1EUIC

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
QLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor. The structure elucidation of a prokaryotic UDG.
pubmed doi rcsb
molecule tags Complex (hydrolase/inhibitor)
total genus 9
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1euiC00
2ZHXB 4LYLB 1UDII 2J8XB 1EUIC 2UGIA 1UGHI 1UUGB 2UUGC 1LQMB 1UGIA 1LQGC
chains in the Genus database with same CATH superfamily
1EEJA 1WMPA 3MHEA 5KP4A 1OHSA 2XGNA 2B1XB 8RNTA 5IW9A 1IVWA 2K0MA 3GWRA 1O7HB 2CFWA 2SARA 3EHCA 4WYKA 5BXQA 1AR0A 3CCR3 4FCJA 1JB5A 2BIRA 5BU4A 3CPW2 1TFKA 2XEPA 3Q3FA 4CCVA 2ZHXB 1IQXA 1SARA 3HOHA 1X1XA 3FZWA 4K1UA 1VQ83 1WTHA 3GZYB 1J2BA 2P0XA 1YVBI 3JUQA 2UX0A 1GY6A 2GU3A 1UUVB 3V98A 3HIIA 1RNBA 1BSAA 1YJW3 5BIRA 1VQK3 3ZG0A 1CQSA 2WOHA 4BL2A 1N8R4 4IIAA 1Y4KA 2XGLA 1HKXA 4NHFA 4XB5A 4OVMA 2HOHA 3F8XA 1QJGA 2C4BA 3FG1A 4J8TA 1U5OA 2J8XB 1JBTA 3NX0A 1QAFA 3F14A 4HOHA 4GHOA 4OUQA 5AIGA 3X42A 4CDLA 1VQ73 6STDA 4HM1B 1DYUA 1IYYA 3BNBA 4WFOA 2L1SA 1IT7A 2OTL3 1JRQA 2RSXA 2V1LA 3B4PA 3L0RA 1I2EA 1FUTA 2A15A 4EXRA 1JZOA 1HU9A 3OXAA 5AIHA 4HYZA 2UUGC 1UGIA 4HM2B 4HKVB 1I8VA 4LMIA 1BNRA 3KSED 2F5WA 1TTOA 3ER7A 3BNDA 3CC23 1ULJB 4U13A 1ZGXA 2F98A 4H3UA 5IG0A 4IT7A 1YJ93 2P0MA 2XRXB 4J9AA 2JDIH 1PU4A 2CFKA 1BUQA 4GB5A 3CU3A 3B7CA 2CFGA 1IVXA 2KF3A 4HZ9B 4KFFA 2XFSA 3X41A 2CKFB 1YIT3 3FCSB 1LOWA 3CCQ3 1OHOA 1STDA 1W7CA 3LTCA 3KFQC 3T0UA 4EV2A 1YVSA 3N8BA 4R9LA 2XSHB 3UL6A 3VGNA 1BSDA 1BRHA 2BMOB 2CWUA 1I0XA 4RNYA 3V99A 5M18A 3SOAA 1RRLA 1LOVA 1TU5A 1OHPA 1D6ZA 1FGTA 2CHCA 4MMYB 2K3DA 1AQZA 4BTYA 1FW7A 1QMAA 3G713 4RNZA 1JV2B 4XBXA 1G02A 1GMPA 1ZS7A 6RNTA 1E3RA 3HIGA 2YFJB 1UUGB 3K63A 1BNFA 3A76A 3KZTA 4R80A 3G4S3 1YNVX 5DREA 1RSNA 1LOXA 1BIRA 3BLZA 3HX8A 1TRQA 1X1YA 1GMRA 1ROAA 3SYUA 2CFDA 3UNLA 1YHQ3 1GY7A 1FZUA 3JUMA 3FG4A 1O7NB 3SEDA 4CPKA 2QA43 2BT3A 1Q864 1KSIA 2F56A 2GEYA 1RCKA 3CXC2 1SIHA 4FMCA 2OCTA 1EKMA 1X1WA 1OH0A 1BRGA 3WODG 3ZG5A 1B2SA 3NQZA 3JVCA 3CCU3 2KXGA 1JB4A 1GS3A 1QAKA 3H3HA 3LTDA 3LYGA 4RNTA 1O7PB 3CPOA 3K9MC 2CWTA 1Q814 1BNIA 1MGWA 1RGKA 1UW1A 4N6OB 