1EV11

Echovirus 1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
281
structure length
281
Chain Sequence
b'GDVQNAVEGAMVRVADTVQTSATNSERVPNLTAVETGHTSQAVPGDTMQTRHVINNHVRSESTIENFLARSACVFYLEYKTGTKEDSNSFNNWVITTRRVAQLRRKLEMFTYLRFDMEITVVITSSQDQSTSQNQNAPVLTHQIMYVPPGGPIPVSVDDYSWQTSTNPSIFWTEGNAPARMSIPFISIGNAYSNFYDGWSHFSQAGVYGFTTLNNMGQLFFRHVNKPNPAAITSVARIYFKPKHVRAWVPRPPRLCPYINSTNVNFEPKPVTEVRTNIITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECHOVIRUS 1
publication title Structure determination of echovirus 1.
pubmed doi rcsb
molecule tags Virus
total genus 51
structure length 281
sequence length 281
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ev1100
1EAH3 3M8LA 1MEC2 3NAPB 5A32B 4LLFA 1X36A 3VBOB 1M06G 1RUF2 1R091 1X33A 1AR91 1C8M2 2HWB3 5CFDB 2WLPA 1QJX2 4AEDC 3DPRA 1RUC2 2RR12 4CDQB 4Y4YA 1HRI1 2WZR3 3VBRB 2RMU3 1ND3A 5L7OB 1ZBE3 1VBE1 4WM8B 2RM22 4YVSB 1V9U2 4RQPC 2RS13 1DDLA 1ZBA3 1VB4A 3ZFFB 2RS33 1TME3 4GH4C 1AR72 1FMD1 2RS53 1RUG3 1R081 5ACA2 1QJU1 1RUD3 1AUYA 2MEV2 2GSYA 5A33B 1VBD2 1EV13 1RVF1 1PO23 2DF7A 1QJY1 1PGW2 1Z7S2 4CDWA 4PDWB 4Q4X1 5FOJB 1MEC3 5K0UA 3ZFGB 1MQTA 5BNPC 1COV2 4QPIB 1RUF3 4SBVA 4QPGC 1C8M3 2HWD2 1QJX3 1HRV2 1RUC3 2PLV1 2RR13 4RS5B 1VBB1 1IHMA 5ABJC 5C9AC 3VBUC 4CDXB 2RM23 5J98B 1V9U3 2R041 3VBSA 1FOD2 1CJDA 4RFT0 3VDDB 1AR73 4FSJA 1RMU2 5ACA3 3CJIA 1ND2B 4CDUB 1HXS2 2X5IC 1RHI2 3IDEA 3NAPC 4Q4V1 4YVWB 5C8CA 2MEV3 1D4M1 1VBD3 1PVC1 4CEYB 3JB4C 1Z7S3 4WM7A 4AEDA 4Q4W1 1NA1A 5L7OC 1COV3 1AL0G 4IV3B 4GMP3 4YVSC 4FTEA 1RUE1 2BPA2 1HRV3 5JZGC 3JD71 3ZFFC 1BBT2 3ZFEA 1NCQA 1AR81 1VBA2 1PGL2 1OOPA 1FPN2 3JBG2 1FOD3 4GMP0 1NG0A 1RMU3 2R061 3VBFA 2HWF2 5LK7B 4Q4Y1 1RUG2 1K5MB 1NY72 1RUH1 1HXS3 2HWE1 4Z92B 4PDWC 1RHI3 3ZFGC 1RUI1 2WFF2 4QPIC 5C4WC 4RR3A 3S6PA 1B35C 1AR61 4N43A 1NCRA 4GB31 2VQ0A 1POV1 5DDJ1 4RS5C 1TMF1 2WS92 4CDXC 1RUJ2 2HWD1 1PO12 1AYN2 4JGZC 5CFCA 1BBT3 2XBO1 3DPRB 1VRH2 3VDDC 1VBC1 1VBA3 3VBHA 1ND3B 5D8AA 1ND2C 4CDUC 1FPN3 3JBG3 1AYM1 4YVWC 2XPJA 2R071 3TN91 4CEYC 2HWF3 1OHFA 1ASJ1 4JGYC 1R1A3 4EJRA 3J8F1 2HWC1 2WFF3 5BNNC 4N53A 4IV3C 1VAKA 4CEWA 4RHV1 2TBVA 1GFF2 1BMV2 1WCDJ 5JZGA 1PIV2 4CDWB 1EAH1 5J96B 2WS93 5K0UB 1QQP2 1RUJ3 1MQTB 5AC92 1H8TA 2ZTNA 4IV1C 1PO13 1AYN3 2HWB1 2BFUS 1VRH3 1AL23 1BEV2 2WZR1 2RMU1 1ZBE1 1K5MC 2RS11 1ZBA1 1E57A 3VBSB 4FTSA 5C4WA 5BNOA 2RS31 1TME1 1R092 2RS51 1AR92 1RUG1 3CJIB 1RUD1 3VBOC 1HRI2 2IZWA 5C8CB 1VBE2 1EV11 5CFDC 1PO21 5FMOS 1PIV3 4WM7B 4AEDB 1MEC1 1NA1B 4CDQC 1QQP3 3VBRC 4WM8C 1FMD2 5AC93 4RQPA 1R082 1RUF1 1C8M1 1QJU2 4RQPB 1QJX1 1RUC1 2RR11 1BEV3 4GH4A 4GH4B 3ZFEB 1NCQB 4JGYA 1RVF2 2RM21 1V9U1 1QJY2 4Q4X2 1OOPB 5BNNA 3LOBA 1AR71 3VBFB 1R093 1AR93 5ACA1 1R1A2 2PLV2 4CDWC 5BNPA 1VBB2 1HRI3 1VBE3 2MEV1 5GKAC 4QPGA 1VBD1 1POV0 2R042 1PGW1 4RR3B 1Z7S1 4N43B 1NCRB 5ABJA 5C9AA 3VBUA 1COV1 1FMD3 1R083 1QJU3 4GMP1 3JB8A 1CD3G 1HRV1 4NWWA 5CFCB 1AL22 1D4M2 1W39A 1PVC2 1RVF3 1QJY3 2X5IA 3VBHB 3NAPA 4Q4X3 5D8AB 5A32A 1F2NA 2X5IB 3VBOA 1FOD1 5C8CC 1RMU1 2BBVA 5CFDA 1RUE2 1HXS1 2PLV3 1RHI1 4WM7C 4CDQA 1NA1C 1NOVA 2FZ1A 5L7OA 3VBRA 1VBB3 3JD72 4WM8A 1VB2A 1AR82 4YVSA 4N53B 2R043 2Y26A 4CEWB 3ZFFA 2ZZQA 1SMVA 2FZ2A 5JZGB 4BCUA 2R062 3ZFEC 1NCQC 3FBMA 4Q4Y2 2HWE2 1RUH2 1H8TB 1OPOA 1OOPC 4Q4V3 1RUI2 5A33A 1BBT1 1D4M3 1HX6A 1PVC3 3VBFC 1VBA1 1PGL1 4PDWA 4Q4W3 1AR62 1FPN1 3JBG1 4GB32 3ZFGA 5DDJ2 1TMF2 4QPIA 1A6CA 5C4WB 2HWF1 5BNOB 1RUE3 1B35A 1NY71 4RR3C 1B35B 1R1A1 4N43C 2ZAHA 1NCRC 4RS5A 1C8NA 3JD73 2XBO2 4CDXA 2WFF1 1AR83 1VBC2 2WWSA 4JGZA 1AYM2 4JGZB 2GH8A 3VDDA 5CFCC 3DPRC 2R063 2WS91 2R072 3TN92 1RUJ1 1ND2A 1ND3C 4CDUA 4Q4Y3 2HWE3 1RUH3 1ASJ2 3VBHC 5D8AC 1PO11 1AYN1 2HWC2 3J8F2 4YVWA 1RUI3 1VRH1 4NWVA 4CEYA 1AL21 4RHV2 1AR63 4JGYB 4GB33 1HQNA 1POV3 2BUKA 3ZXAC 5DDJ3 1EAH2 1TMF3 4IV3A 5BNNB 4Y5Z0 4N53C 2HWD3 4CEWC 2HWB2 2BFUL 2XBO3 5K0UC 1VBC3 1MQTC 2WZR2 5BNPB 1RB8G 2RMU2 1ZBE2 4IV1A 4FTBA 4QPGB 1BMV1 1H8TC 4IV1B 1F8VA 2RS12 1AYM3 1ZBA2 1PIV1 2R073 3TN93 1QQP1 2RS32 1TME2 5C9AB 3VBUB 5ABJB 2QQPA 1K5MA 1ASJ3 1QJZA 5AC91 2RS52 3J8F3 2HWC3 1RUD2 4Q4V2 3VBSC 3HAGA 1BEV1 4RHV3 5BNOC 1EV12 5FMOL 1PO22 3CJIC 4Q4W2
chains in the Genus database with same CATH superfamily
1EAH3 2ET1A 2QDRA 4MADA 1CESA 1UMHA 4K20A 3I8TA 4RA0A 5F5QA 3GBWA 3OBRA 4YRDA 5GLZA 2P2KA 2AACA 1V70A 2DCZA 1UPSA 5FQ0A 1AR91 5FYUA 2HWB3 1WLTA 2E33A 5LA9A 4AEDC 1QU0A 1RUC2 2BGPA 1C1FA 4ARXA 1RGSA 2JD9A 1SLAA 5B4NA 4S2DA 2YG0A 3ENRA 3RNSA 1ND3A 3AMHA 3TB0A 1VBE1 4WM8B 2BW8A 2KD7A 2ET7A 2ADEA 4GWJA 2BVBA 4ZS2A 2RS13 5C71A 3M3QA 4LBMA 5JR7B 5I91A 4Y20B 3ZSKA 4BA6A 5FXZA 4UF0A 2VUAA 2V73A 1GUIA 1KJLA 5I8TA 2CV6A 2QKDA 4BQ1A 3LIGA 1AXZA 1QJU1 3PMEA 4KWJA 1URXA 3I4IA 2QQWA 3V0BA 3NNJA 4JQRA 2PQSA 1MZ6A 1W0OA 4IETA 3WNNA 1CAWA 1OFSA 2VOWA 5J48A 2EAAA 1OLRA 3W58A 5K9YA 3WDTA 4CP0A 1PO23 3HN1A 1XOYA 4K8FA 2DVAA 3OD0A 4CDWA 2JDZA 1MEC3 2Y64A 3PLQA 1CAXA 4M4PA 2ZKLA 4Y3OA 4M3CB 4YWAA 1T6BX 2JDNA 5A7OA 1CONA 2VMCA 2VH9A 4XMAA 1W6MA 1IZ3A 1RTVA 2VOKA 4K7JA 1HQWA 3WP6A 1JUIA 2VZUA 3AZWA 3ABZA 4A44A 1YQCA 5ABJC 4Y22B 1JYCA 1AX0A 