1EV13

Echovirus 1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
239
structure length
239
Chain Sequence
b'GLPTMNTPGSNQFLTSDDFQSPSAMPQFDVTPEMHIPGEVRNLMEIAEVDSVMPINNDSAAKVSSMEAYRVELSTNTNAGTQVFGFQLNPGAESVMNRTLMGEILNYYAHWSGSIKITFVFCGSAMTTGKFLLSYAPPGAGAPKTRKDAMLGTHVVWDVGLQSSCVLCIPWISQTHYRFVEKDPYTNAGFVTCWYQTSVVSPASNQPKCYMMCMVSACNDFSVRMLRDTKFIEQTSFYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECHOVIRUS 1
publication title Structure determination of echovirus 1.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 239
sequence length 239
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ev1300
1VBD3 4YVSC 5C9AC 5C8CC 1HXS1 4NWWA 2RM22 1AL21 1PGL1 1PVC2 2X5IB 2HWC3 2RS31 2BFUS 1QQP3 4CDWB 1ASJ2 5C8CB 5AC92 1EAH1 4AEDC 1AYM3 1R091 1BBT1 1COV3 1RUE3 3CJIA 4WM8C 1FOD3 1NG0A 1QJZA 2RMU2 1D4M3 1QJX3 4CEYC 1HXS3 4AEDB 1FPN2 3ZFEC 1RHI2 1VBA3 2RM21 1PVC1 4WM8B 5A32A 1EV13 1ND3A 5L7OA 1PO23 1MQTC 1ASJ1 5AC91 1R093 3LOBA 1H8TA 2GH8A 4Q4V1 2RS53 2R063 1MQTB 3VBOC 2RMU1 2ZZQA 1FPN1 2ZTNA 1B35A 2HWD2 4QPGA 1RHI1 2HWE2 5D8AA 2WS91 2WWSA 4Q4Y2 1BEV2 1OOPC 1ASJ3 4EJRA 1PO12 4CDXB 1NCRC 4CDUB 5DDJ3 5ACA2 3J8F2 2XBO1 3VDDA 5BNNA 1RVF2 3JD73 1HQNA 1FMD3 2HWD1 1RHI3 2HWE1 4Q4Y1 4YVWA 1F2NA 1TMF1 5A33A 1BEV1 4N43C 1F8VA 1PO11 3ZFFA 1DDLA 1VBD2 4JGYA 5JZGC 4WM7C 5ACA1 3CJIB 2HWC2 5C4WA 1K5MC 1QQP2 5FMOS 1RVF1 4FTEA 4FTSA 1PGW2 1TME3 5JZGB 2GSYA 2WLPA 1AR71 1AYM2 2R073 2XPJA 1COV2 4Q4Y3 5CFCC 5CFDC 1BEV3 3VBRA 1FOD2 1OPOA 4IV1C 2DF7A 2FZ2A 1ND3B 3ZFGC 5L7OB 5LK7B 1GFF2 1QJX2 1VBD1 4GMP0 1VBA2 1B35C 3J8F3 1H8TB 1NOVA 2HWC1 1EV12 1QQP1 1PO22 4QPIA 1AYM1 1B35B 4JGZA 1COV1 4QPGB 1MEC3 5D8AB 1Z7S2 2X5IC 4RFT0 3VBFA 2RS52 4N53A 4CDQA 1FOD1 4CDWC 1D4M1 1QJX1 1VBC2 2RS13 4Q4W3 1VBA1 1CJDA 2HWF3 2BUKA 1EV11 3VDDB 3DPRA 1PO21 5J98B 1POV0 5ABJA 5BNPA 4RS5A 5DDJ2 1Z7S1 2RS51 5A33B 3JD72 4LLFA 2R061 4GMP3 3FBMA 3ZFFB 1FMD2 1R1A3 1VBC1 3ZXAC 4JGYB 1RUC2 1RMU2 1RUH3 4IV3A 3VBUC 5C4WB 4GH4A 1AL0G 1E57A 2RR13 5DDJ1 3NAPA 1QJU3 1VRH2 1Z7S3 2ZAHA 3IDEA 5GKAC 3VBUB 3S6PA 1AYN2 3VBRB 3JD71 1C8M3 4CDXC 1NA1C 1FMD1 1VBC3 1TME2 4CDUC 2R072 1AUYA 1RUC1 3VBHA 4N53C 1POV3 1VBE2 4FSJA 1NA1B 2WZR3 4RR3A 2BBVA 1VRH1 1ZBA3 1V9U3 4N53B 1C8NA 2BFUL 3DPRC 1VB2A 1TME1 2QQPA 5ABJC 1RUC3 2R071 1ND2A 1RMU3 1MEC2 3CJIC 2R043 5BNOA 3DPRB 1AR63 4PDWA 5ABJB 1AR83 1VRH3 2RS12 4Q4W2 4RS5B 3J8F1 2HWF2 1SMVA 1AYN3 1ZBE2 1HRI2 4YVSA 5C9AA 5C8CA 1ND3C 5L7OC 1BMV2 1PIV3 1HRV3 3HAGA 2MEV2 1MEC1 1H8TC 5A32B 3JBG3 4IV3B 4AEDA 1VBE3 4CEWA 1QJY3 4GH4B 4SBVA 1R083 4WM8A 1R1A2 1X36A 1IHMA 2RS11 4Q4W1 4QPGC 1RUH2 3NAPB 5D8AC 2HWF1 1ZBE1 2VQ0A 4CEYA 4Q4X3 3ZFEA 1BMV1 1OHFA 5J96B 1PGW1 1RUG2 2RR12 1VAKA 4RR3C 1VBB3 1QJU2 2BPA2 2Y26A 3VDDC 5BNNC 1C8M2 1RUD3 1RUJ3 4GMP1 4RR3B 1R1A1 3TN92 1RUH1 3VBOA 1ZBE3 1HRI3 4YVWC 1W39A 5BNNB 5BNOC 1RUG1 5K0UA 2WZR2 3ZFFC 2RR11 4GB33 4JGYC 4PDWC 2MEV3 1QJU1 2PLV2 1ND2B 1CD3G 1OOPA 1AR93 4YVWB 1ZBA2 2HWB2 1VB4A 1NCRA 1V9U2 5C4WC 5BNOB 1C8M1 4RQPA 5FMOL 3TN91 4Z92B 4PDWB 1HX6A 2R042 1WCDJ 4YVSB 3VBRC 5C9AB 1RUI2 3VBSA 1POV1 1RUG3 1M06G 4CEWC 2WZR1 1AR62 1NCQA 4RHV3 1AR82 4Q4V2 2WFF3 1NY72 4N43A 2PLV1 1ZBA1 2HWB1 1V9U1 5JZGA 4WM7A 4CEWB 1PIV2 1AL23 3TN93 1K5MA 2WS92 2RS33 4QPIC 1HRV2 3JB8A 1RMU1 4JGZC 2R041 3JBG2 4CEYB 3VBFC 4CDQC 1EAH3 1RUI1 3ZFEB 1QJY2 1BBT3 1AR61 1R082 1X33A 5CFCA 4QPIB 5CFDA 1AR81 4IV1A 2XBO2 2PLV3 1NY71 4JGZB 3ZFGA 1RUF2 2HWB3 1AYN1 3VBFB 4CDQB 4Q4X2 1PIV1 3JB4C 2RM23 1PVC3 5K0UC 1TMF2 1HRV1 5BNPC 5FOJB 1VBB2 4RS5C 4FTBA 3VBOB 3JBG1 1RUI3 5AC93 1VBE1 1RUD2 1RB8G 1QJY1 1RUJ2 1R081 2TBVA 2X5IA 2FZ1A 4RQPC 5K0UB 4Q4V3 5BNPB 2IZWA 4CDWA 1RUF1 1OOPB 2RMU3 1NCRB 4IV3C 4Q4X1 1FPN3 4GH4C 4RQPB 3VBSC 1AR72 2WS93 4GB32 1NCQC 1VBB1 3NAPC 1AR92 1RUD1 3VBSB 1RUJ1 4Y5Z0 1NCQB 2XBO3 1RUF3 4N43B 1HRI1 3VBHC 2HWD3 2HWE3 4WM7B 4GB31 1RUE2 1TMF3 3VBUA 1K5MB 4RHV2 4BCUA 2MEV1 2WFF2 1MQTA 1AR91 1PO13 3M8LA 3VBHB 1D4M2 1HXS2 5ACA3 1AL22 1PGL2 5CFCB 2RS32 5CFDB 4IV1B 1RVF3 1ND2C 3ZFGB 4CDXA 1NA1A 4NWVA 1EAH2 4CDUA 1AR73 1R092 1BBT2 4Y4YA 1A6CA 1RUE1 4RHV1 2WFF1 2R062
chains in the Genus database with same CATH superfamily
1YYNA 2VCMA 5LBCA 5C9AC 1S1AA 4M0NA 1F15A 1UY4A 3MPBA 4XC9A 1OF4A 1WGPA 2VNOA 1RYYA 2YC0A 2X5IB 2NM1A 2RS31 4D6SA 2W39A 2BFUS 5FXXA 1XNAA 1DGWA 3ETQA 3LIGA 4N8MA 4CDWB 2Z69A 4XIKA 4ZHNA 4EV0A 4LE4A 3O1PA 2WA3A 2WNOA 1UMHA 4ZY9A 1LULA 2VOKA 2NYYA 1R091 4IQPA 1COV3 4OUEA 3VKFC 1CN1A 3CJIA 3OY8B 1A78A 4ARXA 1WCUA 2QQNA 1SDDB 2WNVA 1NG0A 4YZ3A 2DVBA 5K7PA 2LS6A 2WN3A 3VHNA 4Q0UA 2P6HA 3AP5A 2RMU2 1D4M3 3U14A 1G9DA 1VR3A 2WRAA 4CEYC 5FXZA 2DVAA 4PJYA 5J09A 2ES3A 2ZGMA 3BIWE 3ZFEC 1OA4A 1J59A 1Q8SA 2Y6KA 3IWZA 2RM21 1W6NB 2XG3A 5A32A 1OKQA 5JSRA 1EV13 3UNPA 1WMFA 2BW8A 2RVAA 5FZMA 2FDFA 1G9AA 4JAAA 1NQJA 2J7MA 2YB7A 3EYPA 4PHZA 3O12A 2VZQA 3BU0A 1JHNA 1R093 1TNFA 1JBCA 2D6PA 5FY5A 2ZS6B 4HKLA 1UOBA 1AZDA 1H8TA 3ZSMA 4P9GA 2WO1A 2ZGRA 2RS53 1U5ZA 5KHGA 2B46X 5L9RA 1MQTB 3JXSA 3ILNA 4WVMA 2ZZQA 4PIYA 1FPN1 2ZTNA 4XJAA 3WQBA 4CP2A 4NR1A 1QNWA 5D8AA 1E5IA 1FV2A 4QMAA 2NQYA 4LOTA 