1EUIC

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
b'QLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor. The structure elucidation of a prokaryotic UDG.
pubmed doi rcsb
molecule keywords URACIL-DNA GLYCOSYLASE
molecule tags Complex (hydrolase/inhibitor)
total genus 9
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1euiC00
2J8XB 2UUGC 1LQMB 2UGIA 1UUGB 1UGHI 2ZHXB 1UGIA 1LQGC 1EUIC 1UDII 4LYLB
chains in the Genus database with same CATH superfamily
2RCDA 3GZBA 3MG3A 1OF5B 2D1WA 2KCDA 1CQSA 1B20A 4OK0A 2CFLA 1OGXA 1WMOA 1QMAA 1HKXA 2CFDA 3OWSA 4LEHA 1I0VA 3EHCA 3KFQC 2UUGC 3OX9A 4N6TA 1LXEA 1JBTA 2CWTA 1EQKA 1FA3A 1AV4A 1SIHA 3EN8A 4HM1B 4L8OA 3S27A 2CX1A 4NHFA 2BIRA 1IVUA 4TX4A 3WDGB 1UUVB 1V57A 2OOVC 4HM5B 1VQO3 2RFRA 1UCKA 1I2GA 2KF4A 4QWTA 5AEWB 2Z76A 1C54A 4HVNA 3S29A 5AIGA 1R4CA 2A15A 2R4IA 3O8YA 1RN1A 1LRAA 2C10A 3T8UA 1DVDA 1WQLB 1NNVA 4XDWA 3DGYA 4R4KA 1L5GB 1B2ZA 1I8VA 3CCL3 4FMDA 2XR8B 2E2UA 2IYJA 1DE3A 3I563 4OVMA 5CLKA 1Q7HA 4HM4B 3EB8A 1UCJA 1Q42A 1K734 3ZG0A 2GBXB 2XGNA 3PCSA 7GSPA 1ROVA 1AQZA 3D79A 1B2MA 1UI7A 1RCLA 1RNBA 4AEQA 2SARA 1I2FA 2AAEA 2KRTA 3K9MC 1JN5B 4FCMA 1OHSA 1GS3A 2QA43 1OH0A 1KC84 3FGYA 3LTAA 1FZUA 2BU4A 3BNBA 4N3VA 3D4AA 3X40A 6GSPA 1A2PA 4JF8A 4X2HA 2H0HA 5D82A 3NQZA 1DYUA 1W01A 3F7XA 3OWUA 3CPOA 2YFJB 1IK3A 1RRHA 2W6JH 4RNYA 3F8XA 4GB5A 2B24B 3H51A 3IMAB 4NPBA 1Y4KA 1WMPA 2YFLB 4LGQA 5ELJA 1LVNA 1C7HA 2CX0A 5RNTA 1JKGB 1NDOB 1X1WA 5JPPA 1JKGA 1LOVA 2CKFB 4H61A 3LTBA 4HZ9B 3CCU3 5AYRB 4G1MB 3CU3A 4J9AA 4I5QA 4Q53A 5CXOA 3N54B 2OOVA 1RN7A 1W7CA 2HMMB 2IMJA 1FW7A 1B21A 3SLUA 2BT3A 3B4OA 2GXFA 2F5WA 4KFFA 4MMXB 5G1LA 3K5TA 5ELUA 4KZ1A 1MOLA 1BRJA 1RRLA 3KSPA 5BU4A 4WFOA 4L7KA 1I2EA 3EBTA 3NM2A 4IT7A 3B7CA 1RGEA 1YIT3 1BRIA 1YNVX 3BIRA 1DMQA 2UX0A 1N8R4 3PGBA 4BTXA 3QK9A 3NBRA 1O7PB 1RCKA 4XBXA 1I3FA 3A5EA 1RGAA 2SBLA 2Z6BA 3N8BA 2JQ5A 3KCHA 3H3HA 2WO0A 1PY3A 1GD4A 1BNEA 4N6NB 2HMNB 4J5GA 1GY6A 3LT9A 4HOHA 1QAFA 8CHOA 4GL6A 4XM4A 3VSYA 2Y74A 3AHSA 4HKVB 4XDVA 2BO9B 4HYZA 1S723 5M19A 1V58A 3FSDA 4KFDA 3RDEA 4BL3A 3AHWA 4FMCA 4BTWA 3PYJA 4KFEA 