2Z79A 4JQTA 3NNFA 4PCRA 5C3PA 4ZS3A 5LEJA 5CAZA 4LBQB 4NAMA 1V9U3 4P08A 2QDNA 3H8XA 2GMEA 3VBSA 4XACA 1D2SA 2R0HA 4IE0A 1FOD2 3VKOA 2E7TA 1G8WA 2WAAA 1B09A 4IEYA 1UU5A 4COYA 3H7YA 4CXXA 2VMFA 3RRDA 1AR73 3HT2A 1RMU2 1YXWA 1Z78A 4CTEA 2XWBB 2Z42A 1LHNA 5ACA3 2JECA 3CJIA 1ND2B 1O4YA 2WIIB 1PM4A 4META 2X5IC 3WW2A 3TEXA 1Q8OA 1W28A 4AG4A 2XH6A 4YVWB 2YPJA 1UZWA 3C3VA 2VQTA 2MEV3 3B9CA 1H4GA 2B4KA 3FHQA 4IERA 2QQMA 1I5ZA 1X9TA 2CDPA 2JXAA 4NHLA 4Q4W1 4CCNA 4I0AA 2YC0A 3FUOA 4GULA 4HKOA 4KL1A 5CVRA 5FZ0A 3WDVA 4AVAA 4YARA 4K9SA 2ZGQA 4KG0A 1JHJA 1Q43A 3OF1A 5GLUA 2VUCA 4IV3B 4NUBA 5BV6A 2ZCWA 3LDBA 4CCEA 5EYXA 2DCKA 3AXDA 1JW6A 2PHUA 4GMP3 4HXCA 1RUE1 4Z8BA 3W5NA 3WCRA 3WXPA 1HRV3 2BPA2 4CCOA 4PF1A 1KFUL 3EXUA 5T55A 1UY4A 2WDBA 3VZOA 1G9BA 3VZLA 5F9TA 1W8HA 5JZGC 1BBT2 1NCQA 3K77A 3V0AA 1IS5A 3WQ0A 2BP6A 4EZ4A 1DQ4A 3AKRA 5JI7A 1BK0A 1QEXA 3JBG2 4AL9A 5J09A 4AFDA 2LS6A 1LU2A 4XJAA 5BNOB 1JZ8A 4YGBA 2WNEA 2R061 3VBFA 5FMDA 4XCBA 5LK7B 4DXSA 4Q4Y1 2HWE1 1RUH1 1PZ7A 1HXS3 5B2GB 4YYOA 4PDWC 3ASIA 5CYYA 1XNKA 3FUQA 3KV4A 2WNVC 4FOQA 1O91A 2G1MA 3JCIA 2V72A 1QXRA 3KB5A 3ACGA 2PHDA 3MIGA 5LCWL 4OQ9A 3RZHA 5FY0A 1W6PA 3NMBA 2G9GA 5JMCA 1QJEA 2OUJA 4EWAA 1YIFA 5FPZA 4YNIA 4LE3A 5DDJ1 3ZIXA 3HPNA 1TMF1 1UOGA 2A6WA 1RXFA 4R9DA 5ERLA 1US2A 3VD3A 2OUHA 5FY4A 3AP6A 1G6NA 1H1IA 2A6ZA 1PK6A 3MIEA 2JDAA 1IPSA 1JI6A 2EVXA 2Q30A 3HNYM 3OG2A 1W04A 1NX9A 4XOGA 1RJ8A 1VBC1 2CU5A 4C90A 2FDHA 1OLME 3POWA 4XFBA 1CX1A 1SZBA 5JIAA 1WBLA 5JXGA 4RYDA 1ZNPA 4CDUC 1FPN3 1H2KA 4DUXA 1UYZA 1HB2A 4SLIA 3KQ4B 5F2WA 5FREA 1LOBA 1ZVFA 3AVRA 4FFFA 4XBQA 5CZKA 4FPCA 3H50A 2VNOA 3GBGA 2ZXQA 1ST8A 1DQ2A 4PT6A 1W3VA 2FMDA 1NLQA 2GC2A 3AFKA 5L9VA 1DQ5A 4YZ5A 3IIIA 1R1A3 1DGLA 2C24A 4EJRA 4NHMA 2FDGA 2VVFA 2ZA9A 3CLPA 3FN9A 3WF2A 3QBQA 3ZVXA 2JEMA 4B7EA 1HJFA 5BNNC 1JYNA 5AFBA 5LRRA 3ZPYA 4LBNA 5A3TA 2VTXJ 1VAKA 4CEWA 4RHV1 4FPKA 3WINE 3WW3A 4AHWA 4QX2A 5FJKA 1APNA 1JU4A 1LHWA 4M0HA 2WT2A 4Z2AA 2VQAA 3IT8A 1PIV2 3A21A 4QU1A 1BVP1 5E1RA 3J7MA 3R4UA 3SH4A 4YZ4A 5T50A 5C5UA 5FYTA 3ZYGA 5AC92 3RZJA 4XAEA 4JRAA 4YSFA 3H0OA 1LGCA 4LKSA 3BUCA 1ODMA 2H6CA 2ZGKA 3VD4A 2VAUA 1N1SA 1XJAA 4XTMA 5L9BA 1O3QA 2QBXA 2VMIA 1O8PA 4LITA 2JG8A 5EIYB 4UW6A 3OGRA 1GSLA 2UWCA 3MW2A 4KGQA 3ST7A 3WHUA 4XZUG 1FAYA 2A3WA 4Y1VA 4EROA 5IAVA 4Q1RA 1E57A 3PTYA 5G05L 5A6QA 2A3YA 3T0BA 2Y6KA 2X53S 3NSTA 5C4WA 4FQZA 4P9IA 3O1RA 2LM3A 5BNOA 1W6QA 2RS31 1BCXA 5F6KA 1W6NA 3DECA 1GZTA 1N3QA 1VMFA 3ILFA 3FE5A 4NIAA 3RYPA 5JDBA 3I2KA 1WLDA 3JUUA 4I3PA 5APAA 4AEKA 4CU9A 1CQ9A 2W46A 1HDKA 1S1AA 2A1XA 3VBOC 2JKBA 2IZWA 1MS8A 3ALQA 2GNBA 3F2ZA 4R9BA 2P6HA 3WDUA 1EV11 5IVYA 4FBFA 4M3CE 2PHXA 3LOIA 3UK9A 4FFIA 4FPHA 5FMOS 2K9ZA 4BM8A 4WM7B 4AEDB 1W0NA 5FYMA 4CDQC 1DZRA 3I3MA 5FPXA 2B5HA 2P3YA 2YDEA 3I59A 1L7QA 3N9LA 4YG6A 2YB7A 5FP8A 2KM2A 4RQPA 3B9IA 1R082 3VHPA 4Y26A 2EAKA 1QJX1 4NHYA 1W2UA 4E9KA 3A7QA 2HLEA 1KDMA 2AENA 1KDKA 4IGQA 4GH4A 4P5YA 2W5FA 4EYUA 5A6XA 2Y6LA 4A41A 3ZFEB 5EWSA 2IXKA 3OUIA 1LGBA 4F8AA 2CGNA 1KRIA 1RYYA 1QJY2 4IXLA 4LUKA 4Q4X2 2EICA 4NRPA 4WZCA 3ZYIB 2GH2A 2IXIA 3J4UH 3C2UA 4AQSA 1D0GA 1VR3A 1REEA 2AZ5A 2XXZA 4R8HA 3V56A 3LOBA 5L36A 2WO3A 4LJHA 1W6OB 5FOBB 1OD5A 2YU2A 4KGGA 4P9LA 4QD2A 4YGDA 5CG8A 4MGZE 5FUPA 3ZYPA 1R1A2 4BMBA 4RL7A 4ONUA 2PLV2 1RUOA 1F35A 1HRI3 4IEUA 4YZ3A 3WF4A 5GKAC 4QPGA 4B29A 2W1UA 4J1XA 1XNBA 3R6SA 3TEZA 1BYHA 1OLMA 3O0WA 4Y1ZA 1OXCA 1PGW1 4RR3B 3SXWA 3DXUA 3WDWA 5HXVA 3H8OA 1DGRA 1QGLA 4N43B 4O9GA 5DAQA 2QZ3A 4ISQA 4Q0VA 5LRSA 4DMIA 3VBUA 1S0CA 3BTZA 5AFEA 3OGVA 1YWKA 4Q8KA 4DXRA 1UZYA 1PHMA 4QPWA 1BVVA 3OD4A 3LSDA 4N9HA 5T5JA 4O65A 4I3GA 4NWWA 4LIVA 2VW2A 1V6KA 2ZPXA 3AXEA 1ULOA 4JTOA 3RMYA 3S5AA 1PZ9A 1ENXA 1OA3A 2JG9C 2ZGOA 1YI9A 2ID4A 3KCCA 4GWNA 1RVF3 2Z5WA 3LDKA 3D6EA 3LKJA 1CVNA 4XQ4A 3VBHB 3X29B 2EXJA 3K4AA 1LHVA 4H14A 3B02A 5D8AB 1DG6A 1UY1A 2X5IB 1UMIA 2ZEYA 3WR0A 5LA1A 1X7NA 1CAUB 1ZZ9A 1JU3A 1NZCA 5FYHA 2QQNA 5KWRA 2D3PA 4NOTA 4CP9B 3AMMA 1TZOA 3J7NA 4BPZA 4ATFA 2O14A 1IG3A 5C3OA 3VD5A 2PTMA 3UJOA 3WUDA 4A3XA 2GMPA 1RHI1 2ZX0A 3W9AA 3AK0A 2FZ1A 1RC6A 1VBB3 1OLQA 2B39A 1IKPA 2ZGUA 3I3EA 2DUQA 4WM8A 1F4HA 1VB2A 2WT0A 1AR82 2QE3A 5EHDA 1E5SA 4WBBA 3UYJA 5KXEA 4DUVA 2W87A 1RINA 2XR4A 2Y26A 3KGZA 4JDNA 4LA3A 2OQ7A 2XJPA 4MHUA 1D0HA 4Y20A 3T30A 1IOAA 4NPMA 5F5AA 5JPNB 5JZGB 3I2JA 1K12A 2Y33A 2SLIA 4OHXA 1DYKA 3TOJA 5HBAA 1S2EA 1UOFA 2VU9A 3BIEA 1O5LA 1AZDA 1QDOA 4PBPA 5FZHA 2J1RA 2JICA 3V64A 1OOPC 5FZKA 1WCQA 5CG9A 1WCSA 4H55A 1YQ6A 3CMGA 4S2HA 1O3RA 1FI2A 3BODA 1J1LA 4JKLA 1D4M3 1HX6A 1LRHA 2D93A 2JB8A 2QNKA 2RJ2A 3HR9A 4HFSA 3MF9A 2A5ZA 4KWKA 5T5OA 4XEZA 1KS4A 5FP4A 4CU8A 5IVEA 1U5YA 1MS5A 4GB32 4M3CA 5FZIA 1I6XA 5D21A 3U75A 3AKSA 2OVUA 1A6CA 1HV0A 1U0AA 2HWF1 2DTWA 2D6MA 2BERA 4FOYA 4L99A 3ZN5A 2DTYA 1GZWB 4CUAA 3LZZA 4I0WB 3N9PA 5E89A 4OMCA 2WFF1 4QM8A 1SPPB 1WMFA 2WWSA 4J1WA 4LBQA 3MHZA 4LA2A 4X6RB 2OYZA 1GQPA 4BU2A 5HXMA 1MS0A 3OGJA 4BQXA 4JGZA 3LD8A 3VD9A 1CIYA 3KWVA 4LOSA 1W8OA 2GH8A 3POIA 2VR4A 3GZUC 3MIDA 3DPRC 4JC1A 4PI0A 5DUVA 5I0RA 2WS91 3O0VA 3TN92 2PXJA 4XHBA 1H6XA 1ND2A 1SBEA 