5FZFA 2ZZJA 4Y1UA 3W5MA 2JX9A 1OKOA 4FO9A 5AFEA 5FY7A 3VZNA 4IGOA 1GP4A 4CU9A 3MHZA 4AI1A 1CPMA 3CJXA 4IEVA 4CDUB 1YJLA 5C3OA 3KB5A 1ZA7A 4WBBA 3J8F2 4Y26A 3HWJA 3DYMA 1D2SA 2PELA 3PIJA 4Y5SA 4FPJA 4Y24A 3JD73 3VV1A 4HN0A 2JKXA 4I3GA 4YWAA 1M4WA 4L0PA 3ORJA 2HWD1 3H3UA 4MHUA 2ZABA 4YPJA 3ZSEA 1JZ3A 3CF6E 1ZRRA 2JE7A 3PU3A 4FPKA 4YVWA 3UV9A 2VUCA 1B09A 1BEV1 4G3YC 3VLBB 3I2KA 2WNVC 4N43C 2CGPA 3NKTA 5A7SA 3DCQA 2JIGA 2QCSB 4P9IA 4BOWA 3ZR6A 2OIIA 2JD4A 5FZAA 1W8NA 3TEYA 3P5BA 4Y20B 3WINE 2R0HA 4CP9B 1NT0A 2V5DA 3LA3A 4X6QB 5T5OA 1K5MC 2KA3A 5FY8A 1L3JA 1OF3A 4YG6A 2OXBA 3K4ZA 2J1RA 3NJXA 3L2HA 2UY9A 5JZGB 3RYPA 1BK1A 2R073 2P6CA 1YI9A 2QQIA 1COV2 1P8JA 1QEXA 2E7QA 3IAPA 4WVWA 2XPJA 4AVSA 1JYIA 5CFDC 1BEV3 2A3WA 1LHNA 4XFCA 3TEZA 2NMOA 5EWSA 1OA3A 5L7OB 3WG1A 1VLNA 5A3TA 4NRMA 1PK6B 3LFMA 1D0HA 4QX5A 1KJLA 3I2GA 5JUVA 4META 5IFTA 5FBZA 4DIQA 2PHUA 4O9GA 1EV12 1XYOA 5FK7A 2G9ZA 1HV1A 2GNTA 2Q8DA 3OYWB 4MSVA 4CPBD 3EO6A 3C7FA 3EXUA 4P5YA 2WBKA 3WW1A 2PFWA 3AK0A 1B35B 4HPKA 4B7KA 4QPGB 4JHTA 3OUHA 2VC9A 5FZOA 4RFT0 2JG9C 1SPPB 2DUQA 2RS52 3VBFA 1RJ8A 3ZXJA 4CDQA 2QTWB 2VZSA 2EIGA 4AAXA 1BXHA 2ZGNA 2WABA 2YV8A 3WUDA 4C1WA 2VVEA 1WCKA 3DKWA 1QMJA 3MLKA 3QH6A 4HETA 1GNYA 2RJLA 4D6RA 5FFOC 5C7GA 5LY2A 3T2QA 3WNNA 4DMIA 4DXTA 1Q8OA 3MLJA 1FV3A 5FWJA 1QY4A 2JDMA 2Q8EA 4N7IA 3VDDB 2IVJA 5A6XA 1AF9A 2WA4A 4S2FA 1W28A 2CV6A 3GGLA 3MW3A 4V1PA 1QJEA 5B2GB 2FMYA 1J1LA 2VM9A 4LA3A 4QX8A 4YW5A 3I3MA 1DYPA 3B7MA 3ETPA 2A3YA 3TAYA 1Z7S1 1ENSA 2DTYA 2J1EA 4FPGA 3U37A 2JECA 1TZOA 4DINB 3E6BA 3JD72 2GDFA 3C2UA 4UFJA 5EYXA 2VECA 3FBMA 4LKEA 3ZFFB 1R1A3 4MG2A 1VBC1 3A7QA 2VCBA 2XONA 2EXHA 1IS6A 4JGYB 2VE1A 5LBEA 2JDYA 1RUH3 3VZKA 1U0AA 3KM5A 3PUAA 3VB9A 5JOXA 4S2GA 4GH4A 3BIEA 1AL0G 2VVFA 3T1LA 2ZGQA 3H7JA 4AW7A 5FBJA 1SQ4A 1RXFA 1ZZ7A 2OZ6A 1W99A 4PQ9A 1VRH2 1Z7S3 2OS2A 2P1BA 2ZAHA 3MIGA 5FYZA 4X8PA 2BNMA 3WY6A 1Y4WA 3IN9A 4B4QA 3DXUA 4FVVA 4EN0A 2VQAA 1HDKA 1VBC3 1VJ2A 2B8MA 4H7MA 4D6QA 2A70A 4XUQA 4K1ZA 2R072 1AUYA 2HLEA 2SLIA 3P3PA 4E4ZA 5HPOA 3TNQA 4AI3A 1PX3A 4Q27A 2OQ7A 2VY0A 1SLCA 3HEIA 5HV4A 1A3KA 1JH5A 4GULA 3ZXFA 4OVEA 1POV3 4JVAA 3O1VA 5GLUA 3DUIA 4RR3A 1HLCA 4V2WA 3ZYRA 3AVSA 1D2QA 2P4EA 3J7MA 4K8RB 2WZPP 3WG3A 1QNYA 2AH2A 1IKQA 3AZWA 3G6JB 5BNQA 1ZBA3 1BVVA 1POQA 1XYNA 2XUMA 1H6XA 1RC6A 4AG4A 1C8NA 5F5QA 5CKQA 3WHTA 5A7QA 3T08A 2VW0A 1TVGA 4LNVA 1NE4A 3OOXA 3ACGA 4JRAA 5I8YA 1W0OA 1WCSA 2R1DA 1PHMA 2CDOA 1LEDA 4FP3A 2PHFA 2WZ8A 2ZGKA 2R043 5BNOA 1XXNA 4FPFA 2E6VA 2GMPA 2PXJA 3AVRA 5H9RA 4UW4A 5IYYA 3O1RA 2QQMA 1W6PB 5F9TA 4XZUG 1AR83 4YGCA 1AXYA 2H6CA 2IXKA 3D6EA 1JZ6A 2FCTA 3I3EA 1BVP1 1N1YA 2OA2A 1SMVA 1Q3EA 1U5XA 1HRI2 4YVSA 1IPSA 2WNUA 5KHKA 1JODA 2WINB 2DCKA 5L19A 4XAAA 3BYWA 2VBBA 3I59A 4ZXKA 1JUHA 3FZ3A 2WUHA 1W6MA 4W4ZA 4R9DA 3HAGA 2Q4SA 5F5AA 3IDCB 1LU2A 3DKQA 2XB6C 5A32B 2PMWB 4AK3A 4DY3A 2CU5A 3H0OA 1N1TA 4AEDA 5GZGA 1S0CA 1LOFA 4IE5A 1KJRA 1YFUA 1GV9A 1YFYA 4R9BA 4ZU5A 3D0JA 1R1A2 2WYSA 4WM8A 2WO3A 1X50A 4Q4W1 4BK4A 1RUH2 3HIFA 1WLDA 1F5JA 3HN1A 4FFFA 4CCLA 3PU8A 4MOAA 1JXNA 4JZRA 3AMHA 3KV5A 2VOXA 1BYHA 5J96B 3UKVA 1RUG2 1YIFA 3CEWA 3N7KA 4WVMB 5C3PA 4RR3C 1H2KA 3RJ2X 4QM9A 1UPSA 2WYFA 4AFBA 1Q56A 1ST8A 1MS4A 1O8SA 1OLME 4GJYA 4LO8A 1XJAA 1KDMA 5BNNC 4XMAA 4P9YA 4TN7A 1JUIA 1A8DA 3IMMA 3LDKA 2R6QA 1RUJ3 4Q0SA 4BXFA 4E9KA 1PNGA 4LHLA 2J1TA 1UIJA 1C4RA 1KEXA 3DN7A 4P14A 4U36A 1G9FA 3VBOA 1AVBA 3RYRA 1WLWA 3H50A 3VZOA 5AVPA 5BNOC 4D8MA 4H2AA 2VW1A 3B69A 1UMZA 4XQDA 4GB33 4AFDA 1XU2A 4UXAA 1G6NA 3HNYM 1JYTA 5EJ1B 1J1TA 2MEV3 1QJU1 2DCZA 2PLV2 1ND2B 4MXWA 1CD3G 4NPMA 2HEYF 4YVWB 1ZBA2 3RJRA 1JOPA 1VB4A 1D4VB 4HG6B 2X53S 1L7RA 3B5LB 3T2PA 1O3QA 1ZRFA 2WNUC 4QM8A 3ILRA 2R0FA 2ZEYA 4XETA 4OCTA 3TN91 2HEWF 2Y0OA 4MLOA 4LIUA 1MS8A 4MGZE 1VMHA 4XABA 4MH0E 3SCFA 5JR2A 4NIIA 2OYZA 2R042 1O5LA 2GC0A 3WG2A 4JV4A 3UT0A 3MFCA 1FYUA 3R4SA 1UZ0A 5FZ4A 3OEAA 2EXJA 3LPFA 4LKDA 4QGMA 2O0OA 3A22A 1W6OB 4XF0A 3FHAA 1AR82 4HMZA 4XUPA 3VZJA 5JOWA 4B29A 2HWB1 5IK7A 1V9U1 3RS6A 4XMIA 5E1RA 4XUOA 4C90A 5E89A 4D0QA 3WF2A 1O4ZA 3BPSA 4YM0A 5A3NA 1AL23 1US2A 3TYJA 3LOIA 5I0DA 3TN93 1CGPA 3AKPA 1UU6A 3ZX7A 1RMU1 3HNMA 3SKJE 4JGZC 5T5LA 4AE2A 1JYCA 5I8TA 4UT5A 2BYVE 5FZ8A 5FMDA 1RUI1 3D5OA 2PTMA 3ES4A 4QHZA 1WW5A 1X33A 3MPPG 1QH6A 3H3ZA 2D5HA 2XBO2 2EIEA 2FD8A 2HWB3 4UFIA 1J58A 3WP5A 4Y33A 4XF4A 3VBFB 4CDQB 1VAVA 5FYBA 1O91A 3THTA 4YZ1A 2W5FA 1JYNA 4JX0A 2Q1FA 5KC5A 4DUWA 3RGBA 3AB0A 4ZKTB 1PVXA 3ZM8A 1Q43A 1TMF2 1GNHA 1HRV1 3GBFA 5FY0A 2UWCA 3WG4A 5BNPC 5F1RA 2D6KA 4RS5C 4L99A 5GZFA 1VPHA 2WIIB 4HK8A 4IEZA 3VHPA 1GZWB 4MXVA 1DQ6A 3JBG1 2BBAA 1RUI3 4IEQA 5AFBA 1VBE1 1UZWA 2VCAA 2GC1A 1RB8G 1RUJ2 4FPOB 4LEJA 2X5IA 1WBLA 4HSJA 5K0UB 4Q4V3 2QNKA 2UYBA 2IZWA 4CDWA 4ONUA 5FLHA 1S0BA 5JOZA 1OOPB 2JD9A 3POWA 5FMCA 2VMDA 4XCBA 1NCRB 2VVDA 4IV3C 2XH6A 2W95A 2GC2A 2XUEA 5CVRA 3I49A 1VAMA 2JWPA 4R9AA 4YM2A 3O1UA 3VHOA 3OY8A 4N7UA 4Z8BA 4PF5A 2WS93 3CLPA 4GB32 1UZZA 2A73B 2WC2A 4OLLA 1C1FA 4YW2A 4K3UA 4X8NA 1ZA4A 1E5SA 4B7EA 2OT7A 2QQUA 4IESA 4IEPA 5KXEA 3PUHA 2GZWA 3ZIWA 3NKGA 2IFWA 