1EV13

Echovirus 1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
239
structure length
239
Chain Sequence
GLPTMNTPGSNQFLTSDDFQSPSAMPQFDVTPEMHIPGEVRNLMEIAEVDSVMPINNDSAAKVSSMEAYRVELSTNTNAGTQVFGFQLNPGAESVMNRTLMGEILNYYAHWSGSIKITFVFCGSAMTTGKFLLSYAPPGAGAPKTRKDAMLGTHVVWDVGLQSSCVLCIPWISQTHYRFVEKDPYTNAGFVTCWYQTSVVSPASNQPKCYMMCMVSACNDFSVRMLRDTKFIEQTSFYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECHOVIRUS 1
publication title Structure determination of echovirus 1.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 239
sequence length 239
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ev1300
1AYM2 4GMP1 4QPGA 1POV0 2X5IC 1QQP1 5FMOL 3DPRB 2WZR1 4GMP0 1NCQA 1FMD1 2R071 1R1A1 2HWD2 1FPN2 1X36A 1AR92 1VBD1 1VRH2 2HWB3 1C8M2 4Q4X1 3VBHC 1AR61 1RUF3 4JGZC 5DDJ1 4RR3C 1NA1A 2BFUS 1VBA3 4GB33 4Y4YA 4CEYC 1ND3C 3VDDA 5L7OA 2PLV3 3JBG2 4RHV2 4QPIC 1H8TA 1AYN3 1RUI1 5J96B 1AR73 5A32B 1HX6A 1E57A 2R041 1COV1 1OOPB 5A33A 1RMU3 5ABJC 3VBFB 5C8CC 1V9U3 4CDXB 5BNPB 1R091 5ACA3 1VBC3 2RR13 4RQPB 1Z7S2 1NY71 3M8LA 1PIV2 3IDEA 2WS92 2WFF1 4Q4Y1 1AL0G 4NWVA 1RUC3 1X33A 4CDQA 5CFCC 1EAH2 5K0UA 2RMU2 1VBB2 1PVC2 2XBO2 5C4WA 3VBHB 5BNOA 4JGZB 1B35A 1FOD3 1HXS2 1BEV3 1TMF1 2BUKA 2MEV3 1QJU3 4CEYB 2RS31 1ASJ2 1ND3B 4NWWA 4QPIB 1HRI3 1ND2C 1QJY2 4YVWA 1RVF3 2R061 5ABJB 1ZBE2 2HWB1 5C8CB 1RUF1 3J8F3 4GB31 1VBA1 1TME2 1MQTB 1MEC2 5CFDC 1FMD2 2PLV1 3ZFEA 1AUYA 5FOJB 1AYN1 5CFCB 2HWE1 1AR71 4CDUA 1RUH2 4JGYA 4RS5A 1RMU1 1RUE2 4YVSB 1RUJ3 1F2NA 1V9U1 1IHMA 3VBRA 1QJZA 5ACA1 1VBC1 2DF7A 2RR11 4IV3A 4QPGC 1PO12 1HRV2 1COV2 5AC93 1ND2B 1NCRA 1NCQC 1ZBA2 1AYM3 1RUC1 2RS12 3VBSA 1C8NA 3FBMA 2HWD3 1FOD1 4Q4V2 1NA1C 1FPN3 1BEV1 2ZAHA 2TBVA 2MEV1 1AR93 1QJU1 1VRH3 1PGL1 1C8M3 5JZGA 3VDDC 5L7OC 4WM7A 3JB4C 2QQPA 2XPJA 1H8TC 2BBVA 1HRI1 1M06G 2FZ1A 4PDWB 3JBG3 2VQ0A 4RHV3 1EV12 2RM22 2FZ2A 1PO22 1OOPA 2BPA2 4RFT0 3J8F1 3VBFA 4CDXA 4WM8A 4QPGB 2HWC2 3NAPA 1GFF2 5FMOS 2R062 1NCQB 5BNNA 3ZFGA 4CDQC 1NG0A 1Z7S3 5K0UC 2WS93 5C4WC 1R082 1PGW2 1RUG3 5BNOC 2X5IB 1AL22 1B35C 1RUJ1 1EAH3 2RMU3 1VBB3 1PVC3 2XBO3 4N43A 1OHFA 5C9AA 4Y5Z0 3VDDB 5L7OB 1QJX2 1RHI2 3JD72 1RUD1 1HXS3 4Q4W2 2HWE2 4IV1A 1H8TB 1ASJ3 3TN92 1AR82 2ZTNA 5AC91 4RR3B 4GH4A 1AYM1 4YVWC 5D8AA 3JB8A 3ZFFA 5A33B 1VB2A 4AEDA 2HWF2 1QJY3 2HWD1 3ZXAC 1FPN1 4N53A 1AR91 1VRH1 1ZBE3 1D4M2 1C8M1 3VBOA 1MQTA 3ZFEC 2RS52 1VBE2 1TME3 1MEC3 1BBT2 4CDQB 4BCUA 1BMV2 5K0UB 4CDUC 1DDLA 3JBG1 5C4WB 1QQP2 4JGYC 4RHV1 1F8VA 4RS5C 4SBVA 5BNOB 2WZR2 1B35B 2R072 1R1A2 1RUH3 3VBRC 4YVSA 1VBD2 1RUE3 1K5MA 4Q4X2 1AR62 3VBUA 4CEWA 4IV3C 5DDJ2 4CDWA 1NCRC 4YVWB 4LLFA 1PO13 1Z7S1 3CJIA 3VBSC 2WS91 1HRV3 1ZBA3 1RUG1 1RUI2 2RS13 4RQPA 1EAH1 2R042 2GSYA 2RMU1 1VBB1 1CJDA 1PVC1 2XBO1 3DPRA 5JZGC 4WM7C 1HXS1 4Q4V3 3ZFEB 1R092 1ASJ1 4CDUB 2BFUL 4RS5B 1NY72 4PDWA 2WLPA 2WFF2 4Q4Y2 3S6PA 5CFDB 1OOPC 1OPOA 1QJY1 1VB4A 1RUD2 1EV13 3VBFC 2RM23 2Y26A 4CDXC 1ZBE1 1PO23 4IV3B 4WM8C 1RVF1 3NAPC 1TMF2 5A32A 1NCRB 1TME1 5BNNC 3ZFGC 2RS32 2HWC3 1MEC1 3VBSB 1CD3G 1NOVA 2WWSA 2R063 5BNPA 3HAGA 5GKAC 1RUH1 2X5IA 1R083 4N43C 5C9AC 1RUE1 5JZGB 1AL23 2HWB2 4WM7B 1PIV3 1RUF2 4IV1C 4GB32 1VBA2 4EJRA 1QJX3 1RHI3 3JD73 4GH4C 1NA1B 3VBHA 5D8AC 4JGZA 1PO11 2PLV2 2HWE3 4Q4W3 4RR3A 3ZFFC 4AEDC 1HRV1 3TN93 4CEYA 1AR83 1ZBA1 1AYN2 5LK7B 1SMVA 1ND3A 1AR72 1W39A 2RS11 2GH8A 4N53C 2HWF3 4QPIA 1RMU2 4WM8B 3VBOC 3NAPB 1MQTC 1V9U2 4Q4V1 2IZWA 5BNNB 3ZFGB 5ACA2 1D4M3 5ABJA 1VBC2 2RR12 1RUG2 5C8CA 1POV3 2RS53 1VBE3 4FTSA 1BBT3 4GMP3 1RUC2 1WCDJ 1QQP3 4YVSC 4N43B 1EV11 5J98B 5C9AB 2RM21 2WZR3 4FTBA 1K5MC 1FMD3 2R073 1PO21 1R1A3 3VBUC 4CEWC 4IV1B 1FOD2 5CFCA 1BEV2 2MEV2 4CDWC 1QJU2 1VBD3 4GH4B 1HQNA 4Q4X3 1PGL2 1AR63 5D8AB 2HWC1 3ZFFB 5DDJ3 3CJIC 4AEDB 1RB8G 1HRI2 4RQPC 1RVF2 4N53B 3LOBA 1R081 3VBOB 1PGW1 1RUI3 3DPRC 1AL21 1ND2A 1PIV1 2R043 1COV3 3J8F2 1VAKA 1QJX1 1RHI1 3JD71 1A6CA 1R093 4Q4W1 4PDWC 3TN91 1AR81 5CFDA 4FSJA 1K5MB 2WFF3 4Q4Y3 2ZZQA 2HWF1 3VBUB 4CEWB 4JGYB 1RUJ2 1RUD3 4CDWB 1D4M1 3VBRB 3CJIB 1TMF3 4FTEA 1POV1 2RS51 5BNPC 1VBE1 4Z92B 2RS33 5AC92 1BMV1 1BBT1
chains in the Genus database with same CATH superfamily
1POV0 3KV9A 1GYKA 3SCHA 1DP0A 2FDIA 3J26N 3DGTA 1OA3A 4ZS2A 5LY1A 5IK5A 1IPSA 2WZR1 2DYCA 2XJQA 5JLVA 4IEUA 5JPNB 1NCQA 1VAVA 3FZ3A 4RGAA 4J6GA 3VD9A 2EIEA 1POQA 2WNUB 2W68A 4B3NA 3UK9A 2HYKA 2LM3A 2Y6JA 4Q4X1 3VBHC 2VZOA 2C26A 2VXRA 3VZKA 3OUHA 1G9BA 4JGZC 2PQSA 2UYAA 1K45A 3WD5A 4RR3C 5FYTA 1NA1A 4XF1A 3O1MA 2XR4A 3LB9A 2ZEWA 5L7OA 3AFKA 4Z1VA 2NM1A 1W0OA 4MHRA 3LA3A 4UFIA 4QPIC 3ZPOA 4XBLA 4FOQA 5J96B 5JUVA 4JHTA 2GNMA 2ZEYA 3BN6A 2ORXA 3NNJA 1HX6A 1E57A 1W6NB 2VQAA 5LA9A 4D6SA 1KS5A 1ONAA 3FE5A 1GWLA 2W47A 3ZPYA 1SFNA 3K4ZA 3OYWB 3LSDA 3BTAA 3VBFB 2E7QA 2BTVC 2VOVA 2ZGMA 2Q8OA 3OEAA 2Y6KA 1L7QA 4BYYA 4FPGA 1SEFA 5BUVA 1LGCA 1WW4A 3BCWA 2RR13 3VLBB 4RQPB 3VZNA 3BTYA 4HOOA 4UFLA 2FDGA 5DG2A 5C9AA 4FOYA 3HR9A 2AZ5A 3CIHA 2Y33A 2WS92 2CGOA 4COVA 1MVQA 3ROUA 2VUCA 2WFF1 4GKXA 3ZMNA 2UY9A 2BGOA 4QHZA 4CP9A 4COYA 4DPNA 2A7AA 5CFCC 5EJZB 1QMJA 1VBB2 2RMU2 3O0XA 2XBO2 2ZGQA 