4O02B 4TX4A 3LT8A 3CNXA 1O7GB 2GEXA 2HMJB 2RNTA 3E99A 1VQ93 1DETA 3IMAB 4N6MA 2PNCA 4EW5A 4QWTA 1ZO2A 2MF7A 3BIRA 4FR9A 1NNVA 3KSPA 1KWIA 2BHMA 3I563 1Q42A 1IVVA 1DMNA 4LSOA 4R4KA 4BIRA 2CX1A 5FGOA 1GOYA 5IG3A 2CC3A 5BVBA 1S723 1TRPA 4HM7B 5D81A 1VZZA 3NUVA 1T2HA 1KD14 2IMJA 7STDA 1IU7A 3S29A 1JNQA 5IF6A 1AVKA 3GSPA 2Y74A 1MWSA 2KF6A 4IPBA 5G1LA 1MGRA 1BNSA 2CK3H 1RTUA 1VQN3 4NREA 2YX9A 1BRIA 1RN4A 2W03A 2RGQA 3MKIA 3X3ZA 3DGMA 2AADA 3VF1A 4HVNA 2F4YA 1Q824 3EN8A 4PEJA 3WHOA 3CC73 2R41A 1SPUA 4EBGA 3WDGB 5CXOA 3EF8A 2D1WA 4XBYA 1DE3A 1M1XB 2RBIA 2H0HA 3GZBA 5EQLA 4STDA 3X40A 1FUSA 5AEUB 4L8OA 3CME3 1MOLA 1BRSA 3IJEB 4RBNA 1VQ63 5STDA 1MNLA 1K9M4 1W5ZA 1B2XA 4HAAA 3G0KA 3AHSA 3LOYA 2Z76A 5AIIA 2GBWB 3CC43 1B20A 5AIFA 2P05A 1DMMA 1B3SA 1VQ43 2CIUA 4N6NB 4N6UA 3LTAA 3CCM3 3DGLA 1RNTA 2Z7AA 5IERA 1GD3A 3MSOA 2O3OA 1AVLA 1OACA 3PYJA 1JB2A 5CLKA 3DH2A 2R4IA 3K7CA 1RGEA 3TDGA 5IG5A 1G0TA 4KFEA 1NO3A 1N5HA 1Z1SA 3OX9A 1IQYA 2KF5A 3D9RA 1JJ22 2WOFA 1D6YA 5IEPA 3BNEA 1EA2A 1IT8A 4WP5A 4GL6A 3SVAA 4HBRA 2KRTA 5CK6A 1BAOA 1OGZA 1T2IA 3SOYA 7GSPA 4HM6B 2QEX3 1VQL3 2OQEA 3S67A 1NWWA 2Z77A 1BVIA 1AY7A 1BRKA 5LC7A 3PGBA 2QGUA 2F5MA 1N8QA 2CH9A 4BU4A 2P09A 2B24B 3DGYA 1I2FA 2YFIB 5G2GA 5HGRA 1VQP3 1UI8A 1JKGB 4CJNA 4L8PA 3G8ZA 3S27A 3X3XA 4HJLB 5AEWB 2CW9A 1W6CA 1B21A 3UB1A 1UCJA 4AEQA 4LYLB 1C54A 3KN4A 2XFTA 1WNHA 1VQM3 2INXA 1GSPA 4LGQA 2HMNB 3ECFA 4H61A 1W6YA 5KP3A 1LNIA 1DVCA 4XDVA 6GSPA 2YFLB 4ZM8A 3VSYA 3RNTA 1W00A 3NV0B 1GD4A 3LZAA 3KIIA 3NXJA 5M19A 3J7Yd 1W2B2 4J5GA 2HMLB 4LZIA 3T8NA 3D3LA 1MWUA 1N5PA 3CD63 4RZMA 4BTWA 1DMQA 2WGOA 3FLJA 3CNMA 1G96A 3AGOA 1RDSA 1B27A 4N6LA 1K8A4 1OF5B 1RHLA 1SQWA 3GZXB 1JBRA 3PXMA 1VQ53 2UGIA 1E97A 3DM8A 1L5GB 1STFI 3AMOB 2PZVA 3KKGA 4LEHA 1FGOA 2L4VA 2E2TA 3MG1A 5DRVA 4FMBA 1RRHA 3PS8A 3G6E3 3Q2PA 4DKIA 1Q40B 2GU1A 2XR8B 2IUKA 1BNGA 2Z6BA 3S28A 1PYLA 1W6GA 1IVUA 3ALAA 1E3VA 3U1WA 2BO9B 2AAEA 2CFLA 1OUNA 3B4OA 3FF2A 3LMLA 3NBJA 3RDEA 3MPHA 2XSOB 2OWPA 3F9SA 4I4KA 1BNJA 1UGHI 3U97A 1BRNL 3I0YA 3N9HA 2GSPA 2OOVA 2LYXA 1OPYA 3RGAA 3EE1A 5D82A 4HM4B 3WOEB 5G1KA 1IV9A 