2XMGA 1FW8A 3VU3A 4CEIA 1XT6A 2HRQA 1TQDA 2RGGA 4Q1VA 1PE0A 1ZY2A 2I4LA 1LJUA 3BWMA 1NMZA 2B78A 4NQRA 4Y7CA 2C9CA 2WDPA 4B47A 1QB7A 2OAGA 2X7JA 3O84A 3RK1A 1DIAA 3DNMA 3OEHD 3K53A 3CUTA 5I01A 1WG8A 1WB4A 2X3FA 5F5NA 1UWKA 1TIKA 2EXXA 2I4TA 2NW6A 4GPIB 5IUJC 3RI3A 2Z0MA 3MTEA 5CT8A 4DANA 3DDWA 3PL1A 5KTNA 4H3KB 2E6KA 3BRQA 1L5MA 3KAPA 4D82A 3NYQA 1FP4B 1V47A 1WEHA 2H2AA 3A6ZA 2QN8A 3U4MA 2I2BA 3DQPA 1SHUX 2PWYA 3ZNQA 1J9ZA 2PS1A 1SKUA 1KMQA 3OEEA 4TMVA 1HE5A 1URPA 3GFSA 4UE3S 4JYPA 1WP9A 5CX1A 5DISB 3QFSA 5EN4A 5TRTA 3OLVA 4DLTA 3F5MA 4ZO4A 3ZNNA 2GEVA 2OFFA 2O3RA 1DIGA 4KK4A 4EYEA 2IQIA 3NNNA 3G68A 4Q4HA 4ENTA 4RUKA 4C0SA 3IEPA 2WIFA 3GLTA 3QVMA 4KE8A 1AN0A 3EFOA 2PXXA 1OPXA 1QB8A 2ST1A 3IE0A 2OBYA 2QMEA 4JBXA 4JUFA 3KHKA 5GADl 1YBVA 3RAEC 2GCEA 2ANBA 1MAAA 1W1IA 4PZPA 5CVEA 5GJCA 5CXUA 2DWOA 1ACJA 1K86A 1RRCA 4EJSB 4Y2JA 1GP2A 2ZKIA 1PR4A 4QYWA 1Z5WA 3N75A 5FO0A 3HP7A 3GT4A 2DXIA 4ZMSA 4O4LA 1GY8A 2QMYA 2Z5LA 3F47A 3E8SA 3NGLA 1GA4A 1X7ZA 5E6SA 5SZIA 4DV6B 3S44A 3TKAA 4G09A 4EY4A 1E4VA 1FS5A 4NZYA 3HCWA 4MRPA 3ZLJA 3GELA 3D6AA 5FOUA 1UMBB 3ZHUA 4JJAA 5AKXA 4PWYA 1T10A 1QU2A 1R8JA 5EXPA 1EVQA 1FJHA 3CNEA 3TUIC 3QEAZ 1XEAA 2O8VA 3VNAA 3TVTA 5F33A 2VPWA 4BVGA 4EGFA 2IH5A 1PYDA 2QE6A 3OZUA 1U7OA 4MYDA 1TJYA 4HK4A 1CY1A 1XVAA 2AL7A 3W5SA 4H17A 3L0OA 5HCIA 5DM2A 1GIAA 4JEIA 3VO2A 2Z8XA 4QL3A 5CYFA 1U2GA 2GEBA 1L5VA 3VR3A 3BTUA 1YK0A 1O7JA 4NS4A 4LFCB 2PKEA 4HP8A 1GHTA 4KN9S 4NTZA 2H08A 4JB2A 4Q4JA 3TOSA 3CH7A 1NM5C 1RC1A 3K1YA 4GXNA 1KAEA 4GWKA 4QDUA 1V39A 4C4ZA 4D9CA 1LPSA 1XXHE 1RM4A 3EEOA 4WUTA 4ZEVA 4IDFA 2QE7D 3AUXA 4N7JA 1M2KA 2VF7A 5KJFA 4A2CA 3PDJA 2OGUA 5CVVA 3R7BA 4EB6A 2OWEA 1EXMA 3GW8A 1I01A 1SHTX 1WIWA 1E5DA 1Q7TA 1U7UA 3BH7A 1TMOA 1EWVA 1ZINA 2YMLA 3RTGA 4AJNA 3ZU3A 1IMJA 2OBXA 3M83A 2J9YB 4ZOLA 1CUVA 2FUKA 3TR0A 