1EURA

Sialidase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
361
structure length
361
Chain Sequence
GEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGTDPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQYTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRKVAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIRMSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGGICAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three domains of a bacterial sialidase: a beta-propeller, an immunoglobulin module and a galactose-binding jelly-roll.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords SIALIDASE
total genus 95
structure length 361
sequence length 361
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 1996-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13088 BNR_2 BNR repeat-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 1eurA00
1NNBA 4QNPA 4X49A 4QN4A 1A4GA 2YDPA 2W38A 3H71A 2HTYA 3PJQA 1E8UA 4NCSA 1EUTA 2AEPA 2YA6A 1EURA 3O9KA 2VVZA 4YW4A 1NMAN 2C4AA 4WA5A 4HZZA 4XOGA 2QWGA 2HTQA 2VW2A 2HT8A 4MWRA 2SLIA 2ZB5A 4MWXA 4XJZA 1V3BA 1W21A 2VK7A 1INWA 3T1EA 5JYYA 2X9MA 1MZ6A 4XJRA 3CYEA 4CPNA 4MWWA 4X6KA 4K1KA 1A4QA 4XJUA 3B69A 4QN5A 2F25A 4GZXA 4MWLA 3TI3A 1SNTA 2F13A 1L7FA 2QWBA 1W1XA 4MC7A 1INXA 4Q6KA 4FQ4A 4B7JA 4MJVA 4CPZA 1USRA 2F28A 2AGSA 4CPYA 1NCCN 2QWJA 4FPEA 3TI5A 1W20A 1VCJA 4FP3A 1MR5A 4I00A 1BJIA 4CPMA 2HTUA 4GZOA 3H6JA 2ZB6A 4XIKA 1INVA 2F10A 1Z4YA 6NN9A 2F0ZA 2SILA 1V0FA 1DILA 4MX0A 4MZEA 4SLIA 1W8NA 4GZTA 4KS1A 2VWDA 3H73A 1INGA 3TI4A 4MWVA 1XOGA 4QN7A 2AEQA 1NSCA 4YW3A 2YA7A 1N1YA 2VSMA 4K1JA 4XILA 4MWQA 4YZ4A 1B9VA 4MWUA 4XJ9A 4UF7A 5HUNA 2YA5A 1Z4WA 2W5NA 1Z50A 3BEQA 2HTWA 3INBA 2HU4A 2AH2A 4H53A 4WEFA 4QN3A 3K39A 2B8HA 2QWAA 4FOQA 3TI8A 1V3DA 4MZAA 1KITA 4B7MA 1XOEA 2YA4A 2F11A 4YZ1A 1V0EA 4M4NA 1MS4A 4HZVA 4YW5A 1SLIA 4FPLA 4XMAA 1NNCA 4NN9A 4GZQA 3CL0A 4KS4A 4KS3A 1V0ZA 1V3CA 2HU0A 2BZDA 3TI6A 4KS5A 2XZJA 4FOYA 1L7HA 3NSSA 2QWCA 1F8DA 1VCUA 4JF7A 1L7GA 4DGRA 1MS5A 2VSKA 4B7QA 3D12A 3SANA 1W0OA 1NN2A 1N1VA 4HZYA 2BERA 1INFA 4FPJA 1F8EA 2F29A 1SO7A 2BF6A 3D11A 2VW0A 4WEGA 4K1HA 4FJ6A 4B7NA 1INYA 2VW1A 2F12A 4FPGA 1NSDA 2HTVA 2HTRA 1MS1A 5HUGA 1MS0A 2W5OA 1IVEA 1A14N 1F8CA 4WA3A 4XYXA 3K36A 3K3AA 2QWFA 1S0IA 1IVBA 4M3MA 3B7EA 4XMIA 2RKCA 2XCYA 3K38A 4HZWA 2F24A 4FPKA 1F8BA 1N1TA 1MS8A 4MWJA 2YDTA 2QWKA 1NCBN 1W8OA 3TICA 3SILA 4B7RA 3SLIA 4YZ3A 4FOWA 4GDJA 4XJAA 1IVDA 2CMLA 4HIZA 1NSBA 4GZWA 2JKBA 5NN9A 4YW1A 1EUSA 2YA8A 4K1IA 5HX0A 3ALXA 4XJWA 2XZIA 4XHXA 2W20A 4GJTA 4X4AA 4GZPA 1SLLA 3TIAA 1USXA 4FOVA 1Z4XA 4XHBA 1NNAA 2SIMA 1EUUA 1NMCA 2QWHA 5M1ZA 3GVKA 4FVKA 1IVGA 1Z4ZA 4HZXA 2XZKA 5B2CA 3NN9A 4M4UA 4KS2A 3H72A 4XJQA 4MWYA 4CPOA 2HT5A 1NMBN 4FP2A 