1I0VA 3DGNA 1YGEA 3EBYA 3NBBA 3WR2A 4O3VA 3F7XA 1LXEA 1RGAA 1LNHA 1TP6A 2W2CA 3CCJ3 1LQGC 5AYRB 3OWYA 3QRDA 2FNQA 2C10A 1KQS2 2LQVA 4GSPA 1GOVA 1ZX2A 3FF0A 1ASKA 5LC6A 2MC8A 4FMDA 3OW22 1WQLB 1YIJ3 1MWRA 1A2PA 3LXUX 1ULIB 3OWSA 3PCRA 2HMKB 2ML5A 4KZ1A 1FA3A 2KAAA 4N6TA 1FUWA 3KCHA 5EEOA 3STDA 1GYBA 1X1UA 2BU4A 2FGTA 1BOXA 1RKYA 3RGRA 1JKGA 4KFDA 3F40A 1R4YA 5AI1A 3EC9A 1OGXA 1Q9EA 3QK9A 4HM8B 2XF3A 3EQQB 3PZWA 1O7WB 4FCMA 2STDA 3AHWA 1NU3A 3SX1A 1A90A 4L7KA 5IG4A 5CF2A 1UCIA 1RN7A 4KT3B 3S5CA 1BSBA 3D5GA 3NV0A 3EN1B 1A2VA 1GY5A 2W04A 1F8NA 3B8LA 1UI7A 1LOYA 2ML6A 3DXOA 3GRDA 2I9WA 4ORLA 5EVHA 1JZDA 3SLUA 5TGNA 3X3YA 1BGSA 3CCE3 3OWUA 3DY5A 3I553 3AGNA 3DZLA 4MMXB 4OK0A 3CMA3 3K5TA 7RNTA 3JUPA 1WMNA 2SBLA 1VQQA 4I5QA 1O7MB 2E2UA 4MJDA 4FCZA 3NHXA 4XDWA 2KCDA 4FMAA 1OF5A 1AV4A 1RGLA 3D4AA 1BANA 4XM4A 1ROVA 3AMOA 1PY3A 5HOHA 3NQYA 1RGGA 1W02A 2IYJA 4WWUC 1HZ1A 1LVNA 3SXXA 1Q40A 1JN5B 1SIIA 5GSPA 1NDOB 1OCVA 1YI23 5CF1A 1B2MA 2RFRA 3UL5A 2OQEC 1K28A 3GAXA 4KVHA 5RNTA 5FW5A 1SJWA 1NJI4 1N9JA 2H0IA 3CCL3 1K41A 3G16A 1ISKA 1GMQA 4HM3B 2O9UX 1TJDA 4Q53A 5A0OB 1DVDA 1VQO3 2HMOB 4NPBA 1HYFA 1TUHA 3NM7A 4WHAA 2OTJ3 1FGRA 1T5YA 1NB3I 2CG1A 1NB5I 3FG3A 2BMQB 1RGCA 2W9PA 5JBSA 1RGFA 3UJMA 3WMDA 2KF4A 4BTXA 1RMSA 1K734 3BU4A 1BRJA 3V92A 3NM2A 9RNTA 3DGOA 2M7OA 4XBTA 3F8HA 4HM0B 5ELUA 2H0GA 3K0ZA 2W56B 3T8UA 1A2KA 3KE7A 1A67A 1EUIC 1V58A 2BNGA 4X2OA 3URPA 1D6UA 4AKZA 2W0QA 1R4CA 3BNCA 2RCDA 2WGQA 2HMMB 1IQ8A 5AYSC 1FGQA 1I3FA 4ILFA 2W9QA 1YJN3 2WO0A 3OV4A 3F7SA 4AKYA 1EQKA 4WYKB 1RCLA 3MG2A 1QALA 4EC6A 1LRAA 2Q07A 3WA2X 4EV5A 2F86B 2IA7A 3EJVA 3EX9A 1T3BA 1IK3A 1U8CB 4MEIA 1CYUA 1FGMA 1S5AA 4BL3A 2C11A 1W01A 1W4NA 3H51A 1BSEA 1RGHA 3M8CA 4K61A 3MWZA 5ELJA 1JBSA 3CCS3 1UCKA 1I2GA 1C7HA 3DMCA 1BSCA 5M1AA 3Q90A 2IY2A 1M904 2BMRB 2GXFA 3LH4A 2E2VA 1B2ZA 2ZL8A 3JUOA 1UDII 3N54B 4JF8A 2K54A 5I97A 1V57A 5D83A 2CX0A 3DUKA 2OOVC 3HK4A 2IUJA 3FKAA 3FSDA 3IPTA 3GZRA 3JUNA 3D5IA 2W6JH 1FYSA 4O8SA 1QVF2 4N3VA 2FXTA 1IDPA 3NBRA 2QIYA 5IEOA 3MYTA 1TIJA 4X2HA 2D42A 1TFOA 1W2ZA 5KP1A 4K1VA 1I3IA 3O8YA 1BNEA 1JN5A 2Y73A 