5J37A 4LKSA 4PLOA 1ENRA 1DCSA 4FFFA 4NUBA 2VZVA 2GNTA 4FVVA 5H9RA 5FZHA 1FOD3 3B7MA 4GWIA 3ZKUA 1BEV3 2AEZA 1L7RA 1C3HA 5JAXA 2VVDA 3FN9A 2YMZA 2G9FA 4DIQA 3BIEA 2RS31 1ASJ2 4MV2A 1ND3B 4NWWA 1DGLA 1Y7BA 3JUUA 2O8OA 1NQJA 2CTVA 4L11A 1YQ2A 3PUQA 2OIIA 4YW1A 5FMBA 2LALA 1S2BA 4R8HA 1S4CA 4XEZA 3L9JT 1LOBA 2AGSA 2WA3A 2WT0A 4A3ZA 4AI0A 4CYDA 5C33A 2R061 1U5ZA 2Y8KA 3J7LA 1FT9A 3LFMA 2WZPP 3VKOA 3UJQA 4K21A 3Q8BA 1YIFA 3AM2A 2VAUA 1G6NA 1MS5A 1NLQA 2J1VA 2VMEA 4KG0A 3ASIA 3WP6A 1LCLA 3ILNA 3OCPA 4MSVA 1HLCA 3D3AA 4PI2A 3B00A 1S0DA 4GALA 4P9JA 4ATEA 1OLRA 4AAPA 1NXD1 2JG9B 3NJZA 4DB5A 3ZFEA 1NLRA 1AUYA 4IE7A 4E4SA 3OBRA 3KGZA 5FIXA 5FPBA 2YBPA 3KB5A 1PNGA 1WKYA 4KWUA 2XVKA 4XZUG 1RUH2 2W1SA 3GZEA 4JGYA 3GM8A 4QGMA 1GOHA 1LHOA 5FP9A 2WAAA 3AL6A 1XQNA 4EWEA 4F3JA 2H0VA 1RMU1 2KM2A 3NKGA 1LEDA 1US2A 3PTYA 1FAYA 1K3IA 2VW0A 1B09A 1O4YA 2XGXA 4YGEA 3ZN4A 1DYPA 1CAXA 2GC0A 2P17A 2WO2A 1WMFA 3AP9A 3N9MA 4XTMA 3WLUA 1I6XA 2ETEA 5SV8A 4EYUA 1F5JA 3BU7A 4QPGC 3M2MA 2DBIA 3ACLA 4D8MA 3NWKA 1G86A 5HCBA 3R05A 1COV2 5GLWA 4Y24A 5LASA 3BB6A 1AYM3 3BODA 3ETPA 3ZDVA 4E27A 5LA1A 2JWPA 1UO9A 1RUC1 3NW4A 3DYPA 1S0FA 4YZ5A 4YZ1A 4Q8LA 2JDMA 1DLCA 1C8NA 1OH4A 3FFZA 4IEVA 4DINB 1FV2A 2IXCA 3MLKA 5FZDA 3GZAA 1UY4A 2OXBA 1MS8A 4Y1VA 4B8EA 4GQ7A 5LRSA 2HWD3 4BQ1A 4Y20B 1V6MA 3T0DA 2TBVA 1MPXA 2MEV1 2Y64A 1AR93 4B4PA 4LTAA 5JZGA 2AC1A 4BZ4A 4Y3OA 2CL2A 3VGIA 3I2KA 4AI1A 1H8TC 1HRI1 1KJLA 1HJFA 1IS5A 1CN1A 2FZ1A 2JICA 4G4FA 4PIYA 4YRDA 3RNSA 3U75A 4CU9A 1SBEA 2UWCA 1PZ9A 2XL7A 3OBTA 3GNEA 4YG6A 4D7TA 3AP6A 2PAKA 5D1IA 4DS0A 5ERLA 1ZRFA 4LBLA 2FZ2A 3MPBA 1ZRCA 5A1AA 1LULA 2BPA2 4UFKA 2VO5A 3MPPG 5JXIA 2WSUA 4QKNA 2HWC2 1KQRA 2PHFA 5A80A 4D7YA 4XCAA 1BXHA 4EV0A 4IETA 5CNAA 3ZXKA 4Y1XA 3C7HA 2I2SA 1XE8A 3CLPA 3FJSA 1W6OB 4BU2A 2ZOEB 3OGRA 1SPPA 1Z7S3 3AXDA 3IPVA 3H50A 5E1RA 1KDKA 5FXVA 4XQDA 3THDA 4JKMA 2WN2A 1UZ0A 1I9RA 5EYXA 5FPVA 1B35C 3U37A 5JDBA 2QQKA 3OSDA 4AHWA 2Y38A 3IIAA 4XYXA 3MIDA 2C4XA 3POGA 4RSUA 1DLLA 1GZWB 4UYBA 2ES3A 2I07B 4HZFA 4Y5Z0 3OG2A 3VDDB 3WF3A 4KU8A 5A3TA 5CBLA 2VUAA 5IWFA 4HSJA 1CQ9A 3RPQA 2JG8A 4HK9A 4EN9B 4OQ8A 3FLPA 3NMBA 4AF9A 3PUAA 3TN92 1H9WA 2ZTNA 3RGBA 2JEMA 3VKNA 2GALA 4UBGA 1ACCA 5G04L 4NPLA 2WLQA 5A33B 1VB2A 2DFCA 1ZZCA 4AEDA 5FK8A 5FYHA 2FMDA 5IATA 3PURA 5F3CA 3LIHA 1AXZA 2WYSA 3L2HA 3WDVA 2Y0OA 4HLTA 4HT1T 1D4M2 3VBOA 1XXNA 3ZSEA 3DKWA 2XVGA 2D3PA 2BOJA 1RC6A 3O0VA 4QX1A 4OYUA 1OKOA 2IXHA 4W65A 4J1XA 4FO9A 1Y3TA 1OMIA 1OBNA 2CAVA 2TEPA 4CDQB 1E5IA 5K0UB 2G1MA 5FPLA 1QQP2 2DCYA 2Q5TA 2WRAA 3QOPA 4JDMA 4Z2WA 1GQGA 5BNOB 3GALA 1DGWX 5L9RA 1XE7A 4UFHA 1R1A2 4OQ9A 2W92A 4MADA 4XBNA 4YVSA 3VBRC 4XQWA 5GLZA 4MHUA 4EZHA 1CPNA 5M0TA 4MOAA 3IZOA 3UV9A 1UYYA 4IV3C 4LO4B 4KGGA 5EP9A 3UKNA 2ZMNA 5DDJ2 5FZ9A 1O3TA 2J42A 5FPZA 4AW7A 2P3YA 2UY8A 4B29A 3OY8B 2DV9A 1UMIA 3N9NA 3NJVA 2F4PA 4LLFA 4W6YA 1PO13 1XSRA 3CJIA 3ENRA 2WS91 1HRV3 3T2OA 1OVSA 1O3SA 1QXPA 1ZBA3 1RUI2 2OZJA 4CCDA 4RQPA 3T2QA 2QDNA 1UY0A 1VBB1 2PFWA 1WD4A 2R16A 2RMU1 2XBO1 3TNPB 5DPNA 5ANQA 3TRSB 3ZSKA 5JOZA 3QD6A 3O14A 2LROA 4IGPA 5CEHA 2VOKA 3D0JA 1W8UA 2VOTA 5JPMB 4XAAA 2G9GA 4M3CE 4LBNA 2ARXA 2EF6A 5K4LA 4CP1A 1ASJ1 2W52A 5GZDA 1GNHA 5EIYB 3OUIA 5C70A 4IEPA 2ZS6B 2SBAA 3USUB 5I91A 4FQ4A 1VRBA 1SFPA 2FCUA 4PDWA 4XUQA 2I45A 1EYBA 2P3JA 4MH0E 4Q4Y2 4W6XA 2ZGKA 5FBZA 2A70A 2QQVA 3B93A 3S7IA 1VB4A 2Z5WA 1ULFA 1RUD2 1GUIA 4GAZA 5FPUA 3SH3A 2RM23 3AZWA 4O7XA 1ZZ8A 1NE6A 3HBZA 3BYWA 4Q0QA 3ZYGA 2R0HA 4DRVA 1YCIA 3FL7A 1ZRIA 1TMF2 3J7MA 3WP3A 1W6NA 2QQJA 2GH2A 1NCRB 3I7DA 2VW1A 2G19A 5BNNC 1URXA 5LBFA 3HN1A 4JAAA 3U4SA 2RDSA 3OYWA 5FWEA 3MIBA 2C24A 2BW8A 1CD3G 4SLIA 4WBBA 2JDHA 2ADEA 2WFPA 3KS7A 3AKRA 3PUSA 1E5SA 4QKBA 5GKAC 1WMEA 5JOYA 1RUH1 1ZA7A 3LZZA 4XXPA 4HETA 3WQBA 1CX1A 3IT8A 1XOYA 2HWB2 5JSRA 1FXZA 3NV3A 1RUF2 2DVBA 4YZ3A 5FY4A 2VBBA 4IV1C 4GB32 1O59A 1O8PA 1VBA2 4GZ9A 3JU9A 3MW4A 3BPZA 1E5HA 4HN0A 4IE5A 1RHI3 3JD73 3RI8A 1NA1B 2D6OX 3GZTB 1LECA 2Q1FA 4LEJA 3ZFFC 2PLV2 4WVZA 4M3CB 4AVBA 2PXJA 4BWOA 1DQ5A 5DZFA 5EXOA 4YW2A 1UMZA 4Z2AA 5LK7B 1ND3A 1RTVA 3MO4A 4EWDA 4NMIA 2E26A 1JS9A 4FOWA 1JHJA 3O1TA 1I5ZA 2E7AA 3EHKA 5AVPA 1C4RA 1KGYA 2D5FA 2WNEA 2E63A 4WM8B 4AHZA 1REDA 3VD3A 4QX2A 2ZHMA 3POBA 5EHDA 4Q1RA 1MQTC 3MV01 2XQXA 4CCNA 2X10A 1ZYBA 3NNLA 4AVVA 1YJKA 1K12A 3OGJA 4JQTA 4UWDA 3O0WA 5LATA 1LOEA 2ATFA 1UXZA 2ZX4A 1VBE3 4Y33A 3WDTA 3WCSA 4D94A 3VD5A 1BBT3 3MFCA 4I09A 3AZYA 5J3UA 2BERA 1CAUB 2JG9A 2ZGLA 4H55A 4IEXA 2WZR3 5BNQA 2O0OA 4FTBA 2WQ4A 5FY8A 3MLJA 3MV11 3VBUC 1PM7A 4Q0SA 3KVBA 4HVQA 2QDRA 4BJ0A 4XF9A 1JHNA 4UW5A 4Q4X3 2BP6A 4XF3A 2A75A 1IOAA 1S0CA 2HWC1 3A7QA 3LFIA 4JC1A 2EIDA 3KM5A 4PF1A 2F17A 1RXFA 1Y43B 4AFMA 1C5IA 5L9VA 2DCJA 4P9WA 5A7SA 3ZYHA 2LS6A 1EP0A 2ZHLA 4JX0A 4AVCA 3UT0A 3ZXEA 1JZ2A 1PMHX 2QVSB 2XONA 3DPRC 1H2NA 4HG6B 4W50A 5JVVA 3Q9OA 4NIGA 3SKVA 1MS3A 5GLTA 3GJAA 1PIV1 3SEPA 3UYJA 5T52A 3ZXLA 2XMLA 3J8F2 1VE0A 3CJXA 3PUIA 1E5RA 2D7FA 1NKGA 1VAKA 4V2VA 5LA2A 4BHPA 4CU8A 4EN0A 3IIIA 2VQTA 1VAMA 5LCWL 1C28A 2HLEA 3LSEA 4TN7A 4QQPA 4XFAA 3RQ0A 1OF3A 2IFWA 2VVFA 5A6ZA 