5LR6A 1PDOA 4AMYA 3F6EX 1IOVA 4HDNA 1BS2A 1XDUA 2BC9A 1QP0A 4M7PA 5K6RA 1I7SB 4BO6A 2AH5A 4TVKA 4Q7LA 4Q3KA 4XYLA 4H7IA 4RORA 2FQYA 3P9IA 4JL8A 5K3FA 4Z3OA 4PO9A 3PJRA 1BHSA 4JLVA 5IDWA 2J30A 1QV7A 2JCBA 1FDIA 5C5EA 2A9KA 1UC8A 4RGYA 2ZWIA 1T25A 1NN0A 4M37A 2ORIA 4EK9A 1E9DA 4WGFA 3CUYA 3LS2A 1YDWA 3NKVA 3IPAA 3CCCA 1TM7E 3KIPA 4WMLA 1LK0A 4FT4A 1Y3IA 1FX1A 3UOWA 1B42A 3OFSA 2AI3A 3WFIA 5I3ZA 1W5BA 1LA2A 1B8UA 2QY6A 4LBYA 4PG5A 3V4ZA 3D54D 1OLXB 3D3WA 1TX4B 3L4SO 3OESA 1R6DA 4CKZA 4KRXA 4AKIA 1ONPA 5HR5A 1YB2A 1ZCAA 3GAZA 3N7AA 4DLKA 1F2VA 2RARA 1MZPA 3QM1A 3P2MA 1BHQ1 4OJNA 3RASA 4DADA 5B57C 2XB2A 1P9WA 1J0CA 1K5DA 1DTWB 1Z2OX 2GD1O 2IYYA 2XB9A 5IASA 2H29A 4GOOD 3A1VA 2V98A 5HNKA 1UR5A 1WWKA 2C1ZA 1C9JA 1MC4A 1TT7A 2FEAA 2OD2A 2PTHA 2XF2A 3LGXA 4FWIB 2P5SA 3U3KA 1JFFB 2GEJA 1PQUA 3S8MA 1A88A 4WGGA 2QAIA 1MA0A 1UMCB 4AM8A 1U2DC 4MYUA 1AQ6A 1Q1ZA 3HVHA 1J00A 5ALJA 3ZDCA 4DCOA 1GRNA 5KYXA 3OOWA 4ALKA 4UM9B 3D8BA 4KRYA 1YBHA 2C07A 4HNHA 2OZKA 3A0RB 3ILVA 3B36A 3ZIDA 2VJAA 3JVEA 4EECA 4UM8B 3WDLA 1E9EA 3CU5A 3CW9A 3ZXUB 3KKQA 2BF7A 4B8WA 1RE1A 4D45A 4PR3A 5GVRA 3PYLA 4G8BA 5HJEA 3RADC 3M4ZA 1M7BA 1GPWB 4BLTA 5MN6A 1KPGA 3K0FB 4JBIA 4XLLA 1BYUA 3VTKA 3ONFA 5ARBA 3QRWA 4KJXA 3HXTA 1SC3A 1C9DB 1M2EA 3BWVA 4DLXA 5E4YA 4V39A 3R7SA 2K6GA 4J94A 1XZKA 1MQ8B 5DSTA 5B3LA 4BQSA 3HM9A 2KE5A 4HAXA 4HAYA 4JDUA 1X7GA 5BV2P 1O94D 1JSXA 2GF2A 3CZAA 3N6RA 1TF7A 1OXUA 2WVHA 5FPHA 3TSYA 3IL2A 4GOKA 1VIVA 1DIBA 2ZT5A 4N0EA 3T3OA 5FXMA 2FP4A 1NQAO 3U7FB 3EFBA 2YNMD 2FPLA 3TOZA 1WD5A 4LY6A 1HPLA 5DIZA 1HMYA 2FPPB 5BUSA 2R4QA 2X8BA 5BMOA 4IZIA 4MS3A 1ZGAA 3GO4A 5AXCA 2O3UA 3WGZA 1PGJA 4HQ0A 4EEXA 1KQGA 4TLAA 3QYJA 1VDMA 4AMZA 2G40A 1Y7IA 3GLRA 4OATA 2B4AA 1Z2DA 2ZUWA 2IZ1A 5TS3A 4BN0A 3A25A 3KSZO 2BTOA 3EWIA 4WNYA 4YCNA 1F5SA 2I4OA 3ZDQA 4CE6A 