1EV11

Echovirus 1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
281
structure length
281
Chain Sequence
GDVQNAVEGAMVRVADTVQTSATNSERVPNLTAVETGHTSQAVPGDTMQTRHVINNHVRSESTIENFLARSACVFYLEYKTGTKEDSNSFNNWVITTRRVAQLRRKLEMFTYLRFDMEITVVITSSQDQSTSQNQNAPVLTHQIMYVPPGGPIPVSVDDYSWQTSTNPSIFWTEGNAPARMSIPFISIGNAYSNFYDGWSHFSQAGVYGFTTLNNMGQLFFRHVNKPNPAAITSVARIYFKPKHVRAWVPRPPRLCPYINSTNVNFEPKPVTEVRTNIITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECHOVIRUS 1
publication title Structure determination of echovirus 1.
pubmed doi rcsb
molecule tags Virus
total genus 51
structure length 281
sequence length 281
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ev1100
1RUF2 3VBSA 3VBUB 1TME1 4JGZC 1PVC3 3JBG2 5BNNC 1AUYA 1HXS2 4CDXC 1EV11 2FZ1A 1VBA2 2XBO2 1V9U2 5JZGB 3DPRC 2R042 2HWF1 1OPOA 1VB4A 1ZBA2 1R091 4FTEA 1QJY1 4WM7A 2HWC1 1AR63 4RHV3 4Q4Y2 5BNOB 3VBFA 1AYM3 4YVSA 1Z7S1 1BEV2 4N53B 1RUJ1 4IV3C 3VBRA 1TMF3 1RUI3 3NAPC 4IV1A 4Q4X3 5A32B 1FPN1 4WM8A 1QQP1 5C4WC 1B35A 2HWB2 5D8AB 1PGL1 4QPIB 1NCQB 2WFF2 1DDLA 5ABJB 3CJIC 4CEWB 2RMU2 5ACA1 4FSJA 2WZR3 1QJU1 1RUH3 1RUG1 4RQPA 1HRI3 1PO12 4RS5C 1MQTA 1R083 1C8M2 1RUJ3 3JBG1 3IDEA 1HXS1 1ASJ2 5BNNB 1VBA1 2XBO1 1V9U1 4CEYC 1FPN3 2X5IC 3ZFGC 1QQP3 4QPGC 5C8CC 1AR62 2R041 4RHV2 1CD3G 1EAH1 1RMU1 2R073 4PDWB 4YVWA 1OOPA 5LK7B 1AYM2 1AL0G 3VBUC 1QJU3 1BBT3 1HQNA 4EJRA 2RS31 5JZGC 4Q4X2 3VBHA 4Z92B 2RM21 1ND3A 1RUF3 5J96B 1AYN2 1VRH3 2WZR2 1RUH2 4GB33 1HXS3 1NY72 4IV3B 2VQ0A 1VBA3 5K0UB 3NAPB 2HWB1 3VBFC 5BNOC 1RB8G 5C4WB 1AR83 1ZBA3 3CJIB 4N53C 1RUE2 3VBOA 1R082 4IV1C 1PVC1 1VBB3 5BNPB 1PO11 4WM8C 1B35C 4CDQB 5D8AC 4GH4B 4RS5B 4QPIC 1NOVA 1NCQC 4Q4Y3 1VBD3 1MEC3 4CEWC 2WS92 1BEV3 1POV0 2HWE2 1ASJ1 5C9AB 1BBT2 1NA1B 1VAKA 1X36A 1AR61 2WFF3 3VDDB 4N43A 4RHV1 4QPGB 2RMU3 1AYM1 2BFUS 2R063 3VBSB 4Q4W2 4RFT0 4NWWA 1VRH2 1TMF1 1PO13 1ZBE2 4GB32 1RUI1 4AEDA 4Q4X1 1ND2A 1RVF3 1OOPC 4PDWC 2RS52 5CFDA 3TN92 1C8M3 1AR82 3LOBA 2WZR1 2PLV3 1RUH1 1ASJ3 1NY71 2DF7A 4Q4V3 1VBB2 1HRI1 4WM7B 4CDWA 2BPA2 3VBFB 1W39A 1VBD2 1MEC2 1FOD2 4YVSB 5AC93 2WWSA 3J8F2 1R081 3VBRB 1VB2A 5K0UC 5CFCA 4IV1B 4RR3A 4WM8B 1B35B 2ZZQA 4SBVA 4Y5Z0 1RUD2 3VBOC 2R071 1AYN3 3JD73 2R062 1D4M2 5BNPC 4RQPB 1BBT1 1WCDJ 4CDQC 4GH4C 5FOJB 3JB4C 1F8VA 1RVF2 1MQTB 1RUE3 1RUF1 2BFUL 1RHI2 2MEV3 4Q4W1 1POV3 5C9AC 1VRH1 2PLV2 2IZWA 4GB31 5L7OA 1NA1C 4N43C 4Q4V2 5GKAC 3VDDC 1PO22 2RS51 5FMOS 2WS93 4YVWB 1OOPB 3VBSC 5AC92 1AR81 3ZFEA 1ZBA1 5DDJ2 3ZFFA 4BCUA 2HWE3 5A33A 1RUC3 1CJDA 1NCRA 1VBB1 3VBHB 4Q4Y1 1C8NA 1VBD1 1MEC1 1FOD1 1ND3B 4JGZA 4Q4W3 1BEV1 1K5MA 3JD72 4CDXA 1AL23 1ZBE3 4WM7C 1A6CA 1H8TA 3DPRA 1AR73 2RS53 3TN93 2WFF1 4YVSC 2RMU1 1M06G 3VBOB 2R061 3VBRC 2MEV2 4RR3C 1QJX3 1VBC2 2HWF2 1RVF1 1FOD3 1OHFA 3J8F3 1C8M1 1QJY2 4RQPC 2PLV1 1RUC2 2FZ2A 1IHMA 1VBE3 4Q4V1 1BMV2 4N43B 2RR12 1RUD3 5FMOL 1MQTC 1AR93 5AC91 1FMD3 1SMVA 1D4M3 5L7OC 4CDUA 1AL22 1PGL2 4AEDB 1COV2 2GSYA 4Y4YA 1ND2B 4JGYA 1PGW2 1PIV3 1AR72 4YVWC 5CFDB 2BBVA 3ZFEC 3ZFFC 1RHI3 1RUG2 1AYN1 3JD71 2XPJA 4CEYA 3ZFGA 2X5IA 5C8CA 4CDWB 1QJX2 4FTSA 3VBHC 1PO23 3ZXAC 1ND3C 3VBUA 4FTBA 1K5MC 5DDJ3 1RUE1 2MEV1 1H8TC 1POV1 5JZGA 5CFCB 1VBC1 1RMU2 1EAH2 4RR3B 1VBE2 2HWD2 2WS91 1AR92 2QQPA 2RS32 1R1A3 1FMD2 2HWE1 2RS13 1RUC1 5BNOA 2RM22 1BMV1 2RR11 1PIV2 1TME3 4N53A 2ZTNA 4GMP0 1EV13 3S6PA 1HRV2 5A32A 1AL21 5L7OB 5D8AA 1ZBE1 1COV1 2Y26A 1VBC3 1NCQA 4QPIA 2HWF3 2TBVA 5ABJA 1PGW1 4CEWA 1AR71 2WLPA 3TN91 1R093 3ZFEB 1PVC2 3ZFFB 5A33B 1QJY3 4CDUC 2HWC3 4AEDC 1NCRB 1QJX1 4JGYC 1ND2C 2BUKA 2RR13 1Z7S3 5CFDC 4JGZB 3J8F1 1K5MB 4CDXB 5BNNA 1R1A2 3HAGA 1H8TB 1COV3 4CDWC 2RS12 3DPRB 4PDWA 1VBE1 4NWVA 5ACA3 2HWD1 1F2NA 1RUD1 1AR91 1TME2 1RUG3 1TMF2 1FMD1 1RUI2 4GMP1 1D4M1 1EV12 5CFCC 3M8LA 1PIV1 3JBG3 1R092 1RHI1 2XBO3 1V9U3 3JB8A 4IV3A 1HRI2 1HRV1 1QJZA 5K0UA 3NAPA 5J98B 2HWC2 1NG0A 2R043 1X33A 1RMU3 1EAH3 5C4WA 2HWD3 1PO21 3CJIA 1Z7S2 1RUJ2 2RS33 2GH8A 5BNPA 5DDJ1 3FBMA 4GMP3 4CDQA 4CDUB 4GH4A 1FPN2 4RS5A 1QQP2 5ABJC 4LLFA 1HX6A 2RM23 2R072 4JGYB 5ACA2 1QJU2 5C9AA 1R1A1 1GFF2 1HRV3 1NA1A 2HWB3 1NCRC 4CEYB 3ZFGB 2X5IB 1E57A 2RS11 5C8CB 3VDDA 4QPGA 2ZAHA
chains in the Genus database with same CATH superfamily
2YDEA 2VNGA 4QX2A 1AHSA 1PVXA 3ETPA 3I3BA 2VW2A 3VBSA 2J1RA 4LBQB 3AZVA 4CP9B 4EN0A 2OYZA 4F83A 3VBUB 1LHWA 5JCTA 1JZ3A 3DV8A 1PVC3 3JBG2 5BNNC 1UXXX 4MGKE 4XUQA 3PMSA 2E51A 4B29A 1VBA2 5AFEA 3OEBA 5FY9A 2JG8C 3WOGA 3VD9A 1GQPA 3DPRC 3U0ZA 2QNKA 3ZMOA 2BYVE 1W6MB 3WG1A 3KM5A 3A22A 4Q4Y3 3IPVB 4K3UA 4RYDA 3JCIA 4BA6A 1FT9A 1D0GA 2DVDA 4FTEA 1ULCA 1XNDA 1OA3A 3PJYA 3ZYBA 5HXMA 2HWC1 4OFGA 2WZ8A 1Q8QA 1NUKA 4META 4HONA 1LCLA 2O14A 1ZX5A 2DTYA 2WSVA 4FQ4A 2RVAA 1VAVA 2PHLA 1Z7S1 1LGBA 2VUJA 2H0BA 5KBFA 1J58A 3WDYA 4CUAA 4IV3C 1OKQA 1L7LA 2NQYA 3VBRA 3L2HA 3KCXA 1J83A 4H55A 4XQWA 2NLRA 2WO3A 4LO6B 3NWKA 1E5RA 1ZREA 1FPN1 4WM8A 1JI6A 5C4WC 2WQ8A 2HWB2 4UXAA 5FZEA 4QPIB 1R1ZA 1NCQB 2JDMA 2WFF2 3VZJA 5A6YA 4OQ8A 3ZSJA 2YGLA 1YFUA 2JEMA 2ZGOA 2ZGMA 5ACA1 1JMUB 4AVVA 2WZR3 1RUH3 4M3CB 3UGHA 5A3UA 2IXJA 3HBZA 1NE6A 4IGPA 2Q8CA 1W8UA 