1OFNA 4CE8A 3TN91 1CAWB 1PNFA 4CCMA 1UWWA 1X8EA 4NAOA 1O91A 4E2QA 1AX0A 4Y5TA 5DUWA 4Y1UA 4FSJA 1K5MB 2WFF3 3H8UA 4EQVA 3TAYA 1N1YA 4CEWB 4JGYB 4J25A 3T2TA 1RUJ2 4HVOA 3KLSA 2WA4A 3WUDA 3WVJA 2QKDA 4BE3A 4KGQA 5FO8B 4CDWB 1WW6A 4IGQA 3HIFA 4LA2A 4QQOA 1D4M1 1YFYA 1AX2A 1WCSA 3BVCA 5FXXA 1CAXB 1JW6A 1OURA 1OD5A 1QNWA 5FP4A 5HV4A 2VGDA 4FPYA 1WCUA 1LEMA 3I3DA 3HN3A 4LBJA 4YG3A 2C1FA 5BNPC 5KXEA 2RS33 1S2EA 3GBGA 1W6PB 1J3QA 5E8AA 1DHKB 2JB4A 4LO6B 4LR4A 4YM2A 1O3QA 4Z8BA 2ZJCA 2VZ3A 2X5IC 3A0NA 1QQP1 4AFDA 4PI0A 1GNZA 5C7GA 2RDRA 4HPKB 2BVBA 3JZVA 3NV2A 1R1A1 4E4ZA 1W6OA 5H9SA 2FDFA 3AZVA 4Y22B 3ZXJA 1CWPA 5IVFA 4COWA 1VRH2 5FXWA 3BTXA 3AKTA 3KQ4B 1AR61 4O9EA 3RZLA 2EIBA 1HQLA 5F37A 5DDJ1 3V64A 4AGGA 5HCAA 1X9TA 4KBZA 3UKTA 3N9PA 5I0RA 2RVAA 4XFFA 2G9ZA 2X8KA 4CCOA 1GZWA 4ZKTB 3OBAA 5L73A 3VDDA 3SH5A 3AKQA 5IK7A 3JBG2 4QKFA 3D0SA 4JHZA 4RHV2 3AMNA 4YWAA 1P8JA 1UZWA 3OPWA 3PHMA 4JV4A 4CRQA 5JR7B 2JDKA 5J7MA 3PTRB 1RUI1 1YUDA 3B9IA 4I3PA 2X53S 1IGOA 1W3XA 1W2NA 3AMMA 3BGAA 4FPHA 4QDRA 5A3OA 2NMNA 4AGVA 5FTTC 1DZTA 5A33A 1RMU3 4LBMA 2VMFA 5IVCA 4KH9A 2YPJA 3DKQA 3EJKA 5JMOA 1YRZA 4INDA 5C8CC 3OF1A 1ZZ7A 4I01A 1AJKA 4CZSA 2DFBA 1W2OA 2NLRA 5DAQA 3CKHA 5FMDA 2O14A 4OVEA 2BZDA 4K8RB 2BVVA 1EY2A 2VZUA 3M8LA 3WP4A 3IDEA 4AI8A 1CAVB 1D4VB 1R1ZA 2WAOA 4Q4Y1 1AL0G 3ATGA 4NWVA 3IDCB 4F8AA 1RUC3 2H6CA 4CDQA 4A44A 1SCRA 4IGOA 5K0UA 2Q8DA 1NZCA 2ET7A 2ARBA 3VBHB 5F3EA 5BNOA 3RWNA 2J1UA 3IMMA 4JGZB 1BYHA 3TEYA 1ZX5A 2BEOA 2DBNA 1TMF1 2C5DA 3QACA 2MEV3 2D6NA 5FZFA 2WNVC 5T55A 4D6RA 3QH6A 3WG3A 4JDNA 2AUYA 1MZEA 2Q1ZB 4P14A 2CGNA 2VD7A 3DV8A 3OJBA 4R9DA 3VHPA 4BLJA 3O1OA 2EAAA 5KC6A 2DVAA 4QPIB 3MEPA 3ES4A 1HRI3 2E51A 2JE8A 4JQRA 3VDAA 1ND2C 2OQ7A 1RIRA 3SKJE 5FOBB 3RSJA 3FLRA 2Z42A 1RVF3 5FLIA 4PBPA 1DGWA 3KWVA 1ZBE2 2B7YA 2HWB1 3SNMA 4TZDA 3K48A 1RUF1 2QQMA 4ZU5A 5FYIA 3R6SA 3TYJA 4QHBA 4GB31 1VBA1 4WV8A 1ST8A 2BBAA 1TME2 4KI5M 4LORA 3WQ7A 1MEC2 5IVYA 4QU2A 2OUJA 5CYYA 1FMD2 2PLV1 2VULA 2GMPA 5A7WB 5CFDC 2P5BA 3WNXA 5HXVA 1C1FA 2LRPA 4K1ZA 4R9BA 3WV6A 1W8WA 5C71A 5CFCB 4C90A 4XJUA 5FZGA 4ATFA 2IVJA 1GKBA 3B5LB 1DIWA 1VMFA 5FY1A 4KG8A 3USUA 2ZHNA 3POEA 1RUE2 1X8MA 4YVSB 4NRMA 2K9ZA 3BPSA 3HOBA 2GC1A 5AVAA 3CBNA 4CXYA 1EUUA 2ZABA 1F2NA 5KWRA 3I2OA 3LA7A 2C6SA 4QX3A 1QJZA 4QPWA 2VMDA 2H0BA 4IEWA 2VZPA 4V1PA 4EN7B 1MS1A 5C3SA 1GNYA 5FUPA 3T09A 2DF7A 3DXUA 3HMYA 1LODA 1SDWA 5EWSA 3VKFC 1ULGA 4BQ4A 3NNGA 1XYOA 3W21A 1CZVA 1NCRA 3B3QE 5FYVA 4LQRA 1BCXA 3M3OA 5ISLA 2X09A 4TWTA 1LOGA 4YARA 3T08A 2RS12 1KFXL 2PHLA 4NR1A 1YFUA 4COZA 4A42A 1N1TA 2YU1A 5DABA 3FC0A 1FV3A 3FBMA 2YBKA 1SACA 4HXCA 4KQ7A 1ZNPA 2EAKA 5F32A 2VMCA 4QPYA 4K8FA 1LU2A 3NV4A 2SLIA 2ZAHA 2DWRA 3AMPA 2D6LX 3I2DA 1LHWA 1UF2C 3CMGA 5T5LA 1JZ4A 5FYUA 4UI9L 1AR62 3M70A 2ZGSA 5J48A 4JZRA 1JH5A 1H2KA 3HPNA 3MIHA 1UOBA 3JB4C 4DRRA 3HEIA 3C3VA 4D0QA 2PMWB 2XPJA 4XJ9A 2BBVA 2O8QA 3Q8CA 3VDCA 4DNYA 3RDIA 2ET1A 4PDWB 4BB3A 4XAEA 2VQ0A 4C0BA 1WBLA 1EV12 2ARCA 2CNAA 2GN3A 3PMEA 2QJVA 4KL1A 4M3CA 5CIRA 3PNAA 3KHBA 1QU0A 4ISRA 1OOPA 4LKEA 4RFT0 4L97A 3J8F1 1D2SA 4WZFA 3DUIA 1W99A 2DVGA 3U4XA 3I4IA 4LBOA 5FDBA 3VUOA 2JJ6A 4FT8A 4CDXA 4WM8A 4QPGB 5A3WA 3W5MA 1GLHA 1SFYA 4FQZA 3AX4A 1GFF2 4BLIA 1YO8A 3DEMA 4FAHA 4R4ZA 5GZGA 3NQHA 1ZRDA 5DAVA 5FZKA 4J1WA 3ZYBA 2Y6LA 5KC5A 1NG0A 1U12A 4HKLA 5CKQA 5H9PA 2WS93 5F5IA 5C4WC 1R082 2ZEXA 3LEIA 3Q8EA 4LUMA 5LZ6A 4I0BA 1PGW2 1Q5OA 1S2KA 1RUJ1 5LBEA 2ZEZA 3I3BA 4MZUA 3EB7A 2RMU3 1DZRA 1VBB3 4PIZA 3UGGA 2WSVA 2XBO3 1CAUA 4K40A 4AAXA 3C7FA 1UOJA 1OHFA 2VC9A 3WUCA 4B4RA 2XQRA 3KD4A 5CKNA 3WQ0A 4XILA 1V00A 4FXKB 3ZSJA 1VPHA 4NHLA 3AB0A 4HSLA 5L36A 2P34A 4QQHA 2HWE2 4C1WA 1H8TB 2ZCWA 1W3VA 1ASJ3 2PAEA 1AR82 3ELNA 4P9YA 4ZU7A 3KF3A 2JB8A 5A7PA 4YVWC 1UZVA 2IVIB 4LNVA 1CIWA 4LXLA 2JECA 3SH4A 2HJIA 2FDJA 3RYPA 4MGQA 1ULPA 4RD7A 1G7YA 3ZM8A 3E5QA 3POIA 4BMBA 1YFWA 1CZTA 1BK0A 4LO5B 4H2AA 2VZSA 1HJGA 1VRH1 2AH2A 2QZ3A 2OS2A 4E2GA 4Z82A 3N9LA 1C57A 5FYBA 4BXFA 3ZR5A 2HH9A 5L19A 2RS52 1LENA 2WWUA 2ARAA 3EMRA 3T4HB 2CDPA 4A6SA 1CVNA 4N9HA 3FUQA 1NE4A 3ZN6B 1EPWA 2CV6A 3P3PA 3WINE 4CDUC 1MVEA 3IBMA 3JBG1 2P3KA 1SLAA 1GWMA 4HBNA 4RHV1 4W6WA 1F8VA 4RS5C 4NHYA 5K8SA 3GXUA 3LGRA 4XMAA 1B35B 1M4WA 2XJUA 4IESA 1CAWA 3TOJA 1RUH3 1TZOA 4Y1YA 1XNDA 2B4KA 4XCBA 4LT5A 5JIUA 1REEA 4Y4RA 5I0DA 4OCTA 1K5MA 3OOXA 1W8FA 2CWSA 3GYDA 4CEWA 4Z07A 2VMIA 3QH7A 1XB9A 2G4IA 1OQDA 4AE2A 4CDWA 2PHTA 3U78A 4AQTA 2OT7A 4E4HA 4N7IA 1UN1A 2FCVA 4X6QB 3HNBM 2VNGA 3VBSC 3TEXA 1RUG1 2J1EA 1W6PA 1UIJA 2WNUC 3I59A 2GP5A 4CPBD 5CADA 4YFZA 5KBFA 4TTGA 2R042 4LA3A 4AQ2A 5A7NA 1A8MA 2NPIA 3NV1A 3POFA 4KU7A 4R9AA 1YLLA 5FV3A 3KGLA 1T6BX 4MYEA 4HPKA 4AHYA 4FPFA 5I0UA 4BK5A 4WM7C 1XE0A 4FAGA 5T5OA 4LOSA 4RGKA 1R092 2ZBJA 4Y22A 1KXGA 4D69A 4I3GA 2UU8A 3FWEA 3H1WA 4H14A 1H1IA 1FYUA 2ZX2A 5FMCA 2AR6A 1FI2A 2DTYA 3A21A 4FBFA 1NY72 4JRLA 3KZ4C 3OD0A 5FR3A 2XLFA 3AL5A 5F6KA 1YQ5A 1V6OA 4RL7A 3RZHA 4WVMB 2VZQA 5I8SA 4N9IA 2ZHKA 2VE1A 3I3EA 4KMQA 2XUEA 1VMJA 4XC9A 2B39A 3VBFC 1U5YA 3CO2A 1UU6A 1OH3A 4GJZA 4XJZA 3CNAA 3UETA 4Q2FA 1ZBE1 3T0BA 