2XRFA 2W2QA 1EQUA 4L02A 3N8DA 2D0IA 1XIVA 4ZGWA 2E4WA 1RRFA 4ZI7B 3MHTA 2VTKA 2C3OA 1EM8A 4HWPA 1L5HA 4Q7JB 4DNFA 2ZB4A 3PDIA 1QYRA 3CQ9A 3TRDA 1RWOA 4LJ7A 4MI1A 3VR4D 2PZFA 3I34X 2X1HA 3KKLA 3FSGD 3FDJA 4G07A 4G2NA 2GZAA 2ZDQA 3UQZA 3M33A 4EW2A 2I66A 2PTGA 1PK7A 3UK0A 5DTIA 4B3IA 3P4YA 1MNAA 4NESA 2A84A 3P1JA 2JL1A 3L7KA 3ZK8A 4WBNB 5KUTA 2OWDA 4IDPA 4IP0A 3IOBA 1G2PA 1UDBA 4J0JA 1DXHA 3ROZA 1QIIA 3D4PA 1GAQA 5ALQA 4EPTA 4ETMA 2PZ8A 3T1QA 1TTTA 2AC2A 2FW1A 1OILA 4FYVA 4DR7B 4R0VA 1XA0A 2NT4A 1HF3A 4HH0A 5EIBD 3WWYA 4BJHB 4M1YA 5H3LA 1Z07A 1O2DA 2ECQA 2NWQA 2OZPA 2WJYA 5EIHA 1A8PA 4WKOA 3RNLA 1JFTA 1LJLA 2X0DA 1E3TA 3WO0A 5WRFA 3MPOA 5FWXA 2QZZA 1JRLA 2V7WA 3EODA 3L05A 1UT5A 4FYIA 3S5JA 1FP6A 1F9AA 4DA9A 4NZPA 3BFKA 2JCVA 1OROA 2ZJ7A 3E70C 3FUCA 2BFEA 2PRYA 3H2BA 1QYWA 4O1HA 3WOVA 4ESHA 1ADCA 1NJ2A 2FUG1 1D4ZA 2NUBA 4TKMA 4DWJA 3VAZA 3IT0A 4IMIB 4Y9DA 4ESEA 3OKPA 4P8RA 1LQUA 2GAOA 1MO4A 3LPLA 4WLOA 3IMEA 4D2IA 4LYJA 3MINA 4I1SA 2ZIAA 4UC0A 4A6DA 1M33A 1KRWA 4ABYA 3BJMA 3GFVA 4HFRA 5HGXA 4QYMA 5AVWA 1UBMS 2ZWPA 2X86A 1TYCA 3RPEA 4C0AC 1A4XA 4FFDA 3PEFA 4I8DA 4KRFA 2VWHA 2VPQA 2O5CA 1ZNWA 1RCTE 1ULUA 2H4FA 1RXWA 4EGAA 2EQAA 3LQ4A 2WU0A 3CZCA 4M54A 4DV4B 1XFDA 4KYTA 4C88A 2R5WA 2ACEA 4XDYA 1IY2A 2RK3A 4AJJA 3I6BA 5JZSA 3UCXA 2GF9A 2IGTA 1HG1A 1UC4B 2XXBA 3ICQB 2WNHA 1J70A 2R1TB 1AD2A 1I7LA 2NNWB 1UZLA 1LBSA 2FFQA 1UXKA 4QAJA 4R8VA 1HLDA 4B2YA 5K2OA 1FSZA 1M5UA 2O8FB 1GPH1 3C5VA 3IUEA 4DR2B 4RMNA 3SVLA 5KVQA 2AW5A 4Q9LA 1M72A 1QONA 1SO8A 5EJ4A 2I8CA 3RG2A 2WKQA 5ITWA 1C14A 1PTJC 2WUGA 3GEPA 4XGNA 5JWOA 4EW3A 3NBMA 1ZI9A 3PKZA 2V7XA 5T67A 1RJWA 2D5AA 4FQ7A 4ON9A 5ALEA 4WXPA 1X1CA 2FPUA 2V6FA 3UCFA 3A1NA 3ASZA 2J0EA 2H1IA 3OLQA 2RHMA 1ORWA 4B74A 3BZUA 1S0UA 1V6CA 3C4QA 5P21A 3SXUA 2V7QA 1O96A 4E3ZA 4DR4B 3U80A 3VKVA 1F8GA 5KYNA 