3C8XA 4I02A 5FZFA 2CNAA 2E6VA 4PLMA 3KHBA 3ZSJA 5EPAA 1PO11 2BNOA 4YVWA 3B01A 1RUI3 3O1TA 1R64A 4WVWA 3SNMA 5F5CA 1AL21 4ES9A 3HWJA 3OBZA 4HPKB 4IQPA 2LALA 1WMDA 3G6JB 1AR63 5FPBA 2X05A 2WN2A 4LHLA 1VMJA 1YHFA 1POV3 1WW6A 2HYKA 1MVQA 5JMOA 1OQ1A 2ZGTA 4AWDA 2NMNA 2VXJA 4IV3A 5BNNB 1DYOA 1YYNA 3HOBA 4EV0A 2VULA 4Y5Z0 5J1XA 2A73B 2GAUA 3D8CA 3DN7A 4XQWA 3ECQA 4MGTA 4PBOA 3VKNA 4ZXKA 3RZKA 2BGOA 2XBO3 4QB1A 3T08A 1GOHA 5K0UC 1MQTC 2E63A 5FAXA 1XNAA 4D8MA 1ZYBA 2A70A 4YG3A 1H8TC 2WUHA 5AVAA 2YUEA 5F3CA 4D69A 1QH7A 2YFZA 1L3JA 1FV3A 3I7DA 5I93A 5CIRA 4A4AA 5JXIA 1QQP1 5C9AB 1TME2 3UGFA 4FQ4A 1ASJ3 1QJZA 2DURA 2RS52 3O1PA 2XHNA 2VOVA 5FYSA 1OMIA 3J8F3 5FZ1A 1RUD2 4QKNA 1STMA 5IK5A 5FZ7A 1HN0A 1YNAA 2WQ4A 1KQRA 4CCMA 2BEOA 2W0XA 2ENRA 1UY3A 5KHIA 3Q8BA 1Q5OA 4JX0A 3QACA 2ZHKA 5A32B 1UYXA 4TWTA 3T0AA 4LLFA 3BU0A 3J9SA 3VBOB 3VDAA 1PMJX 1JYWA 1RUF2 1R091 1X33A 1C8M2 3POEA 4BLIA 1ZRFA 5A7NA 1J59A 2WLPA 3WG1A 2A6XA 1X82A 2AREA 1S55A 2D5FA 2XJSA 2RR12 2IUWA 4CDQB 4TXWA 4HN1A 4KI5M 4Y4YA 4HVRA 3ZDSA 1TG7A 2WZR3 3LPGA 2RMU3 5EQUA 3G7DA 1N47A 1ZBE3 2ILMA 5L7OB 1ACCA 2RM22 4XQDA 4B7KA 2WYFA 3ZO0B 2CAUA 1DDLA 3FL7A 4BB3A 1CN1A 1ZBA3 1A34A 4O9EA 4BIOA 3ZXGA 1KGYA 1Y9MA 4DZGA 4NRMA 4UW4A 5DXDA 5KR7A 2WABA 5KC5A 5FZBA 3E1F1 1FMD1 2ORZA 4HLTA 3WDXA 4KBZA 1NAEA 1J83A 2R30A 3K3NA 5FO7B 3WD5A 4XXPA 3RVHA 1LOGA 4OHWA 1GOFA 1GWLA 2VCMA 3ILNA 3VZNA 4KU8A 1JHNA 3OEBA 1VBD2 4F7ZA 2AEZA 3L2YA 3PUQA 1W0PA 2DF7A 3E97A 1Z7S2 2WC2A 5FOJB 4QX1A 5FPAA 1VRBA 2AEYA 1UPIA 4NE9A 1R1ZA 1A8MA 3T09A 5HV4A 1HB3A 5BNPC 1COV2 4D0QA 2WA4A 2E7AA 5A80A 3O5SA 4URAA 5FFOC 2E9QA 2GZWA 2HEVF 1ODNA 3I2OA 4G4FA 1RUC3 2E51A 4DXZA 3H3UA 4H7LA 2BOIA 4JKKA 4QHZA 4RS5B 3WNKA 5LBCA 4C0BA 5FP9A 2G4IA 3NJVA 4Q0UA 2LRPA 1EP0A 1RL3A 3HVDA 5GZFA 3WQBA 5BNQA 2R041 1W9FA 1Y9QA 2GMMA 1PMIA 1CX4A 3P3NA 1WLCA 1CJDA 4RFT0 3WNMA 2VC9A 4CUCA 3VDDB 2JENA 3B69A 2MPFA 2A3XA 5F37A 3KS7A 4JDMA 1VMHA 4B4PA 5DQ0A 2JX9A 3BALA 3NAPC 4DIQA 2PAEA 4YZ2A 1UZVA 4ASMB 4QAWA 3MIBA 3R4SA 1PVC1 3E6BA 2OXBA 4XDQA 5FBZA 5LASA 4AW7A 3PDQA 3C7EA 1HB1A 4XBLA 5DUUA 3TAYA 2PMWB 4WM7A 3AYEA 2AGSA 5FRAA 1WMEA 1UZZA 4AEDA 4BWOA 4MO3M 5BXXA 3SITA 2O0OA 1J1TA 4LORA 1OI6A 3AL5A 4HKWA 3K51A 4GXLA 3ZYHA 4EZHA 1CGPA 4EN9B 5FZOB 4HETA 1W05A 4YVSC 2FBEA 4FTEA 2ZHNA 4FXKB 1SDDB 3U11A 3NKGA 2FQPA 3JD71 3ZFFC 1SDWA 3KV5A 4WVMA 5FZGA 3ZFEA 4AI0A 4EE2A 1RITA 4LO7A 3MDPA 4OLLA 3NV1A 1VBA2 3LCPA 4XDOA 1PGL2 5JCTA 4YM3A 3KM5A 4BJ0A 1PX3A 3SC7X 4QU2A 4XUPA 5FV3A 1FOD3 3SCFA 3FFZA 3POYA 2XJRA 3GCWA 2WRAA 3WVJA 1RMU3 2BGCA 2JE8A 1WCUA 2XLGA 1MACA 4NIHA 1IQDC 1K5MB 1NY72 4LUMA 3CZUA 2YGMA 4M3CF 3R0RA 4O61A 3ZFGC 4COZA 1LHOA 2RDRA 1NQDA 1IG0A 3MPPG 4H2AA 2ES3A 4QPIC 1ULEA 3C7OA 4PLOA 1REFA 1SLLA 4Q29A 2SBAA 5JOYA 2WINB 4RR3A 3QLQA 4GAZA 4OI2A 1JH5A 3WP5A 5JSOA 1UKGA 4N43A 1GICA 3RFRA 2A6VA 2RHPA 2VQ0A 3I97A 4HSJA 5IATA 4QQ2A 1GBGA 4CDXC 5FR3A 1RUJ2 2WYSA 1M4WA 1CPMA 2ADDA 2HBTA 1O5UA 3WG3A 5C5TA 2UU8A 3BB6A 5EJ1B 1PMHX 1AYN2 4LO6B 3ZN6A 2MHFA 2DFBA 1BBT3 5C3RA 3DPRB 1VRH2 5IUQA 3A0KA 4J25A 4MZUA 2VZRA 3HT1A 3VBHA 1F5FA 5JWPA 5D8AA 1TE1B 4MGQA 4AYUA 5HPOA 3WF3A 3JBG3 3RZLA 1FX5A 1CAUA 3F95A 4XUOA 2YC4A 3GHNA 1AYM1 3WP4A 4CPBA 5A3LA 2JDYA 4CP9A 3DF0A 3OJBA 4AGRA 2P5BA 2JE9A 2R071 3OYWB 4CEYC 2PHTA 1QJFA 2UY9A 1DP0A 1OHFA 4ORFA 4QQPA 1IGOA 3PIJA 2QQOA 4FO9A 4K3UA 5FDBA 5FZ6A 2HWC1 4R4ZA 1AF9A 4UFHA 1HLCA 1UD1A 4AEMA 4HT1T 3RWNA 4YW3A 3THDA 2VJXA 4MVTA 5E8AA 1WGPA 1QOSA 4B1LA 1X9PA 4CVUA 4L0PA 5JZGA 2NLRA 1EAH1 4QHBA 1D7PM 3MICA 4Z1VA 5K0UB 1DHKB 4XVHA 1MQTB 4XFFA 2EXHA 3O1MA 1KFXL 2JJ6A 2C9KA 2VUJA 3TWIA 1A8DA 2P3KA 2HWB1 4OYUA 2WT1A 4IDZA 1I9RA 2XGXA 4OQ8A 2QQLA 1BEV2 1XYPA 3AP9A 3S0MA 4QB6A 5FCCA 3GYDA 4QDSA 4LBQD 4MLOA 1W90A 2RS11 1UQXA 2IWGB 2B42B 2CHHA 3SH3A 2C26A 3OUJA 5FUNA 3AZZA 3AKQA 4QX0A 1JYTA 2AH2A 4MGYE 4LMFA 1AR92 5SV5A 4GD4A 2OPKA 4W6XA 2ZGMA 4IGOA 3D0SA 3PIGA 1SPPA 4LBOA 1G9CA 1MZ5A 3ES1A 2G19A 4FVVA 1ZZBA 2QUOA 4XFIA 4DY3A 2YZ4A 2ZOEB 1VBE2 5C8CB 1JZ2A 5CB7A 4XF3A 4UFJA 4CE8A 2Q0AA 4ZONA 5CFDC 2GDFA 1PO21 2VMHA 2ZAAA 2O8OA 4Y1YA 1PIV3 2BYVE 2IXLA 2DU0A 1MEC1 1NA1B 2O1QA 2YBKA 3ELNA 3S30A 4LT5A 2E32A 3VBRC 4IW3A 5IVFA 3TYJA 3LF7A 5AC93 4AK3A 1V6JA 1NXMA 2R6QA 1UCXA 4NN0A 5A6YA 1QJU2 3ZMNA 2W1QA 5F32A 5GM0A 1O59A 1ULPA 2JE7A 3SEPA 3QH6A 4PF5A 4XFHA 4HPKA 3PUHA 4HKLA 4YG0A 1I5PA 2YGLA 3SKJE 5A3OA 2WWUA 3BTAA 1E5HA 4EN0A 2D6PA 1V9U1 2DUOA 2EXIA 2UYAA 5EP9A 5DZFA 5IK7A 4QT6A 5BNNA 5GLWA 4UW3A 4KQ7A 5FP3A 1ZZCA 3VZMA 5I0DA 2J22A 5L19A 3DYPA 1EYBA 1W9TA 1J58A 1AR71 5FYZA 4LO5B 4AXOA 1YFUA 2B9VA 5ACA1 3BPZA 2PFWA 4CDWC 2NMOA 1X8MA 2WKKA 4QX7A 3PJQA 4TTGA 2MEV1 1A3KA 1POV0 3K48A 3C7GA 2VOXA 2VOTA 2VMDA 5LATA 1ONAA 5JPMB 5FPLA 5IK4A 4IE4A 1GR3A 1U5ZA 4HMZA 1Y7BA 1NCRB 4OZOA 5LBFA 3M3IA 5DABA 3VL8A 3RZZA 5C9AA 3AMPA 4AVSA 3K2OA 3BVCA 4LK7A 4BHPA 2R7EB 3U37A 1R083 1OC1A 4CA9A 4CCLA 1RUNA 4ZU4A 4GMP1 3HBKA 3HNMA 2P4EA 1HRV1 1CZTA 2P34A 5CFCB 4E4DX 5FMBA 3ZN4A 3GF6A 2G9FA 1W39A 2VZTA 2XONA 4LKEA 4V2VA 5FK8A 3NV2A 4IEVA 4R9CA 4CP2A 1QJY3 4XXAA 4Q4X3 5A32A 3Q8FA 2WSVA 1XSRA 