1EV2A

Crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
HFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FIBROBLAST GROWTH FACTOR 2)
publication title Crystal structures of two FGF-FGFR complexes reveal the determinants of ligand-receptor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor/growth factor receptor
total genus 28
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1ev2A00
2F8XC 4EFPA 4LO0C 1XYFA 4USOA 3O4OA 1FGAA 1XG6A 7I1BA 4LO7B 3LTQA 4WBCA 4JQ0A 3RMYA 5BP5A 3BA7A 3VSZA 5FZZA 4DCKC 1HCEA 2J3PA 1R8OA 3Q7XA 1FMMS 1BARA 3AZWA 5HPZA 2GO2A 5FZUA 4Q91A 3T8SA 2KH2A 1WBAA 4FGFA 2P39A 2VSEA 4I2SA 2D20A 3RSJA 4LO1C 1I1EA 2IHOA 1IRPA 4OUJA 2F2FA 2M49A 4ISQA 1AFCA 3V0AB 3OJVA 3HOMA 2Y9XE 2DRYA 1HCDA 4OEGA 4P0JA 5F8WA 5G00A 5DZUA 2LIEA 1F31A 4ISRA 3WA1A 1MD6A 3VT2A 2Q3NB 3N7MA 1SR4A 2FFVA 4I4SA 4A7KA 1JQZA 4KC3A 4YOLA 3F1RA 3OGFA 5D61A 4JAWA 2FO1A 1IILA 3W9TA 3P6IA 4HA2A 1R8NA 3AH2A 3BAOA 4X38A 2ZQNA 1XZZA 4J2KA 4I4YA 3B9UA 5FZYA 2D24A 4QD2B 2VXRA 1XHBA 5EHAA 4HR6C 3FGMA 3FJCA 2Z49A 3O3QA 4I8MA 3O5WB 4JRAA 1DQGA 3FJIA 5BQUC 1IRAX 4G1RA 3JRRA 3O44A 2D22A 1JTCA 2X2SA 3UJ4A 1PC8B 3K1XA 3UDAA 4I4XA 4I1BA 1AVWB 2NVHA 4P0KA 1JY0A 1S0CA 4HJJA 2X2TA 2HWAA 3FJ8A 3HALA 5EG6C 4I0YA 1BFFA 2LIQA 1HKNA 2ZQOA 3CA1A 3IAGC 1W3FA 3UD8A 4ZFUB 1M16A 1MC9A 1OQLB 1ISZA 3I2XA 2FGFA 4DENA 1KNMA 3NBEA 4G9MA 2K8RA 3JUTA 1Z2VA 5JLVA 4KEKA 2K43A 2E4MA 1EVTA 1PUMB 4OEEA 4EFQA 3AH1A 3EF2A 5D63A 2AFGA 1QXMA 4X39A 1E0OA 1WD3A 3BAUA 4G6MA 3VUOA 3H6SE 1EPWA 1DIWA 31BIA 4F83A 2QN4A 1G9AA 2D44A 1BASA 4IONA 3F62B 1BLDA 1Q03A 4OWLA 4LO3A 5D62A 1S0LA 1DFQA 3WINC 2AQZA 4ZLBB 3OBTA 4GP3A 4I7IA 4EB2B 1HWMB 1HWOB 3BRFA 3IM5A 3H6QA 4QALA 4Q9PA 3BA4A 3VSFA 1RZOB 3BB2A 4X37A 3UD9A 3OBRA 3FJHA 