1T5LA 2BMAA 4F04A 1N32B 1XZJA 2BI8A 2BZ1A 1MOQA 2DWUA 2QRKA 3P9YA 1EE2A 2AFIE 2O7VA 4YT4A 2AKEA 3FMIA 1EZZA 2JZOA 1EM6A 1NBMA 3EA4A 3B9BA 1JHQA 3VZDA 1Z15A 3GEGA 4IDOA 3TSCA 5JYCA 4WUVA 2XZTA 3FUTA 4GMHA 5HFAA 2XWPA 1E63A 1V3QE 4R1LA 4INZA 5CIQA 3PHIA 4D3XA 3VYUB 4BECA 2H9YA 2XY4A 2YMMA 1JVSA 2GPTA 3DE4X 5FTLA 2XUQA 4MJLA 5JS8A 1PQ4A 1WHSA 5FUBA 2CJXA 4LFBB 3DTTA 4M8NE 4X20A 2FWJA 1DNPA 3TJZA 3TQRA 2L17A 2EJBA 4EABA 2B34A 1L5QA 4ZOEA 2A1TR 1MJ5A 2VT7A 3IAXA 4X6XA 4WOPA 1P29A 1QVAA 2CXNA 2QU7A 1Y3BE 4YJ2A 3EARA 1JA0A 1VPEA 1UCFA 4AZ0B 1Z0AA 1T0IA 1PHRA 4UULA 4BYGA 1NM5A 2BMWA 2YR0A 1XZNA 1A7UA 2LP4Y 4C3OB 3TRJA 1CDEA 1P72A 4NMHA 1APBA 1ZH8A 1V26A 2QQEA 4J1TA 1K7XB 1SPXA 9LDTA 5DNVA 4BVBA 4QXRA 5FDFA 1G7SA 1XVUA 2F3SA 2K4MA 2YJ6A 4W8GA 4KN6A 4KLAA 4BFCA 1KNQA 1GQ2A 1TTQB 1YVUA 1CUFA 1Q2XA 4KMOA 2HA3A 3NRJA 5D7NA 4Q12A 1RMQA 2RI0A 5E3JA 3OU7A 1E2LA 2IUTA 4XDZA 2CYAA 1TPZA 3KCNA 4N5DA 1IJFA 4IDHA 3OWXA 3VXKA 2W83A 5DV9A 1E9RA 2P4EA 1J1ZA 3FFBA 1E8MA 3CZ5A 5IJAA 1HNZB 3AUUA 3UJ3X 2HTFA 2PS3A 1KEVA 4O4HA 3W79A 1B8VA 3GY0A 3SDSA 4EJSA 1ZHHA 3TTWA 4UPEA 4IKPA 4QGFA 3X2SA 4ND6A 4IXWA 4FNGA 2WV7A 5D84A 3RYHB 2AOUB 3W06A 2EIXA 5ELLA 3VR4H 3NGXA 5GINE 2GBCA 4RY8A 2HPAA 3FDXA 2P2NA 2MDTA 5DBHX 3HH8A 5E6UA 4CL8A 3NQ41 2JHCA 3S55A 3WK5A 2G82A 3IV7A 2CF6A 3PE3A 2KBEA 4GLBA 2J07A 4L76A 3QVWA 1KMIY 3HO1A 1VIDA 1PSDA 1SXJC 3TR5A 1C4OA 2MU1A 3LC1O 1T36B 1XMVA 4FE3A 4LY3A 4MDYA 4NFLA 5AK5A 1U0RA 5HUHA 3RYFA 1V16A 4KYVA 1NNI1 4JIGA 3K5PA 3FYHA 2XNHA 2Y71A 1IHOA 2SBTA 3L6BA 4MMXB 5K8IA 5CP8A 3ETHA 1I0LA 1HXHA 1G6HA 1P3JA 3L0PA 1K7SN 4IFEA 1JP7A 4V0NA 3RRXA 4TZ0A 1ZK0A 2JLYA 1FUIA 3C7DB 4BNIA 2VRNA 2XUAA 4MGIR 4G36A 1EFUA 1PWYE 1V7ZA 1VHQA 4CLRB 3LYUA 1V41E 3BL5A 1Z0UA 3HWX1 3I53A 1ZWLA 4LE0A 5FAXA 3UV6A 1NHGA 1ZI6A 3LXUX 1WUHS 4HWKA 3QMPA 3R7FA 