3UKTA 3ACIA 5FPBA 4XF1A 4NR1A 1VLNA 2E26A 5DAVA 4D7YA 1CAVB 4XF3A 1DQ0A 3ST7A 3UNPA 2P4EA 2P3KA 2ETEA 3NMBA 2A3XA 4H7LA 1HW5A 4XF4A 1RUJ3 5LEJA 1WW5A 1W3XA 2PTMA 4BDVB 4BWOA 3O1OA 1ASJ2 1HXS1 3VHPA 4D94A 3A4UA 3T30A 3WHTA 2MNGA 3T08A 1V9U1 3LIGA 3ZSEA 2X5IC 1QQP3 4QPGC 5T50A 4QT6A 3INAA 3IDAA 3O1SA 1CD3G 2OQ7A 4KWLA 1EY2A 4MHRA 2OKXA 4QHBA 5FZ0A 3H3LA 5JSRA 1AYM2 4HMZA 5LK7B 2QBXA 2C26A 2X10A 1QJU3 2Y60A 3QH7A 1OMIA 1GV9A 1X7NA 4UBHA 3VBUC 5A6XA 2A6WA 4EJRA 4QXBA 1DQ1A 2FQPA 3TNQA 4XACA 2GZWA 2JENA 1AZDA 2ZX2A 4LO4B 4W50A 4Q4X2 1W8HA 1SLAA 3EBRA 2WDBA 4JX0A 3H0OA 5EFUA 3R05A 1O4YA 1SFNA 4XFAA 4BOWA 2PQQA 2AACA 5J96B 2XLGA 3GXUA 4AHZA 2Z79A 4YRDA 1X8EA 3NSTA 1JYCA 4FP2A 1DZQA 4NE9A 4C90A 4OUSA 1WMFA 3LOIA 3MW3A 1YI7A 2DTWA 4GJYA 1J3QA 1QOOA 1VP6A 4HSJA 5JDBA 1CAWB 4MYEA 3P1IA 1XRUA 1DFQA 5FK7A 2OT7A 1RUE2 3VBOA 2WABA 4ZS2A 1BK1A 5K7PA 2P5BA 3FUOA 2E7AA 3OPWA 1PVC1 4XOGA 4AEKA 4BB3A 4BM8A 3E5XA 1NLRA 2XVLA 3OPTA 4LEJA 1UNBA 4QPIC 1NCQC 4OI1A 2W94A 4Z07A 3WHUA 4LHKA 4W65A 3ZYIB 2BDRA 3ZR5A 4OYUA 2C5DA 4R9BA 5CZKA 3PURA 2HWE2 2Y8KA 3WF4A 5C9AB 4Y5SA 1BBT2 2Q1MA 5AVAA 4DPNA 1NA1B 4QDQA 1H6XA 2Y64A 3MFAA 4YGEA 1X36A 1BHGA 2P17A 3LKJA 5DQ0A 3U75A 1WA6X 2VR4A 4FBFA 4NVPA 1LULA 2RMU3 2BFUS 5EP9A 4CSWA 1PZ8A 2VOXA 4Q4W2 1O5UA 4NWWA 5HBAA 2QQIA 1WWYA 3O7OA 1QOSA 2BV4A 1ZBE2 5FY1A 5FYCA 5CKMA 2RV9A 1WLWA 3DYPA 3I2IA 4JC1A 4TN7A 4IEZA 3SISA 1OOPC 3RJRA 5FXWA 1Q3EA 4QGMA 3D5OA 3LEGA 4AQ6A 1JZ7A 1C8M3 2BERA 3HT1A 2XKOA 3IBMA 4U2AA 2VNRA 1GANA 1UY2A 1RUH1 2WZR1 1NLSA 3IKWA 2G9FA 4IW3A 2FMDA 4NPRA 4Q4V3 3QD6A 1YFYA 1LEMA 3BGAA 2WO7A 3SITA 2BPA2 3VBFB 4TLGA 5AC93 1VBD2 4IERA 1FOD2 2D40A 3IAPA 1JOPA 1PZ7A 3PIJA 1XC6A 3DYOA 1JZ5A 2PAMA 4D7SA 4N7IA 1VJ2A 2E31A 5CFCA 2QQUA 3LDBA 4IV1B 1K5JA 3PHMA 4PF5A 4QXCA 3P6BA 1X50A 2CAVA 5FYTA 1B35B 1JHJA 4O65A 2ZZQA 3KV9A 4Q29A 4DNYA 3PTRB 5JSPA 3B94A 4DY5A 4HXCA 5DUWA 4PLNA 1AYN3 4DXTA 2D98A 4Y20A 2ZOEB 2Z42A 5FLJA 1N3PA 1SLLA 2VE1A 4Q2FA 4RQPB 4XAEA 1DIWA 3A21A 5CISA 3BN6A 4JV4A 1LNSA 5T54A 1W6NB 1C4RA 3JB4C 1GOFA 1TQ5A 5H9RA 4DUWA 3BTZA 1Q8PA 1VAMA 2VVFA 3AP9A 4GA9A 2JB4A 1XNAA 3PU8A 1SLCA 5C9AC 5LBEA 2PLV2 4QWNA 1W6OB 2IZWA 3FMGA 1I3HA 1NA1C 4QDSA 4QB6A 5I8SA 2YC2A 4BPZA 1OBNA 4XURA 5I91A 1HIXA 1RXFA 1QXJA 4GWNA 3ZYPA 1IS4A 5FMOS 1IPKA 3CJXA 2YU2A 1O8SA 1WW7A 1SCSA 3KF3A 5JMCA 5FOBB 2YG0A 4QHOA 4NROA 1VRBA 1UZZA 3ZFEA 4XHXA 2A3YA 4DRVA 3ZN6B 3HQUA 5H9SA 1S1AA 1NZCA 3N35A 2ZZJA 1CJDA 5F5QA 1XBFA 2R6QA 3MV11 3VKMA 3IZOA 1S0CA 3E6BA 1D7PM 1NCRA 4R4ZA 5FPXA 3HT2A 1LRHA 2VW0A 4Y24A 3M3EA 3HD8B 1ZA4A 2RG4A 1IKPA 3VBHB 4D0QA 5I8TA 1QJFA 3WV6A 4CXYA 2XJTA 4FCAA 4AFCA 2VQAA 2WINB 3M7AA 1X9TA 1LODA 1O4TA 3JD72 1AL23 4Q0VA 2Y0OA 3K4AA 4AG4A 3N9QA 2VZTA 1WKYA 5GZCA 4ZY9A 1LEDA 3K48A 2WT1A 4IEQA 3DEMA 3WEZA 1Q8VA 1OUXA 4CE8A 1ULEA 5FYSA 3PU3A 4B1LA 4HG6B 1PMJX 2EXIA 2RMU1 4MV2A 4YZ3A 5C3SA 2WQZC 1UYPA 3M3QA 2DFBA 4FOQA 3QBQA 3ZXFA 5FP9A 5FY0A 1RUOA 1OT5A 3OGJA 1WCKA 3WF2A 2YROA 3D4KA 3MBWA 3EMRA 4IE0A 2W3JA 3AMHA 2R16A 1DGRN 2WSUA 4A2UA 5FXVA 3MV01 2WAAA 2O8QA 1A8MA 4N7UA 3ITQA 3ZIXA 1GBGA 4AVCA 4NIGA 1C8M1 3POSA 4DXRA 1W9TA 5HPOA 3MO4A 4RQPC 1R64A 4P14A 1RUC2 3OCPA 4X6QB 5E89A 2RJKA 2FZ2A 1AXYA 4KI5M 2CGPA 1IHMA 2G9ZA 4Q4V1 2ZBJA 3FL7A 4N8MA 4D6QA 1BMV2 3O12A 4N43B 2QQJA 4XZUG 1ULDA 5AC91 3ZXKA 2Q30A 3WW1A 1KDKA 1OFSA 2XUEA 3NNFA 1GP6A 3LSDA 2B8MA 4Q1PA 4Q5OA 2KD7A 5A3OA 4DEQA 3N4MA 3BTAA 3KT1A 2VCAA 2WYSA 3Q8AA 5EJZB 4JGYA 1PIV3 1I9RA 5JOXA 1UKRA 3WINE 2CL2A 2VNVA 1LOFC 1F4AA 3ZFFC 5KHJA 3MFCA 2AYHA 1ZVFA 3H1MA 1MS1A 1AYN1 4CCMA 1H2LA 1QU0A 4OI0A 3QOPA 2JG9B 3JUUA 3LDKA 4XUTA 5H9PA 4CEYA 3ZFGA 1AX1A 5C8CA 4HL0A 3Q9OA 3LA2A 4XJZA 3I2DA 3VBHC 4AVAA 1ZNPA 2QKDA 5F5AA 1RJ8A 1FV3A 1L7RA 4O9GA 1CZVA 1MS4A 1MZ5A 4P02B 5TSWA 1QGLA 2W1UA 2ZHMA 1L7QA 4KGGA 5F2SA 1H8TC 3EYPA 5IVEA 3J7HA 2Y6HA 4YM1A 1IKQA 4WVMA 3H8OA 2Q1FA 4GXLA 1DQ6A 3HNMA 4NPLA 2NMNA 3OYWB 2B7YA 3O1UA 2ZX4A 4F3JA 1GZWB 3KCYA 1W99A 3GCWA 4B3NA 3IM0A 4BQ4A 1Q8SA 2WZPP 5IK8A 1BVP1 4AI8A 2XQRA 2EF6A 3U37A 1W03A 2IVIB 1XNBA 2Z2SB 4LBKA 1AXKA 4HSLA 2I2SA 2CGNA 5DG2A 5DG1A 1KQRA 1MZ6A 1QY4A 4ISQA 4Q8KA 1TVGA 1LHVA 1LOAA 2H6BA 3BU7A 4NJ4A 1EV13 2BVBA 1JYNA 2A70A 2ENRA 2FDGA 4A7ZA 1JHNA 1W0NA 4I0BA 1AL21 2VH9A 2WNVA 3TRSB 2E7TA 5L7OB 2ADEA 2JDYA 2Y26A 4XJUA 1BJQA 3AZYA 3WNLA 2ZGTA 5BXXA 2TBVA 1XB9A 3KV4A 3U78A 1PK6A 4HK9A 2JDZA 4B8EA 1R093 2VUAA 2B46X 4WZCA 1PVC2 1LGNA 1LKNA 1QJY3 1UO9A 5A33B 1GYKA 3S7IA 1H9WA 4X6RB 4I2OA 1CQ9A 3RYPA 4FFGA 5FBJA 4AQTA 2BUKA 5T5PA 3VKLA 2RR13 3H50A 5HCAA 3T3YA 3O0WA 5A1AA 4OHYA 4DY3A 2ZX1A 3U10A 3PIGA 1UIJA 2OIIA 3MIFA 2VZQA 3C7OA 3AFGA 2YBSA 5IHRA 5J3UA 2JG9C 2CSGA 2K2SA 2XJVA 4FPLA 5J7MA 3HAGA 1COV3 2RS12 1W8TA 2FDJA 2K0GA 1W2OA 5FR3A 2QFEA 2HWD1 3FLTA 3H1WA 4QQPA 4IQPA 3AJYA 1F2NA 4FAHA 4C0HA 4K40A 1H9PA 4PIYA 4CTEA 5DZFA 3W9AA 4HN1A 4QKFA 3ZSMA 1PHMA 5FV3A 1OD5A 1TNRA 5JXIA 1V6KA 1G9AA 5EZWA 4MGIE 2W92A 5A1FA 2W08A 2GU9A 1CAXB 3M8LA 1YIFA 2A5ZA 4INDA 5EQUA 3EQEA 1XPWA 4EV0A 5HV0A 2QQKA 1PIV1 2WZEA 2XG3A 4WVVA 2ORXA 5JIAA 1NX9A 3V0BB 3EXUA 2X29A 2UURA 3PVNA 