3BIWE 1RITA 4IV3B 4QQLA 1GZTA 1RVF1 5FKBA 3NAPC 5J36A 4AI9A 4FFHA 4BXSV 4Q5OA 5CG8A 1V70A 1MACA 3G7DA 1TME1 4LOTA 5HCFA 3ZFGC 2YU2A 1WA6X 2HWC3 1MEC1 4HKOA 1OPMA 2BNMA 1OUSA 2N7GA 1W9YA 2WQ8A 1YIPA 5LBBA 3ZX7A 5EJ3A 5L9BA 2CWMA 1V6LA 1IG0A 1GOFA 2JENA 2V73A 2CAUA 3W5NA 2DVFA 2VMGA 4N43C 1D7PM 5FZ7A 1O4TA 3PIJA 3HT1A 4MO3M 2CDOA 1UCXA 1RUE1 1V6KA 1CAVA 1GBGA 1L3JA 2UWBA 1NYWA 4Q0PA 1Q8VA 3N7LA 1PIV3 4M4PA 3SITA 3LIGA 1O6UA 3ZLIA 1OQEA 5F8PA 4CSWA 4FPLA 3TEZA 3IDAA 4MX3A 4OHWA 4CP0A 4GH4C 4NPRA 3SQOA 1HQWA 3VBHA 4B1LA 1JYTA 1W8HA 5D8AC 3V0BB 4JGZA 4PQQA 4XUOA 5HV0A 4RR3A 2B42B 2B45X 3K77A 2YC0A 5GZEA 2BNNA 5JI7A 2A6WA 3TN93 1CZSA 2WUHA 1AYN2 2JDAA 5IAVA 4BIFA 2OZ6A 1AR72 1G9AA 2RS11 3LAGA 3BALA 5BY5A 1UYZA 3J4UH 1A34A 1Q8QA 4B7KA 4N53C 4OI1A 4GXLA 4QPIA 1TNRA 5IHRA 2WO1A 2Y0IA 2P6CA 1UKGA 1XJAA 3LEKA 4GJYA 3CZUA 1V9U2 1VJ2A 4OMDA 4EWAA 4YM1A 3D5OA 1S0GA 5BXXA 5BNNB 1OC1A 1RGSA 1UY2A 2R1BA 1D4M3 3GGLA 5ACA2 3LKJA 4UFJA 1VBC2 1S0BA 2IXJA 5A3NA 2XG3A 3N7MA 4PQ9A 4QX5A 4XXAA 1NZIA 2VECA 3LF7A 2ZGRA 3H9AA 1FX5A 1VIWB 2JIGA 2FDHA 4FTSA 4DY3A 4W8JA 2Q1MA 2VUDA 2XOMA 1QQP3 4GA9A 2VMHA 1XC6A 3WW3A 1EV11 5FFOC 5A7WA 4B4QA 2W2IA 4MXVA 2A73B 5FYSA 1ALYA 3KT1A 5FCCA 1GV9A 3JXSA 1QKQA 2V4AA 1R1A3 3ST7A 4IV1B 2EXIA 5CFCA 4IXLA 2VU9A 4TSVA 1RJ8A 1QJU2 2YC4A 5FY5A 1HQNA 2QQNA 4CXXA 4F7ZA 1AR63 2J1RA 1F15A 3ZFFB 4PT6A 5DDJ3 1GQPA 2ZGUA 4FFIA 1RB8G 5AFEA 3N9QA 4A45A 2D5HA 4K20A 5IVEA 1MZFA 4ORFA 1NUKA 4EN8B 3SC7X 1CX4A 1W8OA 3KV6A 4ZU4A 3LOBA 1UPSA 1N47A 2EICA 1LOAA 1R081 4K3UA 1JYIA 3OUJA 3TWIA 1WCQA 1PGW1 1RUI3 2AYHA 1DG6A 2PA7A 3AYEA 4AR2A 2OKXA 1BZWA 1N1VA 2W1WA 4YGDA 1N1SA 4QKDA 1S0EA 4AI2A 2PHRA 4KNCA 3VV1A 4Y5SA 4P02B 5A3UA 1STMA 5JSOA 1F31A 1IQAA 4OZXA 4JKKA 3WX5A 2C9KA 2MHFA 2DCTA 4NRQA 3WF0A 3WW1A 3R4DB 1G9CA 1AR81 1QEXA 1UX7A 2DURA 2V09A 4WVVA 3OGVA 4NPMA 3RJRA 3ZSLA 4CTEA 2XLGA 1OT5A 1OF4A 2WR9A 4R4XA 4YGBA 5JI9A 5LEJA 2YXSA 4NJ4A 4MVTA 4Q4Y3 2RJKA 3QCWA 3UKVA 2D43A 3VBUB 1WMXA 2W9XA 3WNPA 1JXNA 3AXEA 2ZZJA 4BA6A 1O3RA 5B2GB 1RUD3 4XIOA 3RI9A 3RZJA 1D0HA 1LRHA 1UY1A 3OPTA 2PN5A 4A41A 2D6PA 2QBXA 1WZXA 3K4AA 1SG3A 4BQ3A 2VTFA 5FY0A 1BJQA 3WF2A 3CZJA 4KWLA 3TEWA 2EA7A 4FPEA 1NQDA 3THPA 1TMF3 2XJRA 1GICA 2RS51 2C9AA 2VNVA 3FHIB 5AC92 3S30A 1CPMA 2HEVF 4QB2A 5FO9B 4GMP1 1ZZ6A 4QPGA 3IN9A 1GP4A 2OX0A 2RG4A 2RDNA 1W9TA 3C8XA 3DPRB 3Q8FA 1DQ1A 2BWAA 1PVXA 1NLSA 2J7MA 2XJVA 3ZYJB 1FPN2 2ZMLA 4ONUA 4ZHNA 1VMHA 2HWB3 1C8M2 4ES9A 5LWBA 1G8WA 2CU5A 3MZHA 1RUF3 3HQUA 2ENRA 3DCQA 4GB33 1VBA3 5JXGA 5FY7A 4DUXA 2P3IA 4CEYC 2PHUA 1GANA 5EV7A 3ZN5A 2PLV3 1DQ4A 4H7MA 2R1DA 3RYRA 3NRUA 1IPKA 1H8TA 5TSWA 4L2NA 2VY0A 2AACA 3ECQA 5IW0A 5FWJA 5A1FA 3KHCA 3I2FA 4XABA 3PU8A 1LAJA 3ALQA 5A32B 5FYYA 1W8ZA 2R041 2VH9A 1COV1 1W90A 1OOPB 5APAA 5ABJC 2ZGPA 5FP3A 4AVAA 1W9SA 3U11A 3UGFA 1CESA 2QE3A 3USSA 4CDXB 1KDMA 1R091 4N8MA 5BNPB 3D8CA 2AENA 3CU7A 2Q0AA 3WT3A 1AVBA 1XNKA 2DUQA 2J22A 1Q43A 1H4HA 3H7YA 2WN3A 1NY71 2WBKA 5LW9A 1WLCA 1PK6C 5JOXA 3M3EA 4Q26A 4DEQA 1X33A 3ZN6A 1EAH2 1HB2A 3Q8AA 1MS4A 1PVC2 4ZS3A 1F4HA 1N3OA 2OA2A 4V2WA 2J1SA 4H3WA 1A3KA 2FBEA 4QGLA 1Q8PA 4P9IA 1B35A 2VOXA 2RJ2A 3NJYA 3O1SA 2B8MA 1HXS2 3MW3A 5IJRA 1KD7A 4EE2A 3ZXGA 1S1AA 3EQEA 4KWKA 5FP8A 3FLTA 3A23A 3TBDA 2Q8EA 5FAXA 1SQ4A 5IAXA 1IKPA 3APBA 5FYZA 2ZGNA 1TE1B 1QH7A 4FXGB 5DN2A 2Z4FA 5F9TA 4DQAA 5BV6A 1QJY2 3S7EA 5I8TA 5H9QA 3VZMA 2GU9A 2WQZC 2YDEA 3ACGA 4XVHA 3M1HA 5FKCA 3T4VA 5IVJA 4MXWB 1BK1A 1V0AA 4Q27A 2Q4SA 1XNAA 3MI8A 5GJ6A 3WW4A 3ZR6A 1DQ2A 5C8CB 5IFPA 2ZPXA 4HANA 1UOGA 2R49A 1LOFC 1UY3A 3J8F3 3IB3A 1DGRN 2E31A 1JODA 3HNYM 1GU3A 1XU1A 2OW4A 2JE7A 3GJBA 4QB1A 5FBJA 3LD8A 3FMGA 3AJYA 5C5TA 4OLLA 4XMIA 4NIHA 1IZ3A 4CCJA 1QDOA 3A0KA 2A6XA 1AYN1 2GMEA 2QTWB 2JDYA 2A6VA 2KD7A 1AR71 1C1LA 2XB6C 4DMIA 4N90A 3RS6A 3ZDSA 1YWKA 4LE3A 1O4ZA 1R64A 1GP6A 1LESA 3BKZA 1QJEA 1RUJ3 3WNLA 4WVMA 4QHOA 1V9U1 1IHMA 3VBRA 2WNVB 3QLQA 5LBCA 4AEKA 1DBNA 4PLMA 1LJ7A 1PHMA 5ACA1 3ITQA 4URAA 2BYVE 1VBC1 4OHXA 4IV3A 2JXAA 4XFIA 4AK3A 4YG0A 1PM4A 2K2SA 2R32A 2XL9A 1UYXA 2OQ6A 4LHNA 3IM0A 5GALA 4BQXA 3T1LA 3H8OA 5A6YA 1ND2B 1NCQC 4KBBA 3I2HA 3WCRA 5IK4A 2A3XA 1IPJA 4C91A 1F5FA 3OTFA 4YYOA 4I2OA 4LMFA 3I59B 2VBDA 5FZAA 3EXUA 3WZ1A 4P9XA 3SXWA 3J7HA 1GMMA 2WC2A 2PHWA 1WA4A 4Q4V2 1NA1C 1A78A 1JBCA 3GZUC 2VZRA 5FPXA 1QJU1 1VRH3 4DXRA 4LUKA 1LHVA 4B1MA 4AZZA 1K42A 5L7OC 4XJAA 3ZYPA 2V4VA 3E1F1 3HBKA 1JZ3A 4CA9A 3OGSA 2X29A 3E6DA 5ANNA 4M00A 3NNFA 2EIGA 4UW3A 2QQPA 1DF0A 1OD3A 1YI7A 2D3RA 4OI4A 2A1XA 3INAA 2ZXQA 3JBG3 1PZ7A 3R4SA 5SV5A 3V0BA 4RHV3 1MZ6A 4A4AA 5IFTA 4OUMA 1WLDA 3DN7A 4GD4A 1H8VA 1PO22 3ZVXA 3K75B 1OI6A 1WLTA 1WMDA 1W0PA 1TVGA 3UL2A 1J83A 3CHXA 3KT4A 3HD8B 1NX9A 3OD4A 2WT1A 2R30A 5CZKA 2YROA 3JQWA 3MGUA 1JYXA 4QXBA 5C6CA 2XHNA 2YV8A 3VHOA 4E9KA 5E88A 2R062 2ZGOA 1OA4A 5FMOS 5BNNA 1N3QA 4S2DA 4Y26A 4PBOA 5FZLA 2VNRA 1UQXA 2E7TA 1W04A 3KF5A 5JIAA 5T3NA 3D6EA 1ULEA 4HFSA 1BHGA 1OKQA 1RUG3 3KV5A 4QQ2A 1AL22 1OUXA 2WZ8A 4QDQA 3DECA 3WEZA 1XPWA 1J3PA 3BU0A 5C3PA 5DMYA 5FZEA 3S0MA 3VHRA 5FJHA 1LR5A 3SCFA 1SHWB 1MR5A 1QJX2 2EXHA 