1EV14

Echovirus 1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
61
Chain Sequence
GAQVSTQKTGAHETSIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPMKDVMIKTLPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECHOVIRUS 1
publication title Structure determination of echovirus 1.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 61
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ev1400
1NA1D 4Q4V4 4Q4Y4 1AR64 3JBG4 2PLV4 1PO14 1AR74 1K5MD 3J8F4 3JD74 1RHI4 4Q4W4 1RUH4 1VBE4 1VBC4 2RS54 1D4M4 1RMU4 2X5ID 1HRI4 1RUF4 1PO24 1PVC4 2R074 1AL24 1PIV4 4Q4X4 1EV14 1MQTD 1NCQD 1RUI4 1EAH4 1VBA4 1VRH4 1Z7S4 2HWC4 2RS34 1POV0 1RVF4 2R064 4GB34 1ASJ4 1HXS4 1OOPD 1RUJ4 1RUE4 2RM24 1HRV4 2RR14 1RUC4 2RS14 2RMU4 1H8TD 1R084 1AR84 4RHV4 1R094 1COV4 2HWB4 1VBD4 1BEV4 4PDWD 1AR94 1RUG4 1RUD4 1VBB4 2R044
chains in the Genus database with same CATH superfamily
2ACZA 5C2TA 2PLV4 2WU5A 3AEAA 1YQ4A 4YTMA 3P4QA 1PVC4 4Q4X4 1EV14 2RS34 3FI7A 3VRBA 4GB34 2RM24 2WDQA 3AE4A 3AEGA 3AEEA 1YQ3A 3AEFA 4RHV4 2WP9A 3SFDA 1VBD4 1BEV4 1NEKA 4PDWD 3VR9A 2R044 3AEDA 2PYLA 1NENA 4Q4Y4 3JBG4 3AEBA 3J8F4 3JD74 3SUCA 4YSXA 4Q4W4 1RUH4 1XHZA 3GQKA 4YSYA 1D4M4 1RMU4 2FBWA 3AE9A 2X5ID 5C3JA 1PO24 1AL24 1NCQD 1EAH4 1Z7S4 1XI1A 2WDRA 1RUJ4 1HXS4 1HRV4 2RR14 1RUC4 2RS14 4YXDA 2HWB4 1AR94 2PZSA 1NA1D 4YTNA 1AR64 2WQYA 1VBE4 1VBC4 1ZOYA 2RS54 3AE7A 2PW9A 3GQHA 1HRI4 2R074 1PIV4 1RUI4 1MQTD 1VBA4 3AE2A 4YT0A 1VRH4 1RVF4 4YSZA 1ASJ4 1RUE4 2H88A 2PYJA 2RMU4 3AE5A 2H89A 1R094 3CIRA 1KF6A 2EX3A 1XHXA 4Q4V4 4KX6A 1L0VA 1PO14 3VRAA 1AR74 1K5MD 3ABVA 1RHI4 2B76A 3SFEA 2R7FA 1KFYA 3P4PA 1RUF4 2WU2A 3AE6A 2HWC4 1POV0 2R064 3P4RA 1OOPD 2WS3A 2PY5A 3VR8A 3AE3A 1ZP0A 4YTPA 1H8TD 1R084 1AR84 3P4SA 3AE1A 1COV4 3AECA 3AE8A 2WDVA 1RUG4 1RUD4 1VBB4
chains in the Genus database with same CATH topology
1NA1D 4Q4V4 4Q4Y4 1AR64 3JBG4 2PLV4 1PO14 1AR74 1K5MD 3J8F4 3JD74 1RHI4 4Q4W4 1RUH4 1VBE4 1VBC4 2RS54 1D4M4 1RMU4 2X5ID 1HRI4 1RUF4 1PO24 1PVC4 2R074 1AL24 1PIV4 4Q4X4 1EV14 1MQTD 1NCQD 1RUI4 1EAH4 1VBA4 1VRH4 1Z7S4 2HWC4 2RS34 1POV0 1RVF4 2R064 4GB34 1ASJ4 1HXS4 1OOPD 1RUJ4 1RUE4 2RM24 1HRV4 2RR14 1RUC4 2RS14 2RMU4 1H8TD 1R084 1AR84 4RHV4 1R094 1COV4 2HWB4 1VBD4 1BEV4 4PDWD 1AR94 1RUG4 1RUD4 1VBB4 2R044