4AVTA 4CRQA 3JB8A 1HRV1 3WQ7A 1QJZA 5KR7A 3AP4A 2D44A 2CV6A 5I8YA 1NG0A 1WD3A 2ZAAA 4IEVA 4OCTA 3AVRA 4JZRA 1RMU3 1QDOA 4AGVA 4XVHA 3USUB 2ZEWA 2BEOA 4NHKA 2JIJA 1EP0A 1V6NA 3GJBA 1RUJ2 3AJZA 4K7JA 4UAPA 4XDPA 5F3EA 3THTA 2GNDA 1ULGA 2RS33 3ZYGA 2WJSA 4GMP3 4A42A 3AKTA 3R6SA 4GH4A 5FPUA 3NNGA 4RS5A 1N47A 1QQP2 3I8TA 1GKBA 4CXXA 2V4VA 4BLJA 2WNUA 5FZOA 1HQLA 1PX4A 5FZ4A 5FKBA 5FY8A 5J09A 1QJU2 5FY7A 2XUMA 5F5CA 3O0XA 3AB0A 2D7FA 1MS8A 1C1LA 2CGOA 1H1MA 3HN1A 2Y6FA 1OQEA 1WA4A 2G9GA 5EYXA 4QXHA 3ACLA 4QQOA 1QXPA 2WA3A 3U1XA 3VDDA 3MW2A 3E97A 2DUPA 2W87A 1NE4A 3RZZA 5IVCA 1OH4A 1V6LA 3VL9A 4Q1RA 4XFIA 4D6SA 1OPMA 1DLCA 2HBUA 1AUYA 1UIKA 3SH3A 2RDSA 4FPYA 1EV11 4G3YC 1Z78A 2XBO2 1JYXA 5JZGB 3BIEA 2FDFA 3I59A 5DN2A 4YW1A 3AKRA 1QKQA 4IGOA 4YG6A 5D21A 4KGQA 3OY8A 2R042 5I0TA 3ZYFA 1U5ZA 5E16A 1OPOA 4AHXA 1DBNA 5EPAA 3RS6A 4W6WA 1UYXA 4KWJA 3RG0A 5BNQA 3G7DA 1K12A 1R091 1CESA 1JOBA 3FWEA 1IS3A 4LE3A 5FO8B 3FLPA 1QH7A 1OKOA 2D6MA 1QJY1 2IXIA 3AKPA 1AR63 3LZZA 4LKSA 1GUIA 3C3VA 5BNOB 4CUCA 4QKDA 1X82A 1BQPA 3IDBB 3HWJA 4FPOB 1JZ2A 5DXDA 4YM0A 3E6DA 2ZGLA 5HCFA 1MZFA 4IE6A 1LJ7A 2W9XA 1RUI3 1V00A 3NAPC 4OI4A 5LZ6A 4CPBD 1XYNA 3UJQA 1C5HA 4MXWB 2VULA 2WT0A 5CKNA 1Y7BA 5T5JA 5D8AB 2DDUA 1PGL1 1JODA 2QQVA 3DYMA 3LQCA 4HZFA 5ABJB 1FAYA 3CJIC 4HFSA 5CU1A 4LBJA 5F3GA 4CEWB 1W2UA 2GC0A 4OULA 4AI1A 2RMU2 1HDKA 4CPBA 2JDKA 2XLAA 4FSJA 1OVSA 4DQAA 1E5HA 4LORA 1GZ9A 5FXZA 1U12A 2OUHA 3N36A 4QU2A 5CEHA 1SEFA 2ZEZA 4LIVA 3AYCA 3LEMA 2YMZA 1HB4A 3ACHA 3TEWA 3T2OA 4O61A 3FBYA 1MQTA 1F5FA 5EV7A 1R083 1C8M2 5FYYA 3VKFC 4NIDA 2VBBA 2WL1A 2E63A 2QVSB 5JIUA 3WT3A 1V6IA 1F31A 4AQSA 4S2DA 2GN3A 2LTNA 3CL1A 3HOBA 5BNNB 3KHCA 1FPN3 3BODA 2GC3A 4KU7A 4XXPA 2JG8B 4RHV2 4FI9A 4FPFA 1RMU1 1Q8OA 3S0MA 1RITA 3AKQA 2NM1A 2DVBA 3AX4A 4YVWA 4YARA 4HVQA 2A73B 1DGRA 4TXWA 4KNCA 2I45A 5G04L 2PN5A 1HQNA 3ENRA 2RS31 1KGYA 3BOPA 2EAAA 5JZGC 5IFTA 1YQ8A 5T5OA 3JQXA 4Y1UA 1WW6A 5FZ9A 5T52A 1HLCA 3WW4A 4CCCA 4Z92B 2IXHA 3H3ZA 1L3JA 1RUF3 5EHDA 5JPMB 4IE4A 1E5IA 2R30A 1TG7A 1WCQA 3GBFA 1AYN2 2OA2A 4XAAA 4ZU4A 3HQXA 5FCCA 5A7NA 4BE3A 2JWPA 4GB33 5A7WB 2PA7A 1GZTA 1HXS3 1CZTA 2AEYA 2ZX3A 3I3QA 3LCPA 4IV3B 3ZX7A 5K0UB 4DEVA 3MDPA 3PDQA 3Q8CA 5KXDA 4M4RA 4N9HA 5F32A 4XW3A 1UX6A 5BNOC 1RB8G 3CZUA 2JDPA 2PHDA 2XDVA 1S2EA 2X05A 5A1LA 5C4WB 1QXRA 1ZBA3 1GQGA 3RQ0A 1HV1A 2CDOA 2EICA 2CHHA 3FZ3A 3D6EA 3ZN5A 3RZKA 1UOBA 3MLJA 1YJLA 1VBB3 4P08A 4XFCA 1PO11 4WM8C 2UY8A 2DURA 5D8AC 1S0EA 1NOVA 3POWA 3BIWE 1O3QA 3ZPOA 5LY1A 3RZLA 4CEWC 2O0OA 2JX9A 2R49A 2KR2A 2ET1A 1W05A 5SV8A 3WUCA 4NHMA 4AI3A 3QH6A 4WZFA 3V56A 5T55A 2VTXA 2WQ4A 1W90A 5FIXA 4YW2A 3S30A 3N9PA 1AR61 1DLLA 2WNOA 5FXXA 2V4AA 4QPGB 4KG8A 2W47A 3PUAA 2VMDA 2WO1A 2XJSA 3NKTA 4P9LA 1T6GC 4FAGA 1IQAA 2DCTA 1GNYA 2DV9A 2A6ZA 2OUJA 3F95A 3LA3A 3ZOIA 1ZZ6A 1VRH2 4EROA 4A44A 1RUI1 1PMIA 4COVA 3WCRA 2JKXA 2RDRA 1ND2A 1A3KA 1GOHA 2UY9A 3AM2A 2K9ZA 3KWVA 4L9BA 4NN0A 1C3HA 5F2WA 5CFDA 3RFRA 4BMBA 1AR82 4UBGA 3LOBA 3V65A 2VZ1A 5I0UA 5GZEA 2Q4SA 1NY71 1LAJA 1UY0A 1U5IA 2DF7A 4WM7B 4XQ4A 4CDWA 4P9YA 4E4SA 3K3NA 4QM9A 1WBLA 2XWBB 2ID4A 1CVNA 1CX4A 1DCSA 1I5ZA 1US2A 1W39A 1MEC2 4FFHA 2J22A 1YFWA 1CR7A 1V6OA 2AREA 3POGA 4YVSB 3C7EA 4YYOA 3T09A 4BIOA 3OB8A 5C8WA 5A3WA 1R081 2TUNA 1J84A 2WUHA 4XHBA 3EB7A 5K0UC 3I2KA 3TEXA 2HYXA 1ZRIA 2YYOA 4RR3A 2VQUA 3POFA 4LBLA 3ON7A 4K20A 4YZ5A 3MI8A 5FBZA 4CP0A 5BPXA 2ZEYA 5CADA 4Y5Z0 4LK7A 1H0BA 5KHGA 3VBOC 4MHUA 2ZPXA 1G6NA 4XFBA 3OEAA 4AGRA 4YM2A 3MICA 1W9FA 2YC0A 2R062 5J36A 4FPJA 1O3SA 1F15A 4URTA 1RC6A 4QU1A 2GC2A 2VCCA 1WCDJ 4R9DA 4KU8A 4BZ4A 5FQ0B 4OUEA 1ZRCA 1YQ2A 1V70A 3GALA 2WBKA 3URFA 5C71A 1RVF2 1RUF1 5IK5A 1DF0A 1JS9A 1UMIA 2MEV3 2QUOA 1POV3 4CCJA 2WN3A 4LLOA 5ANQA 2GP3A 2XXZA 4JDMA 4GB31 3WDUA 1PX3A 4HVOA 5JXHA 3AYEA 3UT0A 5CBLA 1A34A 2RS51 3EO6A 4X8NA 2A7AA 2VM9A 4JHTA 3POEA 1OOPB 3PL0A 4XBLA 2CNAA 4ATEA 4ZXEA 1ZBA1 3NV2A 3MPPG 3K51A 1IG3A 2JD4A 1JUHA 3PUHA 3O14A 1VBB1 3C2UA 4YPJA 2W95A 4UW4A 3KCCA 1G9FA 4LK6A 1ND3B 3ATGA 3KVBA 3RYRA 1RIRA 2W46A 4GZ9A 5FO7B 2MPFA 3MIDA 4TSVA 5GLZA 4CU7A 5HCHA 1K5MA 5J1XA 4OLLA 2XGXA 1SHWB 3MW4A 1OA2A 2D3RA 4WM7C 4RL7A 2JKBA 4HPKB 4P9WA 1MS5A 3DPRA 3VDCA 4YNIA 4XFGA 5JXGA 1AR73 5EJ1B 3NQHA 1IGOA 3WVJA 4YVSC 2YPJA 1OVPA 3ORJA 1LR5A 2OZJA 1M06G 4IEXA 5LA9A 2VJXA 1F9KA 1OF3A 1QJX3 1JTZX 3N7LA 3IMMA 1O59A 1IQDC 4RGKA 4YGDA 1JYIA 4XXAA 4KBBA 4F8AA 1PZ9A 4DUXA 4LKDA 4UF0A 1YC61 3E1F1 1O7FA 5F6LB 4FPGA 4PJYA 2UWBA 4FO9A 4ZPIA 3J8F3 4PT6A 3S5QA 1KJRA 1DYKA 1ENRA 2BQPA 5A7OA 2P6HA 3KMHA 1AF9A 1MS9A 1QJY2 4Z1VA 2YU1A 1SFYA 1F35A 3CZJA 3T0AA 1QIQA 1BLZA 2JICA 5HV4A 2ATFA 2J42A 2VZSA 3L9JT 4LBNA 4XZPA 5FREA 2NZ9A 2XJUA 1JW6A 4Y3OA 4YG3A 4YW3A 3WNXA 2RR12 3ES1A 3KQ4B 5JSOA 4L8QA 5FZKA 1AR93 1AVBA 4CP2A 1RUNA 2BTVC 1G8WA 1W6QA 4XPVA 4XQDA 4E8DA 3O1MA 2GH2A 4AI2A 4DINB 1SMVA 1KD7A 4EN8B 4R9AA 4CDUA 2Q5TA 2CU5A 3I2FA 5FYZA 1PGL2 3ETQA 4K1ZA 4XCBA 1COV2 3SCHA 4AEDB 2VOVA 2GSYA 3DKWA 4Y4YA 5T5LA 1W04A 3NVCA 4AR2A 1PGW2 1GQHA 5IYYA 1IG0A 3ZFEC 1W8FA 2VAUA 2C1FA 3GZAA 4GALA 5I0SA 1RHI3 3RVHA 1JYTA 4LBQD 2TNFA 