3GYDA 1W6NA 3VBSB 5FP3A 2JEMA 1H9WA 3GALA 5FPVA 3AZVA 4QB6A 2O1QA 1H8VA 5KXDA 3ZSLA 4QT6A 1V6OA 3ZDVA 5JCTA 3HBKA 1X82A 3PUIA 3O1MA 4WM7B 1RUNA 1GWMA 1XE7A 1SFYA 1RUE2 1FX5A 3VBUA 2C4XA 4NVPA 1W04A 2R49A 2AREA 1MQTA 3ZKYA 1PO13 3OTFA 4KG0A 4INDA 5FYUA 3N3HA 3N35A 2WQ8A 4QQPA 5FZ1A 5ACA3 4LBNA 4TTGA 3N7JA 1AL22 3E5UA 1PGL2 3LIHA 3WP3A 4BK5A 4AQTA 1MZ5A 5CFCB 3D0SA 4XFAA 1RVF3 2ARXA 2PA7A 1V6MA 4IERA 3ZFGB 2VQUA 4DO0A 1NA1A 1XB9A 2GP3A 3FFZA 4G4FA 1JOJA 4CDUA 1REFA 1AR73 4IE0A 2FDKA 4KWLA 4E8CA 4OHYA 3CZUA 1HB3A 4XILA 3KQRA 4Y4YA 1A6CA 4P08A 2NZ9A 3WW2A 5IVFA 2WFF1 2F6BA 3LDBA 4DB5A 3C7HA 4XE9A 2R062 2KR2A 2QQWA 1S0IA 2VZVA 2JB8A 5IVCA 2C0ZA 2PYTA 3O5SA 2W94A 4DXSA 3O7OA 1SLLA 4BQ3A 3MBWA 4AYUA 3WNOA 3H8UA 2YHJA 4AVAA 5FYYA 1JTZX 1UF2C 4QXBA 1ASJ2 3USSA 2P5BA 3M70A 4XTMA 4Y1ZA 3T3YA 4LO6B 3IIAA 4CCJA 1EAH1 3W21A 2G4IA 1AYM3 4Y20A 4AWDA 1BBT1 2NMNA 2YUEA 4CP9A 3NV4A 1JZ8A 4IGPA 3OD4A 5L7OC 2CAVA 1FOD3 2ENRA 3KGLA 4MGIE 5SV8A 2DURA 3N9OA 1OFSA 1UU4A 4UFHA 3WXPA 2P3JA 3N4MA 1UOJA 1FI2A 3QOPA 5FZ0A 2VTXJ 4K1YA 4AEDB 3B02A 5KHHA 4C0HA 5LWBA 1LB2A 2ZMNA 4GWMA 1NAEA 4ZPIA 4Q8KA 3C3VA 5J7MA 4WM8B 2BGCA 5GLZA 3INAA 3MIFA 5FPUA 1PMIA 5L7OA 1LTEA 5FZEA 5FLIA 1MQTC 3E97A 1XSQA 5HXMA 5LATA 1CWPA 1WMDA 2ZX1A 1S4CA 2VH9A 3NNFA 3VN4A 2VZRA 2VW2A 2RDNA 5BXXA 2GH8A 5EIYB 4GA9A 2QKDA 2GMMA 4K9SA 1JYVA 5J36A 2ZX0A 5CNAA 5A80A 4AQ2A 1T2XA 3OYWA 1UOGA 1YO8A 3J9SA 2RMU1 3VL9A 4LO4B 1O4TA 4QX3A 5F2SA 3V65A 1JOBA 1B35A 2BV4A 4NHYA 4QPGA 3L9JT 4KI5M 4Q4Y2 5DUVA 1JU4A 2QE3A 1JYXA 3I54A 4OUSA 1UYYA 3D82A 1PO12 3NW4A 3RNSA 3POEA 4CDXB 1HN0A 1N3OA 1IPJA 2D40A 2BGPA 4A44A 5ACA2 1GOGA 4M0HA 1W9TA 3OEBA 3MO4A 3VDDA 5FZKA 5FXWA 4XBLA 3GJBA 1EP0A 4KMQA 1PGSA 1RVF2 2VZOA 2ZEXA 3GDBA 2G9FA 1I1EA 4FOYA 1FMD3 1ZZ8A 3B00A 3WDUA 4COVA 4AHZA 3B94A 3LFIA 2FCVA 3ZSKA 3SEPA 2E33A 1IG0A 3POFA 3RZZA 5A6YA 4ATEA 5K8SA 3NNJA 4UFLA 3EJKA 4GD4A 1W2NA 3TEXA 1JN2P 1F8VA 2VXJA 3ZFFA 5F37A 2BRTA 1D7PM 2D6OX 2OZJA 1DDLA 4JGYA 5JZGC 4GWIA 4RYDA 3BKZA 2BNOA 5DN2A 3KS7A 2ZHNA 5FYVA 4M00A 1SHWB 2K0GA 5FYTA 2V72A 4YM3A 5FMOS 4FTEA 5KHIA 2W52A 3M3EA 3IIIA 1PGW2 4BHPA 1PK6C 1TME3 3U1XA 1VIWB 2GSYA 3ZMNA 1AYM2 4LUMA 3QACA 3SHRA 1I3HA 1PZ8A 5E8AA 2XLAA 1FOD2 1OPOA 2XQXA 1LJ7A 2DF7A 4IV1C 1GZ9A 1ND3B 3RYKA 2KXLA 5FO7B 3SITA 3M4FA 3WQ0A 4EN7B 3E5XA 1B35C 3OSDA 4IDZA 4KNCA 2A6VA 3J8F3 3LB9A 3HT2A 3JQWA 2GALA 5T5JA 2Z79A 2PAEA 3Q8BA 3BI3A 3ZPOA 3NRUA 3ZOIA 2IFRA 3DF0A 3L2YA 4A3XA 4AL9A 3ON7A 1COV1 1MEC3 3HPNA 4J1XA 3QD6A 5AVAA 3WF0A 2YMZA 3V0BB 4E2SA 4NRPA 2D43A 3ZN5A 5D21A 3MUY1 3EHKA 4XJZA 1OVPA 2VG9A 3DV8A 4G9SB 4AFCA 1D4M1 1GANA 1H30A 1O6UA 4QB2A 3H8RA 1S0EA 1ZZBA 3BU7A 4UBHA 2PHTA 3I2IA 4YGEA 4NPRA 3VDBA 2HWF3 3NVCA 2QQVA 2D98A 1EV11 2XOMA 3CQOA 3WOGA 1DU3D 1AX1A 5LRRA 4XAEA 5J98B 5GJ6A 1POV0 4CE8A 1W6PA 2XJQA 1K45A 3GNEA 5FYCA 1RUOA 5C71A 3IBMA 3I8TA 3PVOA 2AR6A 3LF7A 3NNMA 4QQOA 3UETA 2RS51 2EAKA 3ASIA 3FX3A 3Q8AA 4JCKA 1DQ0A 4QHOA 1VMJA 4A41A 4CUAA 1L7LA 4NMIA 4CTEA 1GYKA 3THCA 1FMD2 1GICA 2ARCA 2DCJA 2UWAA 4XJUA 3ZXAC 2DU1A 3MI8A 4HVRA 1RUC2 3OG2A 3BOPA 3HBZA 4FOWA 2JXAA 1W03A 4ET7A 5C4WB 3BODA 2PHWA 1Y9QA 4XHBA 3H8OA 4Z07A 2W92A 5ERLA 1AHSA 1QOSA 2DWRA 3ACHA 3C7EA 3EQEA 3KHBA 3M3CA 5ANNA 4YW3A 5CA6A 5FKCA 4P9WA 3IDEA 2B5HA 5HBAA 1YUDA 2ZHKA 2CNAA 4FFGA 2Y64A 1BCXA 3VBUB 2DUOA 1AYN2 1YNAA 5FCCA 4LITA 2XLGA 1DG6A 3OPZA 3JD71 1C8M3 3VBRB 3OGJA 4KQ7A 2J1SA 4XACA 3NV1A 1TME2 1JS9A 3MV01 3ST7A 1N3PA 2VJXA 2DCTA 2VZTA 3RWKX 2W46A 4QXKA 3CZJA 3KF5A 4XTPA 5C5TA 5F5IA 2AGSA 1I5ZA 1UY1A 4PQQA 4B1LA 5FR3A 3O14A 4LUKA 2QZ2A 1ZNPA 3N36A 4FSJA 1WMEA 1NA1B 3AZYA 1I6XA 1MS5A 1T6GC 1QOOA 2VNRA 3GF6A 1VRH1 1DGLA 1DQ2A 1EUUA 5DZGA 3BALA 1UU5A 2J1VA 3NNLA 4LTAA 3WUCA 2JG8A 1DP0A 1UNBA 4AGRA 4OQ8A 4N53B 2BFUL 2JJ6A 4CXWA 3KV9A 5EZWA 1QXPA 1ZZCA 4AVVA 1URXA 2BQPA 4H55A 4A2UA 1RJ7A 3H42B 3VL8A 2E51A 2R071 1ND2A 4ES8A 1W8HA 4QPYA 2VTFA 5DG2A 1MEC2 3FLTA 4BH9A 1UMIA 2JDKA 3CJIC 3UGFA 1OBNA 3AMNA 4NIHA 3NMBA 2Y8KA 3KWVA 3AL6A 2JDZA 3DPRB 3F95A 3SCGA 2N7GA 1OURA 1YQ5A 2Y33A 5ABJB 1XOYA 4R4XA 1VRH3 3W9AA 3GZEA 1UY3A 2HWF2 4LE3A 1ZBE2 3K3OA 1S0FA 1Y9MA 5T5PA 1NKGA 5C8CA 1BMV2 1OSGA 2I74A 1PIV3 1S2KA 3NSTA 2YBPA 3AZXA 3H7YA 5FY9A 1W6OA 2VMHA 1K42A 1R1ZA 2J22A 5IK8A 4XZPA 3KD4A 2ZCWA 1H8TC 3BN6A 3WHUA 3CMGA 3U11A 1CAVB 1HB2A 4KU8A 1QJY3 2V73A 1R083 4FI9A 3HR9A 3SH4A 4QKBA 1X36A 1IHMA 2RDRA 2Q8OA 5GLVA 2D5FA 2VMEA 3NAPB 5D8AC 2W91A 5LRSA 5TSWA 1KRIA 5EJZB 1S2EA 4KWKA 4HVOA 3MIHA 1XNCA 4SLIA 4Q4X3 1GWLA 3U75A 2YYOA 3R4UA 3K46A 1VAKA 4YNIA 4EN8B 3GZTB 4NHKA 3PVBB 3AYCA 1JYWA 4LMFA 3AP9A 4BM8A 2BU9A 2Y6GA 4YGDA 5LA9A 1C8M2 1CVNA 1RUD3 1XC6A 5DAWA 4DFSA 4OQ9A 4NHLA 1Z0HA 4AI2A 2Y6FA 1R1A1 2O8QA 4BLJA 1F31A 4XYXA 4XQ4A 1RUH1 5FZHA 1AJKA 1GZWA 1HRI3 4YVWC 3ZYFA 1SFNA 3GM8A 3QBQA 1UYZA 1YQ6A 4QX7A 2XJUA 4DUVA 2L9LA 4LT5A 2JE8A 2C9KA 1RUG1 5K0UA 1EYBA 2BJSA 1QKQA 2RJKA 4HN1A 1UY2A 1V6NA 2G19A 4P00B 2A71A 5E6HA 2BZDA 1OOPA 1AR93 4BQXA 1NCRA 2ET7A 3POGA 5BUVA 2VMIA 1H4HA 5J3UA 1VALA 4WV8A 5FXVA 4Z92B 4PDWB 4QDQA 1DGWX 4WZCA 1RTVA 2VMGA 2D93A 5IVVA 