1EV14

Echovirus 1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
61
Chain Sequence
b'GAQVSTQKTGAHETSIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPMKDVMIKTLPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECHOVIRUS 1
publication title Structure determination of echovirus 1.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 61
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ev1400
4Q4X4 1AL24 1ASJ4 1RHI4 2PLV4 1AR64 2RMU4 1HRV4 1EV14 1R094 2R064 1RUE4 1OOPD 1AR74 1NCQD 1PIV4 2RS54 1HRI4 2RS14 1H8TD 2R074 4PDWD 3JBG4 1RUG4 4RHV4 1RUJ4 1RMU4 1BEV4 1D4M4 1MQTD 1PO14 3J8F4 1RUC4 2R044 1VBE4 4GB34 1VRH4 1POV0 3JD74 1RVF4 1VBA4 1COV4 1VBC4 4Q4V4 4Q4Y4 1AR94 2X5ID 1RUI4 1VBD4 2RM24 1EAH4 1PO24 1PVC4 2HWC4 1RUH4 1RUD4 1VBB4 1R084 1HXS4 1K5MD 4Q4W4 2RR14 1NA1D 1Z7S4 2RS34 1RUF4 2HWB4 1AR84
chains in the Genus database with same CATH superfamily
4Q4X4 2R064 2RS54 1ZOYA 1NEKA 3VR8A 1ZP0A 2RS14 2R074 4YTPA 2WQYA 1RUG4 3P4PA 1VBE4 4Q4V4 3AEFA 1XHZA 3AECA 1RUI4 1EAH4 1PO24 2FBWA 2HWC4 1RUH4 4KX6A 3AE3A 3VR9A 2WDVA 3P4QA 2RS34 1RUF4 2HWB4 5C2TA 3P4RA 2EX3A 5C3JA 2PYJA 1RUE4 1AR74 1HRI4 3JBG4 1RMU4 3AE2A 3AE9A 3AE7A 1POV0 3JD74 1VBA4 3ABVA 3AEEA 1NENA 3AE4A 1VBD4 2H89A 3SFDA 3GQKA 1RUD4 1VBB4 3GQHA 1R084 1K5MD 2B76A 4Q4W4 2H88A 2WU2A 3VRAA 3FI7A 1L0VA 1AL24 1ASJ4 1RHI4 1AR64 2WS3A 1EV14 3AEGA 3SFEA 1OOPD 1NCQD 1YQ3A 1H8TD 4PDWD 3J8F4 1MQTD 3SUCA 1RUC4 1KFYA 2WU5A 1COV4 3AE5A 1XHXA 2WDRA 4YT0A 1YQ4A 2ACZA 2X5ID 3AEBA 1XI1A 4YXDA 2RR14 3AE8A 3AE1A 1Z7S4 2PZSA 3P4SA 3CIRA 2WP9A 2PLV4 2RMU4 1HRV4 1R094 4YSYA 1PIV4 4RHV4 1RUJ4 1BEV4 1D4M4 1PO14 3AEAA 4GB34 2R044 1VRH4 2R7FA 1RVF4 1VBC4 4Q4Y4 1AR94 4YSZA 2RM24 1PVC4 1KF6A 2WDQA 3AE6A 4YTMA 1HXS4 2PYLA 1NA1D 4YSXA 2PY5A 3AEDA 3VRBA 2PW9A 4YTNA 1AR84
chains in the Genus database with same CATH topology
4Q4X4 1AL24 1ASJ4 1RHI4 2PLV4 1AR64 2RMU4 1HRV4 1EV14 1R094 2R064 1RUE4 1OOPD 1AR74 1NCQD 1PIV4 2RS54 1HRI4 2RS14 1H8TD 2R074 4PDWD 3JBG4 1RUG4 4RHV4 1RUJ4 1RMU4 1BEV4 1D4M4 1MQTD 1PO14 3J8F4 1RUC4 2R044 1VBE4 4GB34 1VRH4 1POV0 3JD74 1RVF4 1VBA4 1COV4 1VBC4 4Q4V4 4Q4Y4 1AR94 2X5ID 1RUI4 1VBD4 2RM24 1EAH4 1PO24 1PVC4 2HWC4 1RUH4 1RUD4 1VBB4 1R084 1HXS4 1K5MD 4Q4W4 2RR14 1NA1D 1Z7S4 2RS34 1RUF4 2HWB4 1AR84