3P3PA 5G05L 1LOCA 2XPJA 2X5IA 1ZA7A 5FMDA 2PHXA 5FDBA 2EIBA 1PO23 4Q27A 2D6OX 3ZKUA 4ZZ5A 1APNA 2ZGUA 4CP9A 1ND3C 3NV1A 4LBQA 4D69A 3VBUA 5GJ6A 4FTBA 4W6XA 4XC9A 5DDJ3 1OLMA 1DG6A 4EWAA 3T2TA 2MEV1 4ISRA 1BCXA 1POV1 3ZYJB 2OW4A 2ARXA 1S2KA 2BNNA 4KH9A 1N1YA 4Y1ZA 1C5IA 2XR4A 4RFRB 3X29B 1VBC1 3WNOA 1RMU2 1B09A 4BK4A 2EIDA 4JKMA 3QACA 1W6MA 1VBE2 1RL3A 5C3OA 4UW3A 1V6MA 1GU3A 4QB1A 3IPVA 1CPMA 2A6YA 3HQRA 2GMPA 4MLOA 3S5AA 4DOUA 2VTFA 2RS32 4AFAA 1R1A3 3RYKA 1FMD2 3VZOA 5DAPA 1C28A 2YBKA 3Q8FA 5CA6A 4K9SA 4LOTA 4OHXA 2P1BA 4W4ZA 3KQRA 4IXLA 4QPWA 5J37A 3W21A 4P5YA 1W6PB 1GR3A 2E33A 3OBAA 1QOTA 1TME3 2X53S 5KC6A 2P3JA 4HOOA 2OX0A 1ACCA 2CWSA 2CY6A 1JBCA 1ZYBA 1NZIA 3M1HA 4LE4A 1DQ5A 5A7QA 1HN1A 1OD3A 4QPIA 1NCQA 3AYAA 5FYBA 2HWF3 5E6HA 1TE1B 2DUQA 1AR71 3APBA 4EN6B 4M3CA 3WDTA 4HKOA 4Y1YA 5LATA 3WX5A 3VHRA 3ZFFB 4GJZA 1XE7A 4PIXA 3R0RA 3WNNA 4AEDC 2JDAA 4DZGA 1QJX1 4JGYC 4YW4A 1CAVA 2ZMKA 3RRDA 1LU1A 3HVDA 4ITCA 1W3VA 5LRRA 5LA0A 1V6JA 1YEWA 4COUA 3D82A 1ENQA 1N1TA 1UU4A 2CDPA 3FJSA 4LKEA 2DU0A 2EAKA 4AYUA 4JGZB 5LA1A 3J8F1 1XNKA 4CDXB 5FO9B 2OS2A 1T2XA 5FY4A 3M4FA 4DRRA 2ZGRA 3T0DA 1QH6A 1H8TB 3WUDA 4R9CA 2K46A 4FVVA 1Q56A 2KM2A 4NWVA 1ZRFA 4LA3A 3FHIB 1T6BX 3C7GA 4TZDA 1UKGA 1AR91 1LHOA 4H7MA 4MH0E 1UWWA 4D7TA 1GWKA 5GZDA 1OLQA 4YWAA 1RUI2 2NPIA 3ZXJA 3H8XA 1CN1A 5FWEA 3DXTA 1YI9A 3SLIA 3ILRA 5L19A 3AP5A 4XMAA 4EN9B 4F7ZA 2PAEA 1Q43A 1WMEA 3JBG3 3N7KA 1U5YA 1RHI1 2YB7A 3LD8A 1H2NA 3UYJA 3I2OA 1PNGA 2HWC2 1KITA 4GWJA 1CAWA 3W59A 3CF6E 3FN9A 3PMEA 4MGQA 4BQWA 2HWD3 1PO21 2EXHA 5F6KA 2PELA 4COYA 1F4HA 1Z7S2 4E2GA 1GICA 4PI0A 5FZGA 1OQ1A 2V09A 3K4DA 4XJ9A 4BQ1A 5FZCA 5DDJ1 5K9YA 2WNVC 3WW2A 3LGRA 4QX3A 4RGAA 1LOGA 2W0XA 1UQXA 1FPN2 3BB6A 4UT5A 3OF1A 1GWLA 5DUUA 4GULA 2FHRA 3V0AB 1LOBA 2RM23 1POQA 3NJZA 3MF9A 5GM0A 1UW8A 1KRIA 1UU5A 3CMGA 3VKNA 3B01A 5ACA2 2WFPA 5DZEA 5APAA 3FLRA 1UPSA 5GLUA 1S2BA 4COWA 5C9AA 1R1A1 3U07A 1HRV3 5JXJA 1NA1A 4ZHNA 2HWB3 2XL9A 2JE7A 4CZSA 5JVVA 1D2QA 1PMHX 1E57A 2GNTA 2VMFA 3MGUA 4FPHA 4PBOA 3THPA 4YFZA 5JAXA 4MG2A 1N1VA 2ZAHA 2HH9A 4IDZA 1Q5OA 3IIAA 1RUF2 4UYBA 5DABA 5FPAA 3WW3A 1ZRDA 2DYCA 1TME1 4Y22B 4JGZC 4A3ZA 2RJLA 3R4UA 4LJHA 3DL3A 1HXS2 4CDXC 2FZ1A 5FZMA 1V9U2 4NAMA 1LU2A 1CJPA 1J1TA 2QQLA 3TEYA 3WLUA 2HWF1 5C6CA 1REFA 2VU9A 3H7YA 4RN5A 3UGGA 1YQ5A 1VB4A 1ZBA2 2ZABA 4WVZA 2UYAA 2BVVA 5L73A 2QDNA 3ACGA 1VIWB 1Y3TA 3B3QE 4IEYA 4M01A 4HKLA 2I07B 5FYVA 3AYDA 5LY2A 1KFUL 3VKOA 4EYUA 1JH5A 1MZEA 5IT6A 1FX5A 3BUCA 2WO2A 3VBFA 2D93A 3UK9A 1AYM3 3KGZA 1AJKA 2PHTA 3TNPB 4N53B 1QF3A 4W8JA 2GP5A 1AX2A 3JZVA 1WCSA 1TMF3 4G4FA 4YG0A 5E8AA 4AAXA 4JCKA 3L2YA 4IV1A 4KWKA 4Q4X3 3WY6A 1MVEA 3T0BA 5A32B 5J48A 1B35A 1K3IA 3GBWA 3DN7A 4MOAA 1DDLA 1X9PA 2VECA 5LRSA 5SV5A 2HEWF 5FUNA 3VZLA 5F3CA 1FI2A 5DUXA 1NXD1 2QCSB 4BXSV 3ROUA 4Q0UA 3ILNA 4PF1A 4QX8A 4RQPA 3BPSA 3RDIA 1HRI3 2VD7A 3LE0A 4I30A 4RS5C 1MPXA 5FYIA 5A7PA 3WP6A 1W6NA 1H6YA 2GMMA 4BIFA 2VOTA 3CDZB 3N9MA 1TEIA 1N3OA 1UYYA 4AWDA 1YJKA 3NNMA 1IOAA 5JR7B 5JI9A 2VGDA 3KV6A 3WSOA 2ZGSA 1J3PA 1G9CA 3JBG1 3SEPA 4K21A 3IDEA 2UWAA 1W6OA 1DYOA 4LXLA 1VBA1 5JWPA 1DGWA 1FV2A 2A6VA 3T1LA 5C70A 2IVJA 4EWEA 3MUZ1 4UFHA 3JXSA 3ZR6A 4PDWB 2R073 3QCWA 3SXWA 2A3WA 1CIYA 3LWCA 3VD7A 3RSJA 2W1SA 1SPPB 4CYDA 3ZN6A 5LBBA 4OHZA 3ZYRA 1BBT3 4DO0A 3MIBA 3SKJE 1EUTA 3LEKA 1KFXL 4IUGA 2W1QA 3UV9A 2NP0A 3WF3A 3LSEA 4V2VA 5E88A 3VBHA 4MXVA 4ATFA 1H1AA 4XABA 2GDFA 2RM21 4IESA 5FZIA 1OC1A 1UU6A 1NXMA 3ZXDA 2VXJA 2WZR2 5LWBA 1CAUB 1RUH2 2J1AA 3MYXA 4AQ2A 1CIWA 2IFWA 1S4CA 4YFWA 4XUPA 3NAPB 2D3SA 2LUWA 2HWB1 2WAOA 3A23A 1WLTA 1JXNA 4FOWA 4I3PA 1KDMA 4OMDA 4QGLA 1W2NA 3WZ1A 3HEIA 3F2ZA 5ISLA 3SQOA 4XFFA 3CJIB 3IDCB 4LA2A 4N53C 2Y38A 1W0PA 2HJIA 5FZLA 2W2IA 2RDNA 1OUSA 2W52A 4XFHA 4A6SA 4XDOA 5BNPB 5FYMA 3UGFA 3WCSA 3AVSA 5FZDA 4Z82A 4CDQB 2H6CA 2VMCA 2Q8DA 2D43A 1MVQA 2DFCA 2LALA 2XJRA 1M4WA 1ZZ7A 2QDRA 1VBD3 4NRMA 4LHLA 4AI9A 1J3RA 1Y9GA 5GLVA 2F4PA 5CKQA 1BEV3 4LBOA 1US3A 3TB0A 1C57A 4ZU7A 1ASJ1 2E53A 3VUOA 1E5SA 1W9WA 2W91A 2E32A 2J1UA 5ANNA 1VAKA 4AF9A 4ZKTB 1PM7A 2EIGA 4CUGA 1WLCA 1XU1A 2ZS6B 3DECA 4N43A 3ZN4A 2NMOA 2VPVA 4KL1A 3FX3A 2DVAA 1AYM1 3C8XA 3SKVA 4LIUA 3VBSB 1VR3A 3B9IA 4J6GA 1OLME 1NT0A 4GD4A 3A0KA 1TMF1 1PO13 4UFKA 2F4LA 2AC1A 3AKSA 1FNYA 4NHLA 4Q4X1 1ALYA 4S2GA 4O9EA 4AEMA 4PDWC 5DAXA 4L92A 3ZDVA 2GMEA 4RA0A 5LEKA 2W68A 3T2QA 2SLIA 2OQ6A 4EN7B 4LO8A 4Y1VA 1O3TA 3W20A 1JN2P 2PLV3 5T3NA 4C1WA 4E9KA 3BU0A 1K45A 5EXOA 2JG9A 1TNFA 3ZMNA 3THDA 1UY3A 1UCXA 1HRI1 4AXOA 4BISA 1W28A 3NO8A 4QDRA 4LO5B 4XTPA 1LHNA 4B4RA 4MUVA 3J8F2 4NAOA 5FMBA 2JECA 3WDXA 1JZ8A 1W8ZA 4L11A 1HV0A 2VQTA 3N7JA 4DXZA 3M70A 3VBRB 3IN9A 5FZ8A 4I3GA 2MHFA 4NPMA 5JLVA 2D6LX 3I7DA 3MIHA 4WM8B 4DIQA 5EWSA 2VC9A 4NHYA 2W5FA 1XYPA 2F17A 4SBVA 3OYWA 4K6BA 3I3MA 2R071 2W1WA 1GZWA 1J1LA 4FP3A 4M3CE 3JD73 1D0HA 4BJ0A 1W9YA 4EZ4A 2XMLA 4FPCA 2ZGPA 5BNPC 1BBT1 1KXGA 2ZJCA 3RMYA 4CDQC 2WR9A 1WBFA 3JU9A 1QJEA 4J25A 5F7UA 5CYYA 2VMIA 3JQWA 4IE7A 3KS7A 4LUKA 4QQHA 2VMHA 2ZHLA 5FRAA 3G6JB 1D2SA 2CWMA 1RHI2 5FTTC 4Q0PA 2DUOA 4Q4W1 1HB1A 1OH3A 3LAGA 