1MZ5A 2A75A 3GVJA 4YZ2A 4CPLA 3SALA 4GB1A 1B9SA 1B9TA 4NC5A 4GZSA 4BBWA 1N1SA 4XE9A 1V3EA 4J9TA 2HT7A 5B2DA 1IVCA 4XJ8A 1E8VA 4H52A 1NCDN 2QWDA 1MS9A 2C4LA 1S0JA 2F26A 1NCAN 4FPHA 3GVLA 4YW2A 4GEZA 4D8SA 3A72A 1MWEA 1V2IA 3K37A 2QWEA 3A71A 1W0PA 4QN6A 4FZHA 2QWIA 2BATA 5HUKA 2VK6A 4YZ5A 3CL2A 5F9TA 4FPOB 1E8TA 1Z4VA 3W09A 3ALWA 1MS3A 5HUMA 2FHRA 3TIBA 2F27A 3O9JA 4M4VA 4MJUA 3OPZA 4FPYA 4K3YA 1INHA 1WCQA 7NN9A 4GDIA 2VK5A 4FPFA 4XIOA 3JU4A 1IVFA 1WCSA 1DIMA 4WA4A 3CKZA 4X47A 4FPCA
chains in the Genus database with same CATH superfamily
1PJXA 1NNBA 4QNPA 4CSDA 3BYCA 4X49A 4QN4A 1N7DA 1A4GA 2YDPA 2W38A 3H71A 3WN7A 2HTYA 3PJQA 1E8UA 1N6DA 4NCSA 1EUTA 2AEPA 2YA6A 1EURA 3O9KA 4IYGA 2VVZA 4YW4A 1NMAN 2FLUX 3ZGCA 3NO0A 2C4AA 4WA5A 4HZZA 2IAOA 4XOGA 2QWGA 2HTQA 2VW2A 2IATA 4O5SA 2HT8A 4MWRA 2SLIA 2ZB5A 4MWXA 4XJZA 3A9HA 1V3BA 1W21A 2VK7A 2POOA 1INWA 4L7DA 3E5ZA 3LI4A 2XN4A 3T1EA 1X2JA 5JYYA 2X9MA 1MZ6A 2IAPA 4XJRA 3CYEA 2P4OA 3Q6TA 4AGIA 4CPNA 5FNQA 4MWWA 3SOBB 4X6KA 4K1KA 1A4QA 4XJUA 3B69A 4QN5A 2DG0A 2F25A 4GZXA 4MWLA 3TI3A 1SNTA 2F13A 5EO8A 3SOQA 4D52A 4G3NA 1L7FA 2QWBA 1W1XA 1C9UA 4MC7A 1INXA 1IUCA 1CVMA 4FQ4A 4Q6KA 1S1DA 4B7JA 4MJVA 4CPZA 1USRA 1POOA 2F28A 2AGSA 2FP8A 4CPYA 1NCCN 2IAXA 2QWJA 4FPEA 3TI5A 3O4PA 1W20A 1VCJA 4FP3A 2IARA 1MR5A 4I00A 1BJIA 3DASA 4CPMA 3I1CA 2HTUA 4GZOA 3H6JA 2ZB6A 4XIKA 1INVA 2F10A 1Z4YA 6NN9A 2F0ZA 2SILA 1V0FA 4C1YA 1DILA 4MX0A 4MZEA 4SLIA 1W8NA 5GX1A 4GZTA 4KS1A 2VWDA 3H73A 1INGA 3TI4A 2IAUA 2DSOA 4IN4A 4MWVA 1XOGA 4QN7A 2VPJA 2AEQA 1NSCA 4YW3A 2YA7A 1N1YA 2VSMA 4K1JA 4XILA 4MWQA 4YZ4A 1B9VA 4MWUA 3Q6PA 3SOVA 4XJ9A 4ZLRA 3FVZA 4UF7A 5HUNA 2YA5A 1RWLA 2IASA 4D52B 1Z4WA 2W5NA 1Z50A 3BEQA 3ZGDA 4HW6A 2HTWA 3DR2A 3INBA 2HU4A 3A9GA 2AH2A 4H53A 3G4EA 4WEFA 4QN3A 3K39A 2B8HA 2QWAA 3V1SA 4IMBA 4FOQA 1CRZA 3G4HA 2HQSA 3TI8A 1V3DA 1QLGA 4IFLX 4MZAA 1KITA 4B7MA 1XOEA 2YA4A 2F11A 5FNTA 5D9BA 4YZ1A 1Q7FA 1V0EA 4M4NA 3LI5A 1MS4A 4HZVA 1IUBA 4YW5A 1SLIA 4FPLA 4HHQA 4XMAA 3L6VA 1NNCA 4NN9A 4GNCA 1RWIA 2QE8A 4GZQA 3CL0A 4KS4A 4GNAA 4KS3A 1V0ZA 3II7A 1V3CA 2HU0A 2BZDA 2W8BA 4KS5A 3TI6A 2XZJA 4FOYA 1L7HA 3V65B 3P5BL 3NSSA 2QWCA 1F8DA 2GVUA 4IFJA 1VCUA 4JF7A 1L7GA 3S8ZA 4JMLA 4DGRA 1MS5A 4AGTA 2VSKA 4B7QA 5GTQA 3WWAA 3D12A 3SANA 1W0OA 1NN2A 1CQ1A 1N1VA 4GN9A 4HZYA 2BERA 1INFA 2ZW9A 4FPJA 5FZJA 1F8EA 2F29A 1SO7A 2BF6A 2V91A 1N6EA 3D11A 3Q6KA 2VW0A 4WEGA 4K1HA 4FJ6A 4B7NA 1INYA 4L7BA 4XMBA 3V64C 2VW1A 2ZWAA 2F12A 4FPGA 2ZZKA 1ZGKA 2H2UA 4GNBA 1NSDA 1OFZA 2HTVA 2VAQA 5FNUA 3VNHA 5GX2A 2HTRA 3LI3A 1MS1A 5HUGA 1MS0A 2W5OA 5D9DA 1IVEA 1A14N 4YY8A 3WW9A 1F8CA 4WA3A 4XYXA 3K36A 3K3AA 2QWFA 2GVWA 1S0IA 4GN7A 4N1BA 4R40A 2GVVA 1IVBA 4M3MA 4ASCA 2W8BB 3B7EA 4XMIA 2RKCA 1E1AA 2XCYA 3K38A 4Q1UA 4HZWA 3ADEA 2F24A 5F72C 