2V4VA 1LOGA 1WLCA 1YWKA 2ZGUA 5T3NA 3H1MA 4W65A 3WQ7A 2XDVA 1WCDJ 5C9AB 1BK0A 2WDBA 4QGLA 1POV1 4LO7A 3VBSA 1RUG3 2Y6HA 5FP7A 1WLTA 5GZCA 2YGMA 1M06G 3R05A 4Q26A 3K75B 3ROUA 2IXCA 4HXCA 1FXZA 5IHRA 3WF1A 2WWUA 2H0VA 1OLMA 5A1AA 2PLV1 2TNFA 4QDSA 1ZBA1 2DVFA 4C1XA 2ETEA 2CYFA 4WM7A 3HJRA 4FP2A 1PIV2 2HYXA 1CAWB 3OB8A 4FFIA 4CEWB 1JW6A 3RMXA 3X29B 2DDUA 4BQYA 3JB8A 4C8DA 1CAUB 1I9RA 3FN9A 4UFMA 5FUIA 4DQAA 1I5PA 4K6BA 1LCLA 2R041 4CEYB 3VBFC 4CDQC 4BWOA 3ZFEB 1QJY2 4JKKA 1R082 5CFCA 2UURA 5FP4A 1QHDA 1AR81 2ARBA 1ULCA 2W1UA 2X29A 2PLV3 3OBRA 5DABA 3RQ0A 1RUF2 4Y5TA 4UW6A 3ZFGA 3AXDA 4ZU4A 3WCRA 3GBGA 1LESA 1HJFA 2BEOA 3CDZB 4Q4X2 4PLMA 3JB4C 4AQSA 1PVC3 1ENXA 5K0UC 4YZ4A 3JQXA 4RD7A 4OI0A 1DFQA 2QZ3A 1J84A 1F9KA 1YC61 4OHZA 4L2NA 4GJZA 4GKYA 1KDKA 3J4UH 5AC93 1RUD2 2RDSA 2TBVA 2FZ1A 1VMFA 1RL3A 3RG0A 2WKKA 3SH3A 3LD8A 2VPVA 1NXMA 5FJKA 5I0RA 2BDRA 2XJPA 5FO9B 1BJQA 4GH4C 1WW4A 1V0AA 4RQPB 3VBSC 5DAXA 1HV0A 1NZCA 2QQLA 4AEKA 3HQUA 3D3AA 3N9LA 4LULA 5DZFA 2GNBA 3WW3A 4A45A 1IPKA 4JKLA 5F3CA 1AR92 1LOBA 2R32A 2B9UA 2E26A 3KGZA 4TLFA 4XURA 1UY0A 5CBLA 5FP8A 2VUAA 4IW3A 1LKNA 4IL7A 3SNMA 1K12A 1NE6A 3ATGA 4N9IA 1RUJ1 4Y5Z0 2LUWA 4LKFA 2XL9A 2ZGSA 3K4DA 5JWPA 2XVKA 3LEGA 3WQ1A 2XBO3 4I3PA 3BGAA 3B9IA 3R4DB 3E6DA 4XOGA 2Z42A 3U10A 1XBFA 3DGTA 4N43B 1JZ7A 2QQJA 5L73A 4R8HA 2XVGA 4S2DA 1F35A 1VRBA 5M0TA 3ZN4A 3O1OA 2OQ6A 2HWE3 1OH3A 3FWEA 4KGQA 5DQ0A 5C5UA 3MZHA 3SCHA 2VTXA 4GB31 3H1YA 1TMF3 4TZDA 1K5MB 1U12A 4CXXA 4QGNA 2MEV1 4Q0VA 3GHNA 3T0DA 1O3TA 3ZMOA 2Q5TA 3AJYA 3VKMA 1F4AA 4Y3OA 5ANQA 2EALA 3CKHA 1HXS2 3R6SA 5D1IA 4P5HA 3FLRA 4AOCA 4M3CE 2GP5A 3UGGA 1W8TA 2W1SA 4ASLA 5CFDB 2QQOA 3MF6A 4YG3A 3PL0A 4UFKA 1OFNA 3KQ4B 4CDXA 4NWVA 1XNDA 3AP7A 1ENRA 4IE6A 1YIPA 4JDNA 5I0SA 1KQRA 2JG8B 3T0BA 4N9HA 1CR7A 2GAUA 4OMDA 4XJ9A 3POSA 4A3ZA 2JENA 5J1XA 5CG8A 1HB4A 1W9SA 2WT1A 1RUE1 4DOUA 1FNZA 3T30A 2XJSA 1VE0A 2B4KA 3RVHA 2WNEA 4BE3A 1L7QA 3PTYA 1VBD3 1NZIA 4YVSC 1CZTA 2VMFA 2YBSA 4YSFA 3T4VA 1G8WA 4IEUA 1AL21 1PGL1 1PVC2 4DPNA 2JICA 2VUDA 2HWC3 4O9EA 3TB0A 1W8WA 2JG9B 1QQP3 3S7EA 5J37A 1CAXB 5BY5A 5FZ6A 5GM0A 3S30A 5F7UA 4O7XA 2JIJA 5C8CB 1QJFA 2A75A 4CSWA 5AC92 4NIDA 4AEDC 1REEA 1GU3A 4BU2A 5DUUA 1LOFC 3WF3A 3M3QA 1RUE3 1LEMA 2WJSA 5HXVA 1KS4A 2R1BA 1H9PA 4L8QA 4WM8C 2BGOA 4UW5A 5T54A 1RGSA 4B4RA 4Z2AA 1W3XA 3C8XA 2BWCA 3DYPA 3MLLA 3OPWA 1QJX3 5FY1A 3MEPA 1RHI2 1VBA3 3AKRA 5JI7A 2XLFA 1H4GA 5A3OA 4I01A 1OH4A 4NOTA 5FMBA 3AXEA 1QXRA 5FYMA 1OQ1A 1ND3A 2P2KA 3RZMA 1BLZA 1PO23 2B45X 4BA6A 1TE1B 4XFBA 2RG4A 1ASJ1 3N9PA 4WZFA 3FUQA 3LEMA 1UKRA 4QU2A 1W0PA 1OPMA 4QQ2A 1UIKA 1J3QA 1XPWA 3I3QA 4IE7A 4XBQA 3WZ1A 5C70A 4DRVA 2WO7A 4Q4V1 3I2FA 3FC0A 3O0VA 3ZYIB 2W1WA 1SG3A 1YXWA 2R063 3A0NA 3VBOC 2CTVA 1MVQA 4JRLA 5K9YA 3MV11 5FIXA 1SACA 4MGTA 1UZYA 4JQRA 3LE0A 2VO5A 1MS0A 2ZMLA 2HWE2 4Q1PA 4IGQA 2WS91 2WWSA 4IEXA 5LBBA 1MZEA 5FK8A 1IQAA 2VCCA 3ZYJB 1EPWA 3HNBM 3HMYA 3OCPA 2UY8A 1N1VA 4IE4A 4RA0A 1KS5A 3ZO0B 5KXCA 3V0BA 4CCCA 2EICA 2HBTA 1ASJ3 5FJHA 4EJRA 1MACA 2RDQA 3M2MA 4W6YA 1X8EA 1JMUB 2R16A 2WL1A 2JDUA 4MZUA 2CAUA 5DDJ3 2DTWA 2J42A 1PNFA 2YU2A 1IGOA 2WWJA 3K3NA 3KT4A 5FREA 4I2OA 5DXDA 4MHRA 5KWRA 3MIBA 3VD4A 5A3LA 2GH2A 2LW8A 2YY1A 1HQNA 5C3QA 1AXZA 4ATFA 1YJKA 2JDHA 2RHPA 4YZ5A 3ACLA 4Q4Y1 5CKMA 3NJVA 5IK5A 4XFGA 3WP6A 1U5IA 4Z2WA 1XNTA 4QX0A 4XDQA 4CCEA 1PO11 1VBD2 2G9GA 4K8FA 5ACA1 3AFGA 2ZX4A 4ISQA 1LRHA 4LPLA 4XQWA 5A7OA 2HWC2 5C4WA 3ZSJA 2H0BA 1O5UA 4QPWA 1QQP2 3KCCA 1RVF1 4HKWA 5IUQA 3N9QA 5IK4A 3JCIA 3LEIA 5LA1A 3K48A 5F5CA 2BNNA 5IJRA 1HN1A 3T09A 3IZOA 4NIAA 2WLPA 1AR71 4M3CB 1UCXA 1CIWA 3CNAA 4Q4Y3 3ILFA 4E4HA 1YHFA 1YQCA 1UN1A 4XEZA 4PCRA 5KC6A 3VBRA 1JZ4A 1GQHA 3LSEA 4RGGA 3OUIA 2FZ2A 1GSLA 2HJIA 4EWAA 4MYEA 5LK7B 2X09A 5HCFA 1GFF2 1QJX2 3OGGA 5IATA 4FOQA 3S5AA 4QKFA 4BQWA 1DF0A 1VBA2 1HW5A 4HZFA 1NOVA 4BPZA 3USUB 1GZTA 4E8DA 1AX2A 1PO22 1UW8A 1N1SA 3I7DA 2JDNA 2ZGLA 2BERA 2Q30A 4MX3A 3SLIA 4QPIA 3WNPA 1AYM1 2P34A 1IS3A 2X5IC 4ORFA 1GBGA 3VGIA 1QWRA 4N53A 1FOD1 4CDWC 2C9AA 1DZTA 4B8EA 3FHIB 1UXZA 5FV3A 3Q8FA 4HBNA 5LCWL 5FZ7A 4LLOA 3CBNA 1H1MA 1ENQA 4M01A 2RS13 3I2DA 1N3QA 4RSUA 1CJDA 4JDMA 2BUKA 5HCHA 3BVCA 3NNGA 3DPRA 2ZEWA 3BB6A 4WVVA 2VL4A 4MGQA 4XFIA 3ZXLA 4CPBA 1UXXX 5LEKA 5ABJA 3O1SA 4IUGA 3MDPA 4KH9A 3VD5A 5DDJ2 3K51A 4COZA 3OUJA 5A33B 1V70A 4KG8A 1W2AX 4UWDA 5IVEA 4MUVA 3PUQA 1DZRA 4GMP3 4HSLA 4CUCA 2VZUA 1CIYA 3A23A 3LSDA 3LPGA 1NLSA 2W0XA 3OJBA 3POIA 1RMU2 1UOFA 2VOTA 3WR0A 1Z78A 5FP9A 1G9CA 1ZREA 1LR5A 4FPEA 3VBUC 3WCSA 3ZDSA 5A7WA 1CAVA 4CZSA 3RZJA 4LBJA 4GKXA 4YLZA 1E57A 3V64A 4CU6A 2CL2A 2DBIA 2RR13 4MO3M 4R4ZA 2X05A 1BKZA 5F3GA 5CIRA 3ENRA 5A1FA 3NAPA 1FAYA 5GKAC 2EXKA 3S6PA 5F6KA 3AYDA 1W8FA 2ZHLA 1MS9A 4COUA 3MGUA 3ZXDA 1OT5A 4F7ZA 4JDOA 4Q5OA 2WO2A 3THDA 4KBZA 4CU7A 2ZKLA 4RL7A 1NA1C 1FMD1 4B3NA 5CKNA 4E4SA 3AP4A 4CDUC 1NLQA 1Q5OA 1RUC1 2I2SA 3OD0A 3OBAA 2LROA 2YGLA 4XF1A 2SBAA 2VNGA 4BJ0A 3VBHA 2IXIA 4N53C 1VBE2 3U78A 3UL2A 5LK5A 4EQVA 2WZR3 3B9CA 5FYIA 4D7SA 2BBVA 1OLRA 2EIDA 4EWEA 5IAXA 3H8XA 2JB4A 5FKBA 5GLTA 3H9AA 3FMGA 1LAJA 1SEFA 