3RI8A 3O1RA 4MGZE 3A0NA 4IEPA 5L7OA 2JE8A 1RYYA 1AXZA 3MUY1 4XTMA 4Q4V2 2HYKA 2AR6A 3DXUA 3WDWA 1PO22 4QX1A 2WS93 4E27A 3VBSC 4AE2A 2B4KA 5LK5A 4DMIA 5AC92 4PHZA 4OHWA 5DDJ2 4BCUA 5A33A 1UL9A 1OXCA 1RUC3 4YW7A 2IXLA 3D0SA 3KT4A 4CA9A 4CCDA 2JE9A 5KXCA 2N7GA 4QGNA 1S0FA 3VZKA 4A7KA 4DUVA 2G19A 2JIGA 3O1VA 2ILMA 1UXZA 2R0FA 2ADDA 5JI7A 3RGBA 5IFPA 5FZHA 2LROA 2VMGA 4Q4Y1 1C8NA 1VBD1 1FOD1 4HN0A 1A8DA 4NRPA 2B39A 4QAWA 3AMMA 2EIEA 3N9OA 1WUVA 3UETA 1BEV1 1DHKB 4TLFA 3POIA 2GNBA 2EALA 3I4IA 3J7MA 1EPWA 2E6VA 3BALA 3ZPYA 4LUMA 2DBIA 3IMNA 4CCOA 2DCKA 5FZ1A 2RS53 3TN93 1G9BA 3LPGA 3E5QA 3WP4A 2P2KA 5BUVA 2XQXA 2YPDA 1UF2C 3GHNA 4BXFA 4BQ3A 5C33A 3VBOB 1EPZA 3HIFA 2O8OA 3CO2A 5FLIA 3VBRC 4AFDA 2QZ3A 1OQDA 4RR3C 4S2FA 2GNMA 4ASLA 2P6CA 1RXGA 1CAXA 2HWF2 3OJBA 4MADA 4FXKB 4AL9A 4K8RB 4QKNA 1XSRA 2DU1A 1I6XA 1QWRA 4JDNA 1SLBA 4D3WA 2WWJA 4OI2A 3V0BA 1I1EA 2QTWB 3CEWA 3AL5A 5FYHA 2PLV1 3VZNA 4GQ7A 2O1QA 4TYSA 1WMXA 1ST8A 2BRTA 3USUA 1UZ0A 1YQCA 1RUD3 2QQMA 3ACFA 1FXZA 5FPZA 3SC7X 3DCQA 1MACA 4RGGA 4XJAA 1D4M3 4XBNA 3RZMA 1AL22 1LENA 2YBPA 2EVXA 2J1SA 1UY4A 4HBNA 1YCIA 1XSQA 1ENSA 2XOMA 3K2OA 4PLOA 2FCUA 4N90A 3KV5A 1UOFA 1W8NA 2DVFA 3ASIA 4AI0A 3BKZA 3ZXEA 2BOIA 4B4QA 3BPZA 3WF0A 2XHKA 4H14A 5CVRA 2E9QA 4E2SA 3JD71 1OLRA 1JUIA 4AVBA 3I49A 2UYBA 4AZZA 3E5UA 5A3NA 4YZ1A 3H8UA 3AC0A 3FUQA 1UX7A 1JU4A 4MVTA 4ORFA 4H2AA 4FOVA 1HN0A 4MO3M 3ZXGA 5IVFA 2ARAA 2VBDA 1OFNA 3IIIA 5L9BA 1K5MC 3MIEA 2D3PA 2FCVA 5L9RA 3PTYA 4JQTA 5JZGA 4XIOA 4GWMA 4HVRA 1O5LA 5CFCB 4IETA 3RJ2X 3EJKA 5CG8A 2BZDA 3GDBA 2ZKLA 5F1RA 3WXPA 2IWGB 4YW5A 4WVWA 2HWD2 1REEA 1OURA 3N9NA 4NIAA 2VZ3A 3KVAA 1ZZ8A 1CX1A 1ENXA 1WMDA 2WS91 1NKGA 3DKQA 2QQPA 3OGVA 3S57A 2DCZA 4Y20B 4ASMB 3ILFA 5EIYB 1UD1A 1SBFA 3VHNA 1XE0A 1RUC1 2HBTA 1FATA 2RS13 3O0VA 4AVSA 2OVUA 2QE3A 3K3OA 2J1TA 5BNOA 3E6CC 1YYNA 2RM22 3AK0A 1BMV1 1QEXA 4XUNA 2AH2A 2ORZA 5M0TA 1PIV2 3OUJA 1W0OA 2YHJA 3GYDA 2HKXA 4JVAA 2BWCA 4AEJA 2VVDA 5C5TA 4GMP0 4BMEA 2VCBA 1HRV2 1O6UA 1SBEA 4MXWA 4M3CF 4XJ8A 5D8AA 4A3XA 2BNOA 1VBC3 4R52A 5ABJA 4LQRA 4CEWA 4D6RA 2WLPA 1ZM1A 3TN91 2IFRA 4L2NA 2VXRA 5FK8A 1UPIA 4R4XA 3T1MA 1UOGA 3ZFEB 2ZGQA 4CDUC 1EUUA 2A71A 3NJVA 4PCRA 2Q8EA 5JMOA 1I5PA 5L36A 3AMQA 2ZA9A 4Q0QA 1YO8A 3CHXA 1NCRB 4LR4A 4AAPA 1SG3A 1W06A 2D5HA 1GNHA 3PVBB 2XB6C 3MLLA 3ZYHA 3O1PA 2D5FA 1G86A 3T4HB 2X8KA 5CG9A 5F39A 3SCFA 2GAUA 1SLTA 4AOCA 3MHZA 3BI3A 2ES3A 2BP6A 4QPYA 3H7JA 1O4ZA 3OGGA 5BNNA 3Q8EA 3M3IA 2DWRA 4C1XA 3AMPA 4G9SB 2WN2A 3ZXLA 3J7NA 4CP1A 2JG8A 4V2WA 3VV1A 5KXEA 4LT5A 2OZ6A 1DZRA 1MS0A 1CPNA 1SZBA 4AHYA 3MF6A 1JYWA 4A7YA 1YLLA 1RUD1 4AK3A 2YFUA 1RUG3 3OOXA 4IEUA 1TMF2 4PBPA 1YRZA 3PUSA 4LMFA 5GLWA 2IUWA 1LESA 1LGCA 1D4M1 1EV12 2BGCA 2PHUA 4LITA 5CFCC 3H1YA 4U36A 4CCNA 2VUDA 2VZRA 5DAQA 1CONA 3MPBA 3B5LB 4BHPA 1N3QA 1YWKA 2VNOA 3J7LA 2HEYF 2G1MA 3D0JA 3AMNA 2A75A 4NUBA 2FD8A 4LOSA 2B9UA 4I09A 1ZRRA 1R092 5A7WA 4ES8A 3K75B 2WIIB 2XBO3 4IV3A 1HRI2 5EJ3A 5K0UA 4UFLA 3POYA 1QNWA 2R043 4DS0A 3POBA 5I0RA 3VGIA 1EAH3 4NHXA 3PVOA 1U5XA 5K4LA 2E7QA 2PAKA 5C4WA 4LO7A 3SMHA 3AZXA 2J1VA 5IVVA 3RZHA 3VL8A 2JXAA 2Y6KA 4A4AA 4S2HA 3THCA 5FP8A 2EA7A 3K77A 3U11A 1JZ4A 2YV8A 1JOJA 3FHAA 5C3QA 2Y6LA 3FBMA 1UY1A 2BNMA 3MZHA 2QZ2A 4EZHA 2RDQA 1S0BA 3J26N 1HX6A 5FUIA 1RTVA 3IT8A 1PNFA 2R072 4XBQA 4JGYB 3AXEA 2VL4A 1W8OA 1UZVA 4HKWA 1GSLA 3VD3A 4ZU5A 1OF4A 1SLIA 1YIPA 4LHSA 2H0VA 2ZX0A 5I93A 1GFF2 1GOGA 2BWAA 2WC2A 1UAIA 3OD4A 4KQ7A 5FJKA 3RMXA 3WD5A 1NCRC 3UL2A 4CEYB 1IPJA 3ZFGB 4EWDA 2RS11 5C8CB 5ERLA 5A3LA 4QPGA 4BQXA 2Y6GA 2WKKA 3Q8BA 1BZWA 3LB9A 4JRLA 1RGSA 4M00A 1BVVA 5IUQA 1Y4WA 4WV8A 5FWJA 2YUEA 1GMMA 2VY0A 3AP6A 1MS3A 2WNEA 5JUVA 3BOWA 3FE5A 4JKLA 3A7QA 2HEVF 4JQRA 4WVMB 2PXJA 1HB3A 1RJ7A 4O7XA 1Y43B 5FZAA 2QQNA 4I0WB 5FP4A 4FFFA 1NLQA 4COZA 5AFBA 5E1RA 1UZWA 3RWNA 4QM8A 4WM7A 3H8RA 3B00A 3O5SA 4QX5A 2IC1A 5LB6A 2VTXJ 4WBBA 4RHV3 4Q4Y2 4FPEA 5FMCA 2B42B 3VD4A 4YVSA 4FQZA 1H1IA 2ZXQA 4YGCA 1BEV2 5GALA 1RUJ1 4P9JA 5FKCA 3B9CA 3AP7A 3AFKA 2ARCA 2LM3A 5D2AA 1WCUA 1LOEA 4TWTA 1ZZ9A 2D6NA 5IVBA 3NV3A 2WNVB 1QQP1 1VALA 5DZGA 2RJ2A 4KG0A 3P5BA 1PK6B 3ELNA 2XL7A 5LA2A 1MR5A 1QJU1 3AXDA 2VZVA 2VZOA 4BK5A 1SDWA 2AZ5A 3BYWA 4CXWA 4QQ2A 1RUG1 2PYTA 3LPFA 2VOWA 3KF5A 1PO12 4YW6A 1PGSA 5FQ0A 3T2PA 3NL1A 1BXHA 2QJVA 1GZCA 1QHDA 1TZOA 2YFZA 4JKKA 4OQ9A 3I2JA 3GJAA 3BTYA 4CCEA 1BKZA 2WA4A 3POJA 3IB3A 4UFMA 1GP5A 2BOJA 4N9IA 2LRPA 3TBDA 1GNZA 5IAVA 2XBO1 3RPQA 3WP5A 4CEYC 3ZFGC 5C8CC 3CQOA 3ZSLA 5IK4A 5KHKA 2R041 4ONUA 2ZMNA 1AR62 1CZSA 1EAH1 1OI6A 3LDRA 2ET7A 1OOPA 5LW9A 2JD9A 1U0AA 3CLPA 3VB9A 1AL0G 2XONA 5FFOC 3TWIA 1DGLA 5A3MA 3AZWA 1X8MA 3AL6A 5HCBA 2BBAA 4YSFA 2ZKNA 2A1XA 4A45A 1AJOA 3HNYM 4I0AA 1YFXA 1W8WA 1Z0HA 2VMEA 2ZHKA 2C0ZA 3PNAA 3MLKA 1WW4A 4DXSA 3TAYA 5A6QA 3OUIA 5F5IA 3D8CA 3KT7A 4KBZA 5EYYA 3VDAA 1K42A 1ND3A 3SHRA 2B5HA 4OVEA 4Y26A 4IEOA 1VRH3 4NOTA 5IWFA 1WZXA 1NY72 3KHBA 4HETA 4FFIA 1H30A 4GKYA 2VQ0A 1VBA3 4ZZ8A 4HPKA 4XUOA 3T4VA 2GC1A 2XLFA 3N9LA 4BYYA 3VBFC 4NIHA 3NNJA 3GF6A 3RWKX 1AR83 2LW8A 3WNMA 3KZ4C 1R082 1ZZCA 3ZO0B 2V73A 4IV1C 3UJOA 3GZUC 