2G8SA 3KYAA 4FPKA 1F8BA 1N1TA 4CH9A 1MS8A 5H47A 4MWJA 2YDTA 2QWKA 1NCBN 1W8OA 3S94A 3TICA 3SILA 5FWWA 4D4UA 4B7RA 4L7CA 3SLIA 4YZ3A 2GHSA 4FOWA 4GDJA 4XJAA 4A0PA 1SUUA 3HLHA 5GX4A 1IVDA 4CHBA 2CMLA 3AMRA 4HIZA 1NSBA 4AH4A 4GZWA 2JKBA 2FPCA 4IFNX 5NN9A 1QBIA 2DYHA 4YW1A 1EUSA 2YA8A 4K1IA 2DG1A 1IJQA 1N6FA 5HX0A 3ALXA 4GN8A 4XJWA 2XZIA 4XHXA 2W20A 4GJTA 4X4AA 2H2NA 4GZPA 1SLLA 5EX7A 3TIAA 1USXA 4FOVA 5EO7A 1Z4XA 4XHBA 1NNAA 2SIMA 1EUUA 4ZY3A 1NMCA 2QWHA 4FVKA 3FW0A 3GVKA 1IVGA 1Z4ZA 4HZXA 1ZI0A 1U6DX 5M1ZA 3UC1A 2XZKA 5B2CA 3NN9A 2FPBA 4M4UA 1K32A 4KS2A 3H72A 1X2RA 4IQKA 4XJQA 4MWYA 2GVXA 4CPOA 2HT5A 5CGJA 1NMBN 3IAXA 4FP2A 1MZ5A 2A75A 3U0SA 3GVJA 4D52C 4YZ2A 5FNRA 4CPLA 3SALA 1WP5A 3HRPA 4GB1A 5D9CA 1B9SA 1B9TA 4NC5A 2OJHA 4GZSA 3S8VA 1S18A 4BBWA 1N1SA 1NPEA 1V04A 4XE9A 1V3EA 2WOZA 4J9TA 2HT7A 5B2DA 1IVCA 4XJ8A 1E8VA 4H52A 1NCDN 2QWDA 2IAVA 3AMSA 1MS9A 4O5TA 4UOUA 2C4LA 5FNSA 1S0JA 3HLIA 3KGGA 2F26A 1NCAN 4FPHA 3GVLA 4ZGCA 4YW2A 3SREA 5GX3A 1C5KA 4GEZA 4D8SA 3A72A 1MWEA 3WDZA 3SRGA 1V2IA 3K37A 2QWEA 3A71A 2IAQA 1W0PA 4FZHA 4QN6A 2QWIA 5FZNA 2BATA 5HUKA 2VK6A 4YZ5A 3CL2A 5F9TA 4FPOB 1E8TA 1Z4VA 2IAWA 3W09A 3ALWA 1MS3A 5HUMA 2FHRA 4HHOA 2F27A 3TIBA 4PWZA 3O9JA 4M4VA 4MJUA 3S2KA 3OPZA 4FPYA 3TC9A 2ISMA 4K3YA 1INHA 1WCQA 7NN9A 4GDIA 3VNGA 2VK5A 4C1YB 2Z32A 4FPFA 4XIOA 3JU4A 1CRUA 5GX5A 4AHAA 4DG6A 1IVFA 1WCSA 1DIMA 2FP9A 4WA4A 1H6LA 3CKZA 2IVZA 4X47A 4FPCA
chains in the Genus database with same CATH topology
1NNBA 4QNPA 4X49A 4QN4A 1A4GA 2YDPA 2W38A 3H71A 2HTYA 3PJQA 1E8UA 4NCSA 1EUTA 2AEPA 2YA6A 1EURA 3O9KA 2VVZA 4YW4A 1NMAN 2C4AA 4WA5A 4HZZA 4XOGA 2QWGA 2HTQA 2VW2A 2HT8A 4MWRA 2SLIA 2ZB5A 4MWXA 4XJZA 1V3BA 1W21A 2VK7A 1INWA 3T1EA 5JYYA 2X9MA 1MZ6A 4XJRA 3CYEA 4CPNA 4MWWA 4X6KA 4K1KA 1A4QA 4XJUA 3B69A 4QN5A 2F25A 4GZXA 4MWLA 3TI3A 1SNTA 2F13A 1L7FA 2QWBA 1W1XA 4MC7A 1INXA 4Q6KA 4FQ4A 1S1DA 4B7JA 4MJVA 4CPZA 1USRA 2F28A 2AGSA 4CPYA 1NCCN 2QWJA 4FPEA 3TI5A 1W20A 1VCJA 4FP3A 1MR5A 4I00A 1BJIA 4CPMA 2HTUA 4GZOA 3H6JA 2ZB6A 4XIKA 1INVA 2F10A 1Z4YA 6NN9A 2F0ZA 2SILA 1V0FA 1DILA 4MX0A 4MZEA 4SLIA 1W8NA 4GZTA 4KS1A 2VWDA 3H73A 1INGA 3TI4A 4MWVA 1XOGA 4QN7A 2AEQA 1NSCA 4YW3A 2YA7A 1N1YA 2VSMA 4K1JA 4XILA 4MWQA 4YZ4A 1B9VA 4MWUA 4XJ9A 4UF7A 5HUNA 2YA5A 1Z4WA 2W5NA 1Z50A 3BEQA 2HTWA 3INBA 2HU4A 2AH2A 4H53A 4WEFA 4QN3A 3K39A 2B8HA 2QWAA 4FOQA 3TI8A 1V3DA 4MZAA 1KITA 4B7MA 1XOEA 2YA4A 2F11A 4YZ1A 1V0EA 4M4NA 1MS4A 4HZVA 4YW5A 1SLIA 4FPLA 4XMAA 1NNCA 4NN9A 4GZQA 3CL0A 4KS4A 4KS3A 1V0ZA 1V3CA 2HU0A 2BZDA 3TI6A 4KS5A 2XZJA 4FOYA 1L7HA 3NSSA 2QWCA 1F8DA 1VCUA 4JF7A 1L7GA 4DGRA 1MS5A 2VSKA 4B7QA 3D12A 3SANA 1W0OA 1NN2A 1N1VA 4HZYA 2BERA 1INFA 4FPJA 1F8EA 2F29A 1SO7A 2BF6A 3D11A 2VW0A 4WEGA 4K1HA 4FJ6A 4B7NA 1INYA 2VW1A 2F12A 4FPGA 