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q4X 4;  1AL2 4;  1ASJ 4;  1RHI 4;  2PLV 4;  1AR6 4;  2RMU 4;  1HRV 4;  1EV1 4;  1R09 4;  2R06 4;  1RUE 4;  1OOP D;  1AR7 4;  1NCQ D;  1PIV 4;  2RS5 4;  1HRI 4;  2RS1 4;  1H8T D;  2R07 4;  4PDW D;  3JBG 4;  1RUG 4;  4RHV 4;  1RUJ 4;  1RMU 4;  1BEV 4;  1D4M 4;  1MQT D;  1PO1 4;  3J8F 4;  1RUC 4;  2R04 4;  1VBE 4;  4GB3 4;  1VRH 4;  1POV 0;  3JD7 4;  1RVF 4;  1VBA 4;  1COV 4;  1VBC 4;  4Q4V 4;  4Q4Y 4;  1AR9 4;  2X5I D;  1RUI 4;  1VBD 4;  2RM2 4;  1EAH 4;  1PO2 4;  1PVC 4;  2HWC 4;  1RUH 4;  1RUD 4;  1VBB 4;  1R08 4;  1HXS 4;  1K5M D;  4Q4W 4;  2RR1 4;  1NA1 D;  1Z7S 4;  2RS3 4;  1RUF 4;  2HWB 4;  1AR8 4; 
#chains in the Genus database with same CATH topology
 4Q4X 4;  2R06 4;  2RS5 4;  1ZOY A;  1NEK A;  3VR8 A;  1ZP0 A;  2RS1 4;  2R07 4;  4YTP A;  2WQY A;  1RUG 4;  3P4P A;  1VBE 4;  4Q4V 4;  3AEF A;  1XHZ A;  3AEC A;  1RUI 4;  1EAH 4;  1PO2 4;  2FBW A;  2HWC 4;  1RUH 4;  4KX6 A;  3AE3 A;  3VR9 A;  2WDV A;  3P4Q A;  2RS3 4;  1RUF 4;  2HWB 4;  5C2T A;  3P4R A;  2EX3 A;  5C3J A;  2PYJ A;  1RUE 4;  1AR7 4;  1HRI 4;  3JBG 4;  1RMU 4;  3AE2 A;  3AE9 A;  3AE7 A;  1POV 0;  3JD7 4;  1VBA 4;  3ABV A;  3AEE A;  1NEN A;  3AE4 A;  1VBD 4;  2H89 A;  3SFD A;  3GQK A;  1RUD 4;  1VBB 4;  3GQH A;  1R08 4;  1K5M D;  2B76 A;  4Q4W 4;  2H88 A;  2WU2 A;  3VRA A;  3FI7 A;  1L0V A;  1AL2 4;  1ASJ 4;  1RHI 4;  1AR6 4;  2WS3 A;  1EV1 4;  3AEG A;  3SFE A;  1OOP D;  1NCQ D;  1YQ3 A;  1H8T D;  4PDW D;  3J8F 4;  1MQT D;  3SUC A;  1RUC 4;  1KFY A;  2WU5 A;  1COV 4;  3AE5 A;  1XHX A;  2WDR A;  4YT0 A;  1YQ4 A;  2ACZ A;  2X5I D;  3AEB A;  1XI1 A;  4YXD A;  2RR1 4;  3AE8 A;  3AE1 A;  1Z7S 4;  2PZS A;  3P4S A;  3CIR A;  2WP9 A;  2PLV 4;  2RMU 4;  1HRV 4;  1R09 4;  4YSY A;  1PIV 4;  4RHV 4;  1RUJ 4;  1BEV 4;  1D4M 4;  1PO1 4;  3AEA A;  4GB3 4;  2R04 4;  1VRH 4;  2R7F A;  1RVF 4;  1VBC 4;  4Q4Y 4;  1AR9 4;  4YSZ A;  2RM2 4;  1PVC 4;  1KF6 A;  2WDQ A;  3AE6 A;  4YTM A;  1HXS 4;  2PYL A;  1NA1 D;  4YSX A;  2PY5 A;  3AED A;  3VRB A;  2PW9 A;  4YTN A;  1AR8 4; 
#chains in the Genus database with same CATH homology
 4Q4X 4;  1AL2 4;  1ASJ 4;  1RHI 4;  2PLV 4;  1AR6 4;  2RMU 4;  1HRV 4;  1EV1 4;  1R09 4;  2R06 4;  1RUE 4;  1OOP D;  1AR7 4;  1NCQ D;  1PIV 4;  2RS5 4;  1HRI 4;  2RS1 4;  1H8T D;  2R07 4;  4PDW D;  3JBG 4;  1RUG 4;  4RHV 4;  1RUJ 4;  1RMU 4;  1BEV 4;  1D4M 4;  1MQT D;  1PO1 4;  3J8F 4;  1RUC 4;  2R04 4;  1VBE 4;  4GB3 4;  1VRH 4;  1POV 0;  3JD7 4;  1RVF 4;  1VBA 4;  1COV 4;  1VBC 4;  4Q4V 4;  4Q4Y 4;  1AR9 4;  2X5I D;  1RUI 4;  1VBD 4;  2RM2 4;  1EAH 4;  1PO2 4;  1PVC 4;  2HWC 4;  1RUH 4;  1RUD 4;  1VBB 4;  1R08 4;  1HXS 4;  1K5M D;  4Q4W 4;  2RR1 4;  1NA1 D;  1Z7S 4;  2RS3 4;  1RUF 4;  2HWB 4;  1AR8 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...