4N6LA 1BNRA 1NU3A 3DMCA 4K1VA 1A2VA 1OACA 4NREA 1W5ZA 2IY2A 1FUSA 2O9UX 4K90B 5IERA 3CC73 1VQ93 1YI23 4AKZA 2XH9A 3LT8A 3TDGA 4CJNA 2OTJ3 3QRDA 2E2TA 4J8TA 3L0RA 1ULJB 2BMRB 4ILFA 1FYSA 5IG0A 4HAAA 1RGGA 3E99A 4WWUC 1KQS2 1GOUA 6STDA 1X1YA 2KF5A 1UW1A 4BL2A 1RGCA 3UL5A 1NJI4 1JZOA 4WYKB 5CK6A 5GSPA 4WYKA 4WP5A 5HGRA 3S67A 1VQ83 2AADA 1IQXA 4AKYA 3BU4A 2FNQA 2XRXB 1GMRA 3FKAA 1G0TA 4HJLB 1EKMA 1TRPA 4K1UA 4K61A 5AIFA 2UGIA 3G8ZA 2QGUA 2GU3A 4LZIA 2GU1A 2GSPA 3CC23 1OF5A 1GYBA 3EC9A 3VF1A 1PU4A 3CCE3 1GOYA 1K28A 1BSBA 3M8CA 1BNIA 1BRKA 3BNDA 1TFOA 3MYTA 3SVAA 2W56B 2C4BA 1HZ1A 3CCJ3 2W56A 3F40A 3GZRA 2FGTA 4FCJA 4EW5A 1AVLA 3F14A 4HM3B 3S5CA 3HX8A 4HZBB 1NB3I 2HMJB 3AGOA 5IEOA 1ROAA 4DKIA 3GAXA 1RDSA 2BNGA 1TRQA 3OXAA 2RGQA 1VQK3 2W04A 2XGLA 2YX9A 3MG2A 3MSOA 1BSDA 3LXUX 1MWUA 1M9GA 2KF3A 2W0QA 3BNCA 3T0UA 1IU7A 3CD63 2L1SA 3MHEA 4N6V0 5CF2A 1HYFA 1OUNA 5AI1A 3K0ZA 3KIIA 1G02A 1RMSA 1YIJ3 4R9LA 1VQ73 1JB2A 5FGOA 1B2UA 3LTDA 4BIRA 1UUGB 4XB5A 4OUQA 2C11A 3JUQA 1MWRA 5FW5A 7RNTA 1JN5A 1SIIA 1TUHA 1LQGC 3D3LA 1TIJA 4BU4A 3HI7A 1JNQA 1N9JA 2CFGA 3KZTA 1Q814 2W03A 3LH4A 4O2HA 4MJDA 1LQMB 3NBBA 3UB1A 1Q7Y4 3WA3A 2BMOB 3GRDA 3FCSB 4MMZB 3IPTA 3K63A 1RTUA 1RGFA 3LTCA 3NUVA 1B2XA 1ZX2A 3DXOA 3CXC2 3G4S3 1VQP3 1LOXA 1B27A 1S5AA 1UUWB 1W6YA 2K3DA 2M7OA 1CH0A 1I70A 1RHLA 3FG3A 2GBWB 1PYLA 1SARA 1WMNA 1N8QA 3FF0A 4L8PA 4O8SA 3SYUA 4ZM8A 1FUWA 1VQ53 1RSNA 2CC3A 2HMLB 1VZZA 2GEYA 5IF6A 3EQQB 1QALA 1TFKA 3FG1A 1K8A4 1NB5I 4BTYA 5KP3A 1UGIA 1BNJA 3FZWA 1YVSA 3S28A 2Z77A 1O7MB 5IG5A 1SQWA 2P38A 4X2OA 3NXJA 1JB5A 2XFTA 1TU5A 2PZVA 1WTHA 3PS8A 5AEUB 3V92A 2GEXA 4STDA 1DETA 1V74A 3WODG 1ZO2A 3NM7A 3CPW2 1D6YA 2F86B 1BRSA 1MGWA 1RLSA 1U8CB 3X3ZA 1B3SA 1JJ22 1KSIA 1I0XA 1YGEA 2K0MA 1NO3A 5D83A 5STDA 4O3VA 1IQ8A 1OCVA 3CCS3 1SPUA 2WGQA 2F99A 3HK4A 3WMDA 4HM0B 3MKIA 1O7NB 1E97A 3BLZA 3LZAA 1Z1SA 3LOYA 4H3UA 5KP4A 1BRHA 2CK3H 2RNTA 3KE7A 1VQN3 3GWRA 2MF7A 4KVHA 4GHOA 1SJWA 1IVWA 3MWZA 2P0MA 1K9M4 1FGQA 2CWVA 3PCRA 1IV7A 3AMOB 2KXGA 2HMKB 1BUJA 3AMOA 1AVKA 3KKGA 2P09A 1KD14 5EEOA 1GY7A 2ZDJA 4EYCA 1JBSA 1IV9A 3RGRA 1O7GB 