1EV14

Echovirus 1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
61
Chain Sequence
b'GAQVSTQKTGAHETSIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPMKDVMIKTLPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of echovirus 1.
pubmed doi rcsb
molecule keywords ECHOVIRUS 1
molecule tags Virus
total genus 4
structure length 61
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ev1400
4Q4Y4 1RHI4 1AR74 1RUE4 1RUH4 1HRI4 1EAH4 1NA1D 1Z7S4 1RUC4 1COV4 1BEV4 1VBC4 1RUF4 2R064 3JBG4 1RUI4 2R074 2RS14 1MQTD 1RMU4 2R044 3JD74 1OOPD 1PO24 2RR14 1VBE4 4PDWD 1VBA4 1VBB4 1RUG4 1PO14 1R084 1RVF4 1RUJ4 2HWC4 1AL24 1PVC4 1VBD4 1K5MD 2RS34 1EV14 4Q4X4 3J8F4 2RM24 2PLV4 1PIV4 2RS54 2X5ID 1VRH4 1H8TD 1R094 4GB34 4Q4V4 4Q4W4 1ASJ4 1AR94 1AR84 1HXS4 1RUD4 2RMU4 1NCQD 1D4M4 1POV0 1HRV4 4RHV4 2HWB4 1AR64
chains in the Genus database with same CATH superfamily
1XHXA 1RUE4 3AE6A 1XHZA 2WDVA 1RUH4 3AE4A 2ACZA 1VBC4 1RUF4 1RUI4 2B76A 2R074 1RMU4 2R044 1OOPD 4YTPA 4PDWD 3AECA 3VRBA 1AL24 1PVC4 1VBD4 2WP9A 3AE8A 1NEKA 3J8F4 2WDRA 4Q4W4 1YQ3A 3VR9A 2RMU4 1POV0 4RHV4 2PZSA 1AR64 3SUCA 1L0VA 1HRI4 3SFDA 1EAH4 1NA1D 3CIRA 3FI7A 3JBG4 2EX3A 2RS14 1MQTD 2R7FA 2RR14 3P4SA 5C3JA 3AE3A 2WQYA 4YTNA 1RVF4 1R084 2PY5A 3AE9A 1K5MD 2WU5A 2PLV4 4YSXA 3AEDA 1KFYA 1NENA 1PIV4 3AEAA 3SFEA 3VRAA 1ASJ4 1AR94 1RUD4 2WS3A 3AE7A 1NCQD 3VR8A 4YSZA 4Q4Y4 1RHI4 1AR74 3P4PA 3P4RA 3AEEA 2FBWA 1Z7S4 2PYLA 2H89A 1RUC4 3AEGA 2R064 1YQ4A 1ZP0A 4YXDA 3JD74 1VBA4 3GQKA 1PO14 2HWC4 3AEFA 4Q4X4 2PW9A 1VRH4 1R094 4GB34 3AEBA 1AR84 1HXS4 2H88A 1D4M4 2RM24 1HRV4 4KX6A 2HWB4 5C2TA 3ABVA 2PYJA 2WDQA 1COV4 1BEV4 3AE1A 1KF6A 1PO24 1VBE4 3GQHA 3P4QA 1VBB4 1RUG4 1RUJ4 1XI1A 2RS34 1EV14 1ZOYA 2RS54 2X5ID 2WU2A 1H8TD 4YTMA 4Q4V4 4YT0A 4YSYA 3AE5A 3AE2A
chains in the Genus database with same CATH topology
4Q4Y4 1RHI4 1AR74 1RUE4 1RUH4 1HRI4 1EAH4 1NA1D 1Z7S4 1RUC4 1COV4 1BEV4 1VBC4 1RUF4 2R064 3JBG4 1RUI4 2R074 2RS14 1MQTD 1RMU4 2R044 3JD74 1OOPD 1PO24 2RR14 1VBE4 4PDWD 1VBA4 1VBB4 1RUG4 1PO14 1R084 1RVF4 1RUJ4 2HWC4 1AL24 1PVC4 1VBD4 1K5MD 2RS34 1EV14 4Q4X4 3J8F4 2RM24 2PLV4 1PIV4 2RS54 2X5ID 1VRH4 1H8TD 1R094 4GB34 4Q4V4 4Q4W4 1ASJ4 1AR94 1AR84 1HXS4 1RUD4 2RMU4 1NCQD 1D4M4 1POV0 1HRV4 4RHV4 2HWB4 1AR64