2ERFA 4LO8A 3VBOA 1KS5A 4CSWA 2WZ8A 5FKBA 1LKNA 4QMAA 3MIHA 4P9WA 5SV8A 2BBVA 4Z2WA 1UX6A 3VKFC 1U12A 1RUE2 3RG0A 4MYEA 4UBGA 3OSDA 2E31A 1HXS1 3A23A 5HCBA 2PLV3 5DMYA 4CDQA 1UAIA 2RVAA 2OPWA 3DL3A 2A7AA 2BU9A 3ZXEA 4CUBA 5JUVA 1XB9A 1W9WA 5BYNA 5L7OA 4P02B 2C0ZA 1L7RA 4BXFA 2CY6A 5EFUA 4N53B 1UIJA 3CHXA 1LCLA 2ARAA 1UZ0A 4L11A 4NPLA 5A7WA 1POQA 2P3JA 1LB2A 1UNBA 1XSQA 1UU4A 2XB6C 2ZEWA 1SMVA 5FZEA 2ZABA 3APBA 2R062 1NCQC 4IEOA 3ZXKA 4F3JA 1OT5A 1OUSA 2BBAA 1S0DA 2R0FA 3INAA 4Q4Y2 2HWE2 1RUH2 2Y0OA 4FI9A 4YGEA 5KXCA 4UOJA 2B9UA 2B45X 1OPOA 4PQQA 2I45A 3OGSA 4Q4V3 4NRQA 4HL0A 2YMZA 4QX3A 3LSEA 1QNYA 1CIWA 2YXSA 4CYDA 4MGKE 2NYYA 5F2SA 3T1LA 3VBFC 4XURA 1ZREA 3ZIWA 2XHKA 3N7JA 1FPN1 3LEMA 3FJSA 2RE9A 1TNRA 2PA7A 5FZMA 2BVVA 4LR4A 4KWLA 3THPA 5DDJ2 3AMQA 1TMF2 1PX4A 2ZS6B 4CU7A 3H3ZA 4AFMA 2CAVA 2D5HA 3VDCA 5M0TA 3IDBB 4LHSA 1KD7A 5F8PA 3K46A 2OW4A 4XF4A 3S5QA 1B35A 1HN1A 3AM2A 5DPNA 2VZVA 1R1A1 4QXCA 4W6WA 1CAVB 1ZZ6A 2DVBA 4IL7A 4RS5A 5GZEA 2QVSB 5IT6A 4INDA 2NQYA 1XE7A 2RJKA 1AR83 1VBC2 4D6SA 3VUOA 1OKQA 1SBDA 4F83A 3HMYA 5EJZB 1XRUA 1OVPA 4G9SB 3ZMOA 1AX2A 1GLHA 1PK6C 3VHOA 3VDDA 3RSJA 4Y24A 1UN1A 4DO0A 4ZZ5A 1YFWA 4BLJA 1T6GC 3I2DA 1OKOA 1VPHA 4IGPA 5EYYA 1GZCA 3SEEA 4I30A 1J3PA 1OUXA 3VZJA 1G9AA 1O3TA 4FPLA 1YFYA 2PQQA 4I01A 4XUTA 1DIWA 1JZ4A 2RG4A 4TZDA 4XFAA 4D3WA 2BWAA 3MUY1 3EMRA 3LGRA 3PTRB 4M4RA 4RHV2 4XFGA 5FLJA 4GB33 2Y6JA 1HQNA 2Q1MA 3ZXAC 3GXUA 3ZM8A 5FZOA 2WWJA 1QDCA 2X10A 3WQ1A 1QKQA 1Y3TA 4JDOA 5H9QA 2HWD3 3UJQA 2DBNA 4CEWC 4QXHA 1EUUA 2ARCA 4YPJA 4D7YA 4Q26A 3CDZB 4FT8A 1DFQA 1UX7A 3OBAA 5JXHA 2LW8A 4HK9A 4AI8A 2WNUC 4IV1A 4FTBA 3FBYA 4LNVA 5KHGA 1SACA 3CBNA 2Q4SA 3N9QA 4XTPA 3VL9A 1BMV1 4D7TA 1YQ8A 2E26A 2JDHA 5T5PA 4W6YA 2UYBA 4QKDA 1KITA 3D82A 3RZMA 3TN93 4K40A 2RS32 5ABJB 4MX3A 2K46A 5C7GA 1K5MA 5IVVA 3I2IA 1PZ8A 1NE6A 4AVVA 2DFCA 1TNFA 3NNMA 2V4AA 2AC1A 4QQHA 4AVBA 4BH9A 4Q4V2 4ATEA 2GNTA 3UETA 2J7MA 3NJZA 4QDQA 4AZZA 3C7HA 1DBNA 1OQDA 1E5RA 3BTXA 5BNOC 3Q8CA 1YQ5A 2VUDA 1EV12 2GNMA 4X8NA 3ACFA 5F3IA 1ULDA 5FMOL 4P9GA 4YW2A 3FWEA 4QQOA 3B5LB 3BTYA 1KJRA 4AR2A 4CXYA 1ENQA 1YJKA 3RI8A 5I0TA 3V65A 1S0BA 1A78A 3MYXA 1X36A 4AFBA 2K0GA 4L9BA 2VNVA 3PUIA 1AXYA 1XE0A 3R4DB 3AZXA 3WG2A 4B8EA 2WNOA 2YFUA 2P1BA 2XJQA 3PNAA 5CFDB 1OH3A 5LK5A 2RV9A 1QJX2 1VAVA 3NV3A 3DPRA 1DF0A 1HV1A 4LHNA 3HQUA 4Q8LA 2DCYA 4YLZA 4Y33A 1HRI1 3VBRB 2J1EA 3LDRA 1YCIA 3GCXA 4RQPC 4JVAA 1OA2A 1UWWA 2D7FA 1QNWA 1V6OA 1XBFA 4AFAA 3QD6A 3CO2A 1TME3 3OUHA 4GH4C 1WBFA 1XYOA 3MLLA 2RS53 2OZ6A 1RUG3 4GALA 2BNNA 3PMSA 4YFZA 4JAAA 1RUD3 3MBWA 5IYYA 2C5DA 4ES8A 1V6NA 2DU1A 4LBJA 3V0BB 2UY8A 3RYRA 3ON7A 2GSYA 3ZXLA 1RVF1 1WLWA 2DWRA 4TLGA 3GZEA 1H4HA 1H30A 3Q8EA 4Q2FA 1ENRA 1PGW2 1SHWB 1BKZA 4C1WA 4PDWB 3NO8A 2ZHMA 3FMGA 2WSUA 5K0UA 4K1ZA 5TSWA 1Q56A 1MQTA 1RJ7A 4RFRB 5IJRA 4HBNA 4D7SA 5CKQA 1OVSA 2P3IA 2WNVB 1VIWB 1IS3A 3KCXA 2ZBJA 2W3JA 3VHNA 1RUF3 4SBVA 4QPGC 4FPOB 1C8M3 2HWD2 4I09A 5DZGA 3I3QA 5FZLA 3WNPA 3LEIA 2FCTA 3ZX7A 3LE0A 2RR13 4D6RA 4Y22A 3UKVA 4A2UA 1VBB1 2VPVA 1GZ9A 4NIIA 3VBUC 2RM23 2UWAA 3MFCA 5IVCA 5J98B 4EWEA 2W1WA 4HANA 4RSUA 2HH9A 1YUDA 2V4VA 1H2MA 1YIPA 3NNLA 5A3NA 2W47A 4W4ZA 4HVQA 4QPYA 4GZ9A 3PU8A 3KQRA 3IBMA 4YW6A 4P5HA 5BPXA 2ZEZA 4IE7A 4QX5A 1S4CA 1FYUA 4BZ4A 3BU7A 4S2GA 4CDUB 4LOTA 4N8MA 3SKVA 1RHI2 3WZ1A 1QHDA 4R9AA 5C8CA 3HBZA 2F17A 1D4M1 1VBD3 4KG8A 1WKYA 5LY2A 5J37A 1S0EA 4OI0A 3FHAA 1Z7S3 1NA1A 3POSA 5CEHA 1CZSA 4ISRA 4LIUA 1Q8VA 4EN6B 1QMJA 1N3OA 2V5YA 4KNCA 2D43A 4L97A 3TNQA 4W65A 1COV3 1NQJA 4A6OA 4BXSV 1AL0G 4NHKA 1WCKA 2AYHA 1GYKA 4LBLA 3PVBB 1ZRRA 3HIFA 1SBFA 1W2TA 5FYVA 2VECA 4XF0A 1GWKA 2J1AA 3DYOA 1V0AA 4Q0QA 3RJ2X 3W21A 2HJIA 2CGPA 3ZLIA 3SH5A 3FC0A 1ENSA 3MEPA 1UMZA 4K8RB 4RGKA 2WZPP 3V0AB 4DXTA 2WLQA 1Q8SA 2LTNA 1YEWA 4OULA 2NZ9A 3T2QA 5C70A 1C3HA 3WDYA 3H3LA 3HNBM 2D98A 4I0BA 4AOCA 5C3QA 4AGGA 1IS6A 2ZX1A 4WVVA 4GMP0 5G04L 3GZTB 5JI9A 3AL6A 3MGUA 2HWF2 1CZVA 2W08A 5D1IA 2O8QA 3GHMA 1RUG2 1LECA 3IPVB 2IXJA 3VV1A 5J3UA 1DQ0A 1JODA 2XQRA 3ORJA 5ISLA 4ZHNA 1W9YA 1RUI1 3POJA 4Z07A 2WFF2 2YHJA 4E2QA 1DZTA 1OH4A 1OF3A 3ZSLA 4ZY9A 5FKCA 1WA6X 1Y9GA 4LE4A 2JB4A 3RGBA 3T3YA 4HG6B 1AR61 2D44A 4U2AA 1NCRA 2W91A 3WF1A 1W6PB 2WAOA 3KT4A 1POV1 3D4KA 5F3GA 4LBKA 2PHRA 2YBSA 4XETA 3D5OA 2XKPA 2WS92 4NPRA 4V2WA 2RDQA 2BQPA 1YQ2A 3PUAA 2D3SA 1DGRN 3NWKA 4XBNA 4Z82A 2VW0A 2VE1A 2PN5A 2X09A 5DUWA 3U07A 5GZGA 2XG3A 3NRUA 3S7IA 2NPIA 1PO12 1LOFA 3M3OA 4JGZC 1JXNA 5CFCA 1NLSA 1VLNA 1KEXA 3USUB 2W95A 2XBO1 3SHRA 3WNXA 5JXJA 5KXDA 1VBA3 2ZJCA 4DY5A 1ND2C 2ZZJA 1C1LA 4IE5A 4CCDA 2JKXA 1H6YA 2JDKA 3N9MA 4YVWC 4E2SA 3Q9OA 3QOPA 2ZGNA 4CU6A 4IUGA 4FAGA 3AYAA 3VKMA 5FP7A 1IQAA 1W03A 3GGLA 1ASJ1 1O6UA 1TQ5A 4JGYC 1LOEA 1N1YA 3J8F1 3LFIA 4IE6A 3MIFA 4RGGA 4DQAA 3UNPA 1O3SA 2AUYA 4N53A 4IV3C 3ZPOA 3BGAA 3KLSA 1XNTA 5LB6A 1GFF2 3SCHA 2FDKA 4NO4A 1W2AX 3WG4A 1MZFA 2V09A 2VXRA 3RPQA 3POBA 4HOOA 1WCDJ 4P9XA 4UW5A 4AVCA 1W8FA 2UWBA 2Q8DA 5J96B 1W2NA 2EALA 1Q3EA 1BZWA 1QQP2 1RUJ3 1XXNA 4RD7A 1K42A 4XCAA 2Z69A 2WNUB 3BOWA 3PVEA 3EB7A 5IVJA 1P8JA 5T52A 2HKXA 4BQ3A 3GALA 