4ES8A 1RUD1 3O1VA 2W46A 4BQ2A 1JUHA 4OUSA 4Q4W2 4IV1A 4PIXA 3RFRA 4XUPA 1ODNA 3G6JB 5AC91 4RR3B 4XTPA 2YC2A 5A70A 2W5FA 4PHZA 4AEMA 5KXDA 1JOBA 3ZFFA 4NIAA 3O12A 4GWMA 4S2HA 2HWF2 5CAZA 3H3LA 4BH9A 4MGIE 4FP2A 1REFA 4UBHA 4QT6A 4FOVA 2WDBA 4OUEA 1KJRA 3LDRA 4XHXA 4ZXEA 1BVP1 3WDUA 1FPN1 1J3RA 4P9GA 1ZRRA 1ZBE3 4GWNA 2ZMKA 2A5ZA 1IS3A 1C8M1 3WP5A 5BYNA 1QXRA 3PMSA 4OFGA 1MQTA 5BPXA 1DZQA 3ZFEC 2P1BA 3ZOIA 5EFUA 3HVDA 1TME3 1LGNA 4Q8KA 3PVEA 2CGPA 1MEC3 4UAPA 1BMV2 5A7QA 1H1AA 4BCUA 2YFZA 1DDLA 5C4WB 5J1XA 1OLMA 3PUHA 4JGYC 4OI2A 4NVPA 1KEXA 1SLBA 1Y9GA 2ID4A 3WG4A 3A22A 2TUNA 2R072 3LDBA 3ORJA 5EZWA 1VLNA 3NJXA 5F3IA 2WJSA 1F9KA 3HJRA 1VBD2 1RUE3 4PCRA 5E6HA 4XJ8A 1TG7A 2VCBA 1UD1A 4XURA 3VBUA 1CONA 1HDKA 1W8TA 1UZZA 1XBFA 3W59A 4OHZA 4A3XA 5T5PA 4BIOA 4GKYA 2ZA9A 3PL0A 2H6BA 2A6YA 2BOIA 3VB9A 4YVWB 1QJFA 2JDZA 1AJOA 1UPIA 3FUOA 4JDOA 2PYTA 4YW7A 3X29B 5DZEA 4K1YA 4NO4A 4Q29A 5DAWA 1WWYA 4XIKA 2GNDA 2RDQA 3R0RA 2VNOA 2VXJA 4O9GA 1XU2A 3MUZ1 2DDUA 1LTEA 2RS13 1DGRA 4URTA 3VL9A 4AVTA 1EAH1 2GSYA 1AF9A 4B7EA 1PVC1 3SCGA 4XDPA 2D97A 3LDKA 3LEGA 3P1IA 4FP3A 1W2TA 3LEMA 3DPRA 4K9SA 5JZGC 1X7NA 3RWKX 4BM8A 1HXS1 3S5AA 2PTMA 3WQ1A 2MNGA 2YG0A 1ENSA 2Z69A 3I2GA 1LHUA 4JRAA 4XZPA 3B02A 5CU1A 4GWJA 5FXZA 4CDUB 4XACA 2VTXA 2W1UA 2RV9A 4Q0VA 4OULA 5FZCA 2WABA 4RS5B 2WLPA 1SDDB 1UIKA 3ZMOA 2DTWA 2P2KA 1LKNA 1APNA 1OPOA 1QJY1 1W6MB 5I8YA 2RE9A 1EV13 4XHBA 2VJXA 4YW3A 4MLOA 4XBQA 3VKMA 4YZ2A 2BU9A 2NYYA 3AFGA 5FZBA 5K9YA 3TB0A 3KSCA 2D98A 1JZ6A 1S55A 3KCCA 3T1MA 5KHJA 2XDVA 3E5UA 4UF0A 4G9SB 5A32A 3F95A 5T5JA 3FBYA 4AVSA 3ZYRA 3WY6A 2BV4A 4BDVB 4DFSA 2R7EB 3VKLA 4LHLA 2GP3A 4OMCA 3VBSB 1N3PA 4DO0A 4DUWA 1NOVA 5BNPA 4E4DX 2IWGB 3GCXA 4LK7A 4QGNA 3I3MA 3RZMA 3HAGA 5CG9A 3CEWA 4BK4A 2UURA 5KR7A 1GWKA 4OHVA 2DUPA 2LW8A 1UYPA 2HKXA 1JU4A 2X5IA 2YFUA 4HKWA 1R083 1W2UA 2D93A 5C9AC 3VZLA 5FZ8A 4ARYA 3IAQA 4ZZ5A 5JMCA 4WM7B 3AVSA 1TQ5A 3IKWA 5FZ4A 2JG8C 4NAMA 4IERA 4K6BA 3D4KA 4XUTA 3VL8A 2XUMA 3MW2A 3VD4A 5JSPA 5KHHA 4N7UA 2HWE3 4D3WA 4IQPA 4QU1A 3WNNA 4AEDC 1W2AX 1LOCA 5F6LB 5HCHA 1AR83 3HWJA 2QZ2A 5DQ0A 5GLUA 4CVUA 1SMVA 1RUNA 5B4NA 5FREA 1MS0A 3UNPA 2GH8A 3I2IA 2QQIA 5D21A 4XF0A 1WBFA 2OUHA 3DXTA 3SHRA 3VBOC 3NAPB 1OXCA 1LU1A 4LIUA 3VN4A 4OHYA 4Q4V1 2Z2SB 3NKTA 3ES1A 3OGGA 1IQDC 3WXPA 4MXWA 3ZFGB 4CXWA 3DYOA 1ENQA 1F35A 4G3YC 4HL0A 2B9UA 2RR12 1TNFA 5C8CA 3ZXFA 2VW2A 3LPFA 1YJLA 2RS53 4DOUA 4M3CF 5JOWA 4IEOA 3GHMA 1GR3A 3AYCA 3WSOA 4ASMB 4AQ6A 4C8DA 4GMP3 1SZBA 2D6MA 2J1TA 2NMOA 3L2YA 4YVSC 2XXZA 5B4XA 3H7JA 4N43B 4D6QA 1G9FA 5J98B 3H8XA 1W6QB 1ZM1A 3MLLA 3MFAA 2YBSA 5KHIA 3P3NA 1UMHA 4M0HA 1PO21 4XDQA 1TEIA 1FOD2 3MYXA 3UESA 3N36A 1BEV2 2P37A 4GH4B 4IEYA 1PGL2 1US3A 3K3OA 1H1MA 5D8AB 4TLGA 4AQSA 3FHAA 4HN1A 4LJHA 2FMYA 3CJIC 1YQ8A 1JZ5A 2WNVA 2WT2A 4YGCA 5FZ1A 5KXBA 4QDSA 3E6BA 2ZGTA 1SBDA 4RQPC 3HT2A 1X9PA 2HBUA 4N53B 1RINA 3WNMA 4DXSA 1QGLA 1AL21 1DU3D 1ND2A 5FZIA 3ACFA 5FZOB 2PAMA 2R043 1COV3 4QX8A 3D82A 2KA3A 3W58A 1XYPA 4ZXKA 4I0WB 2A3YA 4UXAA 5FP7A 1CR7A 1QJX1 3H3ZA 3C2UA 5CISA 1JYWA 1A6CA 5DUXA 1UU5A 2WINB 3N7KA 1U0AA 1R093 4Q4W1 5C8WA 3GHNA 4PDWC 5FLHA 2I74A 2OPKA 1O5LA 3W9AA 4IEQA 5FZ0A 5T54A 2BWCA 1NAEA 2WNOA 2JD9A 3WDWA 4TYSA 4IW3A 5CFDA 1HIXA 4CPBA 1C5HA 3H3UA 4LPLA 4MGKE 2QQOA 2HWF1 1W28A 2L9LA 1ENXA 3M4FA 3U10A 2ZKLA 4D7SA 3GF6A 1HV0A 1HN0A 3ETQA 4LULA 2HBTA 4X8PA 2TNFA 2VCCA 3VBRB 3ZIWA 3AKPA 3M3IA 4HVRA 4OZOA 4COUA 3IMNA 2E33A 1W03A 2JE9A 4FTEA 1VR3A 1POV1 4Z92B 5C3QA 4ISQA 1UX6A 2BGCA 3OEBA 1BMV1 4BISA 1W8NA 1AYM2 1Y9QA 2Y34A 3AYAA 3F2ZA 5FMOL 5F5CA 1GOGA 3V0AB 4GMP0 4EROA 1OLQA 1YFXA 4GULA 5A1LA 3U0ZA 4HMZA 1FMD1 2R071 5IYYA 2HWD2 4QMAA 4BMEA 3K51A 2BQPA 1X36A 2XJPA 1HKDA 1AR92 1VBD1 3GDBA 2VCAA 2NN8A 2W94A 2XVLA 1QIQA 4ARXA 1OA2A 2YYOA 4IEZA 3H42B 5FQ0B 4YM3A 2BFUS 5FZ3A 3N3HA 3K46A 2WIIB 3WW2A 4FFGA 2LUWA 4JCKA 4Y4YA 1S0JA 5LRRA 2IXLA 5D2AA 1Q3EA 3ZKYA 1ND3C 3M3CA 3P5BA 5I0TA 5GLVA 1QXJA 1DFQA 3I8TA 3NVCA 3MHZA 4CU6A 2XLAA 4XFHA 1AYN3 3PJQA 2YHJA 4NIDA 1AR73 5KXCA 1V6IA 3EYPA 1FNZA 2JIJA 4QX0A 5FPAA 2NP0A 5IVBA 4DY5A 3LQCA 4M0NA 1V9U3 3CDZB 3WF4A 3NSTA 3BTZA 1JUIA 1JTZX 3AK0A 1WD3A 4HONA 5ACA3 1O5UA 3O1PA 4YFWA 1VBC3 4NRPA 5G05L 3PDQA 1OLME 2QQLA 2W39A 2EVXA 5JR2A 1Z7S2 2JG9C 1PIV2 5GZCA 5J09A 2WYFA 1PX4A 2XH6A 2YY1A 3THTA 2XJTA 4YPJA 1DYOA 3SISA 3LCPA 3ZO0B 1YHFA 1UXXX 1HB3A 5C4WA 2J1AA 4TLFA 5A3PA 3BI3A 3POJA 2FD8A 4I0AA 1WGPA 3NNMA 2DVDA 1PX3A 5CVRA 2BUKA 1X82A 3C7OA 4L9BA 1QJU3 4CEYB 3ACHA 2OYZA 1I3HA 3I49A 3S57A 2ZAAA 2V5YA 3POWA 5DAPA 3POSA 3H8RA 2B46X 1SCSA 2BRTA 2W87A 2YZ4A 4NHMA 4EZ4A 4BQ5A 3WNKA 1FNYA 3WDXA 2IUWA 4Y1ZA 4YVWA 3H0OA 4FPJA 3MF6A 1JOPA 2QQWA 5F5QA 1Z78A 3V56A 3H1MA 5ABJB 2D6KA 4LIVA 1WCKA 2XJSA 4QD2A 4P5HA 2QNKA 3DL3A 2WO3A 5EYYA 1JMUB 1IKQA 2JX9A 4XW3A 4LITA 1AZDA 1MQTB 5FRAA 5E89A 2QQUA 3KV4A 5DZGA 3WHUA 1G9DA 2W91A 2VM9A 1GQHA 4FPCA 1ZVFA 1PK6B 4DXTA 1QHDA 5FOJB 2CHHA 4ZONA 4META 4UT5A 5C3OA 4AWDA 3ZIXA 2VTXJ 2HWE1 3LPGA 4CDUA 3PJYA 1Z0HA 2ZACA 4RN5A 2X05A 4RS5A 3WF1A 4YM0A 4QWNA 3FHQA 1UOFA 1O8SA 3AJZA 3LWCA 2RHPA 4W4ZA 