1Q7HA 3Q1CA 4HM5B 1YGWA 1GOUA 3LT9A 1B2UA 3EB8A 1RLSA 1N9EA 3FGYA 4N6V0 1RN1A 3FH1A 3HI7A 2CG0A 1Q7Y4 2GBXB 2ZDJA 1CEWI 3WOFB 1V74A 3BB9A 3EBTA 4EYCA 1M1K4 3ZFZA 3D79A 2ZA4A 4JRFA 1EG9B 1CH0A 3PCSA 5JPPA 3WA3A 1BU4A 2P38A 3A5EA 4G1MB 4MMZB 5JPUA 1KC84 1IV7A 4HZBB 1MWTA 4K90B 1I70A 1UUWB 4O2HA 8CHOA 1M9GA 2CWVA 4J5KA 1WMOA 1LQMB 2F99A 2XH9A 4R1KA 1UCLA 3LTBA 3CCV3 1PFPA 1US1A 3HZPA 3MG3A 5IENA 1CYVA 1RJOA 2JQ5A 2W56A 3ROBA 4R9KA 1QVG2 1BUJA
chains in the Genus database with same CATH topology
2ZHXB 4LYLB 1UDII 2J8XB 1EUIC 2UGIA 1UGHI 1UUGB 2UUGC 1LQMB 1UGIA 1LQGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZHX B;  4LYL B;  1UDI I;  2J8X B;  1EUI C;  2UGI A;  1UGH I;  1UUG B;  2UUG C;  1LQM B;  1UGI A;  1LQG C; 
#chains in the Genus database with same CATH topology
 1EEJ A;  1WMP A;  3MHE A;  5KP4 A;  1OHS A;  2XGN A;  2B1X B;  8RNT A;  5IW9 A;  1IVW A;  2K0M A;  3GWR A;  1O7H B;  2CFW A;  2SAR A;  3EHC A;  4WYK A;  5BXQ A;  1AR0 A;  3CCR 3;  4FCJ A;  1JB5 A;  2BIR A;  5BU4 A;  3CPW 2;  1TFK A;  2XEP A;  3Q3F A;  4CCV A;  2ZHX B;  1IQX A;  1SAR A;  3HOH A;  1X1X A;  3FZW A;  4K1U A;  1VQ8 3;  1WTH A;  3GZY B;  1J2B A;  2P0X A;  1YVB I;  3JUQ A;  2UX0 A;  1GY6 A;  2GU3 A;  1UUV B;  3V98 A;  3HII A;  1RNB A;  1BSA A;  1YJW 3;  5BIR A;  1VQK 3;  3ZG0 A;  1CQS A;  2WOH A;  4BL2 A;  1N8R 4;  4IIA A;  1Y4K A;  2XGL A;  1HKX A;  4NHF A;  4XB5 A;  4OVM A;  2HOH A;  3F8X A;  1QJG A;  2C4B A;  3FG1 A;  4J8T A;  1U5O A;  2J8X B;  1JBT A;  3NX0 A;  1QAF A;  3F14 A;  4HOH A;  4GHO A;  4OUQ A;  5AIG A;  3X42 A;  4CDL A;  1VQ7 3;  6STD A;  4HM1 B;  1DYU A;  1IYY A;  3BNB A;  4WFO A;  2L1S A;  1IT7 A;  2OTL 3;  1JRQ A;  2RSX A;  2V1L A;  3B4P A;  3L0R A;  1I2E A;  1FUT A;  2A15 A;  4EXR A;  1JZO A;  1HU9 A;  3OXA A;  5AIH A;  4HYZ A;  2UUG C;  1UGI A;  4HM2 B;  4HKV B;  1I8V A;  4LMI A;  1BNR A;  3KSE D;  2F5W A;  1TTO A;  3ER7 A;  3BND A;  3CC2 3;  1ULJ B;  4U13 A;  1ZGX A;  2F98 A;  4H3U A;  5IG0 A;  4IT7 A;  1YJ9 3;  2P0M A;  2XRX B;  4J9A A;  2JDI H;  1PU4 A;  2CFK A;  1BUQ A;  4GB5 A;  3CU3 A;  