2E7AA 2ADEA 2YFZA 3ALQA 3ZKUA 2DVDA 4CRQA 4AVCA 4N90A 1SCSA 1NXD1 4YFZA 3DPRC 4LORA 3AX4A 2FMDA 3VZLA 2A6YA 3LWCA 4K7JA 1JHJA 1TME1 3ZR5A 2QQPA 4JC1A 5IVYA 3WNXA 4A7ZA 1RUC3 2VGDA 3LA7A 5FWEA 1OD3A 2ATFA 5ABJC 5FO8B 4AEJA 1PZ7A 4YW1A 1UL9A 2OPKA 1GOFA 3AM2A 1KITA 3N7LA 4XBNA 3PJYA 1AR63 5HI0A 4P9XA 4A7YA 1JZ2A 1IS4A 4AXOA 4KWJA 4PDWA 3TOJA 3J7LA 2RS12 1KD7A 4RS5B 4AHYA 3J8F1 1AYN3 2WSVA 5C9AA 3ELNA 3KSCA 1UZVA 4CCNA 3Q8EA 1W6QB 2YC2A 2ORZA 2ZKNA 4P9LA 3TBDA 2ID4A 3Q9OA 3HQXA 2ZHMA 3U4SA 1HJGA 5LY1A 5A7PA 2W08A 4MGKE 3ZXEA 2D3RA 4DRRA 4JQTA 1LHUA 5GALA 2QDRA 1MEC1 3WW4A 5I93A 4H7LA 1W05A 3AKSA 4QQHA 1D0GA 4IV3B 4XDOA 4FQ4A 4CEWA 3K2OA 4NAOA 1CAWA 4AI9A 4ASKA 3VDCA 1O7FA 2AC1A 1CAUA 3MFAA 3IT8A 4QPGC 4J25A 2HWF1 1LHVA 5A3MA 1ZBE1 5HCAA 4CEYA 1HKDA 4ZS3A 1CJPA 1PX4A 1QOTA 3F2ZA 3PVEA 3THPA 3ZFEA 4DXZA 1BMV1 2RR12 5EJ3A 3U07A 1ZZ9A 1VP6A 4J6GA 4PI0A 1VBB3 3URFA 5L9VA 3I2HA 4AGVA 2BPA2 2Y26A 3A0KA 5FOBB 2QDNA 2ZAAA 5H9PA 3VDDC 2OX0A 4DUXA 2XKOA 3SMHA 2ZGOA 5KHJA 1QU0A 1G7YA 1SLAA 3PIGA 3O0XA 2LALA 3GHMA 4QAWA 3D4KA 5F3EA 4ES9A 4FOVA 4LIVA 4YZ2A 2DUPA 1ZBE3 2XWBB 5JMCA 3NL1A 1SBDA 5ISLA 1CZVA 4MADA 3BOWA 1XE0A 5L9BA 2WZR2 3ZFFC 3DL3A 1WW7A 3PLQA 4JGYC 1UYXA 1GOHA 3KLSA 4PDWC 3MW4A 4Y1VA 3LCPA 2LRPA 4A7KA 2YFUA 2E9QA 2W68A 3IKWA 4RGKA 3FHQA 4TWTA 4FCAA 2UYAA 5E88A 1GNZA 1C8M1 3WNLA 4RQPA 2ZA9A 1W06A 5FMOL 2C5DA 4QX2A 4M4PA 3CU7A 1J3PA 4QKNA 5HCBA 3FBYA 3Q8CA 5B4XA 4ZS2A 1A8MA 1CONA 1QDOA 1YEWA 2ZGTA 5FPAA 2VBPA 2B9VA 4L97A 3VUOA 2ORXA 5GZEA 5E16A 2YU1A 4BIFA 1GWKA 5A3UA 2QUOA 4CEWC 1AR62 5JLVA 4URAA 3GBWA 4DXRA 2Q8CA 2CSGA 2W1QA 4RHV3 1LOEA 4AEMA 1NY72 4N43A 3PTRB 5JVVA 1NUKA 4OI4A 4BLIA 4BQ4A 4AF9A 1MS1A 2NP0A 1XNKA 5FZCA 2DFCA 3KF3A 5JXJA 4RN5A 2HH9A 3I2OA 1K5MA 1Y7BA 2PHXA 2RS33 1ULFA 1K3IA 2XVLA 4YFWA 3W20A 2P3YA 2GN3A 3P6BA 3BPZA 5JDBA 1UKGA 3AYEA 2ERFA 3ZN6B 4GQ7A 4PLNA 4TYSA 1C28A 1OQDA 4BIOA 3OBZA 1DQ1A 2FDJA 4Q0PA 4A6OA 5FPBA 2VAUA 1XNBA 4GALA 4QPIB 5CFDA 1WW6A 3A21A 3S0MA 3HVDA 3RZGA 3ZYBA 1PMHX 5DAPA 3DYOA 3PDQA 3PHMA 2W9XA 2IUWA 1PIV1 3PVNA 2RM23 2ZEZA 4LOSA 2GNMA 3S5QA 5CG9A 2QBXA 5A6ZA 1ZRCA 3C7GA 1DQ5A 1IOAA 1QIQA 1VBB2 4M3CF 4XCAA 5CEHA 3CO2A 5FOJB 5FZLA 5JSPA 1WD3A 4LXLA 4Q2FA 1QJY1 4XFFA 5G04L 1R081 4RQPC 3EBRA 2IVIB 2F4PA 5A7NA 1W8OA 2ZPXA 1PZ9A 2JG9A 2YG0A 2UU8A 4R9CA 1CAXA 3LAGA 5DAQA 1SZBA 2QJVA 1CPNA 2OUHA 1RUF1 1GQGA 1GMMA 3O0WA 5A70A 1REDA 3LEKA 4KBBA 5BPXA 4XIOA 2FCUA 3ACFA 4Q4X1 5GZDA 1FPN3 2HYKA 3AFKA 3FJSA 2LTNA 1W3VA 5LASA 5JOYA 4LKSA 1LGCA 2WQ4A 4NJ4A 2CGOA 2DCYA 1OLQA 4QU1A 4HVQA 2YPJA 2J1UA 4QHBA 1GUIA 2IXHA 4LHKA 2YDEA 4MGYE 5D2AA 3E6CC 1W2OA 2Z2SB 5A7WB 4FPHA 3RI9A 1RUD1 5T52A 4LBQB 4I0WB 4AHXA 4UF0A 4GIQA 2IC1A 1SLBA 4CUBA 1ZZ6A 2WT0A 4EROA 1NCQB 1MR5A 1C5HA 3H3LA 2V09A 3LKJA 1RUF3 3K4AA 4CA9A 4CUGA 1W8ZA 1HRI1 5T55A 4LK7A 1EY2A 1S2BA 5IFPA 2R7EB 5FZGA 2XMLA 1X9TA 4NE9A 2HWD3 2YPDA 1GKBA 3KCYA 4RGAA 3NJYA 4DZGA 1H2MA 4XFHA 3B01A 3TWIA 1DHKB 4RFRB 3O1TA 4RHV2 1N47A 4QKDA 3VKLA 3RMYA 2G1MA 1O3SA 1AR91 1MVEA 2XKPA 3WF4A 3M8LA 2H6BA 3VBHB 1D4M2 2JG8C 3OF1A 2P37A 1ALYA 3KMHA 3SISA 2P3IA 3HOBA 2IWGB 2NPIA 2RS32 3I3DA 4W6WA 3NO8A 4IV1B 1KXGA 3IPVB 1ND2C 5IT6A 2YROA 3I97A 4PF1A 4YW6A 1H6YA 1IZ3A 2LM3A 2VZ1A 4LBQD 5I8SA 5LW9A 4PIZA 1R092 3WEZA 3AYAA 5LB6A 4JKMA 3PMSA 1HB1A 2EXIA 4Y1YA 4YM1A 3T1MA 1HQWA 4S2HA 1ZVFA 2EVXA 1QF3A 5EYYA 5FPLA 4XUTA 1QXJA 5C8CC 1HXS1 4NWWA 3NWKA 4NUBA 3AJZA 3GXUA 3NV2A 5LA2A 2RM22 4UBGA 5FQ0B 4CU8A 4OHVA 2CWMA 2HBUA 2B39A 3KT7A 3I2JA 1CESA 4PI2A 3IB3A 1ULOA 1WCQA 3S57A 3DECA 2HKXA 2TEPA 3K77A 4LQRA 3E1F1 5IW0A 2O14A 3RPQA 3VD3A 1IS5A 5C3RA 4KWUA 1IQDC 4LBKA 1DGRA 3AKQA 1XQNA 3IAQA 2YZ4A 2WN2A 2Q0AA 5J48A 4YRDA 2X8KA 3ITQA 3NJZA 1QJZA 5LZ6A 2GN7A 2VOVA 4QQLA 1WBFA 3AMMA 5FYHA 1HXS3 1ZM1A 1Y3TA 3PURA 4M4RA 1FPN2 1ZYBA 4M3CA 4Y4RA 3U0ZA 1E5HA 3JUUA 4DS0A 1PVC1 3M3IA 5FYSA 1ZRIA 3NV3A 3J26N 2Y6JA 3VKOA 1T6BX 3GZAA 2DYCA 5C6CA 3U4XA 1LECA 3I4IA 2D97A 2VOWA 4HK9A 4OMCA 4AAPA 2E63A 4AFAA 5AC91 3BTXA 3WNKA 3KHCA 1OD5A 2ZOEB 5JPMB 3LOBA 2C24A 5FUNA 3USUA 1DYKA 4Y22B 4I09A 3VD7A 1DQ4A 3R0RA 4NHMA 4OYUA 1LU1A 1J3RA 3MW2A 1OMIA 1UX6A 4FFHA 4FPCA 4YGBA 1H0BA 1O8PA 4E2GA 1G9BA 1BQPA 4NHXA 1LENA 4CCDA 2XHKA 2Y38A 1CX1A 5FY4A 4CYDA 1OUSA 2F4LA 2HWD2 1GZCA 1RHI1 4AZZA 4OZXA 4LBLA 4DY5A 2AEZA 4FPYA 4AVBA 1BEV2 5DZEA 5JIAA 1KFUL 1OOPC 2ILMA 1C1LA 1NCRC 4LHSA 4AHWA 2Y34A 2IXLA 3V0AB 2XGXA 3HD8B 3AC0A 1W9YA 1J83A 4GAZA 5IVJA 1GP6A 2X10A 1FNYA 2XBO1 2C26A 4BDVB 4QD2A 1WZXA 4XXAA 5BNNA 3ZXGA 1W9WA 2K9ZA 4P02B 3POBA 4XVHA 4TLGA 1WUVA 4LK6A 1YQ2A 2FQPA 1RHI3 5DMYA 1SBEA 2HWE1 5APAA 3VZMA 2VR4A 2UWBA 1W8UA 1F2NA 1TMF1 4Q29A 1C57A 5A33A 1UYPA 1XYPA 5T50A 4AFMA 2YXSA 5C3SA 2AYHA 3ZYHA 2YBKA 3UJOA 3WVJA 1PM4A 1WWYA 4HOOA 1DGRN 5JI9A 5JAXA 3SEEA 3J7HA 3QCWA 1O59A 4WM7C 1QDCA 3ABZA 3CJIB 4HFSA 2GNDA 3GCXA 4Q8LA 2EAAA 2EF6A 1X8MA 2BWAA 2V5YA 1NQDA 2WNVB 2R30A 4OHXA 4OZOA 3T4HB 1XE8A 4UOJA 1LODA 5F6LB 1G86A 5KXBA 4FTSA 2D3PA 2F17A 4FXGB 3PUSA 5EFUA 1V6JA 3KVAA 2AENA 1OI6A 2GMEA 3GZUC 3WDWA 4CCOA 4E27A 2OPWA 5A3PA 1QH7A 5CFCC 3BUCA 