1AYN3 2NP0A 1K3IA 1V6MA 3I2HA 2BFUS 1VRH3 2GN3A 4FAHA 5FMCA 3M3EA 3NNGA 1D2QA 2CSGA 3NKTA 4Q5OA 5ANQA 2WZR1 3DGTA 3IM0A 2RMU1 4FPGA 3I2GA 1ZBE1 2MNGA 4FOWA 1ZRDA 2R49A 4DRVA 4DEVA 2VZOA 4ZXEA 2JIGA 2WO7A 1U5IA 1ZBA1 2XOMA 3AC0A 5JIUA 4CCJA 1F31A 4FTSA 1QXJA 1O4ZA 1AVBA 2JG9B 4LKFA 3PU3A 3U4XA 5CKMA 4A7ZA 2BTVC 1R092 2WA3A 2Y6GA 3GDBA 4JHZA 2ZGLA 2E53A 3KV9A 1NT0A 4XUQA 5DAVA 5GJ6A 1V6IA 2BOJA 3RMXA 4U36A 4ASKA 2R1DA 4C1XA 1H9PA 5CKNA 1WD3A 4OI4A 2OS2A 3N7MA 1FT9A 4XIKA 5A6ZA 4TLFA 4AQTA 3MZHA 1JOJA 1AXKA 1LOAA 2XDVA 4Y1XA 1UO9A 2V5DA 1Q8QA 3FZ3A 1W8ZA 1FMD2 5BY5A 1GNYA 2P17A 5HV0A 2VTXA 2ORXA 2ZGSA 2J1VA 3KSCA 4RQPB 3B7MA 2E7QA 4AQ2A 2B46X 1RUC1 1VALA 3LQCA 3ZYFA 4IEXA 3RWKX 1BEV3 4FP3A 1UXXX 3EQEA 4EWDA 4GH4B 2XLFA 1XU2A 3OB8A 4M01A 5A70A 4XJ8A 5IAXA 4JCKA 3PHMA 4OHVA 1OOPB 5F5IA 1ULFA 4DUWA 5FZ3A 1W6OA 4YGCA 4XF9A 4XJZA 2ZX2A 1AR93 2L9LA 4BDVB 5AVPA 1V00A 5IVBA 2VMGA 5FY8A 3WW1A 2Q1ZB 2ARBA 4QB2A 2IXCA 4G3YC 5A3PA 1AX1A 4XJUA 1VBE3 5EZWA 4HONA 4E27A 4NIDA 3A0NA 3WP3A 2R042 1JYIA 5HCFA 3KT7A 1F4AA 2J1SA 2AR6A 3CU7A 3N9OA 5A3MA 1SFYA 1ZM1A 1S2KA 1SG3A 3AX4A 3IMMA 5ABJA 2VY0A 2OT7A 4OUSA 4AI3A 2EA7A 1XU1A 4GKYA 3MUZ1 4P14A 3AZVA 1QJU3 4KU7A 1C57A 3JB8A 4BOWA 1S0FA 5FZDA 4XJWA 1F9KA 1GNZA 4AI2A 1QH6A 2IC1A 1C5IA 4PJYA 4QWNA 5LA2A 3WSOA 2RDNA 2CGOA 3RZGA 2UURA 1PVC2 3MFAA 3WX5A 4KBBA 4R52A 2X5IA 2PHFA 2R32A 1DYPA 5IFTA 1F2NA 3AJZA 3GJAA 1CWPA 4HZFA 2DVDA 1FOD1 4CP1A 3DEMA 3UKTA 1RMU1 1NE4A 1QY4A 2VMEA 2VNGA 3JQXA 5CFDA 4BIFA 3KHCA 3I54A 3RYKA 1YLLA 3MPBA 3MO4A 4LQRA 4XZPA 4W50A 4LULA 4WM7C 1NOVA 4MH0E 4DNYA 3U0ZA 3VBRA 3JD72 4NIGA 3ACLA 4I2OA 1G7YA 3H1MA 3ZXFA 2BDRA 4OI1A 5LEKA 3HJRA 3R05A 3CNAA 2ZKNA 4LTAA 3ZSEA 5DAWA 1IS4A 4PIYA 4A42A 4JKMA 2VGDA 4OHYA 1YI7A 2FDJA 2Y8KA 4LEJA 4P9YA 3ZFEC 1LTEA 1OPMA 1SLTA 3FBMA 3LA2A 2YY1A 4FPFA 3NQHA 1GP4A 5FLHA 1H8TB 4Y5TA 2WN3A 4XYXA 2XVKA 2VBBA 1BBT1 2Y0IA 3KV6A 4JZRA 2NM1A 3SQOA 3TNPB 3ZKYA 4PDWA 3E6CC 4Q4W3 3NJYA 3JBG1 3BPSA 4BQ2A 5FTTC 4UYBA 3O1VA 3AKPA 3IWZA 4A6SA 1MR5A 4MXWB 4UFMA 2DDUA 2WNVA 1YFXA 3HQXA 3S7EA 4ET7A 3W5MA 2IFRA 5I8YA 1LJ7A 5IWFA 1X50A 3PJYA 4ZZ8A 4MGSA 3I49A 5EXOA 5JSRA 1DQ1A 1RUE3 3H42B 4Q27A 3ZR6A 5A1AA 5GZCA 1GZWA 2EIEA 2P37A 2W2IA 3BOPA 4RR3C 5LY1A 3MV11 1JYXA 4MHRA 3GJBA 2DBIA 4GIQA 4N43C 3DUIA 3ZR5A 1MPXA 4OMDA 4A7YA 3IZOA 3WCSA 3LPFA 5H9PA 2PHWA 3P3PA 3EYPA 3B94A 3N36A 5A7PA 3AYDA 4E8DA 2H6BA 1AYM2 1MS4A 4JGZB 3LEGA 4L8QA 1JZ7A 2OX0A 2R063 2R072 2VCCA 3K4DA 4OUEA 5KHHA 4XUNA 3D0JA 4D6QA 2Q8OA 5CNAA 4CDUA 1ND3C 1GNHA 4Q4Y3 2HWE3 1RUH3 1ZA4A 2OKXA 3VBHC 3VB9A 4DINB 5D8AC 2QTWB 1JZ5A 2XVGA 4XPVA 2HWC2 4OCTA 3DCQA 3WNLA 4NWVA 3IDAA 3LB9A 4DS0A 4FFHA 5FIXA 4YW5A 5L9RA 4ZPIA 4AFCA 1MS9A 2EIGA 4AHYA 3BIWE 3MW4A 4JGYB 2DYCA 2EF6A 3H1WA 4LLOA 3WV6A 1MS1A 5FY9A 5DDJ3 3RQ0A 1EAH2 1TMF3 2EIBA 4MGIE 4KWUA 3ZDVA 3L2HA 2ZX4A 3JU9A 1RIRA 4UI9L 5FZ4A 2W94A 2VD7A 3FX3A 4XILA 3LFMA 2VM9A 3I3BA 1UYYA 3I3DA 4EN7B 2Y6HA 2HWB2 3H8UA 4OZXA 4GQ7A 1OF4A 1WA4A 2OIIA 5ANNA 5JAXA 5FPUA 1OSGA 3AKTA 5FYBA 1VBC3 2JWPA 3B00A 5BNPB 4K1YA 3WNOA 5KBFA 1RB8G 2A6YA 3QCWA 1GMMA 2RS12 4XHXA 4YW4A 3USSA 1AJOA 3UGHA 1PIV1 1FXZA 4GA9A 2QQPA 3IPVA 5AC91 4LXLA 4ZU5A 2I2SA 4AI9A 2HEWF 3ACHA 2XKOA 3VBSC 1FATA 3WT3A 5DG2A 1WZXA 1UXZA 3POGA 1SEFA 2CWMA 2N7GA 1UOJA 4RHV3 1WUVA 5K7PA 2RDSA 5FY5A 4FP2A 4UAPA 1PO22 5KXBA 1ULCA 3CJIC 3AP5A 4M0NA 1PNFA 4Q4W2 3IIAA 4BYYA 3M8LA 1MEC2 3NAPB 4NJ4A 1JZ6A 1M06G 2WFPA 5JOXA 5I8SA 2VZQA 5FXXA 1ZRCA 1UY0A 1H9WA 3UV9A 1QXPA 4TSVA 5FPVA 1G86A 3WW4A 1DGWA 1TVGA 2DUPA 1SFNA 3USUA 3W59A 2ARXA 4MV2A 2VW1A 5A7SA 3QH7A 4MG2A 4WZFA 1XQNA 4XFCA 3ZYRA 1F5JA 4YVSB 1V9U2 1EY2A 3DKWA 1H8VA 4TN7A 4CZSA 5FY7A 2WQZC 3N35A 1VB4A 3ZFFB 2RS33 4HSLA 1O8SA 5C3SA 3OCPA 4HVOA 1AR72 3L9JT 4E2GA 2GC0A 4ZU7A 3LAGA 5ACA2 1R081 2KA3A 1Y4WA 1GKBA 4P00B 5FWJA 5CA6A 4QQLA 1AUYA 2VCAA 3EHKA 1NXD1 3E5UA 1LGNA 2D6KA 3DYMA 3IAQA 1OURA 5D2AA 2CYFA 2MEV2 4QXBA 5A33B 1EV13 4LK6A 2NN8A 3KVAA 1GWMA 1QJY1 1ULGA 3B3QE 3NV4A 4QM9A 4Q4X1 2BWCA 1LESA 5A1FA 3ZFGB 4UFLA 4L2NA 1EPWA 5CU1A 4E4HA 1DGWX 4FPJA 1C5HA 2WNUA 4QPIB 3KVBA 3HD8B 3AMNA 3DXTA 2XUMA 1K5JA 1QJX3 2GNDA 1HRV2 3A22A 3URFA 2QQKA 1BK1A 1QOTA 2PLV1 3DKQA 2YBPA 4BQYA 2VZPA 2YROA 4LKDA 1IHMA 5C9AC 3S57A 1BJQA 4CDXB 2ATFA 4URTA 1UL9A 3IMNA 1YRZA 2Q1FA 3H9AA 1J3RA 3T4VA 3WQ7A 5IK8A 3H1YA 3OPWA 4H7MA 1SCSA 3U1XA 2Y6FA 4YZ1A 4R4XA 3UT0A 4PQ9A 3W20A 2JG9A 2PHLA 1TEIA 1H1AA 1LEMA 4CCCA 4FSJA 4TYSA 3CF6E 3FFQA 3TBDA 2CL2A 3ZXJA 3BN6A 3CEWA 2DCTA 3P5BA 4AVTA 3CZJA 1HXS2 3KZ4C 3M70A 3ROUA 3IDEA 4Q4V1 2LUWA 4QGNA 1YJLA 2EIDA 2I07B 5LA0A 3MV01 4Q0SA 3LIHA 2ZACA 1FNZA 3J7LA 4CEYB 3KF5A 3JB4C 4NROA 4XW3A 3VD7A 1EPZA 5FYIA 1DLLA 3NVCA 5E16A 2QJVA 5LBBA 1VJ2A 2PELA 2FHRA 3ZKUA 1HKDA 3TRSB 3LEKA 4UFIA 3OEAA 4XABA 2X29A 4UFKA 5C8WA 5FY1A 5L7OC 2ZMKA 5C6CA 3OY8B 3I2FA 2WZEA 3U4SA 1V6LA 4Y4RA 1UOBA 3LA3A 5E6HA 1MVEA 1BXHA 1UF2C 5JOWA 2OQ6A 1GP5A 3N4MA 2QQVA 1QF3A 4LHKA 3O0XA 3RS6A 5FO8B 2DVFA 2VO5A 5JVVA 1HJGA 2D6LX 2XQXA 3OPZA 3AYCA 3Q8AA 4MXVA 4NR1A 3VHRA 4FCAA 1AR81 4WVMB 4AE2A 2GC3A 5JLVA 3ETQA 2VQUA 