1B35C 1NQDA 4FT8A 4KWUA 4GH4B 4RS5B 1SFPA 3VDBA 2VCMA 1MEC3 2BGOA 3WG2A 1PK6C 4K8FA 2WS92 2R1BA 4UW6A 2WNUB 5FZOB 3GZEA 1OA4A 5CIRA 1POV0 1P8JA 2YC4A 4P00B 4B4PA 3C7HA 1ODMA 3OBZA 5BYNA 2V5YA 5CAZA 5FZ6A 4IGQA 4E2QA 5GZGA 2WFF3 3WG4A 3VDDB 4RHV1 2VO5A 4ZONA 3H42B 2ZMLA 4Q8LA 5C3PA 2R063 2NYYA 4HLTA 3GCXA 4RFT0 3OG2A 2QQOA 3WQ0A 1HKDA 2ZEXA 4OZOA 4GB32 3P3NA 4AEDA 1OSGA 5FYUA 3I59B 2XKPA 3TYJA 4QHZA 1RVF3 3OY8B 2RS52 3TN92 4DB5A 3HPNA 4MGSA 1IS5A 3CKHA 5JOWA 4L99A 2BU9A 3ECQA 3I3DA 1W2AX 3M2MA 5JOYA 1ASJ3 3LIHA 3KB5A 2OXBA 3PJQA 1VBB2 2FDKA 3OBRA 3I3EA 2ERFA 4V1PA 1NAEA 1N1SA 4ASKA 1LB2A 3OUHA 4JDOA 4LTAA 2PMWB 3I2GA 4M4PA 1ONAA 4PQ9A 1G7YA 2WWSA 3M3OA 5FZFA 2JB8A 4M0NA 5FPVA 1FYUA 4XE9A 1VB2A 2Y0IA 2Z5WA 2VUCA 5JPNB 1DP0A 3C7FA 3LEIA 2PHFA 4ARXA 4MX3A 1XU2A 1Y9QA 2RE9A 3ZIWA 3W58A 2PQSA 4OUMA 3H3UA 2CTVA 4NO4A 4OHVA 2Q8OA 4BQ5A 2EXJA 1UZYA 2OPWA 1RUD2 3OGRA 1XE8A 3J9SA 1XOYA 4BQYA 5C3RA 2XWJB 4C8DA 4A41A 2ZCWA 1D4M2 3GGLA 2WRAA 4J1WA 4ARYA 3VZMA 1YHFA 1NQJA 1V0AA 2KA3A 4Y4RA 4GH4C 3O1TA 4MGYE 5FOJB 1KS4A 2W39A 1W6PA 3W5MA 1H8VA 2R0HA 4AGGA 4TTGA 2WNUC 1F8VA 1IS6A 1MQTB 3DF0A 1XXNA 3I97A 4M0HA 1RUE3 4PI2A 2BFUL 1IPSA 3W5NA 1VMFA 4BQ2A 4QX0A 1D4VB 2ZHNA 1SACA 1H4HA 1PM4A 1DYPA 1UOJA 1VRH1 2XJQA 4XJWA 2DBNA 5A70A 3PVEA 1S0GA 2Y33A 2SBAA 1WD4A 1Y9MA 4H3WA 4MSVA 2PFWA 4N43C 5GKAC 3VDDC 1BK0A 4BU2A 4FXGB 3WR0A 2JDHA 3LA7A 3ALQA 4OMCA 2XJPA 2ZGNA 3FFQA 3PLQA 4YVWB 5CB7A 5A3TA 5FZ3A 2Y6JA 1AR81 1RINA 1O3RA 3KGLA 1LOFA 1W2TA 3J4UH 3ZFFA 2HWE3 4EQVA 3R4SA 4YZ2A 5A80A 3ZLIA 4AW7A 3SCGA 5A3PA 4Y33A 5IW0A 2YZ4A 4UFIA 5GLTA 4JTOA 2YXSA 2LS6A 2B45X 2A6XA 4PLMA 1UMHA 5LASA 4CU9A 3M3CA 1MEC1 3HJRA 5IJRA 4JGZA 2L9LA 1UN1A 4Q4W3 4URAA 2C9AA 3WQBA 3UKVA 4CDXA 2KXLA 5BY5A 4L0PA 1ZBE3 2UU8A 4HK8A 1S0DA 1KEXA 1A6CA 1H8TA 3HBKA 4UI9L 2WWUA 1ULFA 2XHNA 5HI0A 3OSDA 2WFF1 1GP4A 1URXA 4BLIA 4C0BA 2JJ6A 5D1IA 2X09A 4CCLA 5B2GB 2R061 4MZUA 1SCRA 1DZTA 2MEV2 3OD0A 2YY1A 5F37A 4UFJA 4QX7A 3USSA 4ES9A 2GALA 3ABZA 2J1EA 3GBGA 3GNEA 4Z2AA 1VBC2 3K46A 4R8HA 2C24A 2YGMA 3PUIA 1C1FA 1RVF1 1FOD3 3OGSA 3UESA 3CU7A 5IAXA 1OHFA 5FZBA 2HLEA 3OTFA 4XDQA 4GIQA 4XIKA 5B4NA 1VE0A 3NKGA 5JR2A 3RZJA 4FOYA 2P3YA 2JDUA 5B4XA 1VBE3 4P9XA 4JHZA 4FPKA 1WLDA 3RNSA 1UMZA 3EHKA 4I02A 1G9DA 5FMOL 5FUPA 1MQTC 3NNLA 4LKFA 4NIIA 2P3IA 1FMD3 5FP7A 5L7OC 4CCKA 2B9VA 1HJGA 5F3IA 1S0IA 2G4IA 3V0AA 3BTXA 3I54A 1S0JA 1ND2B 3KD4A 2P34A 1AR72 3D3AA 3FFZA 3N3HA 4Y5TA 4IEWA 4P9IA 4YVWC 5CFDB 2BBVA 4SLIA 1RUG2 3ZVXA 3HMYA 5H9QA 1HQWA 2FMYA 4I01A 1STMA 1UYZA 3NRUA 3B93A 4LBMA 2PHRA 3S7EA 3R4DB 2CAUA 4AHWA 1QJX2 4CDWB 5KXBA 5C5UA 2VZPA 4K1YA 2XVGA 4CU6A 4FTSA 2TEPA 3ZXAC 3ZM8A 5A6ZA 2Y34A 2I74A 1JYVA 4QQLA 1DQ2A 3B02A 2XH6A 4Y22A 3N7MA 3WP3A 1RUE1 5BV6A 4DFSA 3NV4A 4PIZA 3FC0A 4MGTA 1XNCA 4PQQA 3WF1A 3I2HA 5IK7A 4AFMA 3LF7A 5FAXA 1H2KA 1KS5A 1AX0A 2VOKA 2XVKA 2VG9A 3HNBM 3B7MA 4RR3B 1EAH2 1KJLA 1O8PA 1GWMA 4X8PA 1HJFA 5F8PA 3CBNA 4XYXA 3RZGA 5C7GA 5LBCA 2RHPA 3CIHA 3WG3A 4YGBA 3VD5A 4E4ZA 3U4XA 1QMJA 3TEZA 2Q0AA 4RD7A 4QXKA 4YZ4A 1CGPA 1AR92 2FCTA 5K8SA 2V72A 4JAAA 2HWE1 4HT1T 4D8MA 3SH5A 5L9VA 3SEEA 4Z8BA 1F5JA 3BVCA 5KWRA 1GLHA 1VMJA 2C4XA 4JTNA 4XCAA 4JRAA 4A6OA 1ULPA 5KHIA 2R7EB 1DGWX 2JDNA 4BH9A 1VPHA 2RR11 5AVPA 4ET7A 2BW8A 4N53A 1FNZA 2ZTNA 3SNMA 4YLZA 5I0DA 1HB2A 1XNTA 2AEZA 1SBDA 2C9KA 1DQ4A 3S6PA 3AZZA 1A78A 2AGSA 3LFIA 5FZ7A 4B1MA 2V5DA 5A32A 5LCWL 4CVUA 1ZBE1 1COV1 1ZZBA 2FDIA 1NYWA 3GZTB 1J59A 2DCJA 4NMIA 3H9AA 1PGW1 3IWZA 2WT2A 5FPLA 3HN3A 4P5HA 2BJSA 3UKNA 2R32A 3FHQA 4Q26A 4E4DX 4Y1XA 3WNPA 4Q0SA 2WYFA 3U4SA 2HWC3 5DMYA 1EYBA 1LECA 3GM8A 4QB2A 2AENA 2J7MA 4B7EA 2ARBA 3VHOA 4QMAA 3VN4A 1ND2C 3WQ1A 4CUBA 1Z7S3 5CFDC 4HANA 4W6YA 5HXVA 5FP3A 3DUIA 4UOJA 4XETA 4OZXA 1YXWA 5DPNA 4QD2A 1LHUA 4LULA 2C6SA 3KSCA 1K5MB 1R1A2 4XEZA 1WGPA 2BGPA 4UW5A 5FY5A 2AUYA 4CDWC 3QLQA 1YNAA 3MIGA 4ZS3A 5KC5A 3DPRB 3OPZA 1BYHA 1O91A 1S55A 3NW4A 2GN7A 4PDWA 1VBE1 2R1DA 5CNAA 4AFBA 4GKXA 4XF0A 3IAQA 4J1XA 4L97A 4XILA 4YM3A 5ACA3 3ZKYA 4GAZA 4C91A 1SPPA 3TOJA 1TME2 2Z4FA 3LFMA 3NJYA 1YQ6A 1FMD1 3SH4A 4GMP1 4XF9A 3WDVA 1XJAA 3ME2A 4EE2A 2P37A 2CYFA 4GWIA 1QNYA 5JOZA 3OBTA 1XYOA 2IXCA 2QQWA 2WLQA 3GHMA 2ZACA 2D6KA 3HR9A 4UF0B 2Z69A 4UWDA 3BCWA 2VW1A 2EXKA 4IL7A 4LPLA 3U14A 5IATA 2NN8A 1CAUA 5F9TA 1IZ3A 4LNVA 2VBPA 1V9U3 4RSUA 2VVEA 4CU8A 4E8CA 1VMHA 3MEPA 5FLHA 3NAPA 5DUVA 2D97A 5IVYA 2IXKA 5J98B 1X33A 2VZUA 2F6BA 3K4ZA 3NJXA 1ULOA 4KMQA 3CJIA 2DVGA 3RI9A 1JZ6A 1REDA 2ZGKA 3B69A 1W6QB 2UWCA 2GH8A 3VLBB 3ES4A 5IVJA 5BNPA 5LBFA 4CDQA 4XMIA 2PHWA 4B7KA 3PUQA 4CDUB 3CNAA 4QKBA 2FBEA 5ABJC 2FDHA 3DGTA 4LLFA 4P9GA 5DAWA 5GZFA 3V64A 1CWPA 1YUDA 1H2MA 3WNKA 1DU3D 2DCYA 5FJHA 5KHHA 3KLSA 1SDDB 4NRQA 1H4GA 1QDCA 2D6PA 4E4HA 4ZXKA 4Z2WA 3ZSKA 1JU3A 4LHNA 1ODNA 2OPKA 2X5IB 3ZDSA 1W9SA 2Q1ZB 5A7SA 1SQ4A 4IE5A 1LTEA 1XQNA
chains in the Genus database with same CATH topology