4COWA 4UYBA 5DUWA 5JIUA 1LGBA 1STMA 2WZEA 1GR3A 4KU7A 3ZFGC 3WDYA 1US3A 1ZX5A 3KT1A 4ASMB 4XF3A 1TNRA 1ULPA 4EZHA 3QH7A 1VBD1 2Q1MA 4GMP0 2ZACA 2ZBJA 3JU9A 3OGSA 4IXLA 4E4DX 4FBFA 3WV6A 1H8TB 2HWC1 3W58A 3RI8A 2A5ZA 4D3WA 1QQP1 4IEWA 5SV5A 3WDXA 2MHFA 4PBOA 1OQEA 1SFPA 4AI0A 4I30A 4UAPA 2OW4A 4NPLA 4XHXA 1NYWA 5CISA 1S0GA 1LHWA 2VZ3A 1Q8PA 5F2WA 4JGZA 3WT3A 4YARA 5D8AB 1Z7S2 1C3HA 1C5IA 2Q1ZB 4HANA 4LJHA 4LA2A 4D7TA 1YCIA 5H9SA 2XJTA 4QB1A 3AKTA 4HL0A 3B93A 2Y0IA 3RZLA 2XXZA 1QJX1 5C8WA 2RJ2A 4DEVA 4BZ4A 1VBC2 1MS3A 1APNA 3N7MA 4Q4W3 3KV4A 5JXIA 1VBA1 1OVSA 1YFXA 1W0NA 4UW3A 3TNPB 1YLLA 4D94A 2B42B 5EP9A 4D7YA 2E53A 2BP6A 4O65A 1AJOA 1K5JA 5K4LA 1PO21 3I3BA 3KVBA 5FAXA 3MF9A 1RITA 4C0BA 4K21A 4XUNA 5FTTC 5BNPA 4RS5A 3RRDA 2FDHA 4OULA 5FZ3A 1PMJX 4PT6A 1KGYA 3UESA 3LDRA 3DEMA 3RFRA 1W6QA 4LLFA 1ULGA 2R061 2VXRA 5EHDA 2E31A 2VUJA 3SKVA 4ZXEA 3B3QE 2BOJA 2AUYA 3NQHA 4Z1VA 2XJRA 2FHRA 3EMRA 4UF0B 4UI9L 1Y43B 2C1FA 5CB7A 1U5YA 3IM0A 1MPXA 1DLLA 1LHOA 4IV3A 1FATA 1DIWA 5H9QA 4BQ5A 2WSUA 2AZ5A 5IAVA 4QWNA 3M1HA 2B7YA 4MVTA 2QQKA 4CP0A 5B4NA 3ES1A 1H1IA 2PQSA 5DDJ1 4ZONA 1QJU3 3QLQA 3WSOA 5F32A 1UX7A 2PHLA 3ME2A 4NIGA 4AQ6A 2P17A 2ZXQA 5FZ9A 3MIEA 4XXPA 3HT1A 3N9NA 4YG0A 4DEQA 1DLCA 1XSRA 5JMOA 2CWSA 4OFGA 4CDXC 3SXWA 1F5FA 2A3XA 4QDRA 2PQQA 5I0UA 2KD7A 4HT1T 3POYA 4BISA 4DNYA 1V6IA 2O8OA 2FDIA 2AACA 4L92A 2VNVA 2WT2A 4NN0A 1JZ5A 3FUOA 1SCRA 1ZRDA 1H2NA 5FRAA 1SBFA 2NN8A 2GC3A 4TSVA 3AP6A 2CY6A 3J7NA 1A34A 4EYUA 1XRUA 4HPKB 3ZXKA 2DVGA 4FXKB 1ULDA 5I0TA 2BVBA 5IWFA 1V9U3 5FZOB 5JSOA 4ZU7A 2YC4A 3PJQA 2OUJA 5FLJA 4K20A 5FZIA 1VB2A 4Q1RA 1SLTA 4XJWA 4XJ8A 3VKNA 5JXHA 4W50A 4NO4A 3TEWA 1RMU3 1W2TA 4JTNA 1W90A 5L36A 4QXHA 2WAOA 4OI2A 5LEJA 5FDBA 2PAMA 2E7TA 2QVSB 5A1LA 5IVBA 3IDBB 4Q4W2 4ITCA 1RIRA 2OVUA 4LBOA 4X6RB 3WDVA 4ARYA 3FE5A 1DZQA 1UPIA 3P3NA 4TXWA 5DG1A 2K46A 1DCSA 1CZSA 4LR4A 1ND3C 3RSJA 2K2SA 2Z5WA 4EE2A 5JXGA 2W87A 3VD9A 4EZ4A 5CZKA 3C7OA 4EN6B 1HRV3 1S0DA 2MEV2 1W9FA 2IXJA 3CL1A 4D69A 2ET1A 4BYYA 3N9MA 3AMPA 3JBG3 3EB7A 3IDAA 1VBE3 4GH4B 3WX5A 4SBVA 1O4YA 1Y9GA 4NRQA 3OBTA 2EIBA 4FAHA 2HEVF 3FLPA 5C33A 3UYJA 4W8JA 1GQPA 2RS11 2RV9A 4FQZA 4CCKA 3P1IA 4GWNA 3ZN6A 2XQRA 4IEYA 2VQ0A 3M3OA 4WVZA 1HIXA 5CYYA 5F8PA 2WQZC 1MZ6A 1OHFA 2D6MA 2ZX3A 3MYXA 1GLHA 1PGW1 3UKTA 4IETA 4JTOA 3ZIXA 4ZZ8A 5FPXA 1RINA 5BV6A 1OA2A 1HQLA 1S0JA 3PMEA 4I0AA 4NAMA 4XW3A 1QJU2 3T0AA 1ACCA 3ZLIA 1NLRA 4A4AA 2DU0A 3LQCA 4IEOA 1S55A 1OXCA 1YRZA 1YQ8A 5JR7B 3HQRA 2DFBA 1WMXA 1BZWA 1TG7A 2JE9A 1ODMA 2KM2A 4GMP1 4RR3B 5FPZA 3TN92 4FPLA 4C91A 5KBFA 3H1WA 1PM7A 4E2QA 4J1WA 3AZZA 2A6ZA 1W39A 2QFEA 3MICA 4XPVA 3POJA 1UWWA 3T2OA 5BNNB 4EWDA 3RZHA 4A6SA 4Y1XA 5JPNB 2XJVA 3KV6A 4A42A 2PHRA 5KR7A 2GU9A 1QGLA 3SQOA 2RR11 4BMEA 4EN9B 4YW4A 2VULA 2AEYA 3UJQA 1H1AA 1O3RA 1WA6X 5EQUA 2HWB2 4BQ1A 4CXYA 2MPFA 1V9U2 5C4WC 3M7AA 1WKYA 3V56A 4AR2A 5BNOB 1LOAA 5F3IA 2FDGA 4GXLA 4NROA 5DPNA 3TRSB 4AVTA 4COYA 2P3KA 1AXKA 3ZVXA 1SLIA 2A1XA 4I02A 2VD7A 1HX6A 4OUMA 2PAKA 1ULEA 3BTZA 4YVSB 3ZYPA 2WNUB 4PLOA 4LBQA 1RUI2 5CU1A 3VBRC 2WFPA 4F8AA 1WA4A 1YI7A 2WZR1 4LHNA 2PN5A 3I59B 1NCQA 3KCXA 2BVVA 4H3WA 5EPAA 3UGHA 1H2LA 3VDAA 2ZX2A 4BB3A 4Q4V2 2WFF3 5LBFA 1W6MB 2A6WA 1X7NA 5DUXA 1IG3A 4HLTA 1W2UA 2RE9A 2VMCA 2WR9A 4KL1A 4QXCA 1XU1A 5JZGA 2MNGA 2XR4A 4PBPA 2EA7A 3AMQA 4V2VA 4OI1A 2WS92 3WDTA 4QPIC 3BTYA 3G7DA 1HRV2 4OHWA 1UD1A 2E32A 4XDPA 5HV0A 1FT9A 3BTAA 5FZDA 3LGRA 1PK6A 3JBG2 1EAH3 1TEIA 4AI8A 1BBT3 2D7FA 1AR61 2XWJB 2D6NA 3CIHA 4LBMA 2I45A 5EV7A 3VHRA 5A3WA 3UKNA 2XHNA 4IV1A 3IPVA 1BHGA 1NY71 4JGZB 1OUXA 1Q8QA 1JI6A 1F4HA 2DBNA 4W6XA 3T2TA 1AYN1 4XF9A 3WNMA 2Y6LA 2CHHA 2ZMKA 4KGGA 3UK9A 1IKPA 2W2IA 2V4AA 3GJAA 5EXOA 3OPTA 4AGGA 1AX0A 3ZYGA 3JZVA 1SPPA 5FUPA 3APBA 4FTBA 1CX4A 2NLRA 4GZ9A 3VBOB 4HONA 1GP5A 2DV9A 2FBEA 2W47A 4R52A 1UO9A 2J1AA 1ODNA 4BMBA 1X9PA 5FQ0A 2ADDA 5A6QA 5CADA 3IMNA 4I0BA 1UAIA 5BNPB 5G05L 4L9BA 3DXTA 3SC7X 4MXWB 3ACIA 4JHZA 4BXSV 2RMU3 4GWJA 4HKOA 2D6LX 3OGRA 4LO5B 1DBNA 1AR72 1CQ9A 3MIDA 1WD4A 2BOIA 4YW7A 4CCMA 1NCQC 1VBB1 2I07B 2ARAA 3NAPC 3ZPYA 1MZFA 1LNSA 5BYNA 3A4UA 3WLUA 4B1MA 2BTVC 3MUZ1 3WP4A 3PNAA 3OGVA 1RXGA 4P9JA 1NX9A 4L11A 4BQ2A 2VZPA 1OC1A 1JU3A 4H14A 2WLQA 5LA0A 2VBDA 4MGSA 3CHXA 3WD5A 1R64A 2JKBA 3FFQA 3VBHC 2VU9A 4F83A 1ONAA 2Z4FA 3HN3A 4B4PA 2Y60A 2JDPA 1SDWA 3AL5A 2ZJCA 4QX1A 3W59A 4Y22A 2D44A 1LOCA 4URTA 1EUTA 4BCUA 5CAZA 1V6KA 1YFWA 1V6LA 4FT8A 2WFF2 4Q0QA 1LGNA 5I91A 4F3JA 2XL7A 2VQTA 2ZGPA 3ECQA 1V00A 4ISRA 1Q8VA 3RWNA 3SH5A 4ZZ5A 4FAGA 1UQXA 3W5NA 3RZKA 2WAAA 4PIXA 1E5RA 3D8CA 2TUNA 3RDIA 2D3SA 3KZ4C 3BCWA 2A7AA 1TQ5A 4CP1A 3LA2A 4MV2A 1EPZA 2CGNA 4CVUA 5F39A 2OKXA 3FL7A 3V0AA 4O61A 5FZBA 1EAH2 2JDAA 4Z82A 1BBT2 5DAVA 4YYOA 2C6SA 3E5QA 5GLWA 3S7IA 4RHV1 1DYOA 2A6XA 3GCWA 4U2AA 2PHDA 2CDPA 2W3JA 3LZZA 1KFXL 4K40A
chains in the Genus database with same CATH topology