2ADDA 2GAUA 1W6MA 1U5XA 1ULOA 1W06A 2VOWA 1YNAA 2RR11 4JKLA 5CA6A 1PO12 2GC3A 3MICA 1HRV2 1HB1A 1SLIA 3WNOA 5AC93 3RYKA 1J84A 3HQXA 1ZBA2 1LGBA 1XSQA 2GZWA 2D44A 3IAPA 4L99A 3OBZA 4LE4A 1KITA 3VBSA 2E9QA 4OI0A 2VQUA 3MBWA 4CUAA 2ZX0A 4RYDA 4I30A 1Y4WA 3A4UA 4H7LA 2WNUA 1HB4A 3O1UA 1FOD1 1FPN3 1BEV1 1OVPA 5FUNA 3NL1A 5KHKA 3EBRA 1C8M3 1S0IA 1PGL1 4F83A 3KVAA 3VDDC 3LOIA 4WM7A 1UNBA 5JXJA 3AKSA 4L92A 4U2AA 1ULDA 2XWBB 4A7ZA 5A3MA 1M06G 5T50A 1YQCA 3AMQA 4E8CA 1I1EA 4NHXA 5KHGA 4ZZ8A 3URFA 2RM22 4DUVA 2Y6GA 3BUCA 3NO8A 4XPVA 2Z79A 4LBQB 4HK8A 3CL1A 5FZ6A 4LBKA 4YLZA 4AG4A 1AXYA 3VBFA 2VG9A 3ZXDA 4XJWA 3OB8A 4AYUA 4UF0B 3KMHA 1UAIA 4QM9A 1SLCA 3NAPA 5FY9A 3IWZA 1W0NA 4YW6A 4UFMA 2GC2A 4AFAA 1JU3A 3RMXA 3U1XA 1NCQB 4YW4A 3MIFA 4L0PA 3WG1A 4IE0A 3J7NA 3ZFGA 2IC1A 4DXZA 1JYCA 4CDQC 3N4MA 3AZXA 2V5DA 3BOWA 5K0UC 3PVNA 3DF0A 4QAWA 2VBPA 1H2LA 5BNOC 2VZ1A 2X5IB 3B94A 4WZCA 2PELA 3KCYA 2GN7A 4IE6A 2RJLA 5C3RA 1MZ5A 1EAH3 4CP2A 2V72A 3VHNA 1QWRA 1PVC3 5GZFA 2DU1A 1EUTA 4N43A 1W9WA 3S5QA 1RL3A 1W6QA 2DU0A 3AZZA 5JWPA 4ZY9A 5L7OB 1RHI2 3JD72 4PJYA 1J58A 3WDYA 3T0AA 4YSFA 1HXS3 3ZSMA 1V6JA 2C0ZA 2Q30A 2VCMA 2VUJA 4TXWA 4K7JA 4UW6A 4NN0A 3RJ2X 1CGPA 4ET7A 3JCIA 4GH4A 2WL1A 1AYM1 1BQPA 4NE9A 5D8AA 1X50A 3JB8A 3U14A 4AEJA 1JYNA 1YEWA 2VPVA 5LA0A 4NROA 2BGPA 5LEKA 4ASLA 3E5XA 3IDBB 1ZREA 3WOGA 5LK5A 1BKZA 1KFUL 1RYYA 1QJY3 5F39A 3W20A 2FDKA 1DQ0A 3U07A 2HWD1 5EQUA 1JZ7A 3SEEA 4MG2A 2R0FA 3UJOA 3ZXAC 3TNQA 5A6QA 4N53A 5FO7B 3WHTA 1AR91 4BPZA 4LLOA 3AP4A 1HW5A 4AFBA 3N9OA 1OFSA 5FZOA 2CSGA 3MDPA 1Q8SA 4XFCA 1VBE2 4C1XA 4MUVA 1RJ7A 1XRUA 3MF9A 4CP9B 3WR0A 1BBT2 3DYMA 3I54A 4XFGA 1OQ1A 4C0HA 3KQRA 5C5UA 1JI6A 5CKMA 3K3NA 2EALA 2VVEA 1D2QA 2W0XA 2YGLA 2QCSB 4LHKA 4SBVA 2WZR2 3P6BA 2P4EA 4NHKA 4WVWA 5HXMA 1XYNA 4CCEA 2B5HA 2IXIA 1WLWA 1JOJA 2QFEA 2IFRA 2DUOA 4S2FA 1IS6A 2IXKA 2CY6A 4O65A 4A2UA 2A6ZA 5DG1A 4Q4X2 2WZEA 4YW5A 2PHXA 4P08A 1A8DA 2FCTA 2KXLA 4XE9A 2XWJB 4LO7A 2OVUA 1NCRC 5FYMA 4CCCA 1Q8OA 3RVHA 3PU3A 1Z7S1 1UU4A 3EO6A 4O61A 4MGYE 4UOJA 1ZA4A 3KCXA 3FX3A 4FPOB 4LO8A 4MGSA 4AHXA 5EPAA 2VR4A 2F6BA 1DYKA 4QX7A 5FZMA 3M3QA 5JCTA 4RFRB 5F2WA 4UW4A 2GDFA 2KR2A 1CJDA 1NXMA 4LKFA 4CUCA 1RUOA 2HEWF 3POYA 2A3WA 2JDUA 4Y20A 5GM0A 3M7AA 3V0AA 2BDRA 2P6HA 2DCKA 1FATA 1H4GA 2QUOA 2VZTA 1ODMA 4I02A 3PVBB 3AC0A 4Q4V3 4QXCA 3ZFEB 1KRIA 1LB2A 1AX1A 1KS4A 5DUUA 3HNMA 4YNIA 5DXDA 1HV1A 1YYNA 5FUIA 1LNSA 3VZJA 3QBQA 4Q0UA 1AHSA 2BFUL 1QDCA 5FQ0A 5F5AA 5IK8A 5IT6A 2CYFA 4ZPIA 5F3GA 2R6QA 2Q8CA 4A6OA 1YI9A 2WFF2 4IDZA 4P5YA 3S6PA 5CFDB 2XKOA 4DEVA 1OOPC 2LTNA 3PVOA 1VALA 3C7EA 5F1RA 2ERFA 3N7JA 3E6CC 3I97A 4QXKA 1VP6A 3C7GA 4U36A 1UZYA 3HQRA 2Y26A 3R4UA 5AFBA 4CDXC 1PO23 1PMJX 4S2GA 4WM8C 3T3YA 3VZOA 2EXJA 4E2SA 1L7LA 1ULCA 4M4RA 1BLZA 4E8DA 2RS32 4ITCA 1Q56A 3MIEA 5FK7A 1IS4A 4RGGA 3BOPA 1H0BA 3GBFA 4DZGA 1U5IA 1GZCA 3CQOA 4FCAA 2K46A 2D3SA 3OPZA 3T2PA 4CCLA 4MGTA 2WWSA 2R063 4CU7A 1QH6A 1XNBA 3UGHA 1XNTA 4XETA 1GSLA 4BQWA 2O1QA 3N35A 1SLLA 3T30A 3JQXA 5A6XA 3AP5A 1QOOA 2W95A 1EPZA 2Y60A 3PIGA 4P00B 4P9LA 5JZGB 4XQ4A 1AL23 2BJSA 2ILMA 3AP7A 5F2SA 1NT0A 3B9CA 3VDBA 4JTOA 4IL7A 4EN6B 1QF3A 2HYXA 5FYCA 4EJRA 1QJX3 5LB6A 1D0GA 1DQ6A 1QNYA 1PMIA 3ACIA 3GCWA 3O5SA 4R9CA 1PO11 4Q4W3 4R52A 2W08A 2WO7A 4AI3A 1HRV1 1WUVA 5FLJA 3RRDA 4CEYA 1YC61 1ZBA1 2DCZA 5HI0A 2OPWA 2JDNA 3WG2A 1CIYA 2VL4A 2XHKA 1W39A 2B9VA 2YPDA 1WW5A 3ILRA 3RZZA 2HWF3 1JYVA 1RMU2 4AFCA 4RA0A 3ME2A 2HEYF 4QB6A 4QXHA 2IZWA 2YB7A 3E97A 5ABJA 2JDPA 2UWAA 4Q1PA 1SPPB 3IPVB 1RUG2 3K2OA 5JXHA 5K7PA 2E32A 5A3LA 1JZ8A 5IVVA 1POV3 1YQ6A 1T2XA 1HN1A 2XKPA 4IE4A 4NIIA 2JD4A 3MUY1 4A7KA 2BNOA 2ZX3A 1K5JA 1CJPA 1J59A 1PGSA 5DAXA 1RUC2 1WCDJ 1XNCA 2MPFA 1Y9MA 2Y6HA 5C9AB 1T6GC 4MGZE 2RM21 1PK6A 4FPKA 3VD7A 1K5MC 1OSGA 1I5PA 3B01A 1FMD3 4X8NA 2R073 4CEWC 1LHNA 1GP5A 3I3QA 5CB7A 2JG8B 3ON7A 1QOTA 1WW7A 2FQPA 4M01A 5EJ1B 2MEV2 2AREA 2FHRA 1VBD3 4CDWC 3K4DA 2Y6FA 4FI9A 1J1LA 5HBAA 3ILFA 3FFQA 2E6VA 4CCKA 5A7OA 3OY8A 2WWJA 3RMYA 1W05A 3AVRA 2NZ9A 4AGRA 1W9FA 5I93A 1UL9A 4AEDB 1SLTA 3ABZA 1HRI2 3H1YA 2W1QA 1SBFA 1UW8A 2JKXA 4JVAA 2E53A 1BVVA 1ZZ9A 1MS9A 1RXGA 1RVF2 4GIQA 1UKRA 3ZYFA 4JTNA 3V65A 4KWJA 3AMHA 4PLNA 3VBOB 5F7UA 4LKDA 4L8QA 4XFBA 4QM8A 1QY4A 2NQYA 1J1TA 1QOSA 1H2MA 3MIGA 1H6YA 1JN2P 2AEYA 4XOGA 2A71A 1AXKA 1RHI1 3JD71 1GZ9A 3I2JA 3O7OA 3AYDA 5E16A 5I0SA 1F4AA 2YUEA 3GBWA 5DUVA 1LOFA 5IUQA 3THCA 2WKKA 2ORZA 2PQQA 4CUBA 3LE0A 2W3JA 2UYBA 1PZ8A 4X6RB 4IUGA 4XUNA 2F4LA 3O1RA 4BQYA 3LA2A 3J9SA 2K0GA 1O7FA 4XF4A 4AXOA 5FJKA 5LY2A 2EXKA 4CUGA 4PF5A 2ZZQA 3RZGA 4LBQD 1H9PA 4YZ4A 4LHSA 3PLQA 4XDOA 3SLIA 2ZX1A 1YXWA 1H6XA 4AL9A 2GNBA 2JKBA 2YGMA 3SMHA 4A7YA 3CF6E 3RG0A 2GMMA 3ZYIB 2D40A 3CJIB 2ZKNA 3KT7A 1ZZBA 4BOWA 3RZKA 4LBQA 4AOCA 1V6NA 2PHDA 4LK6A 1VBE1 5HPOA 1H30A 3B69A 4ASKA 1IG3A 1BBT1 4NOTA
chains in the Genus database with same CATH topology