3SOYA 1BUQA 3NHXA 4ORLA 5A0OB 2Q07A 1HU9A 2XEPA 2ZHXB 5TGNA 4FMAA 3EBYA 3V98A 1YVBI 1FGMA 1MNLA 1O7WB 3EJVA 1Q864 4EXRA 5AIHA 1YJW3 1I3IA 5D81A 1IT8A 4WHAA 5G1KA 4I4KA 4FCZA 3K7CA 1W2B2 2RBIA 1UDII 3DGLA 1RGHA 5IG3A 3U97A 2IUJA 4FR9A 2ZA4A 3X3XA 1MWSA 3F7SA 2H0GA 2STDA 3STDA 1EA2A 4IIAA 2J8XB 1BNGA 1IT7A 1ZGXA 1Q9EA 3F9SA 2BHMA 2B1XB 1IQYA 1F8NA 3DGOA 3HIIA 3LMLA 3ALAA 2OTL3 1FGTA 1BNFA 1DMNA 1Q40B 3FF2A 1JRQA 1R4YA 3D5IA 3U1WA 2W2CA 1VQL3 2CHCA 2H0IA 1GY5A 1RJOA 3NV0B 4N6MA 3WOFB 3NV0A 3ZG5A 2P05A 2CH9A 3X41A 2CFWA 3J7Yd 1A67A 1BAOA 3Q3FA 1J2BA 1OPYA 1LOYA 1N5PA 3PXMA 4HM6B 3URPA 2IUKA 3ZFZA 2F4YA 3DH2A 2ML5A 2HMOB 3ECFA 4RBNA 2OWPA 5DREA 3G713 1JV2B 4JRFA 2YFIB 2F5MA 1E3RA 1UGHI 1QJGA 3JUOA 5BIRA 1M1K4 2JDIH 1JBRA 2FXTA 4J5KA 4EBGA 1VQ63 3RNTA 3I0YA 2KF6A 5I97A 4R9KA 1ISKA 1RGLA 4N6OB 1M904 1QAKA 1D6UA 1JB4A 3NQYA 3OWYA 1VQQA 1N9EA 1MGRA 2QIYA 3CCV3 2IA7A 1STDA 4LYLB 3WOEB 5KP1A 1VQM3 1OHPA 3I553 1BANA 1W6CA 3HOHA 4HM7B 1GSPA 1JZDA 1M1XB 2V1LA 5HOHA 1D6ZA 1IVXA 1IDPA 5JPUA 1N5HA 4O02B 3N9HA 3DGMA 3DGNA 2O3OA 2XSHB 1EEJA 3OV4A 4HBRA 5LC6A 3B4PA 3X3YA 3CME3 1A2KA 3G0KA 4EV5A 3JUNA 1RGKA 4R80A 2HOHA 3F8HA 2CW9A 3NX0A 9RNTA 2P0XA 4CCVA 1EUIC 3EE1A 1QVG2 1EG9B 1US1A 4EV2A 1O7HB 4LMIA 2LQVA 1K41A 3GZYB 1W00A 3EF8A 2PNCA 4PEJA 2Z7AA 3JUMA 1OGZA 4R1KA 4HM8B 5CF1A 1W6GA 1G96A 1FGRA 2CG1A 1TTOA 1Q824 2MC8A 5IEPA 3CCQ3 1DVCA 2CWUA 4LSOA 1IYYA 3B8LA 2CIUA 2XSOB 2XFSA 3CCR3 2I9WA 3CNMA 1E3VA 3V99A 3CNXA 2CFKA 1YJN3 1OHOA 4HM2B 1BOXA 2F98A 1LNHA 1BIRA 2Y73A 1BNSA 3ROBA 1BRNL 1IVVA 3MG1A 3CCM3 3IJEB 4U13A 2L4VA 4XBYA 3UNLA 2LYXA 5BXQA 1YHQ3 2ML6A 3LYGA 2W9QA 1T2IA 3SOAA 3BNEA 3JVCA 1X1XA 1VQ43 1GD3A 3AGNA 3JUPA 5AIIA 3D5GA 1BSEA 5EQLA 5EVHA 1STFI 3Q2PA 3WA2X 1YGWA 1BU4A 3EN1B 3EX9A 1BSAA 2OQEC 1UCIA 3FG4A 3VGNA 7STDA 1DMMA 6RNTA 1ASKA 4KT3B 1BRGA 1CYUA 3G6E3 3X42A 5G2GA 1ZS7A 1W2ZA 3HZPA 2D42A 3DZLA 3RGAA 1UCLA 2RSXA 5DRVA 1RKYA 1TP6A 1TJDA 1ULIB 8RNTA 5IW9A 1GMPA 3UJMA 3DY5A 4XBTA 5IENA 1RNTA 4EC6A 1AR0A 5M1AA 1YJ93 2E2VA 5M18A 2INXA 1BGSA 1X1UA 2OCTA 4RNTA 2BMQB 5AYSC 4CDLA 1A90A 2K54A 1AY7A 1B2SA 1KWIA 