3SLRA 5J9FA 3R74A 6AT1A 5IWCA 1XPOA 4UREA 2CV2A 2XJ4A 3ZQ4A 3S4YA 5JXGA 3QVXA 4ISBA 5AW7A 1K8XB 4LC9A 3DP9A 3EUWA 3HQ4O 5HJ7A 3VR2D 1AN9A 4TMZA 4W6QA 4BNUA 3A2KA 4ARUA 1T2CA 4E13A 3G0BA 3GRUA 4PYOA 2NU8B 1EFCA 3D8UA 2HSGA 1LC0A 4R0NA 1EMDA 1KI7A 2Z3WA 1U0GA 4MYHA 4UCQA 2PWAA 2ZR7A 4GKJB 1OH5A 4KBFA 2AG8A 2OQ2A 4BLOA 3JAKB 1DJLA 1KOFA 1E79A 2VZ9A 4JJKA 3ZCPA 4BKPA 2ZRBA 2UUAB 1DJQA 1NOKA 4BFZA 4YAGA 3EGWA 1V35A 1CY6A 1S7CA 3BAZA 1FRFS 1ULTA 1WZCA 4AICA 1POXA 1XTVA 3N2GA 1EGVB 3WMRA 3PVZA 3IT3A 2WFMA 2HWYA 3ZX4A 1MVNA 2JFWA 4ZTUB 2FLKA 4PLCA 3ZU4A 1Z8DA 2I1LA 4KQCA 4EG5A 1JF8A 1TKCA 1V4BA 1KSJA 1R7RA 2P2LA 2CLLB 1O95D 2ISQA 3CEHA 3DLAA 3MTGA 1B73A 2PMCA 4P80A 3HXLA 4RANA 3VSEA 1V7CA 3GCDA 1P77A 4OHOA 4GP7A 5DK6A 3KOMA 4DQLA 4EMBA 1GZ3A 3QVGA 4QUEA 2PGIA 4GOLD 4TL9A 3A7DA 3QTLA 1O97C 3Q98A 3I5AA 3L04A 4OK6A 5DHSA 1DRKA 4BGEA 4P83A 5LB2A 2I29A 3UJCA 3A10A 3LT5A 4RMHA 4XLZA 4GU5A 5EZSA 5GTDA 4A9AA 3CWCA 3ESYA 3IBGA 5JR3A 1ODJA 3DSRA 2WAYA 4N39A 2WF8A 1U8AA 2H2DA 1H2FA 4YBRA 5HXAA 4PYIA 5L95A 3QVSA 2BFCA 2VATA 3GQBB 4FEYA 3QX9A 4JWKA 3TPCA 4KMSA 1EFHA 4BCBA 1AZLA 4XFKA 5EJ2A 4I1RA 4AY6A 1JTVA 4CIDA 5BXYA 1K7CA 4A8PA 4P4UA 4GGMX 2QIPA 1VA5A 2AX4A 3RR2A 3WAKA 4BFLA 1JBKA 4DA7A 3PHGA 4DC9A 4ETNA 5COBA 1G3IA 2G09A 3ZGLA 5MHTA 2Q6KA 3RHZA 2HSWA 4Q3EA 1JECA 1T5IA 1PQYA 1Q83A 3EGCA 3ENKA 4M9XA 4NFYA 3F6RA 4GI5A 3D3NA 4BNKA 4ARBA 5A62A 5TMPA 3SWWA 3WFZA 2LKDA 3VO1A 1HE2A 3HXKA 3CPJB 3SEFA 1U0EA 4HMPA 1CY8A 1CLUA 4Y2RA 4XGKA 5CK4A 1LX7A 2C7BA 4Y6OA 4KFRA 3EQ2A 1DEXA 2A0FA 4JOBA 3ZQKA 5BN3B 2P2CA 5J4VA 1K5GA 1MT0A 4DMFA 3HGMA 2QI9C 3DE1X 3N58A 5LZ8A 1QIHA 3EW9A 5JY6A 1Q7GA 2C42A 4MVJF 1TO1E 3FDZA 4QDJA 1QMGA 4CUJA 3ABSB 3NW9A 4CKYA 4LOAA 4J3FA 2UYOA 4Z86A 5T6BA 4EJMA 1ENZA 1OI4A 3BK1A 1SH7A 3OCXA 3M4NA 4M0KA 1ZJJA 3UIEA 4FYHA 4P3PA 