1POV0 1GYKA 3SCHA 3J26N 3DGTA 1OA3A 5IK5A 2WZR1 2DYCA 2XJQA 5JLVA 4IEUA 5JPNB 1NCQA 1VAVA 3FZ3A 4RGAA 4J6GA 2WNUB 2W68A 4B3NA 3UK9A 2HYKA 2LM3A 4Q4X1 3VBHC 3VZKA 2VXRA 1G9BA 4JGZC 2UYAA 3WD5A 4RR3C 1NA1A 4XF1A 3LB9A 5L7OA 3AFKA 4Z1VA 2NM1A 1W0OA 3LA3A 4QPIC 4XBLA 4FOQA 5J96B 2GNMA 1HX6A 1E57A 1W6NB 2VQAA 1KS5A 1ONAA 3FE5A 3ZPYA 1SFNA 3OYWB 3LSDA 3BTAA 3VBFB 2E7QA 2BTVC 2VOVA 2ZGMA 2Q8OA 4BYYA 4FPGA 1SEFA 5BUVA 1LGCA 1WW4A 3BCWA 2RR13 3VLBB 4RQPB 3VZNA 5DG2A 5C9AA 4FOYA 3HR9A 2AZ5A 2WS92 2CGOA 4COVA 1MVQA 3ROUA 2WFF1 4GKXA 3ZMNA 2UY9A 4COYA 4DPNA 2A7AA 5CFCC 1QMJA 1VBB2 2RMU2 3O0XA 2XBO2 2ZGQA 5J37A 4PLOA 1ENRA 5H9RA 4FVVA 2GNTA 1FOD3 3B7MA 5JAXA 1BEV3 1C3HA 2VVDA 2YMZA 2G9FA 2RS31 1ASJ2 4MV2A 1ND3B 4NWWA 1DGLA 1Y7BA 3JUUA 2O8OA 1NQJA 2CTVA 4L11A 2OIIA 4YW1A 2LALA 1S2BA 4R8HA 4XEZA 3L9JT 1LOBA 2AGSA 2WA3A 2WT0A 4AI0A 4CYDA 5C33A 2R061 1U5ZA 2WZPP 1FT9A 3VKOA 3UJQA 4K21A 1YIFA 3AM2A 1G6NA 1MS5A 4KG0A 3WP6A 3ASIA 1LCLA 3ILNA 3OCPA 4MSVA 1HLCA 3B00A 1S0DA 4GALA 4P9JA 4ATEA 1OLRA 1NXD1 2JG9B 3NJZA 4DB5A 3ZFEA 1NLRA 1AUYA 4E4SA 3OBRA 3KGZA 3KB5A 1PNGA 2XVKA 1RUH2 4JGYA 4QGMA 1LHOA 1XQNA 4EWEA 4F3JA 2H0VA 1RMU1 2KM2A 3NKGA 1LEDA 3PTYA 1FAYA 2VW0A 2XGXA 1B09A 1O4YA 4YGEA 3ZN4A 1DYPA 1CAXA 2GC0A 2P17A 3AP9A 1WMFA 4XTMA 3WLUA 1I6XA 2ETEA 5SV8A 1F5JA 3BU7A 4QPGC 3M2MA 3ACLA 3NWKA 1G86A 5HCBA 3R05A 1COV2 5GLWA 4Y24A 3BB6A 1AYM3 3BODA 4E27A 4YZ5A 3NW4A 1RUC1 4YZ1A 1S0FA 4Q8LA 4DINB 1C8NA 3FFZA 4IEVA 1FV2A 2IXCA 3MLKA 3GZAA 1MS8A 4Y1VA 4B8EA 4GQ7A 5LRSA 2HWD3 4BQ1A 4Y20B 1V6MA 2TBVA 2MEV1 1AR93 4B4PA 4LTAA 5JZGA 4BZ4A 2CL2A 3VGIA 4AI1A 1H8TC 1HRI1 1KJLA 1IS5A 1CN1A 2FZ1A 2JICA 4G4FA 4PIYA 4YRDA 3RNSA 1SBEA 2UWCA 1PZ9A 2XL7A 3OBTA 3GNEA 4YG6A 4D7TA 3AP6A 2PAKA 5D1IA 4DS0A 1ZRFA 4LBLA 2FZ2A 3MPBA 1ZRCA 1LULA 2BPA2 3MPPG 2WSUA 2HWC2 1KQRA 2PHFA 4D7YA 1BXHA 4EV0A 4IETA 5CNAA 3ZXKA 4Y1XA 2I2SA 1XE8A 3CLPA 3FJSA 1W6OB 2ZOEB 1Z7S3 3AXDA 3IPVA 3H50A 5E1RA 1KDKA 4XQDA 1I9RA 5EYXA 5JDBA 1B35C 4AHWA 2Y38A 3IIAA 4XYXA 3MIDA 4Y5Z0 5T5OA 4RSUA 1DLLA 1GZWB 3VDDB 2ES3A 2I07B 4HZFA 5CBLA 4KU8A 2VUAA 4HSJA 1CQ9A 3RPQA 2JG8A 4HK9A 4EN9B 3FLPA 4AF9A 3TN92 1H9WA 2ZTNA 2JEMA 3VKNA 2GALA 4UBGA 2WLQA 5A33B 1VB2A 2DFCA 1ZZCA 4AEDA 2FMDA 1AXZA 3L2HA 3WDVA 2Y0OA 4HLTA 4HT1T 1D4M2 3VBOA 1XXNA 3ZSEA 3DKWA 2XVGA 2D3PA 1RC6A 3O0VA 2IXHA 4W65A 4J1XA 4FO9A 1Y3TA 1OMIA 2CAVA 2TEPA 4CDQB 5K0UB 1QQP2 2DCYA 2Q5TA 3QOPA 4JDMA 4Z2WA 1GQGA 5BNOB 3GALA 1DGWX 1XE7A 1R1A2 4XBNA 3VBRC 4YVSA 4XQWA 5GLZA 1CPNA 1AR62 3UV9A 4LO4B 4IV3C 3UKNA 4KGGA 2ZMNA 5DDJ2 1O3TA 5FPZA 4AW7A 2UY8A 4B29A 3OY8B 2DV9A 2F4PA 4LLFA 4W6YA 1PO13 3CJIA 3ENRA 2WS91 1HRV3 1O3SA 1QXPA 1ZBA3 1RUI2 2OZJA 4RQPA 2RMU1 2PFWA 1VBB1 2R16A 1WD4A 2XBO1 2QDNA 3TNPB 3TRSB 5JOZA 3ZSKA 3QD6A 3O14A 2VOKA 3D0JA 5JPMB 2G9GA 4M3CE 4LBNA 2ARXA 2EF6A 4CP1A 1ASJ1 2W52A 5GZDA 1GNHA 4IEPA 2ZS6B 2SBAA 3USUB 5I91A 4FQ4A 4PDWA 2I45A 1EYBA 2P3JA 4MH0E 4Q4Y2 4W6XA 2ZGKA 5FBZA 2A70A 3B93A 3S7IA 1VB4A 2Z5WA 1ULFA 1RUD2 3SH3A 2RM23 3AZWA 1ZZ8A 1NE6A 3HBZA 4Q0QA 3ZYGA 2R0HA 4DRVA 1YCIA 1TMF2 3WP3A 1W6NA 2GH2A 1NCRB 3I7DA 2VW1A 5BNNC 1URXA 3HN1A 4JAAA 3OYWA 3MIBA 2BW8A 1CD3G 4SLIA 4WBBA 2WFPA 3KS7A 3AKRA 5GKAC 1WMEA 5JOYA 1RUH1 3LZZA 4XXPA 4HETA 3IT8A 2HWB2 5JSRA 1FXZA 3NV3A 1RUF2 2DVBA 4YZ3A 4IV1C 4GB32 1VBA2 4HN0A 3JU9A 3MW4A 3BPZA 3RI8A 1RHI3 3JD73 1NA1B 2D6OX 3GZTB 1LECA 4LEJA 3ZFFC 2PLV2 4WVZA 4M3CB 4AVBA 4BWOA 1DQ5A 5DZFA 5EXOA 4YW2A 1UMZA 5LK7B 1ND3A 1RTVA 4EWDA 4FOWA 1I5ZA 2E7AA 3EHKA 5AVPA 1C4RA 2D5FA 2WNEA 2E63A 4WM8B 4AHZA 1REDA 2ZHMA 4Q1RA 1MQTC 1ZYBA 4AVVA 1YJKA 3OGJA 3O0WA 1LOEA 2ATFA 2ZX4A 1VBE3 3WDTA 3WCSA 4D94A 1BBT3 3MFCA 4I09A 3AZYA 5J3UA 1CAUB 2JG9A 2ZGLA 4H55A 4IEXA 2WZR3 5BNQA 2O0OA 4FTBA 2WQ4A 3MLJA 3VBUC 1PM7A 4Q0SA 4HVQA 2QDRA 4XF9A 1JHNA 4UW5A 4Q4X3 4XF3A 2A75A 1IOAA 1S0CA 2HWC1 4JC1A 3KM5A 1Y43B 4AFMA 1C5IA 2DCJA 4P9WA 1EP0A 2ZHLA 4AVCA 3ZXEA 2QVSB 3DPRC 5JVVA 1H2NA 3Q9OA 1MS3A 5GLTA 1PIV1 5T52A 3ZXLA 3J8F2 3CJXA 2D7FA 4BHPA 1VAKA 4EN0A 1VAMA 1C28A 3LSEA 4XFAA 4QQPA 3RQ0A 2IFWA 2VVFA 1OFNA 3TN91 1CAWB 1PNFA 1X8EA 1O91A 4E2QA 1AX0A 5DUWA 4FSJA 4Y1UA 1K5MB 2WFF3 3H8UA 3TAYA 1N1YA 4CEWB 4JGYB 3T2TA 1RUJ2 4HVOA 3KLSA 2WA4A 3WUDA 3WVJA 2QKDA 4BE3A 4KGQA 5FO8B 4CDWB 1WW6A 3HIFA 4LA2A 4QQOA 1D4M1 1YFYA 1AX2A 1WCSA 1CAXB 1JW6A 1QNWA 1OD5A 2VGDA 4FPYA 1LEMA 5BNPC 4LBJA 4YG3A 2C1FA 5KXEA 2RS33 5E8AA 3GBGA 1W6PB 1J3QA 1DHKB 4LO6B 4LR4A 4YM2A 1O3QA 4Z8BA 2ZJCA 2X5IC 3A0NA 1QQP1 4AFDA 1GNZA 4HPKB 2BVBA 3JZVA 3NV2A 1R1A1 4E4ZA 1W6OA 5H9SA 3AZVA 4Y22B 3ZXJA 4COWA 1VRH2 3AKTA 1AR61 4O9EA 1HQLA 5DDJ1 3V64A 4AGGA 5HCAA 3UKTA 5I0RA 4XFFA 2X8KA 1GZWA 4ZKTB 5L73A 3VDDA 3SH5A 3AKQA 5IK7A 3JBG2 3D0SA 4RHV2 3AMNA 4JV4A 5J7MA 3PHMA 4CRQA 5JR7B 1RUI1 1YUDA 3B9IA 4I3PA 2X53S 1IGOA 3AMMA 4FPHA 4AGVA 2NMNA 5FTTC 1DZTA 5A33A 1RMU3 4LBMA 4KH9A 2YPJA 3EJKA 1YRZA 4INDA 5C8CC 3OF1A 1ZZ7A 4I01A 1AJKA 4CZSA 2DFBA 2NLRA 4OVEA 2BVVA 1EY2A 3M8LA 3WP4A 3IDEA 4AI8A 1CAVB 1D4VB 1R1ZA 4Q4Y1 1AL0G 3ATGA 4NWVA 3IDCB 4F8AA 1RUC3 2H6CA 4CDQA 1SCRA 5K0UA 1NZCA 2ET7A 2ARBA 3VBHB 5BNOA 3RWNA 4JGZB 1BYHA 1ZX5A 2BEOA 1TMF1 2C5DA 3QACA 2MEV3 2D6NA 2WNVC 5T55A 3QH6A 3WG3A 4JDNA 2AUYA 1MZEA 2Q1ZB 4P14A 2CGNA 3OJBA 3DV8A 4R9DA 3VHPA 4BLJA 2EAAA 5KC6A 2DVAA 4QPIB 3MEPA 3ES4A 1HRI3 