2H2UA 1NSDA 2HTVA 2HTRA 1MS1A 5HUGA 1MS0A 2W5OA 1IVEA 1A14N 1F8CA 4WA3A 4XYXA 3K36A 3K3AA 2QWFA 1S0IA 1IVBA 4M3MA 3B7EA 4XMIA 2RKCA 2XCYA 3K38A 4HZWA 2F24A 4FPKA 1F8BA 1N1TA 1MS8A 4MWJA 2YDTA 2QWKA 1NCBN 1W8OA 3TICA 3SILA 4B7RA 3SLIA 4YZ3A 4FOWA 4GDJA 4XJAA 1IVDA 2CMLA 4HIZA 1NSBA 4GZWA 2JKBA 5NN9A 4YW1A 1EUSA 2YA8A 4K1IA 5HX0A 3ALXA 4XJWA 2XZIA 4XHXA 2W20A 4GJTA 4X4AA 2H2NA 4GZPA 1SLLA 3TIAA 1USXA 4FOVA 1Z4XA 4XHBA 1NNAA 2SIMA 1EUUA 1NMCA 2QWHA 5M1ZA 3GVKA 4FVKA 1IVGA 1Z4ZA 4HZXA 2XZKA 5B2CA 3NN9A 4M4UA 4KS2A 3H72A 4XJQA 4MWYA 4CPOA 2HT5A 1NMBN 4FP2A 1MZ5A 2A75A 3GVJA 4YZ2A 4CPLA 3SALA 4GB1A 1B9SA 1B9TA 4NC5A 4GZSA 1S18A 4BBWA 1N1SA 4XE9A 1V3EA 4J9TA 2HT7A 5B2DA 1IVCA 4XJ8A 1E8VA 4H52A 1NCDN 2QWDA 1MS9A 2C4LA 1S0JA 2F26A 1NCAN 4FPHA 3GVLA 4YW2A 4GEZA 4D8SA 3A72A 1MWEA 1V2IA 3K37A 2QWEA 3A71A 1W0PA 4QN6A 4FZHA 2QWIA 2BATA 5HUKA 2VK6A 4YZ5A 3CL2A 5F9TA 4FPOB 1E8TA 1Z4VA 3W09A 3ALWA 1MS3A 5HUMA 2FHRA 3TIBA 2F27A 3O9JA 4M4VA 4MJUA 3OPZA 4FPYA 4K3YA 1INHA 1WCQA 7NN9A 4GDIA 2VK5A 4FPFA 4XIOA 3JU4A 1IVFA 1WCSA 1DIMA 4WA4A 3CKZA 4X47A 4FPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNB A;  4QNP A;  4X49 A;  4QN4 A;  1A4G A;  2YDP A;  2W38 A;  3H71 A;  2HTY A;  3PJQ A;  1E8U A;  4NCS A;  1EUT A;  2AEP A;  2YA6 A;  1EUR A;  3O9K A;  2VVZ A;  4YW4 A;  1NMA N;  2C4A A;  4WA5 A;  4HZZ A;  4XOG A;  2QWG A;  2HTQ A;  2VW2 A;  2HT8 A;  4MWR A;  2SLI A;  2ZB5 A;  4MWX A;  4XJZ A;  1V3B A;  1W21 A;  2VK7 A;  1INW A;  3T1E A;  5JYY A;  2X9M A;  1MZ6 A;  4XJR A;  3CYE A;  4CPN A;  4MWW A;  4X6K A;  4K1K A;  1A4Q A;  4XJU A;  3B69 A;  4QN5 A;  2F25 A;  4GZX A;  4MWL A;  3TI3 A;  1SNT A;  2F13 A;  1L7F A;  2QWB A;  1W1X A;  4MC7 A;  1INX A;  4Q6K A;  4FQ4 A;  4B7J A;  4MJV A;  4CPZ A;  1USR A;  2F28 A;  2AGS A;  4CPY A;  1NCC N;  2QWJ A;  4FPE A;  3TI5 A;  1W20 A;  1VCJ A;  4FP3 A;  1MR5 A;  4I00 A;  1BJI A;  4CPM A;  2HTU A;  4GZO A;  3H6J A;  2ZB6 A;  4XIK A;  1INV A;  2F10 A;  1Z4Y A;  6NN9 A;  2F0Z A;  2SIL A;  1V0F A;  1DIL A;  4MX0 A;  4MZE A;  4SLI A;  1W8N A;  4GZT A;  4KS1 A;  2VWD A;  3H73 A;  1ING A;  3TI4 A;  4MWV A;  1XOG A;  4QN7 A;  2AEQ A;  1NSC A;  4YW3 A;  2YA7 A;  1N1Y A;  2VSM A;  4K1J A;  4XIL A;  4MWQ A;  4YZ4 A;  1B9V A;  4MWU A;  4XJ9 A;  4UF7 A;  5HUN A;  2YA5 A;  1Z4W A;  2W5N A;  1Z50 A;  3BEQ A;  2HTW A;  3INB A;  2HU4 A;  2AH2 A;  4H53 A;  4WEF A;  4QN3 A;  3K39 A;  2B8H A;  2QWA A;  4FOQ A;  3TI8 A;  1V3D A;  4MZA A;  1KIT A;  4B7M A;  1XOE A;  2YA4 A;  2F11 A;  4YZ1 A;  1V0E A;  4M4N A;  1MS4 A;  4HZV A;  4YW5 A;  1SLI A;  4FPL A;  4XMA A;  1NNC A;  4NN9 A;  4GZQ A;  3CL0 A;  4KS4 A;  4KS3 A;  1V0Z A;  1V3C A;  2HU0 A;  2BZD A;  3TI6 A;  4KS5 A;  2XZJ A;  4FOY A;  1L7H A;  3NSS A;  2QWC A;  1F8D