1YYNA 5C9AC 1S1AA 4M0NA 3MPBA 1WGPA 2VNOA 2YC0A 2X5IB 2NM1A 2RS31 2W39A 2BFUS 1DGWA 3ETQA 4CDWB 2Z69A 4XIKA 4EV0A 4LE4A 2WA3A 1LULA 2VOKA 2NYYA 1R091 4IQPA 1COV3 3VKFC 1CN1A 3CJIA 3OY8B 1A78A 2WNVA 1NG0A 4YZ3A 2DVBA 3VHNA 4Q0UA 3AP5A 2RMU2 1D4M3 1G9DA 1VR3A 4CEYC 5J09A 2DVAA 4PJYA 2ES3A 2ZGMA 3BIWE 3ZFEC 1OA4A 1J59A 1Q8SA 3IWZA 2RM21 1W6NB 2XG3A 5A32A 1OKQA 5JSRA 1EV13 1WMFA 2BW8A 1G9AA 4JAAA 1NQJA 3O12A 1JHNA 1R093 1TNFA 1JBCA 2D6PA 2ZS6B 4HKLA 1AZDA 1H8TA 3ZSMA 4P9GA 2ZGRA 2RS53 1U5ZA 5KHGA 2B46X 1MQTB 3ILNA 4WVMA 2ZZQA 4PIYA 1FPN1 2ZTNA 4XJAA 4CP2A 4NR1A 1QNWA 5D8AA 1FV2A 4QMAA 2NQYA 2ZZJA 4Y1UA 2JX9A 4FO9A 5AFEA 3VZNA 4AI1A 1CPMA 3CJXA 4IEVA 4CDUB 1YJLA 3KB5A 4WBBA 4Y26A 3J8F2 3HWJA 1D2SA 2PELA 4FPJA 4Y24A 3JD73 3VV1A 4HN0A 4I3GA 1M4WA 2HWD1 3H3UA 2ZABA 3ZSEA 3CF6E 1ZRRA 2JE7A 4FPKA 4YVWA 3UV9A 1B09A 1BEV1 4G3YC 3VLBB 2WNVC 4N43C 2CGPA 3NKTA 2QCSB 4P9IA 4BOWA 2OIIA 2JD4A 3WINE 4Y20B 2R0HA 5T5OA 3LA3A 4X6QB 1K5MC 2KA3A 1L3JA 4YG6A 3L2HA 2UY9A 5JZGB 3RYPA 1BK1A 2R073 2XPJA 1YI9A 1COV2 2E7QA 4WVWA 4AVSA 1JYIA 5CFDC 1BEV3 2A3WA 1LHNA 4XFCA 2NMOA 5EWSA 1OA3A 5L7OB 3WG1A 1VLNA 1PK6B 1D0HA 4QX5A 1KJLA 4META 5FBZA 2PHUA 4O9GA 1EV12 1XYOA 1HV1A 2GNTA 3OYWB 4MSVA 3EO6A 3EXUA 3WW1A 2PFWA 3AK0A 1B35B 4HPKA 4B7KA 4QPGB 4RFT0 2JG9C 2RS52 2DUQA 3VBFA 3ZXJA 1RJ8A 4CDQA 2EIGA 1BXHA 2ZGNA 2YV8A 3WUDA 4C1WA 2VVEA 1WCKA 3DKWA 1QMJA 3MLKA 3QH6A 4HETA 2RJLA 5FFOC 4DMIA 1Q8OA 3MLJA 1FV3A 1QY4A 3VDDB 4N7IA 1AF9A 2WA4A 4S2FA 2CV6A 3MW3A 4V1PA 5B2GB 2FMYA 1J1LA 4YW5A 4LA3A 1DYPA 3B7MA 2A3YA 3TAYA 1Z7S1 1ENSA 2DTYA 4FPGA 2JECA 4DINB 3E6BA 3JD72 2GDFA 3C2UA 5EYXA 2VECA 3FBMA 3ZFFB 1R1A3 1VBC1 2EXHA 1IS6A 4JGYB 3VZKA 1RUH3 1U0AA 3KM5A 5JOXA 4S2GA 4GH4A 1AL0G 2VVFA 3T1LA 2ZGQA 3H7JA 4AW7A 1SQ4A 1ZZ7A 2OZ6A 4PQ9A 1VRH2 1Z7S3 2ZAHA 3MIGA 4X8PA 2BNMA 3WY6A 3IN9A 4B4QA 4FVVA 4EN0A 2VQAA 1HDKA 1VBC3 1VJ2A 2B8MA 4H7MA 2A70A 4K1ZA 2R072 1AUYA 2SLIA 3P3PA 4E4ZA 3TNQA 4AI3A 4Q27A 2VY0A 1SLCA 1A3KA 1JH5A 4GULA 3ZXFA 4OVEA 1POV3 4JVAA 5GLUA 3DUIA 4RR3A 1HLCA 3ZYRA 1D2QA 2WZPP 3WG3A 1QNYA 2AH2A 1IKQA 3AZWA 3G6JB 5BNQA 1ZBA3 1BVVA 1XYNA 2XUMA 1RC6A 4AG4A 1C8NA 5F5QA 3WHTA 2VW0A 4LNVA 1NE4A 4JRAA 5I8YA 1W0OA 1WCSA 2R1DA 1PHMA 1LEDA 4FP3A 2PHFA 2ZGKA 2R043 5BNOA 1XXNA 4FPFA 2E6VA 2GMPA 5H9RA 4UW4A 1W6PB 5F9TA 1AR83 4YGCA 1AXYA 2H6CA 2IXKA 3D6EA 1BVP1 1N1YA 2OA2A 1SMVA 1Q3EA 1U5XA 1HRI2 4YVSA 5KHKA 2WNUA 2WINB 2DCKA 5L19A 3I59A 1JUHA 3FZ3A 1W6MA 4R9DA 3HAGA 2Q4SA 3IDCB 1LU2A 4AK3A 2XB6C 5A32B 4DY3A 4AEDA 3H0OA 1N1TA 5GZGA 1S0CA 1LOFA 1KJRA 1YFUA 1GV9A 1YFYA 4R9BA 4ZU5A 3D0JA 1R1A2 4WM8A 1X50A 4Q4W1 1RUH2 3HIFA 1WLDA 1F5JA 3HN1A 1JXNA 3AMHA 2VOXA 1BYHA 5J96B 3UKVA 1RUG2 1YIFA 3CEWA 3N7KA 4WVMB 4RR3C 1H2KA 3RJ2X 4QM9A 1UPSA 4AFBA 1Q56A 1MS4A 4LO8A 1KDMA 5BNNC 4XMAA 4P9YA 1JUIA 1A8DA 4E9KA 2R6QA 1RUJ3 4Q0SA 1PNGA 4LHLA 1UIJA 1C4RA 3DN7A 4P14A 4U36A 1G9FA 3VBOA 1AVBA 3RYRA 1WLWA 3H50A 3VZOA 5AVPA 5BNOC 2VW1A 3B69A 1UMZA 4XQDA 4GB33 4AFDA 1XU2A 4UXAA 1G6NA 1J1TA 2MEV3 1QJU1 2DCZA 2PLV2 1ND2B 4MXWA 1CD3G 2HEYF 4YVWB 1ZBA2 3RJRA 1VB4A 1D4VB 2X53S 3B5LB 1ZRFA 1O3QA 2WNUC 4QM8A 3ILRA 2R0FA 4XETA 3TN91 2HEWF 2Y0OA 4MLOA 1MS8A 4MGZE 3SCFA 4MH0E 2OYZA 2R042 1O5LA 2GC0A 3WG2A 4JV4A 3MFCA 1FYUA 3R4SA 2EXJA 4QGMA 2O0OA 1W6OB 4XF0A 1AR82 4HMZA 3VZJA 5JOWA 4B29A 2HWB1 5IK7A 1V9U1 3RS6A 4XMIA 5E1RA 4C90A 5E89A 1O4ZA 4YM0A 1AL23 3TYJA 3LOIA 3TN93 1CGPA 3AKPA 1UU6A 3ZX7A 1RMU1 4JGZC 5T5LA 4AE2A 1JYCA 5I8TA 2BYVE 1RUI1 3D5OA 2PTMA 3ES4A 1WW5A 1X33A 3MPPG 1QH6A 3H3ZA 2D5HA 2XBO2 2HWB3 1J58A 3WP5A 4XF4A 3VBFB 4CDQB 1VAVA 4YZ1A 1O91A 3THTA 5KC5A 4ZKTB 3AB0A 1PVXA 1Q43A 1TMF2 1GNHA 1HRV1 3GBFA 3WG4A 2UWCA 5BNPC 5F1RA 2D6KA 4RS5C 4L99A 5GZFA 4HK8A 2WIIB 4IEZA 3VHPA 1GZWB 4MXVA 1DQ6A 3JBG1 4IEQA 1RUI3 5AFBA 1VBE1 2GC1A 1RB8G 1RUJ2 4FPOB 4LEJA 2X5IA 1WBLA 4HSJA 5K0UB 4Q4V3 2QNKA 2UYBA 2IZWA 4CDWA 4ONUA 5FLHA 1S0BA 5JOZA 1OOPB 3POWA 1NCRB 2VVDA 4IV3C 2XH6A 5CVRA 2GC2A 1VAMA 4YM2A 4R9AA 3VHOA 3OY8A 4N7UA 4Z8BA 4PF5A 2WS93 3CLPA 4GB32 1UZZA 2A73B 2WC2A 4OLLA 1C1FA 4YW2A 4K3UA 4X8NA 1ZA4A 4B7EA 4IESA 4IEPA 5KXEA 2GZWA 3ZIWA 3NKGA 2IFWA 3GYDA 1W6NA 3VBSB 2JEMA 1H9WA 3GALA 3AZVA 2O1QA 1H8VA 5KXDA 3ZSLA 4QT6A 1V6OA 5JCTA 1X82A 4WM7B 1RUNA 1XE7A 1SFYA 1RUE2 1FX5A 3VBUA 4NVPA 2R49A 2AREA 1MQTA 1PO13 3OTFA 4KG0A 4INDA 3N3HA 3N35A 4QQPA 5ACA3 4LBNA 3N7JA 1AL22 3E5UA 1PGL2 3WP3A 5CFCB 4AQTA 1MZ5A 3D0SA 4XFAA 1RVF3 2ARXA 2PA7A 1V6MA 4IERA 3ZFGB 1NA1A 3FFZA 4G4FA 1JOJA 4CDUA 1REFA 1AR73 4OHYA 4KWLA 4Y4YA 4XILA 3KQRA 1A6CA 2NZ9A 3WW2A 2WFF1 2F6BA 4DB5A 4XE9A 2R062 1S0IA 2C0ZA 2PYTA 3O5SA 3O7OA 1SLLA 4AYUA 3H8UA 2YHJA 4AVAA 1JTZX 1UF2C 1ASJ2 3USSA 3M70A 4XTMA 4Y1ZA 4LO6B 3IIAA 1EAH1 2G4IA 1AYM3 4Y20A 4AWDA 1BBT1 2NMNA 2YUEA 3NV4A 3OD4A 2CAVA 1FOD3 2ENRA 3KGLA 4MGIE 5SV8A 2DURA 1OFSA 1UU4A 3WXPA 2P3JA 3N4MA 1FI2A 3QOPA 4K1YA 4AEDB 3B02A 5KHHA 4C0HA 1LB2A 2ZMNA 4GWMA 4Q8KA 3C3VA 5J7MA 4WM8B 2BGCA 5GLZA 3INAA 3MIFA 1PMIA 5L7OA 1LTEA 5FLIA 1MQTC 3E97A 1WMDA 2ZX1A 2VH9A 3VN4A 2VW2A 5BXXA 2GH8A 4GA9A 2QKDA 2GMMA 4K9SA 5J36A 2ZX0A 5CNAA 4AQ2A 3OYWA 1YO8A 3J9SA 2RMU1 3VL9A 4LO4B 1O4TA 3V65A 1B35A 4QPGA 3L9JT 4Q4Y2 5DUVA 2QE3A 3I54A 4OUSA 3D82A 1PO12 3NW4A 3RNSA 4CDXB 1N3OA 1IPJA 2D40A 5ACA2 4M0HA 3VDDA 4XBLA 1EP0A 1PGSA 1RVF2 