3B7C A;  2CFG A;  1IVX A;  2KF3 A;  4HZ9 B;  4KFF A;  2XFS A;  3X41 A;  2CKF B;  1YIT 3;  3FCS B;  1LOW A;  3CCQ 3;  1OHO A;  1STD A;  1W7C A;  3LTC A;  3KFQ C;  3T0U A;  4EV2 A;  1YVS A;  3N8B A;  4R9L A;  2XSH B;  3UL6 A;  3VGN A;  1BSD A;  1BRH A;  2BMO B;  2CWU A;  1I0X A;  4RNY A;  3V99 A;  5M18 A;  3SOA A;  1RRL A;  1LOV A;  1TU5 A;  1OHP A;  1D6Z A;  1FGT A;  2CHC A;  4MMY B;  2K3D A;  1AQZ A;  4BTY A;  1FW7 A;  1QMA A;  3G71 3;  4RNZ A;  1JV2 B;  4XBX A;  1G02 A;  1GMP A;  1ZS7 A;  6RNT A;  1E3R A;  3HIG A;  2YFJ B;  1UUG B;  3K63 A;  1BNF A;  3A76 A;  3KZT A;  4R80 A;  3G4S 3;  1YNV X;  5DRE A;  1RSN A;  1LOX A;  1BIR A;  3BLZ A;  3HX8 A;  1TRQ A;  1X1Y A;  1GMR A;  1ROA A;  3SYU A;  2CFD A;  3UNL A;  1YHQ 3;  1GY7 A;  1FZU A;  3JUM A;  3FG4 A;  1O7N B;  3SED A;  4CPK A;  2QA4 3;  2BT3 A;  1Q86 4;  1KSI A;  2F56 A;  2GEY A;  1RCK A;  3CXC 2;  1SIH A;  4FMC A;  2OCT A;  1EKM A;  1X1W A;  1OH0 A;  1BRG A;  3WOD G;  3ZG5 A;  1B2S A;  3NQZ A;  3JVC A;  3CCU 3;  2KXG A;  1JB4 A;  1GS3 A;  1QAK A;  3H3H A;  3LTD A;  3LYG A;  4RNT A;  1O7P B;  3CPO A;  3K9M C;  2CWT A;  1Q81 4;  1BNI A;  1MGW A;  1RGK A;  1UW1 A;  4N6O B;  4O02 B;  4TX4 A;  3LT8 A;  3CNX A;  1O7G B;  2GEX A;  2HMJ B;  2RNT A;  3E99 A;  1VQ9 3;  1DET A;  3IMA B;  4N6M A;  2PNC A;  4EW5 A;  4QWT A;  1ZO2 A;  2MF7 A;  3BIR A;  4FR9 A;  1NNV A;  3KSP A;  1KWI A;  2BHM A;  3I56 3;  1Q42 A;  1IVV A;  1DMN A;  4LSO A;  4R4K A;  4BIR A;  2CX1 A;  5FGO A;  1GOY A;  5IG3 A;  2CC3 A;  5BVB A;  1S72 3;  1TRP A;  4HM7 B;  5D81 A;  1VZZ A;  3NUV A;  1T2H A;  1KD1 4;  2IMJ A;  7STD A;  1IU7 A;  3S29 A;  1JNQ A;  5IF6 A;  1AVK A;  3GSP A;  2Y74 A;  1MWS A;  2KF6 A;  4IPB A;  5G1L A;  1MGR A;  1BNS A;  2CK3 H;  1RTU A;  1VQN 3;  4NRE A;  2YX9 A;  1BRI A;  1RN4 A;  2W03 A;  2RGQ A;  3MKI A;  3X3Z A;  3DGM A;  2AAD A;  3VF1 A;  4HVN A;  2F4Y A;  1Q82 4;  3EN8 A;  4PEJ A;  3WHO A;  3CC7 3;  2R41 A;  1SPU A;  4EBG A;  3WDG B;  5CXO A;  3EF8 A;  2D1W A;  4XBY A;  1DE3 A;  1M1X B;  2RBI A;  2H0H A;  3GZB A;  5EQL A;  4STD A;  3X40 A;  1FUS