A;  1VCU A;  4JF7 A;  1L7G A;  4DGR A;  1MS5 A;  2VSK A;  4B7Q A;  3D12 A;  3SAN A;  1W0O A;  1NN2 A;  1N1V A;  4HZY A;  2BER A;  1INF A;  4FPJ A;  1F8E A;  2F29 A;  1SO7 A;  2BF6 A;  3D11 A;  2VW0 A;  4WEG A;  4K1H A;  4FJ6 A;  4B7N A;  1INY A;  2VW1 A;  2F12 A;  4FPG A;  1NSD A;  2HTV A;  2HTR A;  1MS1 A;  5HUG A;  1MS0 A;  2W5O A;  1IVE A;  1A14 N;  1F8C A;  4WA3 A;  4XYX A;  3K36 A;  3K3A A;  2QWF A;  1S0I A;  1IVB A;  4M3M A;  3B7E A;  4XMI A;  2RKC A;  2XCY A;  3K38 A;  4HZW A;  2F24 A;  4FPK A;  1F8B A;  1N1T A;  1MS8 A;  4MWJ A;  2YDT A;  2QWK A;  1NCB N;  1W8O A;  3TIC A;  3SIL A;  4B7R A;  3SLI A;  4YZ3 A;  4FOW A;  4GDJ A;  4XJA A;  1IVD A;  2CML A;  4HIZ A;  1NSB A;  4GZW A;  2JKB A;  5NN9 A;  4YW1 A;  1EUS A;  2YA8 A;  4K1I A;  5HX0 A;  3ALX A;  4XJW A;  2XZI A;  4XHX A;  2W20 A;  4GJT A;  4X4A A;  4GZP A;  1SLL A;  3TIA A;  1USX A;  4FOV A;  1Z4X A;  4XHB A;  1NNA A;  2SIM A;  1EUU A;  1NMC A;  2QWH A;  5M1Z A;  3GVK A;  4FVK A;  1IVG A;  1Z4Z A;  4HZX A;  2XZK A;  5B2C A;  3NN9 A;  4M4U A;  4KS2 A;  3H72 A;  4XJQ A;  4MWY A;  4CPO A;  2HT5 A;  1NMB N;  4FP2 A;  1MZ5 A;  2A75 A;  3GVJ A;  4YZ2 A;  4CPL A;  3SAL A;  4GB1 A;  1B9S A;  1B9T A;  4NC5 A;  4GZS A;  4BBW A;  1N1S A;  4XE9 A;  1V3E A;  4J9T A;  2HT7 A;  5B2D A;  1IVC A;  4XJ8 A;  1E8V A;  4H52 A;  1NCD N;  2QWD A;  1MS9 A;  2C4L A;  1S0J A;  2F26 A;  1NCA N;  4FPH A;  3GVL A;  4YW2 A;  4GEZ A;  4D8S A;  3A72 A;  1MWE A;  1V2I A;  3K37 A;  2QWE A;  3A71 A;  1W0P A;  4QN6 A;  4FZH A;  2QWI A;  2BAT A;  5HUK A;  2VK6 A;  4YZ5 A;  3CL2 A;  5F9T A;  4FPO B;  1E8T A;  1Z4V A;  3W09 A;  3ALW A;  1MS3 A;  5HUM A;  2FHR A;  3TIB A;  2F27 A;  3O9J A;  4M4V A;  4MJU A;  3OPZ A;  4FPY A;  4K3Y A;  1INH A;  1WCQ A;  7NN9 A;  4GDI A;  2VK5 A;  4FPF A;  4XIO A;  3JU4 A;  1IVF A;  1WCS A;  1DIM A;  4WA4 A;  3CKZ A;  4X47 A;  4FPC A; 
#chains in the Genus database with same CATH topology
 1PJX A;  1NNB A;  4QNP A;  4CSD A;  3BYC A;  4X49 A;  4QN4 A;  1N7D A;  1A4G A;  2YDP A;  2W38 A;  3H71 A;  3WN7 A;  2HTY A;  3PJQ A;  1E8U A;  1N6D A;  4NCS A;  1EUT A;  2AEP A;  2YA6 A;  1EUR A;  3O9K A;  4IYG A;  2VVZ A;  4YW4 A;  1NMA N;  2FLU X;  3ZGC A;  3NO0 A;  2C4A A;  4WA5 A;  4HZZ A;  2IAO A;  4XOG A;  2QWG A;  2HTQ A;  2VW2 A;  2IAT A;  4O5S A;  2HT8 A;  4MWR A;  2SLI A;  2ZB5 A;  4MWX A;  4XJZ A;  3A9H A;  1V3B A;  1W21 A;  2VK7 A;  2POO A;  1INW A;  4L7D A;  3E5Z A;  3LI4 A;  2XN4 A;  3T1E A;  1X2J A;  5JYY A;  2X9M A;  1MZ6 A;  2IAP A;  4XJR A;  3CYE A;  2P4O A;  3Q6T A;  4AGI A;  4CPN A;  5FNQ A;  4MWW A;  3SOB B;  4X6K A;  4K1K A;  1A4Q A;  4XJU A;  3B69 A;  4QN5 A;  2DG0 A;  2F25 A;  4GZX A;  4MWL A;  3TI3 A;  1SNT A;  2F13 A;  5EO8 A;  3SOQ A;  4D52 A;  