3EO6A 4LPLA 2W9XA 3THTA 1OOPA 3UESA 1FPN2 3ITQA 3SMHA 1JYVA 3N3HA 2A71A 3NJXA 2DCJA 1SFPA 1NG0A 2PAKA 2VL4A 4IEPA 4UXAA 1LU1A 5F3EA 5KC6A 4GJYA 5HCHA 2IXHA 3P6BA 3T1MA 4GWMA 3K75B 5FZ8A 2JG8C 4AAPA 4E8CA 1UIKA 4GJZA 4JRLA 4Z92B 3M2MA 1RHI3 4QDRA 2IVIB 3RDIA 3ZXDA 1S0IA 1RXGA 2R1BA 1E5IA 1UW8A 4RGAA 3CL1A 5C4WC 2DV9A 3WLUA 5H9RA 4PIZA 3S6PA 2VG9A 5EV7A 4COUA 1B35C 4GB31 3J26N 2EXKA 4XE9A 3PVOA 3U78A 4CUGA 4CXWA 4RS5C 2HBUA 2F6BA 4QKBA 4ITCA 3B93A 4YM2A 4BMEA 2TEPA 1JUHA 1W06A 2HWD1 3GZAA 3IB3A 2D97A 4IEWA 5DAPA 2WO2A 1EUTA 5FQ0B 5FXVA 4A7KA 2HYXA 3DV8A 3ZN6B 2HEYF 3VDDC 2F4PA 4CPBD 3ES4A 3UKNA 2QZ2A 1PGSA 2ZX3A 2CTVA 3O1UA 3OBTA 1ND3B 2PAMA 1D4VB 1VE0A 1NUKA 3NW4A 1H2LA 5I0UA 3OYWA 2QCSB 2BRTA 3GM8A 5A3UA 2XPJA 2XL9A 4UF0B 3TN91 1XE8A 2HWF3 3N7KA 1JOPA 3T2PA 2BNMA 2W39A 5A7QA 1PM7A 2A75A 5CBLA 1LHUA 2C4XA 3AB0A 5H9SA 1VAMA 2VVEA 1PNGA 2OZJA 2I74A 3SISA 3VN4A 3UGGA 2WFF3 2ZMLA 1GANA 4UT5A 1WW5A 3JQWA 4ZKTB 1GU3A 2TUNA 2IFWA 5LBEA 1LULA 3M4FA 2TBVA 1CAWB 5JOZA 4B3NA 4PI2A 4AHXA 1BMV2 2W68A 2KR2A 1GV9A 1S0GA 4QGLA 4NHXA 4AF9A 1W9SA 4Y5SA 3HN3A 4CDWB 4BQWA 2WS93 4A3ZA 1CAXB 5HI0A 3MLKA 4DOUA 2CDOA 4C0HA 3CQOA 3P1IA 3WY6A 3ZOIA 1H8TA 2WR9A 2ZTNA 1IKQA 1QOOA 2W92A 4IV1C 1W6MB 4Q1PA 2J1TA 5FK7A 1PO13 5CISA 2D6OX 3IAPA 5L73A 2Y34A 3LWCA 2H0VA 3ZYJB 4N9IA 4X8PA 1W8WA 3PURA 1AL23 1AHSA 4BK4A 5JR2A 1X8EA 3CKHA 1UY2A 1K5MC 4XIOA 4JHTA 5GALA 1BLZA 1Y43B 3O7OA 2Q8CA 4MXWA 1L7LA 5FJHA 1XC6A 3VBSB 3T2OA 4PLNA 4DRRA 3ILRA 1TME1 2JD4A 1DQ6A 1WWYA 5CADA 3J7HA 1GQHA 2RS51 2VBPA 1RUG1 2ZEXA 1W99A 5FYCA 2GC1A 2QFEA 1H1MA 1JOBA 5IHRA 3CJIB 1RUD1 2YU1A 1OD3A 5JSPA 1HRI2 4W8JA 1ALYA 1GQGA 3TEWA 1OBNA 4N90A 2OA2A 4UWDA 2D6NA 2WBKA 2ZGPA 3HQRA 4FPYA 2VTFA 3K4ZA 1ZRIA 4AHZA 4K21A 1SLIA 3ACIA 5FZ9A 4KH9A 2C1FA 1QQP3 2ZHLA 4WM8C 5IW0A 5FLIA 2Q8EA 1G9DA 2R16A 1RUF1 5FUIA 5T54A 3RJRA 1C8M1 2CWSA 1JZ3A 2Y60A 4P9JA 4DPNA 5KHKA 3WHTA 3TEYA 4QGMA 4XJ9A 1UKRA 2RR11 3M3CA 4OUMA 5LW9A 1I3HA 4JTNA 3WOGA 4XMIA 4M00A 2XJUA 1NCQB 2FMYA 4JGYA 1RVF2 2RM21 3A4UA 3IDCB 1YO8A 2VNRA 3BKZA 1GP6A 2GP5A 4AGVA 3MI8A 5FBJA 3O12A 4NMIA 3WF0A 2X8KA 3AFGA 1NKGA 4PHZA 3MW3A 4B4RA 5C33A 5F39A 3OGGA 5K4LA 3BI3A 1MS3A 1US3A 1R093 3VBFB 2VCBA 3K3OA 4ARYA 3KD4A 4YFWA 3WEZA 1DU3D 1QIQA 1JMUB 1W8NA 4FXGB 5BUVA 1N1TA 1VBB2 5BNPA 3JZVA 3AZYA 2FDIA 2H0BA 3FLTA 2DVGA 1VBD1 1DCSA 4QHOA 4A45A 1REDA 2BJSA 2GP3A 3D3AA 3E5XA 3CIHA 1YC61 2ZGRA 1HW5A 3UL2A 1Z7S1 3M7AA 3HEIA 1MZEA 5FZCA 1Q8PA 1JN2P 4FOVA 1W8TA 4XAAA 3T0DA 1COV1 1FMD3 4IEQA 4XC9A 2WO1A 5KHJA 4OHZA 1IPJA 2Y38A 4O7XA 1N1VA 2W52A 4BQ5A 1CD3G 5K8SA 2GN7A 2JIJA 2K2SA 3N9NA 1FV2A 1PK6B 3O1SA 3GNEA 5DN2A 5GLTA 4ASLA 1AL22 1D4M2 3ETPA 1F15A 3M1HA 4HK8A 4AQ6A 1OFNA 3VGIA 4PIXA 3NAPA 4FPEA 3MLJA 1Z0HA 1XYNA 2LROA 5GLVA 4B4QA 1NLRA 2YYOA 3OPTA 5C8CC 1CPNA 3E6DA 5DZEA 5FXWA 2XVLA 4IESA 5DAXA 3O1OA 3VKLA 2VZ3A 5LZ6A 2BV4A 1PVXA 1C28A 1W3XA 2VVDA 2PYTA 5IFPA 4DB5A 5J7MA 1NA1C 1S0JA 3O14A 4BE3A 2XUEA 4CRQA 3AVSA 2FCVA 1N3PA 2YC2A 2Q5TA 1T2XA 5EJ3A 3VZKA 2XL7A 2BZDA 4YVSA 4YW1A 2Z4FA 1HQLA 2JDUA 3ZYBA 2R043 4CEWB 2VZ1A 3BCWA 2XJVA 5A1LA 2Z2SB 4IEZA 4DFSA 3ZFFA 2ZZQA 5A7WB 2WJSA 2FZ2A 4BCUA 1SQ4A 4X6QB 4NAOA 4LO4B 2QQIA 2KXLA 1U5XA 1W2OA 4XF1A 1C4RA 1JBCA 2B8MA 4COVA 1ZZ8A 1IPKA 3PL0A 5DUXA 5F1RA 3T2TA 1RUI2 2RJLA 3IKWA 3FLRA 5A33A 4AI1A 3E5QA 3U10A 1PVC3 1BQPA 1G9FA 1O7FA 1VBA1 3FLPA 3KGLA 4BK5A 1PGL1 1JTZX 2JG8B 1JS9A 4YW7A 4BQ4A 1AR62 3BYWA 1H2NA 4MOAA 2F4LA 3ZFGA 2TNFA 4E4SA 4QPIA 1XPWA 2G9ZA 1VP6A 3GBFA 3AP4A 1AJKA 1ZA7A 5C4WB 2GALA 1BHGA 1NZIA 2D40A 2FCUA 1W6QB 2C9AA 2P6CA 2JDMA 1LEDA 3MF6A 1W6NB 1NY71 3KF3A 4QKFA 1CAVA 5E88A 1B35B 5B4XA 3VLBB 3CJXA 2ZAHA 1NCRC 2J42A 5FWEA 2FD8A 1C8NA 1K45A 2XBO2 3JD73 4CDXA 4K6BA 1LOCA 1SCRA 3ME2A 5F6LB 1OA4A 2YPDA 4BISA 1H0BA 1WW4A 1SLBA 5T3NA 1J3QA 1J84A 1XNCA 1LOFC 1WMXA 5CFCC 1WW7A 1QWRA 1OQEA 3C7FA 1CR7A 1RUJ1 4QX8A 5J36A 1HB4A 1ZZ7A 2ETEA 2VBDA 3I59B 4JV4A 4YM0A 1ASJ2 4UBHA 4DEQA 4OFGA 1W8UA 2XJTA 3IN9A 4HN0A 4RN5A 4C8DA 4D94A 1AYN1 1UYPA 2QQJA 3J8F2 3OOXA 4QXKA 1CJPA 2VZSA 5A3WA 4AEJA 4V1PA 1VRH1 4CEYA 4N7IA 1LENA 4H3WA 2J1UA 4E4ZA 5F7UA 5LWBA 4EQVA 1DLCA 1XNDA 3POFA 3PVNA 4C91A 5FO9B 3FHIB 2WQ8A 2BUKA 3LA7A 4YM1A 3EJKA 4S2FA 3OY8A 1GOGA 4B1MA 4J6GA 3OTFA 4N53C 2JDPA 5HCAA 3NL1A 3T4HB 5T5LA 3U14A 3N7LA 2C6SA 3PUSA 2BFUL 2W1SA 2XWJB 5FYYA 4CCKA 3AJYA 4KMQA 2ZMNA 1DZQA 3EBRA 1LR5A 4GKXA 4GWIA 3ATGA 4NVPA 2WZR2 4N7UA 2RMU2 5DG1A 1S2BA 1ZBE2 4WV8A 4QPGB 4MSVA 4IV1B 2XLAA 4AAXA 1F8VA 1AYM3 3AP7A 1ZX5A 1ZBA2 3KMHA 4OVEA 3H7JA 4Q0PA 3SCGA 1LAJA 2R073 2FDFA 3VDBA 2QQUA 1UU6A 3VBUB 4COWA 3JXSA 4WVZA 3RI9A 3WUCA 1LODA 2GU9A 4FFGA 2XMLA 4Y1UA 2HWC3 4MUVA 1HIXA 2B7YA 2YV8A 3SLIA 4XDPA 2IVJA 4EN8B 5I0SA 1SLCA 1O4TA 3HAGA 1BEV1 1I1EA 1WD4A 1NYWA 3ZSMA 1FNYA 5FZAA 5GZDA 4L92A 1KXGA 1LNSA 3THCA 3H8RA 2D3RA 2WL1A 3KT1A 3KCYA
chains in the Genus database with same CATH topology