A;  5AEU B;  4L8O A;  3CME 3;  1MOL A;  1BRS A;  3IJE B;  4RBN A;  1VQ6 3;  5STD A;  1MNL A;  1K9M 4;  1W5Z A;  1B2X A;  4HAA A;  3G0K A;  3AHS A;  3LOY A;  2Z76 A;  5AII A;  2GBW B;  3CC4 3;  1B20 A;  5AIF A;  2P05 A;  1DMM A;  1B3S A;  1VQ4 3;  2CIU A;  4N6N B;  4N6U A;  3LTA A;  3CCM 3;  3DGL A;  1RNT A;  2Z7A A;  5IER A;  1GD3 A;  3MSO A;  2O3O A;  1AVL A;  1OAC A;  3PYJ A;  1JB2 A;  5CLK A;  3DH2 A;  2R4I A;  3K7C A;  1RGE A;  3TDG A;  5IG5 A;  1G0T A;  4KFE A;  1NO3 A;  1N5H A;  1Z1S A;  3OX9 A;  1IQY A;  2KF5 A;  3D9R A;  1JJ2 2;  2WOF A;  1D6Y A;  5IEP A;  3BNE A;  1EA2 A;  1IT8 A;  4WP5 A;  4GL6 A;  3SVA A;  4HBR A;  2KRT A;  5CK6 A;  1BAO A;  1OGZ A;  1T2I A;  3SOY A;  7GSP A;  4HM6 B;  2QEX 3;  1VQL 3;  2OQE A;  3S67 A;  1NWW A;  2Z77 A;  1BVI A;  1AY7 A;  1BRK A;  5LC7 A;  3PGB A;  2QGU A;  2F5M A;  1N8Q A;  2CH9 A;  4BU4 A;  2P09 A;  2B24 B;  3DGY A;  1I2F A;  2YFI B;  5G2G A;  5HGR A;  1VQP 3;  1UI8 A;  1JKG B;  4CJN A;  4L8P A;  3G8Z A;  3S27 A;  3X3X A;  4HJL B;  5AEW B;  2CW9 A;  1W6C A;  1B21 A;  3UB1 A;  1UCJ A;  4AEQ A;  4LYL B;  1C54 A;  3KN4 A;  2XFT A;  1WNH A;  1VQM 3;  2INX A;  1GSP A;  4LGQ A;  2HMN B;  3ECF A;  4H61 A;  1W6Y A;  5KP3 A;  1LNI A;  1DVC A;  4XDV A;  6GSP A;  2YFL B;  4ZM8 A;  3VSY A;  3RNT A;  1W00 A;  3NV0 B;  1GD4 A;  3LZA A;  3KII A;  3NXJ A;  5M19 A;  3J7Y d;  1W2B 2;  4J5G A;  2HML B;  4LZI A;  3T8N A;  3D3L A;  1MWU A;  1N5P A;  3CD6 3;  4RZM A;  4BTW A;  1DMQ A;  2WGO A;  3FLJ A;  3CNM A;  1G96 A;  3AGO A;  1RDS A;  1B27 A;  4N6L A;  1K8A 4;  1OF5 B;  1RHL A;  1SQW A;  3GZX B;  1JBR A;  3PXM A;  1VQ5 3;  2UGI A;  1E97 A;  3DM8 A;  1L5G B;  1STF I;  3AMO B;  2PZV A;  3KKG A;  4LEH A;  1FGO A;  2L4V A;  2E2T A;  3MG1 A;  5DRV A;  4FMB A;  1RRH A;  3PS8 A;  3G6E 3;  3Q2P A;  4DKI A;  1Q40 B;  2GU1 A;  2XR8 B;  2IUK A;  1BNG A;  2Z6B A;  3S28 A;  1PYL A;  1W6G A;  1IVU A;  3ALA A;  1E3V A;  3U1W A;  2BO9 B;  2AAE A;  2CFL A;  1OUN A;  3B4O A;  3FF2 A;  3LML A;  3NBJ A;  3RDE A;  3MPH A;  2XSO B;  2OWP A;  3F9S A;  4I4K A;  1BNJ A;  1UGH I;  3U97 