4G3N A;  1L7F A;  2QWB A;  1W1X A;  1C9U A;  4MC7 A;  1INX A;  1IUC A;  1CVM A;  4FQ4 A;  4Q6K A;  1S1D A;  4B7J A;  4MJV A;  4CPZ A;  1USR A;  1POO A;  2F28 A;  2AGS A;  2FP8 A;  4CPY A;  1NCC N;  2IAX A;  2QWJ A;  4FPE A;  3TI5 A;  3O4P A;  1W20 A;  1VCJ A;  4FP3 A;  2IAR A;  1MR5 A;  4I00 A;  1BJI A;  3DAS A;  4CPM A;  3I1C A;  2HTU A;  4GZO A;  3H6J A;  2ZB6 A;  4XIK A;  1INV A;  2F10 A;  1Z4Y A;  6NN9 A;  2F0Z A;  2SIL A;  1V0F A;  4C1Y A;  1DIL A;  4MX0 A;  4MZE A;  4SLI A;  1W8N A;  5GX1 A;  4GZT A;  4KS1 A;  2VWD A;  3H73 A;  1ING A;  3TI4 A;  2IAU A;  2DSO A;  4IN4 A;  4MWV A;  1XOG A;  4QN7 A;  2VPJ A;  2AEQ A;  1NSC A;  4YW3 A;  2YA7 A;  1N1Y A;  2VSM A;  4K1J A;  4XIL A;  4MWQ A;  4YZ4 A;  1B9V A;  4MWU A;  3Q6P A;  3SOV A;  4XJ9 A;  4ZLR A;  3FVZ A;  4UF7 A;  5HUN A;  2YA5 A;  1RWL A;  2IAS A;  4D52 B;  1Z4W A;  2W5N A;  1Z50 A;  3BEQ A;  3ZGD A;  4HW6 A;  2HTW A;  3DR2 A;  3INB A;  2HU4 A;  3A9G A;  2AH2 A;  4H53 A;  3G4E A;  4WEF A;  4QN3 A;  3K39 A;  2B8H A;  2QWA A;  3V1S A;  4IMB A;  4FOQ A;  1CRZ A;  3G4H A;  2HQS A;  3TI8 A;  1V3D A;  1QLG A;  4IFL X;  4MZA A;  1KIT A;  4B7M A;  1XOE A;  2YA4 A;  2F11 A;  5FNT A;  5D9B A;  4YZ1 A;  1Q7F A;  1V0E A;  4M4N A;  3LI5 A;  1MS4 A;  4HZV A;  1IUB A;  4YW5 A;  1SLI A;  4FPL A;  4HHQ A;  4XMA A;  3L6V A;  1NNC A;  4NN9 A;  4GNC A;  1RWI A;  2QE8 A;  4GZQ A;  3CL0 A;  4KS4 A;  4GNA A;  4KS3 A;  1V0Z A;  3II7 A;  1V3C A;  2HU0 A;  2BZD A;  2W8B A;  4KS5 A;  3TI6 A;  2XZJ A;  4FOY A;  1L7H A;  3V65 B;  3P5B L;  3NSS A;  2QWC A;  1F8D A;  2GVU A;  4IFJ A;  1VCU A;  4JF7 A;  1L7G A;  3S8Z A;  4JML A;  4DGR A;  1MS5 A;  4AGT A;  2VSK A;  4B7Q A;  5GTQ A;  3WWA A;  3D12 A;  3SAN A;  1W0O A;  1NN2 A;  1CQ1 A;  1N1V A;  4GN9 A;  4HZY A;  2BER A;  1INF A;  2ZW9 A;  4FPJ A;  5FZJ A;  1F8E A;  2F29 A;  1SO7 A;  2BF6 A;  2V91 A;  1N6E A;  3D11 A;  3Q6K A;  2VW0 A;  4WEG A;  4K1H A;  4FJ6 A;  4B7N A;  1INY A;  4L7B A;  4XMB A;  3V64 C;  2VW1 A;  2ZWA A;  2F12 A;  4FPG A;  2ZZK A;  1ZGK A;  2H2U A;  4GNB A;  1NSD A;  1OFZ A;  2HTV A;  2VAQ A;  5FNU A;  3VNH A;  5GX2 A;  2HTR A;  3LI3 A;  1MS1 A;  5HUG A;  1MS0 A;  2W5O A;  5D9D A;  1IVE A;  1A14 N;  4YY8 A;  3WW9 A;  1F8C A;  4WA3 A;  4XYX A;  3K36 A;  3K3A A;  2QWF A;  2GVW A;  1S0I A;  4GN7 A;  4N1B A;  4R40 A;  2GVV A;  1IVB A;  4M3M A;  4ASC A;  2W8B B;  3B7E A;  4XMI A;  2RKC A;  1E1A A;  2XCY A;  3K38 A;  4Q1U A;  4HZW A;  3ADE A;  2F24 A;  5F72 C;  2G8S A;  3KYA A;  4FPK A;  1F8B A;  1N1T A;  4CH9 A;  1MS8 A;  5H47 A;  4MWJ A;  2YDT A;  2QWK A;  1NCB N;  1W8O A;  3S94 A;  3TIC A;  3SIL A;  5FWW A;  4D4U A;  4B7R A;  4L7C A;  3SLI A;  4YZ3 A;  2GHS A;  4FOW A;  4GDJ A;  4XJA A;  4A0P A;  1SUU A;  3HLH A;  5GX4 