2G9FA 1I1EA 4FOYA 1FMD3 1ZZ8A 3B00A 3WDUA 4COVA 4AHZA 3B94A 3ZSKA 3RZZA 5K8SA 4ATEA 3EJKA 1JN2P 1F8VA 3ZFFA 2OZJA 1DDLA 2D6OX 4JGYA 5JZGC 2BNOA 3KS7A 2ZHNA 4M00A 2K0GA 4YM3A 5FMOS 4FTEA 5KHIA 2W52A 3M3EA 1PGW2 4BHPA 1PK6C 1TME3 1VIWB 2GSYA 3ZMNA 1AYM2 4LUMA 3QACA 3SHRA 1I3HA 1PZ8A 5E8AA 2XLAA 1FOD2 1OPOA 4IV1C 1LJ7A 2DF7A 3RYKA 1GZ9A 1ND3B 2KXLA 5FO7B 3SITA 3M4FA 3WQ0A 4EN7B 3E5XA 1B35C 4KNCA 2A6VA 3J8F3 3LB9A 3HT2A 3JQWA 2GALA 5T5JA 2Z79A 2PAEA 2IFRA 3DF0A 3L2YA 4A3XA 1COV1 1MEC3 4J1XA 3QD6A 5AVAA 2YMZA 3V0BB 4E2SA 2D43A 4XJZA 3EHKA 2VG9A 3DV8A 4G9SB 4AFCA 1D4M1 1GANA 1H30A 1S0EA 1ZZBA 3BU7A 4UBHA 2PHTA 4YGEA 4NPRA 2HWF3 3NVCA 2D98A 1EV11 3WOGA 1DU3D 1AX1A 5LRRA 5J98B 5GJ6A 1POV0 1W6PA 2XJQA 3GNEA 1RUOA 3IBMA 3I8TA 3PVOA 2AR6A 4QQOA 2RS51 2EAKA 3ASIA 3FX3A 4JCKA 1DQ0A 4CTEA 1GYKA 1FMD2 1GICA 2DCJA 2UWAA 4XJUA 3ZXAC 2DU1A 3MI8A 4HVRA 1RUC2 3BOPA 3HBZA 4FOWA 2JXAA 5C4WB 3BODA 2PHWA 1Y9QA 4XHBA 4Z07A 1AHSA 1QOSA 2DWRA 4YW3A 3EQEA 5CA6A 3M3CA 4P9WA 3IDEA 2B5HA 5HBAA 1YUDA 2ZHKA 2CNAA 1BCXA 3VBUB 2DUOA 1AYN2 1YNAA 5FCCA 2XLGA 1DG6A 3OPZA 3JD71 1C8M3 3VBRB 3OGJA 4KQ7A 3NV1A 1TME2 3ST7A 1N3PA 2DCTA 4QXKA 4XTPA 2AGSA 1I5ZA 3O14A 4LUKA 2QZ2A 1ZNPA 3N36A 4FSJA 1WMEA 1NA1B 3AZYA 1I6XA 1MS5A 1T6GC 1QOOA 2VNRA 3GF6A 1VRH1 1DGLA 1DQ2A 5DZGA 3BALA 1UU5A 4LTAA 3WUCA 2JG8A 4AGRA 4N53B 2BFUL 2JJ6A 5EZWA 1QXPA 1ZZCA 4AVVA 1URXA 2BQPA 4H55A 4A2UA 1RJ7A 3VL8A 2E51A 2R071 1ND2A 4ES8A 4QPYA 5DG2A 1MEC2 3FLTA 4BH9A 3CJIC 3AMNA 2JDZA 3DPRB 3SCGA 2N7GA 5ABJB 4R4XA 3W9AA 1VRH3 2HWF2 4LE3A 1ZBE2 1S0FA 5T5PA 5C8CA 1BMV2 1OSGA 2I74A 1PIV3 1S2KA 3NSTA 3AZXA 3H7YA 1W6OA 2VMHA 1R1ZA 5IK8A 4XZPA 3KD4A 2ZCWA 1H8TC 3WHUA 3U11A 1CAVB 4KU8A 1QJY3 2V73A 1R083 3HR9A 3SH4A 1X36A 1IHMA 2Q8OA 5GLVA 2D5FA 3NAPB 5D8AC 5LRSA 1KRIA 5TSWA 4KWKA 4HVOA 3MIHA 1XNCA 4SLIA 4Q4X3 2YYOA 3R4UA 1VAKA 4YNIA 4EN8B 3GZTB 4NHKA 3PVBB 3AYCA 3AP9A 4BM8A 4YGDA 1C8M2 1CVNA 1RUD3 4DFSA 4NHLA 1Z0HA 4AI2A 1R1A1 2O8QA 4BLJA 1F31A 4XYXA 4XQ4A 1RUH1 1AJKA 1GZWA 1HRI3 4YVWC 1SFNA 3QBQA 2XJUA 1RUG1 5K0UA 1EYBA 2RJKA 1QKQA 4HN1A 1V6NA 2A71A 1OOPA 1AR93 1NCRA 2ET7A 5BUVA 2VMIA 1H4HA 5J3UA 1VALA 4WV8A 4Z92B 4PDWB 1DGWX 4WZCA 1RTVA 2VMGA 2D93A 1LOGA 1WLCA 1YWKA 2ZGUA 5T3NA 3H1MA 4W65A 3WQ7A 1WCDJ 5C9AB 4QGLA 1POV1 4LO7A 3VBSA 1RUG3 5GZCA 1M06G 1WLTA 2YGMA 3R05A 4Q26A 3ROUA 2IXCA 1FXZA 2H0VA 2PLV1 2TNFA 1ZBA1 2DVFA 4C1XA 2ETEA 2CYFA 4WM7A 4FP2A 4CEWB 1PIV2 1CAWB 1JW6A 3RMXA 3X29B 3JB8A 1CAUB 1I9RA 4DQAA 4K6BA 1LCLA 2R041 4CEYB 3VBFC 4CDQC 4BWOA 3ZFEB 1QJY2 1R082 5CFCA 2UURA 1QHDA 1AR81 2ARBA 1ULCA 2X29A 3OBRA 2PLV3 3RQ0A 1RUF2 3ZFGA 4UW6A 3AXDA 4ZU4A 3WCRA 3GBGA 1LESA 2BEOA 4Q4X2 4PLMA 3JB4C 4AQSA 1PVC3 1ENXA 5K0UC 4YZ4A 3JQXA 4RD7A 4OI0A 1DFQA 2QZ3A 1F9KA 4OHZA 4L2NA 4GKYA 1KDKA 3J4UH 5AC93 1RUD2 2TBVA 2FZ1A 1RL3A 3RG0A 2WKKA 3SH3A 2VPVA 1NXMA 5I0RA 2XJPA 5FO9B 1BJQA 4GH4C 1WW4A 4RQPB 3VBSC 1HV0A 1NZCA 4AEKA 4LULA 5DZFA 2GNBA 3WW3A 1IPKA 1AR92 1LOBA 2R32A 2B9UA 3KGZA 4TLFA 5CBLA 2VUAA 1LKNA 4IL7A 3SNMA 1NE6A 3ATGA 4N9IA 1RUJ1 4Y5Z0 2LUWA 2XL9A 2ZGSA 5JWPA 2XVKA 3WQ1A 2XBO3 4I3PA 3B9IA 3R4DB 3E6DA 4XOGA 2Z42A 3U10A 3DGTA 4N43B 5L73A 4R8HA 2XVGA 4S2DA 3ZN4A 2HWE3 3FWEA 3MZHA 4KGQA 3SCHA 4GB31 3H1YA 1TMF3 4TZDA 1K5MB 1U12A 4QGNA 2MEV1 4Q0VA 3GHNA 1O3TA 3ZMOA 2Q5TA 3AJYA 3VKMA 2EALA 1HXS2 3R6SA 5D1IA 4P5HA 3FLRA 4M3CE 4ASLA 5CFDB 3MF6A 4YG3A 1OFNA 4CDXA 4NWVA 1XNDA 3AP7A 1ENRA 4LT5A 1YIPA 4JDNA 5I0SA 1KQRA 2JG8B 4N9HA 1CR7A 2GAUA 5CG8A 4XJ9A 3POSA 2JENA 2WT1A 1RUE1 4DOUA 1FNZA 2XJSA 2WNEA 4BE3A 3PTYA 1VBD3 4YVSC 4YSFA 1G8WA 4IEUA 1AL21 1PGL1 1PVC2 4DPNA 2JICA 4O9EA 2HWC3 3TB0A 2JG9B 1QQP3 3S7EA 5J37A 1CAXB 5BY5A 5GM0A 3S30A 5C8CB 2A75A 5AC92 4AEDC 1REEA 5DUUA 1LOFC 3M3QA 1RUE3 1LEMA 2WJSA 5HXVA 1KS4A 2R1BA 1H9PA 4L8QA 4WM8C 4UW5A 5T54A 1RGSA 4B4RA 2BWCA 3MLLA 1QJX3 3MEPA 1RHI2 1VBA3 3AKRA 5JI7A 2XLFA 1H4GA 4I01A 4NOTA 3AXEA 1QXRA 1OQ1A 1ND3A 2P2KA 1PO23 2B45X 4BA6A 1TE1B 4XFBA 1ASJ1 4WZFA 3FUQA 4QU2A 1UKRA 1W0PA 1OPMA 4QQ2A 1UIKA 1J3QA 4XBQA 3WZ1A 4DRVA 4Q4V1 3O0VA 3FC0A 1YXWA 2R063 3A0NA 3VBOC 2CTVA 1MVQA 4JRLA 5K9YA 1SACA 1UZYA 4JQRA 1MS0A 2ZMLA 2HWE2 4Q1PA 2WS91 2WWSA 4IEXA 3ZYJB 1MZEA 1IQAA 1EPWA 3HMYA 3OCPA 4RA0A 2UY8A 1N1VA 3ZO0B 3ZYIB 1KS5A 5KXCA 3V0BA 1ASJ3 4EJRA 1MACA 3M2MA 4W6YA 1X8EA 2R16A 2WL1A 4MZUA 2CAUA 5DDJ3 2DTWA 1PNFA 3KT4A 1IGOA 5FREA 4I2OA 5DXDA 5KWRA 3MIBA 5A3LA 2GH2A 2YY1A 1HQNA 1AXZA 4ATFA 1YJKA 2RHPA 4YZ5A 3ACLA 4Q4Y1 5IK5A 4XFGA 3WP6A 1U5IA 4Z2WA 4XDQA 1PO11 1VBD2 2G9GA 4K8FA 5ACA1 3AFGA 2ZX4A 4ISQA 1LRHA 4XQWA 2HWC2 5C4WA 3ZSJA 2H0BA 1O5UA 1QQP2 3KCCA 1RVF1 4HKWA 5IUQA 5IK4A 3JCIA 3K48A 2BNNA 2WLPA 1AR71 4M3CB 1UCXA 1CIWA 3CNAA 4Q4Y3 3ILFA 5KC6A 1YHFA 4XEZA 1UN1A 4PCRA 3VBRA 1GQHA 3LSEA 4RGGA 2FZ2A 1GSLA 2HJIA 4EWAA 4MYEA 5LK7B 5HCFA 1GFF2 1QJX2 3OGGA 4FOQA 1DF0A 1VBA2 1HW5A 4HZFA 1NOVA 4BPZA 3USUB 1AX2A 1PO22 1UW8A 1N1SA 3I7DA 2ZGLA 4MX3A 2Q30A 3SLIA 4QPIA 1AYM1 2P34A 1IS3A 2X5IC 4ORFA 1GBGA 3VGIA 1QWRA 4N53A 1FOD1 4CDWC 2C9AA 1DZTA 4B8EA 3FHIB 4HBNA 4LLOA 1ENQA 1H1MA 4M01A 2RS13 3I2DA 1N3QA 4RSUA