A;  1BRN L;  3I0Y A;  3N9H A;  2GSP A;  2OOV A;  2LYX A;  1OPY A;  3RGA A;  3EE1 A;  5D82 A;  4HM4 B;  3WOE B;  5G1K A;  1IV9 A;  1I0V A;  3DGN A;  1YGE A;  3EBY A;  3NBB A;  3WR2 A;  4O3V A;  3F7X A;  1LXE A;  1RGA A;  1LNH A;  1TP6 A;  2W2C A;  3CCJ 3;  1LQG C;  5AYR B;  3OWY A;  3QRD A;  2FNQ A;  2C10 A;  1KQS 2;  2LQV A;  4GSP A;  1GOV A;  1ZX2 A;  3FF0 A;  1ASK A;  5LC6 A;  2MC8 A;  4FMD A;  3OW2 2;  1WQL B;  1YIJ 3;  1MWR A;  1A2P A;  3LXU X;  1ULI B;  3OWS A;  3PCR A;  2HMK B;  2ML5 A;  4KZ1 A;  1FA3 A;  2KAA A;  4N6T A;  1FUW A;  3KCH A;  5EEO A;  3STD A;  1GYB A;  1X1U A;  2BU4 A;  2FGT A;  1BOX A;  1RKY A;  3RGR A;  1JKG A;  4KFD A;  3F40 A;  1R4Y A;  5AI1 A;  3EC9 A;  1OGX A;  1Q9E A;  3QK9 A;  4HM8 B;  2XF3 A;  3EQQ B;  3PZW A;  1O7W B;  4FCM A;  2STD A;  3AHW A;  1NU3 A;  3SX1 A;  1A90 A;  4L7K A;  5IG4 A;  5CF2 A;  1UCI A;  1RN7 A;  4KT3 B;  3S5C A;  1BSB A;  3D5G A;  3NV0 A;  3EN1 B;  1A2V A;  1GY5 A;  2W04 A;  1F8N A;  3B8L A;  1UI7 A;  1LOY A;  2ML6 A;  3DXO A;  3GRD A;  2I9W A;  4ORL A;  5EVH A;  1JZD A;  3SLU A;  5TGN A;  3X3Y A;  1BGS A;  3CCE 3;  3OWU A;  3DY5 A;  3I55 3;  3AGN A;  3DZL A;  4MMX B;  4OK0 A;  3CMA 3;  3K5T A;  7RNT A;  3JUP A;  1WMN A;  2SBL A;  1VQQ A;  4I5Q A;  1O7M B;  2E2U A;  4MJD A;  4FCZ A;  3NHX A;  4XDW A;  2KCD A;  4FMA A;  1OF5 A;  1AV4 A;  1RGL A;  3D4A A;  1BAN A;  4XM4 A;  1ROV A;  3AMO A;  1PY3 A;  5HOH A;  3NQY A;  1RGG A;  1W02 A;  2IYJ A;  4WWU C;  1HZ1 A;  1LVN A;  3SXX A;  1Q40 A;  1JN5 B;  1SII A;  5GSP A;  1NDO B;  1OCV A;  1YI2 3;  5CF1 A;  1B2M A;  2RFR A;  3UL5 A;  2OQE C;  1K28 A;  3GAX A;  4KVH A;  5RNT A;  5FW5 A;  1SJW A;  1NJI 4;  1N9J A;  2H0I A;  3CCL 3;  1K41 A;  3G16 A;  1ISK A;  1GMQ A;  4HM3 B;  2O9U X;  1TJD A;  4Q53 A;  5A0O B;  1DVD A;  1VQO 3;  2HMO B;  4NPB A;  1HYF A;  1TUH A;  3NM7 A;  4WHA A;  2OTJ 3;  1FGR A;  1T5Y A;  1NB3 I;  2CG1 A;  1NB5 I;  3FG3 A;  2BMQ B;  1RGC A;  2W9P A;  5JBS A;  1RGF A;  3UJM A;  3WMD A;  2KF4 A;  4BTX A;  1RMS A;  1K73 4;  3BU4 A;  1BRJ A;  3V92 A;  3NM2 A;  9RNT A;  3DGO A;  