2YDEA 2VNGA 1AHSA 1PVXA 2VW2A 3VBSA 4LBQB 4EN0A 3AZVA 4F83A 2OYZA 3VBUB 1LHWA 5JCTA 3DV8A 1PVC3 3JBG2 5BNNC 4MGKE 3PMSA 2E51A 4B29A 1VBA2 5AFEA 2JG8C 3WOGA 3DPRC 3U0ZA 2QNKA 3ZMOA 2BYVE 1W6MB 3WG1A 3KM5A 3IPVB 4K3UA 3JCIA 4BA6A 1FT9A 1D0GA 2DVDA 4FTEA 1ULCA 1XNDA 1OA3A 3PJYA 2HWC1 4OFGA 1Q8QA 4META 1LCLA 1ZX5A 2DTYA 2WSVA 4FQ4A 1VAVA 2PHLA 1Z7S1 1LGBA 2VUJA 2H0BA 5KBFA 1J58A 3WDYA 4IV3C 1OKQA 2NQYA 3VBRA 3L2HA 3KCXA 4H55A 4XQWA 2NLRA 4LO6B 3NWKA 1ZREA 1FPN1 4WM8A 5C4WC 2HWB2 4UXAA 5JMCA 4QPIB 1R1ZA 1NCQB 3VZJA 2WFF2 3ZSJA 2YGLA 1YFUA 2JEMA 2ZGOA 2ZGMA 5ACA1 4AVVA 2WZR3 1RUH3 4M3CB 2IXJA 3HBZA 1NE6A 3UKTA 4XF1A 4NR1A 1VLNA 4D7YA 1CAVB 4XF3A 1DQ0A 3ST7A 2P3KA 2ETEA 2A3XA 4H7LA 1HW5A 4XF4A 1RUJ3 5LEJA 1WW5A 2PTMA 4BWOA 1ASJ2 1HXS1 3VHPA 4D94A 3A4UA 3WHTA 2MNGA 1V9U1 3ZSEA 2X5IC 1QQP3 4QPGC 5T50A 4QT6A 3INAA 1CD3G 4KWLA 1EY2A 4QHBA 5JSRA 5LK7B 1AYM2 4HMZA 3VBUC 1QJU3 3QH7A 1OMIA 1GV9A 1X7NA 4UBHA 2A6WA 4EJRA 1DQ1A 2FQPA 3TNQA 2GZWA 2JENA 1AZDA 2ZX2A 4LO4B 4Q4X2 1SLAA 3EBRA 3H0OA 5EFUA 3R05A 1O4YA 1SFNA 4XFAA 2PQQA 5J96B 2XLGA 4AHZA 2Z79A 4YRDA 1X8EA 3NSTA 1JYCA 4FP2A 1DZQA 4C90A 4OUSA 1WMFA 3LOIA 3MW3A 1YI7A 2DTWA 1J3QA 1QOOA 1VP6A 4HSJA 5JDBA 1CAWB 4MYEA 1XRUA 1DFQA 1RUE2 3VBOA 1BK1A 5K7PA 3FUOA 2E7AA 1PVC1 4XOGA 4AEKA 4BM8A 3E5XA 1NLRA 2XVLA 4OI1A 4LEJA 4QPIC 1NCQC 3WHUA 4Z07A 3ZYIB 4LHKA 4W65A 5KXDA 2C5DA 4R9BA 2HWE2 5C9AB 1BBT2 2Q1MA 5AVAA 4DPNA 1NA1B 3MFAA 4YGEA 1X36A 2P17A 3LKJA 4FBFA 4NVPA 1LULA 2RMU3 2BFUS 1PZ8A 2VOXA 4Q4W2 1O5UA 4NWWA 5HBAA 3O7OA 1QOSA 1ZBE2 1WLWA 4JC1A 4IEZA 3SISA 1OOPC 3RJRA 1Q3EA 4QGMA 3D5OA 4AQ6A 1C8M3 3IBMA 3HT1A 2XKOA 4U2AA 2VNRA 1GANA 2WZR1 1RUH1 3IKWA 1NLSA 2G9FA 2FMDA 4NPRA 4Q4V3 3QD6A 1YFYA 1LEMA 3SITA 2BPA2 3VBFB 5AC93 1VBD2 4IERA 1FOD2 2D40A 1PZ7A 2PAMA 4D7SA 4N7IA 1VJ2A 5CFCA 4IV1B 4PF5A 3PHMA 1X50A 2CAVA 1B35B 2ZZQA 4Q29A 4DNYA 5JSPA 3B94A 4DY5A 5DUWA 4PLNA 1AYN3 2D98A 4Y20A 2ZOEB 2Z42A 5FLJA 1N3PA 1SLLA 4Q2FA 4RQPB 1DIWA 4JV4A 5T54A 1W6NB 1C4RA 3JB4C 1TQ5A 5H9RA 1Q8PA 1VAMA 2VVFA 3AP9A 4GA9A 1SLCA 5C9AC 2PLV2 1W6OB 2IZWA 3FMGA 1I3HA 1NA1C 4BPZA 5I8SA 5I91A 1HIXA 1QXJA 4GWNA 3ZYPA 1IS4A 5FMOS 1IPKA 3CJXA 1WW7A 1SCSA 5FOBB 3ZFEA 1UZZA 4XHXA 2A3YA 4DRVA 3ZN6B 5H9SA 1S1AA 1NZCA 3N35A 2ZZJA 1CJDA 5F5QA 3VKMA 2R6QA 1S0CA 3E6BA 1NCRA 4R4ZA 5FPXA 3HT2A 1LRHA 2VW0A 4Y24A 3M3EA 3HD8B 1ZA4A 1IKPA 3VBHB 5I8TA 3WV6A 2XJTA 4FCAA 4AFCA 2VQAA 2WINB 3M7AA 1LODA 1O4TA 3JD72 1AL23 4Q0VA 2Y0OA 4AG4A 5GZCA 1LEDA 3K48A 2WT1A 4IEQA 1Q8VA 1ULEA 2EXIA 2RMU1 4MV2A 4YZ3A 2WQZC 3M3QA 2DFBA 4FOQA 3QBQA 3ZXFA 1RUOA 3OGJA 1WCKA 2YROA 3D4KA 3AMHA 2R16A 1DGRN 2WSUA 4A2UA 2O8QA 1A8MA 4N7UA 3ZIXA 1GBGA 4AVCA 1C8M1 3POSA 4RQPC 4P14A 1RUC2 3OCPA 4X6QB 5E89A 2RJKA 2FZ2A 1AXYA 2CGPA 1IHMA 4Q4V1 2ZBJA 1BMV2 3O12A 4N43B 1ULDA 5AC91 3ZXKA 2Q30A 3WW1A 1KDKA 1OFSA 4Q1PA 3LSDA 3N4MA 2B8MA 3BTAA 3KT1A 4JGYA 1PIV3 1I9RA 5JOXA 1UKRA 3WINE 2CL2A 1LOFC 3ZFFC 5KHJA 3MFCA 2AYHA 1ZVFA 3H1MA 1MS1A 1AYN1 4OI0A 1H2LA 1QU0A 3QOPA 2JG9B 3JUUA 5H9PA 4CEYA 3ZFGA 1AX1A 5C8CA 4HL0A 3Q9OA 3LA2A 4XJZA 3I2DA 3VBHC 4AVAA 1ZNPA 2QKDA 1RJ8A 1FV3A 4O9GA 5TSWA 1MS4A 1MZ5A 1QGLA 2ZHMA 4KGGA 1H8TC 4YM1A 1IKQA 4WVMA 4GXLA 1DQ6A 2NMNA 3OYWB 2B7YA 2ZX4A 4F3JA 1GZWB 3KCYA 4B3NA 3IM0A 1Q8SA 2WZPP 5IK8A 1BVP1 4AI8A 2EF6A 1XNBA 2Z2SB 4LBKA 1AXKA 4HSLA 2CGNA 2I2SA 5DG2A 5DG1A 1KQRA 1MZ6A 1QY4A 4ISQA 4Q8KA 1LHVA 1LOAA 2H6BA 3BU7A 1EV13 2BVBA 2A70A 2ENRA 4A7ZA 1JHNA 4I0BA 1AL21 2VH9A 2WNVA 3TRSB 2E7TA 5L7OB 2Y26A 4XJUA 1BJQA 3AZYA 2ZGTA 5BXXA 2TBVA 1PK6A 4HK9A 2JDZA 4B8EA 1R093 2VUAA 2B46X 4WZCA 1PVC2 1LGNA 1LKNA 1QJY3 5A33B 1GYKA 3S7IA 1H9WA 4X6RB 4I2OA 1CQ9A 3RYPA 4AQTA 2BUKA 5T5PA 3VKLA 2RR13 3H50A 5HCAA 3O0WA 4OHYA 4DY3A 2ZX1A 3U10A 1UIJA 2OIIA 3MIFA 3AFGA 5J3UA 2JG9C 2K2SA 2XJVA 4FPLA 5J7MA 3HAGA 1COV3 2RS12 2K0GA 2QFEA 2HWD1 3FLTA 3H1WA 4QQPA 4IQPA 3AJYA 1F2NA 4FAHA 4C0HA 4K40A 1H9PA 4PIYA 4CTEA 5DZFA 3W9AA 4HN1A 3ZSMA 1PHMA 1G9AA 1OD5A 1TNRA 1V6KA 5EZWA 4MGIE 2W08A 2GU9A 1CAXB 3M8LA 1YIFA 2A5ZA 4INDA 3EQEA 4EV0A 1PIV1 2XG3A 4WVVA 5JIAA 3V0BB 3EXUA 2X29A 2UURA 3PVNA 4AVTA 4CRQA 3JB8A 1HRV1 3WQ7A 1QJZA 3AP4A 2D44A 2CV6A 5I8YA 1NG0A 1WD3A 2ZAAA 4IEVA 1RMU3 1QDOA 4AGVA 3USUB 2BEOA 4NHKA 4BOWA 1EP0A 1V6NA 1RUJ2 3AJZA 4K7JA 3THTA 3ZYGA 2GNDA 1ULGA 2RS33 2WJSA 4GMP3 3AKTA 3R6SA 4GH4A 4RS5A 1N47A 1QQP2 3I8TA 1GKBA 4BLJA 2WNUA 1HQLA 5J09A 1QJU2 2XUMA 3O0XA 3AB0A 1MS8A 2D7FA 1C1LA 1H1MA 2CGOA 3HN1A 1OQEA 1WA4A 2G9GA 5EYXA 3ACLA 4QQOA 1QXPA 2WA3A 3VDDA 3MW2A 3E97A 2DUPA 1NE4A 3RZZA 1V6LA 3VL9A 4Q1RA 4XFIA 1OPMA 1AUYA 1UIKA 3SH3A 4FPYA 4G3YC 1EV11 1Z78A 2XBO2 5JZGB 3I59A 4YW1A 3AKRA 1QKQA 4YG6A 4KGQA 3OY8A 2R042 5I0TA 1U5ZA 5E16A 1OPOA 4AHXA 1DBNA 3RS6A 4W6WA 4KWJA 3RG0A 5BNQA 3G7DA 4LE3A 1R091 1CESA 3FWEA 5FO8B 1IS3A 3FLPA 1QH7A 2D6MA 1QJY1 2IXIA 3AKPA 1AR63 3LZZA 3C3VA 5BNOB 1X82A 1BQPA 3IDBB 3HWJA 4FPOB 5DXDA 4YM0A 3E6DA 2ZGLA 5HCFA 1MZFA 1LJ7A 1RUI3 1V00A 3NAPC 4OI4A 1XYNA 3UJQA 1C5HA 4MXWB 2VULA 2WT0A 1Y7BA 5T5JA 5D8AB 1PGL1 4HZFA 5ABJB 1FAYA 3CJIC 4HFSA 5CU1A 4LBJA 4CEWB 1W2UA 2GC0A 4OULA 4AI1A 2RMU2 1HDKA 4FSJA 2XLAA 4DQAA 1GZ9A 1U12A 2OUHA 3N36A 4QU2A 1SEFA 3AYCA 2YMZA 3FBYA 1MQTA 1F5FA 5EV7A 1R083 1C8M2 3VKFC 2WL1A 2E63A 2QVSB 5JIUA 3WT3A 1V6IA 1F31A 4AQSA 4S2DA 2GN3A 