2E51A 4JQRA 1ND2C 1RIRA 5FOBB 3RSJA 3FLRA 2Z42A 1RVF3 5FLIA 4PBPA 1DGWA 1ZBE2 2B7YA 2HWB1 3SNMA 4TZDA 3K48A 1RUF1 4ZU5A 3R6SA 3TYJA 4QHBA 4GB31 1VBA1 4WV8A 1TME2 3WQ7A 1MEC2 4QU2A 2OUJA 5CFDC 1FMD2 2PLV1 2VULA 2GMPA 3WNXA 5HXVA 1C1FA 4K1ZA 4R9BA 3WV6A 5CFCB 4C90A 4XJUA 4ATFA 1GKBA 3B5LB 1DIWA 4KG8A 3USUA 2ZHNA 1RUE2 1X8MA 4YVSB 2K9ZA 5AVAA 2GC1A 2ZABA 1F2NA 5KWRA 3LA7A 1QJZA 2H0BA 4IEWA 4V1PA 4EN7B 1MS1A 2DF7A 3HMYA 1LODA 1SDWA 5EWSA 3VKFC 1ULGA 1XYOA 1NCRA 3B3QE 1BCXA 3M3OA 4TWTA 4YARA 1LOGA 2RS12 1KFXL 2PHLA 4NR1A 1YFUA 4COZA 1N1TA 3FC0A 1FV3A 3FBMA 1SACA 4KQ7A 1ZNPA 2EAKA 4QPYA 4K8FA 1LU2A 3NV4A 2SLIA 2ZAHA 2DWRA 3AMPA 2D6LX 3I2DA 1LHWA 1UF2C 5T5LA 3M70A 2ZGSA 5J48A 1JH5A 1H2KA 3MIHA 3JB4C 4DRRA 3C3VA 2XPJA 2BBVA 4XJ9A 2O8QA 4DNYA 3RDIA 2ET1A 4PDWB 2VQ0A 4C0BA 1WBLA 1EV12 2CNAA 2GN3A 3PMEA 2QJVA 4KL1A 4M3CA 5CIRA 3PNAA 1QU0A 4ISRA 1OOPA 4RFT0 4L97A 3J8F1 1D2SA 4WZFA 3DUIA 3U4XA 2DVGA 3I4IA 4LBOA 5FDBA 3VUOA 2JJ6A 4FT8A 4CDXA 4WM8A 4QPGB 1GLHA 1SFYA 4FQZA 3AX4A 1GFF2 4BLIA 1YO8A 4FAHA 4R4ZA 5GZGA 1ZRDA 4J1WA 5KC5A 1NG0A 1U12A 4HKLA 5H9PA 2WS93 5C4WC 1R082 4LUMA 4I0BA 1PGW2 1Q5OA 1S2KA 1RUJ1 4MZUA 2RMU3 1DZRA 1VBB3 4PIZA 2WSVA 2XBO3 1CAUA 4K40A 4B4RA 1OHFA 3WUCA 3KD4A 3WQ0A 4XILA 1V00A 4FXKB 3ZSJA 4NHLA 3AB0A 4HSLA 5L36A 2P34A 4QQHA 2HWE2 4C1WA 1H8TB 2ZCWA 1ASJ3 2PAEA 1AR82 3ELNA 4P9YA 4ZU7A 4YVWC 4LNVA 1CIWA 2JECA 3SH4A 2HJIA 3RYPA 4RD7A 1G7YA 3E5QA 4BMBA 1YFWA 4LO5B 1VRH1 2AH2A 2QZ3A 4E2GA 4Z82A 1C57A 5L19A 2RS52 1LENA 1CVNA 4N9HA 3FUQA 1NE4A 3ZN6B 1EPWA 2CV6A 3P3PA 3WINE 4CDUC 1MVEA 3IBMA 3JBG1 2P3KA 1SLAA 4W6WA 4HBNA 4RHV1 1F8VA 4RS5C 5K8SA 3LGRA 4XMAA 1B35B 1M4WA 2XJUA 4IESA 1CAWA 3TOJA 1RUH3 4Y1YA 1XNDA 4LT5A 5JIUA 1REEA 1K5MA 2CWSA 3GYDA 4CEWA 4Z07A 2VMIA 3QH7A 2G4IA 1OQDA 4AE2A 4CDWA 2PHTA 4AQTA 4N7IA 1UN1A 4X6QB 2VNGA 3VBSC 1RUG1 1W6PA 1UIJA 2WNUC 3I59A 5CADA 5KBFA 4YFZA 2R042 4LA3A 4AQ2A 1A8MA 2NPIA 3NV1A 4KU7A 4R9AA 1YLLA 3KGLA 4MYEA 4AHYA 4HPKA 4FPFA 5I0UA 4WM7C 4FAGA 1R092 2ZBJA 4Y22A 1KXGA 4D69A 4I3GA 2UU8A 3FWEA 3H1WA 4H14A 1H1IA 1FYUA 2ZX2A 2AR6A 1FI2A 2DTYA 4FBFA 1NY72 4JRLA 3KZ4C 3OD0A 2XLFA 5F6KA 1V6OA 4RL7A 4WVMB 5I8SA 4N9IA 2ZHKA 3VBFC 2B39A 1U5YA 3CO2A 1UU6A 4XJZA 3CNAA 4Q2FA 1ZBE1 3BIWE 1RITA 4IV3B 4QQLA 1RVF1 3NAPC 5J36A 5CG8A 1V70A 1MACA 3G7DA 1TME1 5HCFA 3ZFGC 2HWC3 1MEC1 4HKOA 1OPMA 2BNMA 2N7GA 3ZX7A 1YIPA 5EJ3A 2CWMA 1V6LA 2JENA 2V73A 2CAUA 2DVFA 2VMGA 4N43C 1O4TA 3HT1A 1UCXA 1RUE1 1V6KA 1CAVA 1GBGA 1L3JA 2UWBA 1NYWA 4Q0PA 1Q8VA 3N7LA 1PIV3 3SITA 1OQEA 4FPLA 4MX3A 4OHWA 4CP0A 4GH4C 4NPRA 3VBHA 1HQWA 5D8AC 3V0BB 4JGZA 4RR3A 2B42B 2B45X 5GZEA 2YC0A 5JI7A 2BNNA 3TN93 2A6WA 4BIFA 1AYN2 2OZ6A 1AR72 1G9AA 2RS11 3LAGA 3BALA 5BY5A 3J4UH 1Q8QA 4B7KA 4N53C 4OI1A 4GXLA 4QPIA 1TNRA 2Y0IA 1UKGA 1V9U2 1VJ2A 4EWAA 4YM1A 3D5OA 1S0GA 5BXXA 5BNNB 1RGSA 2R1BA 5ACA2 1D4M3 3LKJA 1VBC2 1S0BA 2IXJA 2XG3A 3N7MA 4PQ9A 4QX5A 4XXAA 2VECA 2ZGRA 3H9AA 1FX5A 1VIWB 4FTSA 4DY3A 2Q1MA 1QQP3 4GA9A 2VMHA 3WW3A 1EV11 5FFOC 4B4QA 4MXVA 2A73B 1ALYA 3KT1A 5FCCA 1GV9A 1QKQA 1R1A3 3ST7A 4IV1B 2EXIA 5CFCA 4IXLA 2VU9A 4TSVA 1RJ8A 1QJU2 1HQNA 4F7ZA 1AR63 3ZFFB 5DDJ3 2ZGUA 1RB8G 5AFEA 2D5HA 4K20A 1MZFA 4ORFA 4EN8B 1CX4A 4ZU4A 3LOBA 1UPSA 1N47A 4K3UA 1LOAA 1R081 1JYIA 3TWIA 2AYHA 1PGW1 1RUI3 1DG6A 2PA7A 3AYEA 1BZWA 1N1VA 4YGDA 1N1SA 1S0EA 4AI2A 2PHRA 4KNCA 3VV1A 5JSOA 1F31A 1IQAA 4OZXA 3WX5A 2MHFA 2DCTA 3WW1A 3R4DB 1G9CA 1AR81 2DURA 2V09A 4WVVA 3ZSLA 3RJRA 4CTEA 2XLGA 4R4XA 4YGBA 5JI9A 5LEJA 2YXSA 4MVTA 4Q4Y3 2RJKA 3QCWA 3UKVA 2D43A 3VBUB 1JXNA 3AXEA 2ZZJA 4BA6A 1O3RA 5B2GB 1RUD3 4XIOA 3RI9A 1D0HA 1LRHA 2PN5A 2D6PA 1BJQA 4KWLA 2EA7A 4FPEA 1NQDA 3THPA 1TMF3 2XJRA 1GICA 2RS51 2C9AA 3FHIB 5AC92 3S30A 1CPMA 2HEVF 5FO9B 4GMP1 1ZZ6A 4QPGA 3IN9A 3DPRB 1DQ1A 2BWAA 1PVXA 1NLSA 2XJVA 3ZYJB 1FPN2 2ZMLA 4ONUA 2HWB3 1C8M2 4ES9A 1G8WA 3MZHA 1RUF3 2ENRA 4GB33 1VBA3 2P3IA 4CEYC 2PHUA 1GANA 5EV7A 3ZN5A 2PLV3 1DQ4A 4H7MA 2R1DA 3RYRA 1IPKA 1H8TA 5TSWA 4L2NA 2VY0A 3ECQA 3ALQA 5A32B 2R041 2VH9A 1COV1 1OOPB 5ABJC 2ZGPA 4AVAA 3U11A 1CESA 2QE3A 3USSA 4CDXB 1KDMA 1R091 5BNPB 3D8CA 2AENA 3CU7A 2Q0AA 3WT3A 1AVBA 1XNKA 2DUQA 3H7YA 1Q43A 1H4HA 1NY71 1WLCA 1PK6C 5JOXA 3M3EA 4Q26A 1X33A 3ZN6A 1EAH2 1MS4A 1PVC2 1N3OA 2OA2A 4H3WA 1A3KA 2FBEA 4QGLA 1Q8PA 4P9IA 1B35A 2VOXA 2B8MA 1HXS2 3MW3A 1KD7A 3ZXGA 1S1AA 3EQEA 4KWKA 3FLTA 3TBDA 5FAXA 1SQ4A 1IKPA 3APBA 2ZGNA 1TE1B 1QH7A 4FXGB 5F9TA 4DQAA 5BV6A 1QJY2 3S7EA 5I8TA 5H9QA 3VZMA 2GU9A 2WQZC 2YDEA 3M1HA 4MXWB 1BK1A 4Q27A 2Q4SA 3MI8A 5GJ6A 3WW4A 1DQ2A 5C8CB 2ZPXA 4HANA 2R49A 1LOFC 3J8F3 1DGRN 1XU1A 2OW4A 2JE7A 3FMGA 3AJYA 4OLLA 4XMIA 1IZ3A 1QDOA 3A0KA 2A6XA 1AYN1 2GMEA 2A6VA 1AR71 1C1LA 2XB6C 4DMIA 4N90A 3RS6A 3ZDSA 1YWKA 4LE3A 1O4ZA 1LESA 1RUJ3 4WVMA 1V9U1 1IHMA 3VBRA 2WNVB 3QLQA 4AEKA 1DBNA 4PLMA 1LJ7A 1PHMA 5ACA1 2BYVE 1VBC1 4OHXA 4IV3A 2JXAA 4XFIA 4AK3A 4YG0A 2K2SA 2R32A 2XL9A 4LHNA 3IM0A 5GALA 3T1LA 1ND2B 1NCQC 4KBBA 5IK4A 3WCRA 2A3XA 1IPJA 4C91A 1F5FA 3OTFA 4YYOA 4I2OA 3I59B 3EXUA 3WZ1A 4P9XA 3SXWA 2WC2A 2PHWA 1WA4A 4Q4V2 1NA1C 1A78A 1JBCA 3GZUC