1EAH3 2ET1A 2QDRA 1CESA 4K20A 5F5QA 3I8TA 4RA0A 3GBWA 3OBRA 4YRDA 5GLZA 2P2KA 2DCZA 1V70A 1UPSA 5FQ0A 1AR91 2HWB3 1WLTA 4AEDC 1QU0A 1RUC2 1C1FA 1RGSA 1SLAA 4S2DA 3ENRA 3RNSA 1ND3A 3AMHA 3TB0A 1VBE1 4WM8B 2BW8A 2ET7A 2BVBA 2RS13 3M3QA 4LBMA 5JR7B 5I91A 4Y20B 3ZSKA 4BA6A 2VUAA 2V73A 1KJLA 5I8TA 2CV6A 2QKDA 4BQ1A 1AXZA 1QJU1 3PMEA 4KWJA 1URXA 3I4IA 3V0BA 4JQRA 1MZ6A 1W0OA 4IETA 1CAWA 1OFSA 2VOWA 5J48A 2EAAA 1OLRA 3W58A 5K9YA 3WDTA 4CP0A 1PO23 3HN1A 4K8FA 2DVAA 3OD0A 4CDWA 2JDZA 1MEC3 3PLQA 1CAXA 2ZKLA 4M3CB 1CONA 2VH9A 4XMAA 1W6MA 1IZ3A 1RTVA 2VOKA 4K7JA 1HQWA 3WP6A 1JUIA 3AZWA 5ABJC 4Y22B 1JYCA 1AX0A 2Z79A 4PCRA 5LEJA 5CAZA 4LBQB 1V9U3 2QDNA 2GMEA 3VBSA 3VKOA 1D2SA 2R0HA 5BY5A 1FOD2 2E7TA 1G8WA 1B09A 4IEYA 1UU5A 4COYA 3H7YA 3RRDA 1AR73 3HT2A 1RMU2 1YXWA 1Z78A 4CTEA 2XWBB 2Z42A 1LHNA 5ACA3 2JECA 3CJIA 1ND2B 1O4YA 2WIIB 4META 2X5IC 3WW2A 1Q8OA 4AG4A 2XH6A 4YVWB 2YPJA 3C3VA 2MEV3 3B9CA 1H4GA 4IERA 1I5ZA 2JXAA 4NHLA 4Q4W1 4I0AA 2YC0A 3FUOA 4GULA 4HKOA 4KL1A 5CVRA 3WDVA 4AVAA 4YARA 4K9SA 2ZGQA 4KG0A 3OF1A 1Q43A 5GLUA 4IV3B 5BV6A 2ZCWA 5EYXA 2DCKA 3AXDA 1JW6A 2PHUA 4GMP3 4Z8BA 1RUE1 3WCRA 3WXPA 1HRV3 2BPA2 1KFUL 3EXUA 5T55A 3VZOA 1G9BA 3VZLA 5F9TA 5JZGC 1BBT2 1NCQA 3V0AA 1IS5A 3WQ0A 1DQ4A 3AKRA 5JI7A 3JBG2 5J09A 4AFDA 1LU2A 4XJAA 4YGBA 2WNEA 2R061 3VBFA 5LK7B 4Q4Y1 2HWE1 1RUH1 1PZ7A 1HXS3 5B2GB 4YYOA 4PDWC 3ASIA 1XNKA 3FUQA 2WNVC 4FOQA 1O91A 3JCIA 1QXRA 3KB5A 3MIGA 2PHDA 1W6PA 2G9GA 5JMCA 4EWAA 2OUJA 1YIFA 5FPZA 4YNIA 4LE3A 5DDJ1 3ZIXA 1TMF1 2A6WA 4R9DA 2OUHA 3AP6A 1G6NA 1H1IA 2A6ZA 1PK6A 3MIEA 2EVXA 2Q30A 4XOGA 1RJ8A 1VBC1 4C90A 3POWA 4XFBA 5JIAA 1WBLA 1ZNPA 4CDUC 1FPN3 1H2KA 4SLIA 5FREA 1LOBA 1ZVFA 4XBQA 4FPCA 3H50A 2VNOA 3GBGA 1DQ2A 2FMDA 3AFKA 2GC2A 1DQ5A 4YZ5A 1R1A3 1DGLA 4EJRA 4NHMA 2VVFA 2ZA9A 3CLPA 3ZVXA 3QBQA 2JEMA 4B7EA 5BNNC 5AFBA 5LRRA 3ZPYA 4LBNA 1VAKA 4CEWA 4RHV1 4FPKA 3WINE 3WW3A 4AHWA 1APNA 1LHWA 4M0HA 2WT2A 2VQAA 3IT8A 1PIV2 3SH4A 1BVP1 5E1RA 3R4UA 4YZ4A 5T50A 3ZYGA 5AC92 4JRAA 4YSFA 3H0OA 1LGCA 2H6CA 2ZGKA 1N1SA 4XTMA 1O3QA 2VMIA 2JG8A 4UW6A 1GSLA 2UWCA 3MW2A 4KGQA 3ST7A 3WHUA 1FAYA 2A3WA 4Y1VA 4EROA 4Q1RA 1E57A 3PTYA 2A3YA 2X53S 3NSTA 5C4WA 4FQZA 4P9IA 2LM3A 5BNOA 1W6QA 2RS31 1BCXA 5F6KA 1W6NA 1N3QA 3ILFA 5JDBA 3FE5A 3RYPA 1WLDA 3JUUA 4I3PA 4AEKA 1CQ9A 1HDKA 1S1AA 3VBOC 2JKBA 2IZWA 1MS8A 3ALQA 2GNBA 4R9BA 3WDUA 1EV11 4FBFA 4M3CE 2PHXA 3LOIA 3UK9A 5FMOS 4FPHA 4BM8A 2K9ZA 4WM7B 4AEDB 4CDQC 1DZRA 5FPXA 2B5HA 2YDEA 3I59A 4YG6A 2KM2A 4RQPA 3B9IA 1R082 3VHPA 4Y26A 2EAKA 1QJX1 1W2UA 4E9KA 1KDMA 2AENA 1KDKA 4GH4A 3ZFEB 5EWSA 2IXKA 1LGBA 4F8AA 2CGNA 1KRIA 1QJY2 4IXLA 4LUKA 4Q4X2 4WZCA 3ZYIB 2GH2A 2IXIA 3J4UH 3C2UA 4AQSA 1D0GA 1VR3A 1REEA 2AZ5A 4R8HA 3V56A 3LOBA 5L36A 1W6OB 5FOBB 1OD5A 4KGGA 4P9LA 4QD2A 4YGDA 5CG8A 4MGZE 3ZYPA 1R1A2 4BMBA 4RL7A 4ONUA 2PLV2 1RUOA 1HRI3 4IEUA 4YZ3A 5GKAC 4QPGA 4B29A 4J1XA 1XNBA 3R6SA 1BYHA 4Y1ZA 3O0WA 1PGW1 4RR3B 3SXWA 3WDWA 5HXVA 1DGRA 1QGLA 4N43B 4O9GA 2QZ3A 4ISQA 4Q0VA 5LRSA 4DMIA 3VBUA 1S0CA 5AFEA 1YWKA 4Q8KA 1UZYA 1PHMA 1BVVA 3OD4A 3LSDA 4N9HA 5T5JA 4I3GA 4NWWA 2VW2A 1V6KA 2ZPXA 3AXEA 4JTOA 3RMYA 1PZ9A 1ENXA 1OA3A 2JG9C 2ZGOA 1YI9A 3KCCA 4GWNA 1RVF3 2Z5WA 3D6EA 3LKJA 1CVNA 4XQ4A 3VBHB 3X29B 2EXJA 1LHVA 4H14A 3B02A 5D8AB 1DG6A 2X5IB 3WR0A 1X7NA 1CAUB 1ZZ9A 1NZCA 2D3PA 4NOTA 3AMMA 4BPZA 4ATFA 2PTMA 3UJOA 3WUDA 4A3XA 2GMPA 1RHI1 2ZX0A 3W9AA 3AK0A 2FZ1A 1RC6A 1VBB3 1OLQA 2B39A 1IKPA 2ZGUA 4WM8A 2DUQA 5DG2A 1VB2A 2WT0A 1AR82 2QE3A 4WBBA 5KXEA 2Y26A 1RINA 3KGZA 4JDNA 4LA3A 2XJPA 4Y20A 1D0HA 1IOAA 5JPNB 5JZGB 2SLIA 4OHXA 1DYKA 3TOJA 5HBAA 2VU9A 1O5LA 1AZDA 1QDOA 4PBPA 2JICA 3V64A 1OOPC 5CG9A 1WCSA 4H55A 4S2HA 1O3RA 1FI2A 3BODA 1J1LA 4TWTA 1D4M3 1HX6A 1LRHA 2D93A 2QNKA 3HR9A 4HFSA 4KWKA 5T5OA 3MF9A 2A5ZA 4XEZA 1KS4A 1U5YA 1MS5A 4GB32 4M3CA 1I6XA 3AKSA 2OVUA 1A6CA 1HV0A 1U0AA 2DTWA 2HWF1 2D6MA 4FOYA 4L99A 3ZN5A 2DTYA 1GZWB 3LZZA 4I0WB 5E89A 2WFF1 4QM8A 4X6RB 1WMFA 2WWSA 4J1WA 4LBQA 4LA2A 2OYZA 1MS0A 3OGJA 4JGZA 2GH8A 3GZUC 3MIDA 3DPRC 4JC1A 5DUVA 5I0RA 2WS91 3O0VA 3TN92 4XHBA 1SBEA 1ND2A 4I02A 2CNAA 2E6VA 4PLMA 3ZSJA 1PO11 2BNOA 4YVWA 3B01A 1RUI3 4WVWA 3SNMA 1AL21 4ES9A 3HWJA 4HPKB 4IQPA 2LALA 1WMDA 3G6JB 1AR63 4LHLA 1YHFA 1POV3 1WW6A 2HYKA 1MVQA 1OQ1A 2ZGTA 4AWDA 2NMNA 4IV3A 5BNNB 1YYNA 4EV0A 2VULA 4Y5Z0 2A73B 2GAUA 3D8CA 3DN7A 4XQWA 3ECQA 4PBOA 3VKNA 4ZXKA 2XBO3 5K0UC 1MQTC 2E63A 5FAXA 1ZYBA 2A70A 4YG3A 1H8TC 5AVAA 2YUEA 4D69A 1QH7A 3I7DA 1L3JA 1FV3A 5I93A 5CIRA 1QQP1 5C9AB 1TME2 4FQ4A 1ASJ3 1QJZA 2DURA 2RS52 2VOVA 1OMIA 3J8F3 1RUD2 5IK5A 2WQ4A 1YNAA 1KQRA 2BEOA 2W0XA 2ENRA 5KHIA 1Q5OA 3QACA 2ZHKA 5A32B 4LLFA 3J9SA 3VBOB 1RUF2 1R091 1X33A 1C8M2 4BLIA 1ZRFA 1J59A 2WLPA 3WG1A 2A6XA 1X82A 2AREA 1S55A 2D5FA 2XJSA 2RR12 4CDQB 4HN1A 4Y4YA 4HVRA 3ZDSA 2WZR3 5L7OB 2RMU3 3G7DA 1N47A 1ZBE3 2ILMA 4B7KA 2RM22 4XQDA 3ZO0B 2CAUA 1DDLA 1CN1A 1ZBA3 4O9EA 4BIOA 3ZXGA 4DZGA 4UW4A 5DXDA 5KC5A 1FMD1 4HLTA 3WDXA 2R30A 5FO7B 3WD5A 4XXPA 1LOGA 4OHWA 3ILNA 3VZNA 4KU8A 1JHNA 1VBD2 4F7ZA 3L2YA 1W0PA 2DF7A 3E97A 1Z7S2 2WC2A 5FOJB 1UPIA 1R1ZA 1A8MA 5BNPC 1COV2 2WA4A 2E7AA 3O5SA 5FFOC 2E9QA 2GZWA 2HEVF 4G4FA 1RUC3 2E51A 4DXZA 3H3UA 4H7LA 4RS5B 4C0BA 2G4IA 4Q0UA 1EP0A 1RL3A 5GZFA 5BNQA 2R041 1Y9QA 2GMMA 1PMIA 1CX4A 3P3NA 1WLCA 