3FH1A 3HIGA 2KAAA 3KSED 3WHOA 1W4NA 1W02A 1CEWI 3DM8A 4RZMA 3GZXB 4FMBA 2QEX3 2R41A 1T5YA 3NBJA 2ZL8A 3D9RA 5LC7A 2XF3A 3CMA3 3OW22 3T8NA 1UI8A 4CPKA 1MWTA 3SX1A 3Q1CA 3PZWA 3MPHA 3A76A 3SEDA 5BVBA 4N6UA 1Q40A 4GSPA 2WOHA 5JBSA 3KN4A 2WGOA 1GOVA 3FLJA 4IPBA 3DUKA 4MMYB 3CC43 1LOWA 3GSPA 1QVF2 3WR2A 3ER7A 1BVIA 2CG0A 1BSCA 1FGOA 2WOFA 1CYVA 3SXXA 1RN4A 1WNHA 2W9PA 4MEIA 1GMQA 2OQEA 3UL6A 1PFPA 1LNIA 1T2HA 1U5OA 4RNZA 5IG4A 1T3BA 1FUTA 2F56A 1NWWA 3Q90A 3G16A 3BB9A
chains in the Genus database with same CATH topology
2J8XB 2UUGC 1LQMB 2UGIA 1UUGB 1UGHI 2ZHXB 1UGIA 1LQGC 1EUIC 1UDII 4LYLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8X B;  2UUG C;  1LQM B;  2UGI A;  1UUG B;  1UGH I;  2ZHX B;  1UGI A;  1LQG C;  1EUI C;  1UDI I;  4LYL B; 
#chains in the Genus database with same CATH topology
 2RCD A;  3GZB A;  3MG3 A;  1OF5 B;  2D1W A;  2KCD A;  1CQS A;  1B20 A;  4OK0 A;  2CFL A;  1OGX A;  1WMO A;  1QMA A;  1HKX A;  2CFD A;  3OWS A;  4LEH A;  1I0V A;  3EHC A;  3KFQ C;  2UUG C;  3OX9 A;  4N6T A;  1LXE A;  1JBT A;  2CWT A;  1EQK A;  1FA3 A;  1AV4 A;  1SIH A;  3EN8 A;  4HM1 B;  4L8O A;  3S27 A;  2CX1 A;  4NHF A;  2BIR A;  1IVU A;  4TX4 A;  3WDG B;  1UUV B;  1V57 A;  2OOV C;  4HM5 B;  1VQO 3;  2RFR A;  1UCK A;  1I2G A;  2KF4 A;  4QWT A;  5AEW B;  2Z76 A;  1C54 A;  4HVN A;  3S29 A;  5AIG A;  1R4C A;  2A15 A;  2R4I A;  3O8Y A;  1RN1 A;  1LRA A;  2C10 A;  3T8U A;  1DVD A;  1WQL B;  1NNV A;  4XDW A;  3DGY A;  4R4K A;  1L5G B;  1B2Z A;  1I8V A;  3CCL 3;  4FMD A;  2XR8 B;  2E2U A;  2IYJ A;  1DE3 A;  3I56 3;  4OVM A;  5CLK A;  1Q7H A;  4HM4 B;  3EB8 A;  1UCJ A;  1Q42 A;  1K73 4;  3ZG0 A;  2GBX B;  2XGN A;  3PCS A;  7GSP A;  1ROV A;  1AQZ A;  3D79 A;  1B2M A;  1UI7 A;  1RCL A;  1RNB A;  4AEQ A;  2SAR A;  1I2F A;  2AAE A;  2KRT A;  3K9M C;  1JN5 B;  4FCM A;  1OHS A;  1GS3 A;  2QA4 3;  1OH0 A;  1KC8 4;  3FGY A;  3LTA A;  1FZU A;  2BU4 A;  3BNB A;  4N3V A;  3D4A A;  3X40 A;  6GSP A;  1A2P A;  4JF8 A;  4X2H A;  2H0H A;  5D82 A;  3NQZ A;  1DYU A;  1W01 A;  3F7X A;  3OWU A;  3CPO A;  2YFJ B;  1IK3 A;  1RRH