2M7O A;  4XBT A;  3F8H A;  4HM0 B;  5ELU A;  2H0G A;  3K0Z A;  2W56 B;  3T8U A;  1A2K A;  3KE7 A;  1A67 A;  1EUI C;  1V58 A;  2BNG A;  4X2O A;  3URP A;  1D6U A;  4AKZ A;  2W0Q A;  1R4C A;  3BNC A;  2RCD A;  2WGQ A;  2HMM B;  1IQ8 A;  5AYS C;  1FGQ A;  1I3F A;  4ILF A;  2W9Q A;  1YJN 3;  2WO0 A;  3OV4 A;  3F7S A;  4AKY A;  1EQK A;  4WYK B;  1RCL A;  3MG2 A;  1QAL A;  4EC6 A;  1LRA A;  2Q07 A;  3WA2 X;  4EV5 A;  2F86 B;  2IA7 A;  3EJV A;  3EX9 A;  1T3B A;  1IK3 A;  1U8C B;  4MEI A;  1CYU A;  1FGM A;  1S5A A;  4BL3 A;  2C11 A;  1W01 A;  1W4N A;  3H51 A;  1BSE A;  1RGH A;  3M8C A;  4K61 A;  3MWZ A;  5ELJ A;  1JBS A;  3CCS 3;  1UCK A;  1I2G A;  1C7H A;  3DMC A;  1BSC A;  5M1A A;  3Q90 A;  2IY2 A;  1M90 4;  2BMR B;  2GXF A;  3LH4 A;  2E2V A;  1B2Z A;  2ZL8 A;  3JUO A;  1UDI I;  3N54 B;  4JF8 A;  2K54 A;  5I97 A;  1V57 A;  5D83 A;  2CX0 A;  3DUK A;  2OOV C;  3HK4 A;  2IUJ A;  3FKA A;  3FSD A;  3IPT A;  3GZR A;  3JUN A;  3D5I A;  2W6J H;  1FYS A;  4O8S A;  1QVF 2;  4N3V A;  2FXT A;  1IDP A;  3NBR A;  2QIY A;  5IEO A;  3MYT A;  1TIJ A;  4X2H A;  2D42 A;  1TFO A;  1W2Z A;  5KP1 A;  4K1V A;  1I3I A;  3O8Y A;  1BNE A;  1JN5 A;  2Y73 A;  1Q7H A;  3Q1C A;  4HM5 B;  1YGW A;  1GOU A;  3LT9 A;  1B2U A;  3EB8 A;  1RLS A;  1N9E A;  3FGY A;  4N6V 0;  1RN1 A;  3FH1 A;  3HI7 A;  2CG0 A;  1Q7Y 4;  2GBX B;  2ZDJ A;  1CEW I;  3WOF B;  1V74 A;  3BB9 A;  3EBT A;  4EYC A;  1M1K 4;  3ZFZ A;  3D79 A;  2ZA4 A;  4JRF A;  1EG9 B;  1CH0 A;  3PCS A;  5JPP A;  3WA3 A;  1BU4 A;  2P38 A;  3A5E A;  4G1M B;  4MMZ B;  5JPU A;  1KC8 4;  1IV7 A;  4HZB B;  1MWT A;  4K90 B;  1I70 A;  1UUW B;  4O2H A;  8CHO A;  1M9G A;  2CWV A;  4J5K A;  1WMO A;  1LQM B;  2F99 A;  2XH9 A;  4R1K A;  1UCL A;  3LTB A;  3CCV 3;  1PFP A;  1US1 A;  3HZP A;  3MG3 A;  5IEN A;  1CYV A;  1RJO A;  2JQ5 A;  2W56 A;  3ROB A;  4R9K A;  1QVG 2;  1BUJ A; 
#chains in the Genus database with same CATH homology
 2ZHX B;  4LYL B;  1UDI I;  2J8X B;  1EUI C;  2UGI A;  1UGH I;  1UUG B;  2UUG C;  1LQM B;  1UGI A;  1LQG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...