1CJDA 4RFT0 3VDDB 2JENA 3B69A 2MPFA 2A3XA 3KS7A 4JDMA 4B4PA 2JX9A 3BALA 3NAPC 2PAEA 4YZ2A 4ASMB 3MIBA 3R4SA 1PVC1 3E6BA 4XDQA 5FBZA 4AW7A 4XBLA 5DUUA 3TAYA 4WM7A 3AYEA 2AGSA 5FRAA 1WMEA 1UZZA 4AEDA 4BWOA 5BXXA 3SITA 2O0OA 1J1TA 1OI6A 4HKWA 3K51A 4GXLA 4EN9B 4HETA 4YVSC 2FBEA 4FTEA 2ZHNA 4FXKB 3U11A 3NKGA 2FQPA 3JD71 3ZFFC 1SDWA 4WVMA 3ZFEA 4AI0A 1RITA 4LO7A 3MDPA 4OLLA 3NV1A 1VBA2 3LCPA 1PGL2 5JCTA 4YM3A 3KM5A 4QU2A 1FOD3 3SCFA 3FFZA 3POYA 2XJRA 3WVJA 1RMU3 2BGCA 2XLGA 1MACA 1K5MB 1NY72 4LUMA 2YGMA 4M3CF 3R0RA 3ZFGC 4COZA 1LHOA 1NQDA 3MPPG 4QPIC 2ES3A 1ULEA 4PLOA 1REFA 1SLLA 4Q29A 2SBAA 5JOYA 2WINB 4RR3A 3QLQA 4OI2A 3WP5A 1JH5A 5JSOA 1UKGA 4N43A 1GICA 2A6VA 2RHPA 2VQ0A 4HSJA 4QQ2A 1GBGA 4CDXC 1RUJ2 1M4WA 1CPMA 1O5UA 3WG3A 2UU8A 3BB6A 1AYN2 4LO6B 3ZN6A 2MHFA 2DFBA 1BBT3 3DPRB 1VRH2 5IUQA 3A0KA 4MZUA 3HT1A 3VBHA 1F5FA 5JWPA 5D8AA 1TE1B 4AYUA 3JBG3 1FX5A 1CAUA 3GHNA 1AYM1 3WP4A 5A3LA 3DF0A 3OJBA 4AGRA 2JE9A 2R071 3OYWB 4CEYC 2PHTA 2UY9A 1OHFA 4ORFA 4QQPA 1IGOA 4FO9A 4K3UA 5FDBA 2HWC1 4R4ZA 1AF9A 1HLCA 1UD1A 4AEMA 4HT1T 3RWNA 4YW3A 4MVTA 5E8AA 1WGPA 1QOSA 5JZGA 2NLRA 1EAH1 4QHBA 3MICA 4Z1VA 5K0UB 1DHKB 1MQTB 4XFFA 2EXHA 1KFXL 2JJ6A 2VUJA 3TWIA 1A8DA 2P3KA 2HWB1 2WT1A 1I9RA 2XGXA 1BEV2 1XYPA 3AP9A 3S0MA 5FCCA 3GYDA 4LBQD 4MLOA 2RS11 2IWGB 2B42B 3SH3A 3AZZA 3AKQA 2AH2A 4MGYE 1AR92 5SV5A 2OPKA 4W6XA 2ZGMA 3D0SA 4LBOA 1G9CA 1MZ5A 3ES1A 4FVVA 1ZZBA 2QUOA 4XFIA 4DY3A 2YZ4A 2ZOEB 1VBE2 5C8CB 5CB7A 4XF3A 2Q0AA 5CFDC 2GDFA 1PO21 2VMHA 2ZAAA 2O8OA 4Y1YA 1PIV3 2BYVE 2IXLA 2DU0A 1MEC1 1NA1B 2O1QA 3ELNA 3S30A 4LT5A 3VBRC 3TYJA 5AC93 4AK3A 1V6JA 1NXMA 2R6QA 1UCXA 4NN0A 1QJU2 3ZMNA 5GM0A 2JE7A 3QH6A 4PF5A 4XFHA 4HPKA 4HKLA 4YG0A 2YGLA 3BTAA 4EN0A 2D6PA 1V9U1 2DUOA 2EXIA 2UYAA 5DZFA 5IK7A 4QT6A 5BNNA 5GLWA 4UW3A 4KQ7A 1ZZCA 3VZMA 5L19A 1EYBA 1J58A 1AR71 4LO5B 4AXOA 1YFUA 5ACA1 3BPZA 2PFWA 4CDWC 2NMOA 1X8MA 2WKKA 3PJQA 2MEV1 1A3KA 1POV0 3K48A 2VOXA 1ONAA 5JPMB 5IK4A 1GR3A 1U5ZA 4HMZA 1Y7BA 1NCRB 3M3IA 5C9AA 3VL8A 3RZZA 3AMPA 4AVSA 4BHPA 1R083 1RUNA 4ZU4A 4GMP1 1HRV1 2P34A 5CFCB 4E4DX 3ZN4A 3GF6A 2G9FA 1W39A 3NV2A 4IEVA 4R9CA 4CP2A 1QJY3 4XXAA 4Q4X3 5A32A 2WSVA 2ERFA 4LO8A 3VBOA 1KS5A 1LKNA 4QMAA 3MIHA 4P9WA 5SV8A 2BBVA 4Z2WA 1UX6A 3VKFC 1U12A 1RUE2 3RG0A 4MYEA 4UBGA 5HCBA 1HXS1 2PLV3 4CDQA 1UAIA 3DL3A 3ZXEA 2A7AA 5L7OA 5BYNA 2C0ZA 2CY6A 5EFUA 4N53B 1UIJA 1LCLA 4L11A 2P3JA 1LB2A 2XB6C 1UU4A 1SMVA 2ZABA 3APBA 2R062 1NCQC 4IEOA 3ZXKA 4F3JA 3INAA 1S0DA 2R0FA 4YGEA 4Q4Y2 2HWE2 1RUH2 2Y0OA 5KXCA 2B9UA 2B45X 1OPOA 2I45A 4Q4V3 4HL0A 2YMZA 3LSEA 1QNYA 1CIWA 2YXSA 4CYDA 4MGKE 2NYYA 3VBFC 3T1LA 1ZREA 3ZIWA 2XHKA 3N7JA 1FPN1 3FJSA 2RE9A 1TNRA 2PA7A 2BVVA 4LR4A 4KWLA 3THPA 5DDJ2 3AMQA 1TMF2 2ZS6B 3H3ZA 4AFMA 2CAVA 2D5HA 3IDBB 1KD7A 2OW4A 4XF4A 1B35A 3AM2A 1R1A1 4W6WA 1CAVB 1ZZ6A 2DVBA 4IL7A 4RS5A 5GZEA 2QVSB 5IT6A 4INDA 2NQYA 1XE7A 2RJKA 1AR83 1VBC2 3VUOA 1OKQA 1SBDA 4F83A 3HMYA 1XRUA 4G9SB 3ZMOA 1AX2A 1GLHA 1PK6C 3VHOA 3VDDA 3RSJA 4Y24A 1UN1A 1YFWA 4BLJA 1T6GC 3I2DA 5EYYA 1GZCA 4I30A 1J3PA 3VZJA 1G9AA 1O3TA 4FPLA 1YFYA 2PQQA 4I01A 4TZDA 1DIWA 4XFAA 4D3WA 2BWAA 3LGRA 4RHV2 4XFGA 5FLJA 4GB33 1HQNA 2Q1MA 3ZXAC 3WQ1A 1QDCA 1QKQA 1Y3TA 4JDOA 5H9QA 2HWD3 3UJQA 4CEWC 4D7YA 4Q26A 4FT8A 1DFQA 4HK9A 4AI8A 2WNUC 4IV1A 4FTBA 3FBYA 4LNVA 5KHGA 1SACA 2Q4SA 4XTPA 3VL9A 1BMV1 4D7TA 5T5PA 4W6YA 2UYBA 1KITA 3D82A 3TN93 4K40A 2RS32 5ABJB 4MX3A 1K5MA 1PZ8A 1NE6A 4AVVA 2DFCA 1TNFA 4AVBA 4QQHA 4BH9A 4Q4V2 4ATEA 2GNTA 3NJZA 1DBNA 1OQDA 5BNOC 1EV12 2GNMA 4X8NA 5FMOL 1ULDA 4YW2A 4P9GA 3FWEA 4QQOA 3B5LB 1KJRA 1ENQA 1YJKA 3RI8A 5I0TA 3V65A 1S0BA 1A78A 3MYXA 1X36A 4AFBA 2K0GA 4L9BA 1AXYA 3R4DB 3AZXA 3WG2A 4B8EA 2XJQA 3PNAA 5CFDB 5LK5A 1QJX2 1VAVA 3NV3A 3DPRA 1DF0A 1HV1A 4LHNA 4Q8LA 2DCYA 4YLZA 1HRI1 3VBRB 1YCIA 4RQPC 4JVAA 1OA2A 2D7FA 1QNWA 1V6OA 4AFAA 3QD6A 3CO2A 1TME3 4GH4C 1WBFA 1XYOA 3MLLA 2RS53 2OZ6A 1RUG3 4GALA 2BNNA 3PMSA 4YFZA 4JAAA 1RUD3 2C5DA 4ES8A 1V6NA 2DU1A 4LBJA 3V0BB 2UY8A 3RYRA 2GSYA 3ZXLA 1RVF1 1WLWA 2DWRA 5KHKA 1H4HA 1H30A 4Q2FA 4C1WA 1ENRA 1PGW2 1BKZA 4PDWB 3NO8A 2ZHMA 3FMGA 2WSUA 5K0UA 4K1ZA 5TSWA 1Q56A 1MQTA 1RJ7A 4D7SA 4HBNA 2WNVB 2P3IA 3KCXA 1VIWB 1IS3A 2ZBJA 3VHNA 1RUF3 4SBVA 4QPGC 4FPOB 1C8M3 2HWD2 4I09A 5DZGA 3ZX7A 2RR13 4Y22A 3UKVA 4A2UA 1VBB1 2VPVA 1GZ9A 3VBUC 2RM23 2UWAA 3MFCA 5J98B 4EWEA 4HANA 4RSUA 1YUDA 1H2MA 1YIPA 4HVQA 4QPYA 3KQRA 3IBMA 5BPXA 4P5HA 4QX5A 1FYUA 4BZ4A 3BU7A 4S2GA 4CDUB 1RHI2 3WZ1A 1QHDA 4R9AA 5C8CA 3HBZA 4KG8A 1D4M1 1VBD3 5J37A 1S0EA 4OI0A 1Z7S3 1NA1A 3POSA 4ISRA 1Q8VA 4EN6B 1QMJA 1N3OA 2V5YA 4KNCA 2D43A 4L97A 3TNQA 4W65A 1COV3 1NQJA 1AL0G 4NHKA 1WCKA 2AYHA 1GYKA 4LBLA 3PVBB 1ZRRA 3HIFA 1SBFA 2VECA 4XF0A 3RJ2X 4Q0QA 2CGPA 2HJIA 3SH5A 3FC0A 1ENSA 3MEPA 1UMZA 2WZPP 3V0AB 2WLQA 1Q8SA 2LTNA 4OULA 2NZ9A 1C3HA 3WDYA 4I0BA 2D98A 4AGGA 1IS6A 2ZX1A 4WVVA 4GMP0 5JI9A 3GZTB 3MGUA 2HWF2 2W08A 5D1IA 2O8QA 3GHMA 1RUG2 1LECA 3IPVB 2IXJA 3VV1A 5J3UA 1DQ0A 1RUI1 4Z07A 2WFF2 2YHJA 4E2QA 1DZTA 3ZSLA 4LE4A 1AR61 2D44A 4U2AA 1NCRA 1W6PB 3KT4A 1POV1 3D4KA 4LBKA 2PHRA 4XETA 3D5OA 2XKPA