A;  2W6J H;  4RNY A;  3F8X A;  4GB5 A;  2B24 B;  3H51 A;  3IMA B;  4NPB A;  1Y4K A;  1WMP A;  2YFL B;  4LGQ A;  5ELJ A;  1LVN A;  1C7H A;  2CX0 A;  5RNT A;  1JKG B;  1NDO B;  1X1W A;  5JPP A;  1JKG A;  1LOV A;  2CKF B;  4H61 A;  3LTB A;  4HZ9 B;  3CCU 3;  5AYR B;  4G1M B;  3CU3 A;  4J9A A;  4I5Q A;  4Q53 A;  5CXO A;  3N54 B;  2OOV A;  1RN7 A;  1W7C A;  2HMM B;  2IMJ A;  1FW7 A;  1B21 A;  3SLU A;  2BT3 A;  3B4O A;  2GXF A;  2F5W A;  4KFF A;  4MMX B;  5G1L A;  3K5T A;  5ELU A;  4KZ1 A;  1MOL A;  1BRJ A;  1RRL A;  3KSP A;  5BU4 A;  4WFO A;  4L7K A;  1I2E A;  3EBT A;  3NM2 A;  4IT7 A;  3B7C A;  1RGE A;  1YIT 3;  1BRI A;  1YNV X;  3BIR A;  1DMQ A;  2UX0 A;  1N8R 4;  3PGB A;  4BTX A;  3QK9 A;  3NBR A;  1O7P B;  1RCK A;  4XBX A;  1I3F A;  3A5E A;  1RGA A;  2SBL A;  2Z6B A;  3N8B A;  2JQ5 A;  3KCH A;  3H3H A;  2WO0 A;  1PY3 A;  1GD4 A;  1BNE A;  4N6N B;  2HMN B;  4J5G A;  1GY6 A;  3LT9 A;  4HOH A;  1QAF A;  8CHO A;  4GL6 A;  4XM4 A;  3VSY A;  2Y74 A;  3AHS A;  4HKV B;  4XDV A;  2BO9 B;  4HYZ A;  1S72 3;  5M19 A;  1V58 A;  3FSD A;  4KFD A;  3RDE A;  4BL3 A;  3AHW A;  4FMC A;  4BTW A;  3PYJ A;  4KFE A;  4N6L A;  1BNR A;  1NU3 A;  3DMC A;  4K1V A;  1A2V A;  1OAC A;  4NRE A;  1W5Z A;  2IY2 A;  1FUS A;  2O9U X;  4K90 B;  5IER A;  3CC7 3;  1VQ9 3;  1YI2 3;  4AKZ A;  2XH9 A;  3LT8 A;  3TDG A;  4CJN A;  2OTJ 3;  3QRD A;  2E2T A;  4J8T A;  3L0R A;  1ULJ B;  2BMR B;  4ILF A;  1FYS A;  5IG0 A;  4HAA A;  1RGG A;  3E99 A;  4WWU C;  1KQS 2;  1GOU A;  6STD A;  1X1Y A;  2KF5 A;  1UW1 A;  4BL2 A;  1RGC A;  3UL5 A;  1NJI 4;  1JZO A;  4WYK B;  5CK6 A;  5GSP A;  4WYK A;  4WP5 A;  5HGR A;  3S67 A;  1VQ8 3;  2AAD A;  1IQX A;  4AKY A;  3BU4 A;  2FNQ A;  2XRX B;  1GMR A;  3FKA A;  1G0T A;  4HJL B;  1EKM A;  1TRP A;  4K1U A;  4K61 A;  5AIF A;  2UGI A;  3G8Z A;  2QGU A;  2GU3 A;  4LZI A;  2GU1 A;  2GSP A;  3CC2 3;  1OF5 A;  1GYB A;  3EC9 A;  3VF1 A;  1PU4 A;  3CCE 3;  1GOY A;  1K28 A;  1BSB A;  3M8C A;  1BNI A;  1BRK A;  3BND A;  1TFO A;  3MYT A;  3SVA A;  2W56 B;  2C4B A;  1HZ1 A;  3CCJ 3;  2W56 A;  3F40 A;  3GZR A;  2FGT A;  