A;  1IVD A;  4CHB A;  2CML A;  3AMR A;  4HIZ A;  1NSB A;  4AH4 A;  4GZW A;  2JKB A;  2FPC A;  4IFN X;  5NN9 A;  1QBI A;  2DYH A;  4YW1 A;  1EUS A;  2YA8 A;  4K1I A;  2DG1 A;  1IJQ A;  1N6F A;  5HX0 A;  3ALX A;  4GN8 A;  4XJW A;  2XZI A;  4XHX A;  2W20 A;  4GJT A;  4X4A A;  2H2N A;  4GZP A;  1SLL A;  5EX7 A;  3TIA A;  1USX A;  4FOV A;  5EO7 A;  1Z4X A;  4XHB A;  1NNA A;  2SIM A;  1EUU A;  4ZY3 A;  1NMC A;  2QWH A;  4FVK A;  3FW0 A;  3GVK A;  1IVG A;  1Z4Z A;  4HZX A;  1ZI0 A;  1U6D X;  5M1Z A;  3UC1 A;  2XZK A;  5B2C A;  3NN9 A;  2FPB A;  4M4U A;  1K32 A;  4KS2 A;  3H72 A;  1X2R A;  4IQK A;  4XJQ A;  4MWY A;  2GVX A;  4CPO A;  2HT5 A;  5CGJ A;  1NMB N;  3IAX A;  4FP2 A;  1MZ5 A;  2A75 A;  3U0S A;  3GVJ A;  4D52 C;  4YZ2 A;  5FNR A;  4CPL A;  3SAL A;  1WP5 A;  3HRP A;  4GB1 A;  5D9C A;  1B9S A;  1B9T A;  4NC5 A;  2OJH A;  4GZS A;  3S8V A;  1S18 A;  4BBW A;  1N1S A;  1NPE A;  1V04 A;  4XE9 A;  1V3E A;  2WOZ A;  4J9T A;  2HT7 A;  5B2D A;  1IVC A;  4XJ8 A;  1E8V A;  4H52 A;  1NCD N;  2QWD A;  2IAV A;  3AMS A;  1MS9 A;  4O5T A;  4UOU A;  2C4L A;  5FNS A;  1S0J A;  3HLI A;  3KGG A;  2F26 A;  1NCA N;  4FPH A;  3GVL A;  4ZGC A;  4YW2 A;  3SRE A;  5GX3 A;  1C5K A;  4GEZ A;  4D8S A;  3A72 A;  1MWE A;  3WDZ A;  3SRG A;  1V2I A;  3K37 A;  2QWE A;  3A71 A;  2IAQ A;  1W0P A;  4FZH A;  4QN6 A;  2QWI A;  5FZN A;  2BAT A;  5HUK A;  2VK6 A;  4YZ5 A;  3CL2 A;  5F9T A;  4FPO B;  1E8T A;  1Z4V A;  2IAW A;  3W09 A;  3ALW A;  1MS3 A;  5HUM A;  2FHR A;  4HHO A;  2F27 A;  3TIB A;  4PWZ A;  3O9J A;  4M4V A;  4MJU A;  3S2K A;  3OPZ A;  4FPY A;  3TC9 A;  2ISM A;  4K3Y A;  1INH A;  1WCQ A;  7NN9 A;  4GDI A;  3VNG A;  2VK5 A;  4C1Y B;  2Z32 A;  4FPF A;  4XIO A;  3JU4 A;  1CRU A;  5GX5 A;  4AHA A;  4DG6 A;  1IVF A;  1WCS A;  1DIM A;  2FP9 A;  4WA4 A;  1H6L A;  3CKZ A;  2IVZ A;  4X47 A;  4FPC A; 
#chains in the Genus database with same CATH homology
 1NNB A;  4QNP A;  4X49 A;  4QN4 A;  1A4G A;  2YDP A;  2W38 A;  3H71 A;  2HTY A;  3PJQ A;  1E8U A;  4NCS A;  1EUT A;  2AEP A;  2YA6 A;  1EUR A;  3O9K A;  2VVZ A;  4YW4 A;  1NMA N;  2C4A A;  4WA5 A;  4HZZ A;  4XOG A;  2QWG A;  2HTQ A;  2VW2 A;  2HT8 A;  4MWR A;  2SLI A;  2ZB5 A;  4MWX A;  4XJZ A;  1V3B A;  1W21 A;  2VK7 A;  1INW A;  3T1E A;  5JYY A;  2X9M A;  1MZ6 A;  4XJR A;  3CYE A;  4CPN A;  4MWW A;  4X6K A;  4K1K A;  1A4Q A;  4XJU A;  3B69 A;  4QN5 A;  2F25 A;  4GZX A;  4MWL A;  3TI3 A;  1SNT A;  2F13 A;  1L7F A;  2QWB A;  1W1X A;  4MC7 A;  1INX A;  4Q6K A;  4FQ4 A;  1S1D A;  4B7J A;  4MJV A;  4CPZ A;  1USR A;  2F28 A;  2AGS A;  4CPY A;  1NCC N;  2QWJ A;  4FPE A;  3TI5 A;  1W20 A;  1VCJ A;  4FP3 A;  1MR5 A;  4I00 A;  1BJI A;  4CPM A;  2HTU A;  4GZO A;  3H6J A;  2ZB6 A;  4XIK A;  1INV A;  2F10 A;  