3G0DA 2OM2A 3KZNA 4X84A 4CMBA 4X1KB 2AN4A 2DKOA 2EWMA 2P9YA 1NRJB 3H4IA 5CXSA 4B3BA 2QUKA 1OH6A 1AXRA 1QTIA 4G89A 4YRJA 3QFHA 1SD5A 4TLLB 2Q1WA 1L6IA 3OZAA 5ALWA 3TQOA 2WUEA 4FMCF 5IJWA 1GD1O 2Y0CA 4LJSA 4KR2A 2ZP1A 5B7NA 5DZSA 1SR8A 4BMXA 3D2AA 2GCOB 3DZDA 1ZR2A 1THGA 5JS1A 4CF7A 3NTLA 1IWBB 3LP5A 3CTPA 2V8OA 1TAUA 4M53A 1K0UA 1TUGA 3HU3A 1NNEA 4F6RB 4OB6A 1Z7EA 2UVQA 3PFWO 4MUMA 2ZUBA 4II3A 5SY4A 4V2IA 1TF5A 5AYVA 1LKZA 4D74A 5I7EA 2C9YA 1Z08A 4P3XA 4ZAVA 5KVAA 2ZJ6A 521PA 1L5LA 3L6RA 1VKNA 1VKJA 1B2LA 3OMXA 5LIRA 3H5TA 2OESA 4E5UA 1OASA 2J46A 1C7JA 2QM3A 4KLNA 2O8NA 1NVVR 1P0FA 1VLQA 2ZYAA 1NDQA 3W0LB 3MGKA 1MXHA 2A35A 5ICSA 1I5RA 1ESNA 2H5IA 4P9NA 2DH6A 3H4TA 2IOHA 2FZ5A 1FTSA 1YE5A 3K32A 3PS9A 4PQEA 1OFGA 1RWNA 3DBHB 1GKLA 1T13A 1L8LA 2QVBA 4UAJA 1HY3A 4YBZA 3RABA 4YALA 2D8AA 5KDLA 3O7MA 3P27A 1O8BA 1NPYA 1KY3A 2R6AA 2G0NA 4RTQA 4LF9B 3I1IA 1Y8ZA 2DVMA 1EZ1A 5SYMA 5ESWA 2R7KA 2GETA 3N2NA 4C0LA 3KQTA 1N6OA 4ENVA 3O4FA 2VF8A 1XN4A 2CYBA 2NV0A 1Y63A 2OCDA 3I64A 3IUJA 4JYCA 3AWDA 4NCBA 2O8DB 5ERYA 4EHLA 2I67A 3AEKB 2IV2X 2F62A 5EL0A 2B98A 4B46A 3GWGA 2PANA 2VP5A 1U1CA 1NKTA 2HSEA 3F78A 4GKVA 3W2TA 4M6WA 3A26A 3I39X 2QTCA 4G0ZA 2W6CX 2YFHA 1MX1A 1P2VA 3E9YA 3LY5A 4PLYA 4DDKA 4RTLA 4QGGA 3SS8A 4HFNA 4CQJA 3KOUA 4QU9A 2AN9A 1JIIA 3OJLA 5JSHA 5K01A 1B6GA 2QG6A 5ALMA 3OIGA 1H93A 3SPXA 3L7NA 4FWBA 1FIUA 2ROQA 4V24A 3EXEB 4DXDA 1Y48E 1I2DA 4BFWA 1ZG3A 2XOEA 1BEEA 4E7PA 3PXDA 3TJMA 3GCXA 2XCUA 5CBKA 3W8FA 4IVRA 4EHHA 4R6WA 1QVRA 3T34A 5F3DA 5H4HA 3KWFA 4H08A 1FUYB 1YS4A 4QOSA 4V0LA 5GZ3A 2C1EA 3UAVA 4YFYA 1IBKB 1EPUA 1Y8RB 3IERA 1J8VA 2EP7A 4PN7A 1ONBA 1JFRA 4GRDA 1T35A 4QVIA 2R0QC 1ZN9A 2MYNA 4Q4LA 1QGUA 3OURA 3H1GA 1N3YA 3D6VA 1QBGA 2CEAA 5E9AA 4PC2A 3QFCA 2OYCA 1JR4A 3IAUA 4PHTA 4WADA 2XZLA 2UUBB 1MOPA 4TWAA 3PZRA 5L3SA 3IOEA 