4FCJ A;  4EW5 A;  1AVL A;  3F14 A;  4HM3 B;  3S5C A;  3HX8 A;  4HZB B;  1NB3 I;  2HMJ B;  3AGO A;  5IEO A;  1ROA A;  4DKI A;  3GAX A;  1RDS A;  2BNG A;  1TRQ A;  3OXA A;  2RGQ A;  1VQK 3;  2W04 A;  2XGL A;  2YX9 A;  3MG2 A;  3MSO A;  1BSD A;  3LXU X;  1MWU A;  1M9G A;  2KF3 A;  2W0Q A;  3BNC A;  3T0U A;  1IU7 A;  3CD6 3;  2L1S A;  3MHE A;  4N6V 0;  5CF2 A;  1HYF A;  1OUN A;  5AI1 A;  3K0Z A;  3KII A;  1G02 A;  1RMS A;  1YIJ 3;  4R9L A;  1VQ7 3;  1JB2 A;  5FGO A;  1B2U A;  3LTD A;  4BIR A;  1UUG B;  4XB5 A;  4OUQ A;  2C11 A;  3JUQ A;  1MWR A;  5FW5 A;  7RNT A;  1JN5 A;  1SII A;  1TUH A;  1LQG C;  3D3L A;  1TIJ A;  4BU4 A;  3HI7 A;  1JNQ A;  1N9J A;  2CFG A;  3KZT A;  1Q81 4;  2W03 A;  3LH4 A;  4O2H A;  4MJD A;  1LQM B;  3NBB A;  3UB1 A;  1Q7Y 4;  3WA3 A;  2BMO B;  3GRD A;  3FCS B;  4MMZ B;  3IPT A;  3K63 A;  1RTU A;  1RGF A;  3LTC A;  3NUV A;  1B2X A;  1ZX2 A;  3DXO A;  3CXC 2;  3G4S 3;  1VQP 3;  1LOX A;  1B27 A;  1S5A A;  1UUW B;  1W6Y A;  2K3D A;  2M7O A;  1CH0 A;  1I70 A;  1RHL A;  3FG3 A;  2GBW B;  1PYL A;  1SAR A;  1WMN A;  1N8Q A;  3FF0 A;  4L8P A;  4O8S A;  3SYU A;  4ZM8 A;  1FUW A;  1VQ5 3;  1RSN A;  2CC3 A;  2HML B;  1VZZ A;  2GEY A;  5IF6 A;  3EQQ B;  1QAL A;  1TFK A;  3FG1 A;  1K8A 4;  1NB5 I;  4BTY A;  5KP3 A;  1UGI A;  1BNJ A;  3FZW A;  1YVS A;  3S28 A;  2Z77 A;  1O7M B;  5IG5 A;  1SQW A;  2P38 A;  4X2O A;  3NXJ A;  1JB5 A;  2XFT A;  1TU5 A;  2PZV A;  1WTH A;  3PS8 A;  5AEU B;  3V92 A;  2GEX A;  4STD A;  1DET A;  1V74 A;  3WOD G;  1ZO2 A;  3NM7 A;  3CPW 2;  1D6Y A;  2F86 B;  1BRS A;  1MGW A;  1RLS A;  1U8C B;  3X3Z A;  1B3S A;  1JJ2 2;  1KSI A;  1I0X A;  1YGE A;  2K0M A;  1NO3 A;  5D83 A;  5STD A;  4O3V A;  1IQ8 A;  1OCV A;  3CCS 3;  1SPU A;  2WGQ A;  2F99 A;  3HK4 A;  3WMD A;  4HM0 B;  3MKI A;  1O7N B;  1E97 A;  3BLZ A;  3LZA A;  1Z1S A;  3LOY A;  4H3U A;  5KP4 A;  1BRH A;  2CK3 H;  2RNT A;  3KE7 A;  1VQN 3;  3GWR A;  2MF7 A;  4KVH A;  4GHO A;  1SJW A;  1IVW A;  3MWZ A;  2P0M A;  1K9M 4;  1FGQ A;  2CWV A;  3PCR A;  1IV7 A;  3AMO B;  2KXG A;  2HMK B;  1BUJ A;  3AMO A;  1AVK A;  