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q4Y 4;  1RHI 4;  1AR7 4;  1RUE 4;  1RUH 4;  1HRI 4;  1EAH 4;  1NA1 D;  1Z7S 4;  1RUC 4;  1COV 4;  1BEV 4;  1VBC 4;  1RUF 4;  2R06 4;  3JBG 4;  1RUI 4;  2R07 4;  2RS1 4;  1MQT D;  1RMU 4;  2R04 4;  3JD7 4;  1OOP D;  1PO2 4;  2RR1 4;  1VBE 4;  4PDW D;  1VBA 4;  1VBB 4;  1RUG 4;  1PO1 4;  1R08 4;  1RVF 4;  1RUJ 4;  2HWC 4;  1AL2 4;  1PVC 4;  1VBD 4;  1K5M D;  2RS3 4;  1EV1 4;  4Q4X 4;  3J8F 4;  2RM2 4;  2PLV 4;  1PIV 4;  2RS5 4;  2X5I D;  1VRH 4;  1H8T D;  1R09 4;  4GB3 4;  4Q4V 4;  4Q4W 4;  1ASJ 4;  1AR9 4;  1AR8 4;  1HXS 4;  1RUD 4;  2RMU 4;  1NCQ D;  1D4M 4;  1POV 0;  1HRV 4;  4RHV 4;  2HWB 4;  1AR6 4; 
#chains in the Genus database with same CATH topology
 1XHX A;  1RUE 4;  3AE6 A;  1XHZ A;  2WDV A;  1RUH 4;  3AE4 A;  2ACZ A;  1VBC 4;  1RUF 4;  1RUI 4;  2B76 A;  2R07 4;  1RMU 4;  2R04 4;  1OOP D;  4YTP A;  4PDW D;  3AEC A;  3VRB A;  1AL2 4;  1PVC 4;  1VBD 4;  2WP9 A;  3AE8 A;  1NEK A;  3J8F 4;  2WDR A;  4Q4W 4;  1YQ3 A;  3VR9 A;  2RMU 4;  1POV 0;  4RHV 4;  2PZS A;  1AR6 4;  3SUC A;  1L0V A;  1HRI 4;  3SFD A;  1EAH 4;  1NA1 D;  3CIR A;  3FI7 A;  3JBG 4;  2EX3 A;  2RS1 4;  1MQT D;  2R7F A;  2RR1 4;  3P4S A;  5C3J A;  3AE3 A;  2WQY A;  4YTN A;  1RVF 4;  1R08 4;  2PY5 A;  3AE9 A;  1K5M D;  2WU5 A;  2PLV 4;  4YSX A;  3AED A;  1KFY A;  1NEN A;  1PIV 4;  3AEA A;  3SFE A;  3VRA A;  1ASJ 4;  1AR9 4;  1RUD 4;  2WS3 A;  3AE7 A;  1NCQ D;  3VR8 A;  4YSZ A;  4Q4Y 4;  1RHI 4;  1AR7 4;  3P4P A;  3P4R A;  3AEE A;  2FBW A;  1Z7S 4;  2PYL A;  2H89 A;  1RUC 4;  3AEG A;  2R06 4;  1YQ4 A;  1ZP0 A;  4YXD A;  3JD7 4;  1VBA 4;  3GQK A;  1PO1 4;  2HWC 4;  3AEF A;  4Q4X 4;  2PW9 A;  1VRH 4;  1R09 4;  4GB3 4;  3AEB A;  1AR8 4;  1HXS 4;  2H88 A;  1D4M 4;  2RM2 4;  1HRV 4;  4KX6 A;  2HWB 4;  5C2T A;  3ABV A;  2PYJ A;  2WDQ A;  1COV 4;  1BEV 4;  3AE1 A;  1KF6 A;  1PO2 4;  1VBE 4;  3GQH A;  3P4Q A;  1VBB 4;  1RUG 4;  1RUJ 4;  1XI1 A;  2RS3 4;  1EV1 4;  1ZOY A;  2RS5 4;  2X5I D;  2WU2 A;  1H8T D;  4YTM A;  4Q4V 4;  4YT0 A;  4YSY A;  3AE5 A;  3AE2 A; 
#chains in the Genus database with same CATH homology
 4Q4Y 4;  1RHI 4;  1AR7 4;  1RUE 4;  1RUH 4;  1HRI 4;  1EAH 4;  1NA1 D;  1Z7S 4;  1RUC 4;  1COV 4;  1BEV 4;  1VBC 4;  1RUF 4;  2R06 4;  3JBG 4;  1RUI 4;  2R07 4;  2RS1 4;  1MQT D;  1RMU 4;  2R04 4;  3JD7 4;  1OOP D;  1PO2 4;  2RR1 4;  1VBE 4;  4PDW D;  1VBA 4;  1VBB 4;  1RUG 4;  1PO1 4;  1R08 4;  1RVF 4;  1RUJ 4;  2HWC 4;  1AL2 4;  1PVC 4;  1VBD 4;  1K5M D;  2RS3 4;  1EV1 4;  4Q4X 4;  3J8F 4;  2RM2 4;  2PLV 4;  1PIV 4;  2RS5 4;  2X5I D;  1VRH 4;  1H8T D;  1R09 4;  4GB3 4;  4Q4V 4;  4Q4W 4;  1ASJ 4;  1AR9 4;  1AR8 4;  1HXS 4;  1RUD 4;  2RMU 4;  1NCQ D;  1D4M 4;  1POV 0;  1HRV 4;  4RHV 4;  2HWB 4;  1AR6 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...