2BP7A 1NF9A 4YP9A 5A1JA 3HWWA 4IWNA 4JJ8A 2XRZA 2Z6QA 1ACLA 2HXGA 4UDXX 4OI1A 3VH1A 1NAIA 4M0CA 5DT9A 3JAWA 5I9SA 4MZXA 1H65A 1PL6A 4WZAA 2X0EA 4AIRA 1IBSA 1JU4A 1Y5NA 3K0BA 1F4LA 1OFTA 4TLCA 1XLVA 5ALHA 4ZKEA 2D3TA 2ZJAA 1P8JA 4HQ6A 2HBYA 3R3UA 4L3OA 2A88A 3SSNA 4R2LA 1L7QA 3LWDA 1GTL1 2X0JA 4EG4A 2XCSB 2C7OA 2FR0A 4UCXA 4R2HA 2X4DA 2IU3A 2RMKA 2A4MA 3OJXA 4XX0A 3JD3A 3H0EA 1ZRSA 1ENPA 2DPYA 4DT1B 1IQ0A 5KYVA 3JVIA 3UZUA 2FEOA 2GVDC 4OGWA 4BNNA 2DECA 1LNQA 3QFTA 4ND8A 4TQ9A 2Z9CA 3L77A 2JAHA 2GILA 1MFZA 2WSBA 3AETB 2WRZA 2RHGB 3QKSA 2D00A 2C58A 2R7AA 4LN1A 4X1IA 4TRNA 3BTVA 2AMYA 3EBPA 1ZONA 2QRQA 5CURA 4AZTA 3VJMA 4B6QA 4BWFB 4UATA 1BJRE 4ERXA 2BGTA 4O2RA 3AUYA 3MJ4A 1HE3A 2JA1A 2Q8QA 2RGXA 2X0NA 2BL4A 3IP8A 3PC3A 2MHCA 4DG8A 4L5BA 5JNRA 2H2WA 4ZZ2A 1C7QA 2NYRA 3OHPA 5EYPB 2VAVA 5E0KB 1W85A 3OX3A 2ZM6B 2PM8A 3SZUA 3GGCA 5CB8A 2IS4A 5ICFA 3SZMA 5DT2A 1H6AA 1P80A 4TMXA 1M5TA 3OWOA 2P40A 4P3NA 4DE5A 4TKZA 4RYLA 1ZPDA 2IF2A 4EF5A 5KHLB 3ML1A 1EJBA 1NWCA 5EQJB 2HHCA 5JATA 5JVDF 1ETUA 3O4VA 4JX8A 3GRRA 3TFOA 3T7CA 2C4HA 4HRYA 4MPPA 1QWOA 1MV8A 2V5VA 3NANA 2XNSA 4YYEA 5G02A 1P2UA 4G67A 1AUQA 3KLOA 5JSKA 1KBQA 3SN6A 4GAEA 1QHXA 1NW9B 3C3KA 3FRIA 2COEA 4C5CA 4ZV7A 3LX6A 1F0KA 2OXCA 1KARA 1FXSA 1MC8A 2ZBUA 2YVAA 4ZAGA 3NHZA 2VPYA 2CJFA 3L92A 3RRMA 2Z3VA 2RG7A 3NOQA 1ZL2A 4AZSA 1PR6A 4XDGA 2VNJA 1WY7A 3ILYA 2PD4A 1A9ZA 1OY1A 2JCGA 5BRJA 3GQVA 1YIOA 4D56A 1PGQA 3R9XA 4ZVLA 2CJWA 2ONJA 4FHEA 3A06A 1W9MA 5M7EA 2ZTSA 3BKWA 1ID8A 4O4JF 4WCFC 1XV5A 2OO5C 1C9NA 4GWGA 3DC7A 4RK6A 2H2FA 3M4JA 3DMRA 1P73A 2LBPA 2R7MA 1RI5A 1XTKA 4MV4A 1VXOA 2OLEA 1OX5A 5EPEA 1J4AA 3VJKA 5C32A 5C8XA 1XQ6A 4D3ZA 2VOJA 4EMUA 2QN9A 1ZNYA 3SYNA 1S4QA 1M66A 2V6GA 1H9AA 4E0BA 2Z57A 1FP1D 4K6GA 3PTZA 1UWVA 2W6NA 3NT2A 2FAXA 1RHKA 4QBHA 4ZQCB 5ES3A 5L3ZA 1A3CA 3UT5B