1Z4Y A;  6NN9 A;  2F0Z A;  2SIL A;  1V0F A;  1DIL A;  4MX0 A;  4MZE A;  4SLI A;  1W8N A;  4GZT A;  4KS1 A;  2VWD A;  3H73 A;  1ING A;  3TI4 A;  4MWV A;  1XOG A;  4QN7 A;  2AEQ A;  1NSC A;  4YW3 A;  2YA7 A;  1N1Y A;  2VSM A;  4K1J A;  4XIL A;  4MWQ A;  4YZ4 A;  1B9V A;  4MWU A;  4XJ9 A;  4UF7 A;  5HUN A;  2YA5 A;  1Z4W A;  2W5N A;  1Z50 A;  3BEQ A;  2HTW A;  3INB A;  2HU4 A;  2AH2 A;  4H53 A;  4WEF A;  4QN3 A;  3K39 A;  2B8H A;  2QWA A;  4FOQ A;  3TI8 A;  1V3D A;  4MZA A;  1KIT A;  4B7M A;  1XOE A;  2YA4 A;  2F11 A;  4YZ1 A;  1V0E A;  4M4N A;  1MS4 A;  4HZV A;  4YW5 A;  1SLI A;  4FPL A;  4XMA A;  1NNC A;  4NN9 A;  4GZQ A;  3CL0 A;  4KS4 A;  4KS3 A;  1V0Z A;  1V3C A;  2HU0 A;  2BZD A;  3TI6 A;  4KS5 A;  2XZJ A;  4FOY A;  1L7H A;  3NSS A;  2QWC A;  1F8D A;  1VCU A;  4JF7 A;  1L7G A;  4DGR A;  1MS5 A;  2VSK A;  4B7Q A;  3D12 A;  3SAN A;  1W0O A;  1NN2 A;  1N1V A;  4HZY A;  2BER A;  1INF A;  4FPJ A;  1F8E A;  2F29 A;  1SO7 A;  2BF6 A;  3D11 A;  2VW0 A;  4WEG A;  4K1H A;  4FJ6 A;  4B7N A;  1INY A;  2VW1 A;  2F12 A;  4FPG A;  2H2U A;  1NSD A;  2HTV A;  2HTR A;  1MS1 A;  5HUG A;  1MS0 A;  2W5O A;  1IVE A;  1A14 N;  1F8C A;  4WA3 A;  4XYX A;  3K36 A;  3K3A A;  2QWF A;  1S0I A;  1IVB A;  4M3M A;  3B7E A;  4XMI A;  2RKC A;  2XCY A;  3K38 A;  4HZW A;  2F24 A;  4FPK A;  1F8B A;  1N1T A;  1MS8 A;  4MWJ A;  2YDT A;  2QWK A;  1NCB N;  1W8O A;  3TIC A;  3SIL A;  4B7R A;  3SLI A;  4YZ3 A;  4FOW A;  4GDJ A;  4XJA A;  1IVD A;  2CML A;  4HIZ A;  1NSB A;  4GZW A;  2JKB A;  5NN9 A;  4YW1 A;  1EUS A;  2YA8 A;  4K1I A;  5HX0 A;  3ALX A;  4XJW A;  2XZI A;  4XHX A;  2W20 A;  4GJT A;  4X4A A;  2H2N A;  4GZP A;  1SLL A;  3TIA A;  1USX A;  4FOV A;  1Z4X A;  4XHB A;  1NNA A;  2SIM A;  1EUU A;  1NMC A;  2QWH A;  5M1Z A;  3GVK A;  4FVK A;  1IVG A;  1Z4Z A;  4HZX A;  2XZK A;  5B2C A;  3NN9 A;  4M4U A;  4KS2 A;  3H72 A;  4XJQ A;  4MWY A;  4CPO A;  2HT5 A;  1NMB N;  4FP2 A;  1MZ5 A;  2A75 A;  3GVJ A;  4YZ2 A;  4CPL A;  3SAL A;  4GB1 A;  1B9S A;  1B9T A;  4NC5 A;  4GZS A;  1S18 A;  4BBW A;  1N1S A;  4XE9 A;  1V3E A;  4J9T A;  2HT7 A;  5B2D A;  1IVC A;  4XJ8 A;  1E8V A;  4H52 A;  1NCD N;  2QWD A;  1MS9 A;  2C4L A;  1S0J A;  2F26 A;  1NCA N;  4FPH A;  3GVL A;  4YW2 A;  4GEZ A;  4D8S A;  3A72 A;  1MWE A;  1V2I A;  3K37 A;  2QWE A;  3A71 A;  1W0P A;  4QN6 A;  4FZH A;  2QWI A;  2BAT A;  5HUK A;  2VK6 A;  4YZ5 A;  3CL2 A;  5F9T A;  4FPO B;  1E8T A;  1Z4V A;  3W09 A;  3ALW A;  1MS3 A;  5HUM A;  2FHR A;  3TIB A;  2F27 A;  3O9J A;  4M4V A;  4MJU A;  3OPZ A;  4FPY A;  4K3Y A;  1INH A;  1WCQ A;  7NN9 A;  4GDI A;  2VK5 A;  4FPF A;  4XIO A;  3JU4 A;  1IVF A;  1WCS A;  1DIM A;  4WA4 A;  3CKZ A;  4X47 A;  4FPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...