3KKG A;  2P09 A;  1KD1 4;  5EEO A;  1GY7 A;  2ZDJ A;  4EYC A;  1JBS A;  1IV9 A;  3RGR A;  1O7G B;  3SOY A;  1BUQ A;  3NHX A;  4ORL A;  5A0O B;  2Q07 A;  1HU9 A;  2XEP A;  2ZHX B;  5TGN A;  4FMA A;  3EBY A;  3V98 A;  1YVB I;  1FGM A;  1MNL A;  1O7W B;  3EJV A;  1Q86 4;  4EXR A;  5AIH A;  1YJW 3;  1I3I A;  5D81 A;  1IT8 A;  4WHA A;  5G1K A;  4I4K A;  4FCZ A;  3K7C A;  1W2B 2;  2RBI A;  1UDI I;  3DGL A;  1RGH A;  5IG3 A;  3U97 A;  2IUJ A;  4FR9 A;  2ZA4 A;  3X3X A;  1MWS A;  3F7S A;  2H0G A;  2STD A;  3STD A;  1EA2 A;  4IIA A;  2J8X B;  1BNG A;  1IT7 A;  1ZGX A;  1Q9E A;  3F9S A;  2BHM A;  2B1X B;  1IQY A;  1F8N A;  3DGO A;  3HII A;  3LML A;  3ALA A;  2OTL 3;  1FGT A;  1BNF A;  1DMN A;  1Q40 B;  3FF2 A;  1JRQ A;  1R4Y A;  3D5I A;  3U1W A;  2W2C A;  1VQL 3;  2CHC A;  2H0I A;  1GY5 A;  1RJO A;  3NV0 B;  4N6M A;  3WOF B;  3NV0 A;  3ZG5 A;  2P05 A;  2CH9 A;  3X41 A;  2CFW A;  3J7Y d;  1A67 A;  1BAO A;  3Q3F A;  1J2B A;  1OPY A;  1LOY A;  1N5P A;  3PXM A;  4HM6 B;  3URP A;  2IUK A;  3ZFZ A;  2F4Y A;  3DH2 A;  2ML5 A;  2HMO B;  3ECF A;  4RBN A;  2OWP A;  5DRE A;  3G71 3;  1JV2 B;  4JRF A;  2YFI B;  2F5M A;  1E3R A;  1UGH I;  1QJG A;  3JUO A;  5BIR A;  1M1K 4;  2JDI H;  1JBR A;  2FXT A;  4J5K A;  4EBG A;  1VQ6 3;  3RNT A;  3I0Y A;  2KF6 A;  5I97 A;  4R9K A;  1ISK A;  1RGL A;  4N6O B;  1M90 4;  1QAK A;  1D6U A;  1JB4 A;  3NQY A;  3OWY A;  1VQQ A;  1N9E A;  1MGR A;  2QIY A;  3CCV 3;  2IA7 A;  1STD A;  4LYL B;  3WOE B;  5KP1 A;  1VQM 3;  1OHP A;  3I55 3;  1BAN A;  1W6C A;  3HOH A;  4HM7 B;  1GSP A;  1JZD A;  1M1X B;  2V1L A;  5HOH A;  1D6Z A;  1IVX A;  1IDP A;  5JPU A;  1N5H A;  4O02 B;  3N9H A;  3DGM A;  3DGN A;  2O3O A;  2XSH B;  1EEJ A;  3OV4 A;  4HBR A;  5LC6 A;  3B4P A;  3X3Y A;  3CME 3;  1A2K A;  3G0K A;  4EV5 A;  3JUN A;  1RGK A;  4R80 A;  2HOH A;  3F8H A;  2CW9 A;  3NX0 A;  9RNT A;  2P0X A;  4CCV A;  1EUI C;  3EE1 A;  1QVG 2;  1EG9 B;  1US1 A;  4EV2 A;  1O7H B;  4LMI A;  2LQV A;  1K41 A;  3GZY B;  1W00 A;  3EF8 A;  2PNC A;  4PEJ A;  2Z7A A;  3JUM A;  1OGZ A;  4R1K A;  4HM8 B;  5CF1 A;  1W6G A;  1G96 