2LTNA 3CL1A 5BNNB 1FPN3 3BODA 2GC3A 4KU7A 4XXPA 2JG8B 4RHV2 4FPFA 1RMU1 1Q8OA 3S0MA 1RITA 3AKQA 2NM1A 2DVBA 3AX4A 4YVWA 4YARA 4HVQA 2A73B 1DGRA 4KNCA 2I45A 2PN5A 1HQNA 3ENRA 2RS31 3BOPA 2EAAA 5JZGC 5T5OA 3JQXA 4Y1UA 1WW6A 5T52A 1HLCA 3WW4A 4Z92B 2IXHA 3H3ZA 1L3JA 1RUF3 5JPMB 2R30A 3GBFA 1AYN2 2OA2A 4ZU4A 3HQXA 5FCCA 4BE3A 4GB33 2PA7A 1HXS3 2ZX3A 3LCPA 4IV3B 3ZX7A 5K0UB 3MDPA 4N9HA 4XW3A 1UX6A 5BNOC 1RB8G 2PHDA 5C4WB 1QXRA 1ZBA3 1GQGA 3RQ0A 1HV1A 3FZ3A 3D6EA 3ZN5A 3MLJA 1YJLA 1VBB3 4XFCA 1PO11 4WM8C 2UY8A 2DURA 5D8AC 1S0EA 1NOVA 3POWA 3BIWE 1O3QA 4CEWC 2O0OA 2JX9A 2R49A 2ET1A 5SV8A 3WUCA 4NHMA 4AI3A 3QH6A 4WZFA 3V56A 5T55A 2WQ4A 4YW2A 3S30A 1AR61 1DLLA 4QPGB 4KG8A 3NKTA 2XJSA 4P9LA 1T6GC 4FAGA 1IQAA 2DCTA 2DV9A 2A6ZA 2OUJA 3LA3A 1ZZ6A 1VRH2 4EROA 1RUI1 1PMIA 4COVA 3WCRA 1ND2A 1A3KA 2UY9A 3AM2A 2K9ZA 4L9BA 4NN0A 5CFDA 1C3HA 4BMBA 1AR82 4UBGA 3LOBA 3V65A 5I0UA 5GZEA 2Q4SA 1NY71 2DF7A 1U5IA 4WM7B 4XQ4A 4CDWA 4P9YA 4E4SA 4QM9A 1WBLA 2XWBB 1CVNA 1CX4A 1I5ZA 1W39A 1MEC2 4YVSB 1YFWA 1CR7A 1V6OA 2AREA 4BIOA 4YYOA 5C8WA 1R081 2TUNA 4XHBA 5K0UC 2YYOA 4RR3A 4LBLA 4YZ5A 4K20A 3MI8A 5FBZA 4CP0A 5BPXA 5CADA 4Y5Z0 1H0BA 5KHGA 3VBOC 2ZPXA 1G6NA 4XFBA 4AGRA 4YM2A 3MICA 2YC0A 5J36A 2R062 4FPJA 1O3SA 4URTA 1RC6A 2GC2A 1WCDJ 4R9DA 4KU8A 4BZ4A 5FQ0B 1ZRCA 1V70A 3GALA 3URFA 1RVF2 1RUF1 5IK5A 1DF0A 2MEV3 2QUOA 1POV3 4LLOA 3WDUA 4JDMA 4GB31 4HVOA 3AYEA 5CBLA 2RS51 3EO6A 4X8NA 2A7AA 1OOPB 4ATEA 4XBLA 2CNAA 1ZBA1 3NV2A 3MPPG 3K51A 2JD4A 1JUHA 3O14A 1VBB1 3C2UA 4UW4A 3KCCA 1G9FA 1ND3B 3ATGA 3RYRA 1RIRA 5FO7B 2MPFA 3MIDA 4TSVA 5GLZA 1K5MA 4OLLA 2XGXA 3MW4A 1OA2A 2D3RA 4WM7C 4RL7A 2JKBA 4HPKB 4P9WA 1MS5A 3DPRA 4YNIA 4XFGA 1AR73 1IGOA 3WVJA 4YVSC 2YPJA 1LR5A 2OZJA 1M06G 4IEXA 1F9KA 1QJX3 1JTZX 3N7LA 4YGDA 1JYIA 4XXAA 4KBBA 4F8AA 1PZ9A 1O7FA 5F6LB 4FPGA 4PJYA 2UWBA 4FO9A 3J8F3 1KJRA 1DYKA 1ENRA 2BQPA 3KMHA 1AF9A 1MS9A 1QJY2 4Z1VA 1SFYA 2JICA 2ATFA 3L9JT 4XZPA 4LBNA 5FREA 2NZ9A 2XJUA 1JW6A 4YG3A 4YW3A 3WNXA 2RR12 3ES1A 5JSOA 4L8QA 1AR93 1AVBA 4CP2A 1RUNA 2BTVC 1G8WA 1W6QA 4XPVA 4XQDA 2GH2A 4AI2A 4DINB 1SMVA 1KD7A 4EN8B 4R9AA 4CDUA 2Q5TA 1PGL2 3ETQA 4K1ZA 3SCHA 1COV2 4AEDB 2VOVA 2GSYA 3DKWA 4Y4YA 5T5LA 3NVCA 1PGW2 1GQHA 3ZFEC 5I0SA 4GALA 2C1FA 3GZAA 1RHI3 4LBQD 2TNFA 3P3PA 1LOCA 2XPJA 2X5IA 5FDBA 2PHXA 1PO23 4Q27A 2D6OX 1APNA 2ZGUA 1ND3C 3NV1A 4LBQA 4D69A 3VBUA 5GJ6A 4FTBA 4W6XA 5DDJ3 1DG6A 4EWAA 3T2TA 2MEV1 4ISRA 1BCXA 1POV1 3ZYJB 2OW4A 2ARXA 1S2KA 2BNNA 4KH9A 1N1YA 4Y1ZA 1C5IA 3X29B 1VBC1 1RMU2 1B09A 3QACA 1W6MA 1VBE2 1RL3A 4UW3A 1V6MA 3IPVA 1CPMA 2A6YA 2GMPA 4MLOA 4DOUA 2RS32 4AFAA 1R1A3 3RYKA 1FMD2 3VZOA 1C28A 5CA6A 4K9SA 4OHXA 3KQRA 4IXLA 5J37A 1W6PB 1GR3A 1QOTA 1TME3 2X53S 5KC6A 2P3JA 2CWSA 2CY6A 1JBCA 1ZYBA 3M1HA 4LE4A 1DQ5A 4QPIA 1NCQA 3AYAA 2HWF3 1TE1B 2DUQA 1AR71 3APBA 4EN6B 4M3CA 3WDTA 4HKOA 4Y1YA 3WX5A 3VHRA 3ZFFB 1XE7A 4PIXA 3R0RA 4AEDC 4DZGA 1QJX1 4JGYC 4YW4A 1CAVA 2ZMKA 3RRDA 1LU1A 4ITCA 5LRRA 1V6JA 4COUA 3D82A 1ENQA 1N1TA 1UU4A 3FJSA 2DU0A 2EAKA 4AYUA 4JGZB 3J8F1 1XNKA 4CDXB 5FO9B 3M4FA 4DRRA 2ZGRA 1QH6A 1H8TB 3WUDA 4R9CA 4FVVA 1Q56A 2KM2A 4NWVA 1ZRFA 4LA3A 3FHIB 4TZDA 1UKGA 1AR91 1LHOA 4H7MA 4MH0E 4D7TA 5GZDA 1OLQA 1RUI2 2NPIA 3ZXJA 1CN1A 1YI9A 3SLIA 3ILRA 5L19A 3AP5A 4XMAA 4EN9B 4F7ZA 2PAEA 1Q43A 1WMEA 3JBG3 3N7KA 1U5YA 1RHI1 1H2NA 1PNGA 2HWC2 1KITA 1CAWA 3W59A 3CF6E 3PMEA 2HWD3 1PO21 2EXHA 5F6KA 2PELA 4COYA 4E2GA 1Z7S2 1O3RA 1GICA 1OQ1A 2V09A 4XJ9A 4BQ1A 5DDJ1 5K9YA 2WNVC 3WW2A 3LGRA 4RGAA 1LOGA 2W0XA 3BB6A 1FPN2 3OF1A 5DUUA 4GULA 2FHRA 3V0AB 1LOBA 2RM23 3NJZA 3MF9A 5GM0A 1UW8A 1KRIA 1UU5A 3VKNA 3B01A 5ACA2 2WFPA 5DZEA 3FLRA 1UPSA 5GLUA 1S2BA 4COWA 5C9AA 1R1A1 3U07A 1HRV3 1NA1A 2XL9A 2HWB3 2JE7A 4CZSA 5JVVA 1D2QA 4PBOA 1E57A 2GNTA 3MGUA 4FPHA 4YFZA 3THPA 5JAXA 1N1VA 2ZAHA 1Q5OA 3IIAA 1RUF2 3WW3A 1ZRDA 2DYCA 1TME1 4Y22B 4JGZC 2RJLA 3R4UA 3DL3A 1HXS2 4CDXC 2FZ1A 1V9U2 1LU2A 1CJPA 1J1TA 3WLUA 2HWF1 5C6CA 1REFA 2VU9A 3H7YA 1VB4A 1ZBA2 2ZABA 4WVZA 2UYAA 2BVVA 5L73A 2QDNA 1VIWB 1Y3TA 3B3QE 4IEYA 4M01A 4HKLA 2I07B 3AYDA 3VKOA 1KFUL 1JH5A 1MZEA 5IT6A 1FX5A 3VBFA 2D93A 3UK9A 1AYM3 3KGZA 1AJKA 2PHTA 3TNPB 4N53B 1QF3A 3JZVA 1AX2A 1WCSA 1TMF3 4G4FA 4YG0A 5E8AA 4JCKA 3L2YA 4IV1A 4KWKA 4Q4X3 3WY6A 1MVEA 5A32B 5J48A 1B35A 3GBWA 3DN7A 1DDLA 2VECA 5LRSA 5SV5A 2HEWF 3VZLA 1FI2A 5DUXA 1NXD1 2QCSB 3ROUA 4Q0UA 3ILNA 4RQPA 3RDIA 1HRI3 3WP6A 4I30A 4RS5C 1W6NA 4BIFA 2GMMA 1TEIA 1N3OA 4AWDA 5JI9A 1YJKA 5JR7B 1IOAA 2VGDA 2ZGSA 1J3PA 1G9CA 3JBG1 4K21A 3IDEA 2UWAA 1W6OA 1VBA1 5JWPA 1DGWA 1FV2A 2A6VA 3T1LA 4EWEA 4PDWB 2R073 3QCWA 3SXWA 2A3WA 3LWCA 3RSJA 4CYDA 3ZN6A 4OHZA 3ZYRA 1BBT3 3MIBA 1KFXL 3UV9A 2NP0A 3LSEA 5E88A 3VBHA 4MXVA 4ATFA 1H1AA 2GDFA 2RM21 4IESA 1UU6A 1NXMA 3ZXDA 2WZR2 1CAUB 1RUH2 3MYXA 4AQ2A 1CIWA 2IFWA 4YFWA 3NAPB 2D3SA 2LUWA 2HWB1 1WLTA 1JXNA 4FOWA 4I3PA 1KDMA 4QGLA 3WZ1A 4XFFA 3CJIB 3IDCB 4LA2A 4N53C 2Y38A 1W0PA 2HJIA 2W52A 4XFHA 5BNPB 3WCSA 4CDQB 4Z82A 2H6CA 1MVQA 2D43A 2DFCA 2LALA 2XJRA 1M4WA 1ZZ7A 2QDRA 1VBD3 4Q4Y3 4LHLA 1J3RA 5GLVA 2F4PA 1BEV3 4LBOA 3TB0A 1C57A 4ZU7A 1ASJ1