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA1 D;  4Q4V 4;  4Q4Y 4;  1AR6 4;  3JBG 4;  2PLV 4;  1PO1 4;  1AR7 4;  1K5M D;  3J8F 4;  3JD7 4;  1RHI 4;  4Q4W 4;  1RUH 4;  1VBE 4;  1VBC 4;  2RS5 4;  1D4M 4;  1RMU 4;  2X5I D;  1HRI 4;  1RUF 4;  1PO2 4;  1PVC 4;  2R07 4;  1AL2 4;  1PIV 4;  4Q4X 4;  1EV1 4;  1MQT D;  1NCQ D;  1RUI 4;  1EAH 4;  1VBA 4;  1VRH 4;  1Z7S 4;  2HWC 4;  2RS3 4;  1POV 0;  1RVF 4;  2R06 4;  4GB3 4;  1ASJ 4;  1HXS 4;  1OOP D;  1RUJ 4;  1RUE 4;  2RM2 4;  1HRV 4;  2RR1 4;  1RUC 4;  2RS1 4;  2RMU 4;  1H8T D;  1R08 4;  1AR8 4;  4RHV 4;  1R09 4;  1COV 4;  2HWB 4;  1VBD 4;  1BEV 4;  4PDW D;  1AR9 4;  1RUG 4;  1RUD 4;  1VBB 4;  2R04 4; 
#chains in the Genus database with same CATH topology
 2ACZ A;  5C2T A;  2PLV 4;  2WU5 A;  3AEA A;  1YQ4 A;  4YTM A;  3P4Q A;  1PVC 4;  4Q4X 4;  1EV1 4;  2RS3 4;  3FI7 A;  3VRB A;  4GB3 4;  2RM2 4;  2WDQ A;  3AE4 A;  3AEG A;  3AEE A;  1YQ3 A;  3AEF A;  4RHV 4;  2WP9 A;  3SFD A;  1VBD 4;  1BEV 4;  1NEK A;  4PDW D;  3VR9 A;  2R04 4;  3AED A;  2PYL A;  1NEN A;  4Q4Y 4;  3JBG 4;  3AEB A;  3J8F 4;  3JD7 4;  3SUC A;  4YSX A;  4Q4W 4;  1RUH 4;  1XHZ A;  3GQK A;  4YSY A;  1D4M 4;  1RMU 4;  2FBW A;  3AE9 A;  2X5I D;  5C3J A;  1PO2 4;  1AL2 4;  1NCQ D;  1EAH 4;  1Z7S 4;  1XI1 A;  2WDR A;  1RUJ 4;  1HXS 4;  1HRV 4;  2RR1 4;  1RUC 4;  2RS1 4;  4YXD A;  2HWB 4;  1AR9 4;  2PZS A;  1NA1 D;  4YTN A;  1AR6 4;  2WQY A;  1VBE 4;  1VBC 4;  1ZOY A;  2RS5 4;  3AE7 A;  2PW9 A;  3GQH A;  1HRI 4;  2R07 4;  1PIV 4;  1RUI 4;  1MQT D;  1VBA 4;  3AE2 A;  4YT0 A;  1VRH 4;  1RVF 4;  4YSZ A;  1ASJ 4;  1RUE 4;  2H88 A;  2PYJ A;  2RMU 4;  3AE5 A;  2H89 A;  1R09 4;  3CIR A;  1KF6 A;  2EX3 A;  1XHX A;  4Q4V 4;  4KX6 A;  1L0V A;  1PO1 4;  3VRA A;  1AR7 4;  1K5M D;  3ABV A;  1RHI 4;  2B76 A;  3SFE A;  2R7F A;  1KFY A;  3P4P A;  1RUF 4;  2WU2 A;  3AE6 A;  2HWC 4;  1POV 0;  2R06 4;  3P4R A;  1OOP D;  2WS3 A;  2PY5 A;  3VR8 A;  3AE3 A;  1ZP0 A;  4YTP A;  1H8T D;  1R08 4;  1AR8 4;  3P4S A;  3AE1 A;  1COV 4;  3AEC A;  3AE8 A;  2WDV A;  1RUG 4;  1RUD 4;  1VBB 4; 
#chains in the Genus database with same CATH homology
 1NA1 D;  4Q4V 4;  4Q4Y 4;  1AR6 4;  3JBG 4;  2PLV 4;  1PO1 4;  1AR7 4;  1K5M D;  3J8F 4;  3JD7 4;  1RHI 4;  4Q4W 4;  1RUH 4;  1VBE 4;  1VBC 4;  2RS5 4;  1D4M 4;  1RMU 4;  2X5I D;  1HRI 4;  1RUF 4;  1PO2 4;  1PVC 4;  2R07 4;  1AL2 4;  1PIV 4;  4Q4X 4;  1EV1 4;  1MQT D;  1NCQ D;  1RUI 4;  1EAH 4;  1VBA 4;  1VRH 4;  1Z7S 4;  2HWC 4;  2RS3 4;  1POV 0;  1RVF 4;  2R06 4;  4GB3 4;  1ASJ 4;  1HXS 4;  1OOP D;  1RUJ 4;  1RUE 4;  2RM2 4;  1HRV 4;  2RR1 4;  1RUC 4;  2RS1 4;  2RMU 4;  1H8T D;  1R08 4;  1AR8 4;  4RHV 4;  1R09 4;  1COV 4;  2HWB 4;  1VBD 4;  1BEV 4;  4PDW D;  1AR9 4;  1RUG 4;  1RUD 4;  1VBB 4;  2R04 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...