A;  1FGR A;  2CG1 A;  1TTO A;  1Q82 4;  2MC8 A;  5IEP A;  3CCQ 3;  1DVC A;  2CWU A;  4LSO A;  1IYY A;  3B8L A;  2CIU A;  2XSO B;  2XFS A;  3CCR 3;  2I9W A;  3CNM A;  1E3V A;  3V99 A;  3CNX A;  2CFK A;  1YJN 3;  1OHO A;  4HM2 B;  1BOX A;  2F98 A;  1LNH A;  1BIR A;  2Y73 A;  1BNS A;  3ROB A;  1BRN L;  1IVV A;  3MG1 A;  3CCM 3;  3IJE B;  4U13 A;  2L4V A;  4XBY A;  3UNL A;  2LYX A;  5BXQ A;  1YHQ 3;  2ML6 A;  3LYG A;  2W9Q A;  1T2I A;  3SOA A;  3BNE A;  3JVC A;  1X1X A;  1VQ4 3;  1GD3 A;  3AGN A;  3JUP A;  5AII A;  3D5G A;  1BSE A;  5EQL A;  5EVH A;  1STF I;  3Q2P A;  3WA2 X;  1YGW A;  1BU4 A;  3EN1 B;  3EX9 A;  1BSA A;  2OQE C;  1UCI A;  3FG4 A;  3VGN A;  7STD A;  1DMM A;  6RNT A;  1ASK A;  4KT3 B;  1BRG A;  1CYU A;  3G6E 3;  3X42 A;  5G2G A;  1ZS7 A;  1W2Z A;  3HZP A;  2D42 A;  3DZL A;  3RGA A;  1UCL A;  2RSX A;  5DRV A;  1RKY A;  1TP6 A;  1TJD A;  1ULI B;  8RNT A;  5IW9 A;  1GMP A;  3UJM A;  3DY5 A;  4XBT A;  5IEN A;  1RNT A;  4EC6 A;  1AR0 A;  5M1A A;  1YJ9 3;  2E2V A;  5M18 A;  2INX A;  1BGS A;  1X1U A;  2OCT A;  4RNT A;  2BMQ B;  5AYS C;  4CDL A;  1A90 A;  2K54 A;  1AY7 A;  1B2S A;  1KWI A;  3FH1 A;  3HIG A;  2KAA A;  3KSE D;  3WHO A;  1W4N A;  1W02 A;  1CEW I;  3DM8 A;  4RZM A;  3GZX B;  4FMB A;  2QEX 3;  2R41 A;  1T5Y A;  3NBJ A;  2ZL8 A;  3D9R A;  5LC7 A;  2XF3 A;  3CMA 3;  3OW2 2;  3T8N A;  1UI8 A;  4CPK A;  1MWT A;  3SX1 A;  3Q1C A;  3PZW A;  3MPH A;  3A76 A;  3SED A;  5BVB A;  4N6U A;  1Q40 A;  4GSP A;  2WOH A;  5JBS A;  3KN4 A;  2WGO A;  1GOV A;  3FLJ A;  4IPB A;  3DUK A;  4MMY B;  3CC4 3;  1LOW A;  3GSP A;  1QVF 2;  3WR2 A;  3ER7 A;  1BVI A;  2CG0 A;  1BSC A;  1FGO A;  2WOF A;  1CYV A;  3SXX A;  1RN4 A;  1WNH A;  2W9P A;  4MEI A;  1GMQ A;  2OQE A;  3UL6 A;  1PFP A;  1LNI A;  1T2H A;  1U5O A;  4RNZ A;  5IG4 A;  1T3B A;  1FUT A;  2F56 A;  1NWW A;  3Q90 A;  3G16 A;  3BB9 A; 
#chains in the Genus database with same CATH homology
 2J8X B;  2UUG C;  1LQM B;  2UGI A;  1UUG B;  1UGH I;  2ZHX B;  1UGI A;  1LQG C;  1EUI C;  1UDI I;  4LYL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...