4F34A 3AZVA 4GAIA 4LO2C 3BAGA 3FJJA 4Z8SB 1ITBA 4I6IA 1IT0A 1TFMB 1Q1UA 3UJ0A 1YYNA 5BVPI 3V0AA 3O4BA 2ESUA 1EYLA 1G9CA 2D7IA 2ERMA 3ZX7A 1BFGA 1ISXA 4QKRA 4JP0A 2NM1A 3PHZA 2Y9FA 1DFCA 3FJ9A 4I3NA 4AN7B 5BP5C 3LLPA 3H6RB 4I4VA 3FUOA 2BEBA 3Q7YA 1AVUA 3V0BB 4QBVA 4P0LA 1NUNA 1S0FA 2HW9A 3OJ2A 3RTJB 1QQLA 1TIEA 1V6VA 2AXMA 3KMVA 4JPZA 3CA3A 2Y9GA 2DRZA 4I37A 3HSMA 2F2FC 5B2HA 3BRDA 1FN0A 3O49A 4I4QA 1W3GA 3FJDA 4JKQA 1AVAC 3NBNA 3FJKA 3R4UA 4IYBA 2D43A 2NP0A 3IM7A 1ILR1 1FQ9A 1RG8A 1TOOA 1NZKA 3N0KA 4ZFYB 1FV3A 4JKXB 9ILBA 1QQKA 4L4HA 1TWMA 3CRIA 1L2HA 1JLYA 1FV2A 2QYIB 2Y9WC 5FNWA 3AKHA 3AKGA 3A23A 2ET2A 3N7JA 2WRYA 3WMVA 4II0A 2VU9A 2KKIA 4CJMA 3O4CA 3WO2A 1M2TB 4EFRA 1TWEA 3I29B 1YXWA 1G82A 3CA0A 4LO8B 2D7RA 4OW4A 2XOAA 3ZXDA 5BXSA 4J2XA 1AVXB 4P6AA 5BXTA 4I1EA 1D0HA 2Q9XA 1Z4SA 4I4OA 4GOYA 3QYDA 3OJMA 2UUSA 3AJ6A 4ZOTA 1PUUB 3CAHA 2WBCA 4EEEB 3WO4A 4OWKA 1S0BA 1S0DA 4EKXB 2AAIB 3O4AA 1PWAA 4FVVA 3FUQA 1JLXA 4XKIA 2DREA 1JT5A 1BFBA 4ZFWB 1ISYA 2RG9B 1K5UA 3HMYA 1Q04A 1BA7A 3CU1B 3BAQA 3ZC8A 4AN6A 2NTDA 3HBWA 3NJ5A 4J2SA 4XFUA 3MALA 1DLLA 2VXTI 3N7LA 4IY8A 2IWTB 3CRGA 4I4PA 2D23A 3WINA 1G9DA 3CA6A 4QC4A 3VT1A 5BXPA 3QR5A 2HWMA 5EC5A 4IZEA 3TC2A 1BLAA 3ZXGA 3HN1A 3SNVA 4KBBA 4LO7C 4OWJA 4LO0A 5F90A 3NBCA 3PG0A 2I1BA 3ILAA 1P63A 1HWPB 4LO3C 1A8DA 3BTAA 3H6RA 4A7YA 3MPPG 5JMCA 1YF8B 2GZBA 3D7WB 2VLCA 1FWVA 1WD4A 1S0GA 4KEJA 4H04A 3AKFA 1TP0A 3FJEA 4IZXA 4GP0A 2RSTA 1IOBA 5DUYA 4I4UA 3PMEA 4TLPA 4LO1A 3RMXA 1I1BA 1FWUA 3VT0A 1K5VA 1RMLA 4GOVA 1IHKA 4D8HA 1Z0HA 3AJ5A 5E24E 4H9WA 2R9KB 3A07A 1FMZA 2KI4A 3NBDA 1JT4A 4ENDA 4ZA3B 1T4QA 3FJFA 1BFCA 1V6WA 1DZDA 1IJTA 2BFHA 2Z48A 3A22A 1AF9A 2D1ZA 3AH4A 1J0SA 2P23A 1II4A 3POKA 4IQPA 1ABRB 2BEAA 3P6JA 3BAHA 1ISVA 5I1BA 1JT7A 2MLLB 4QBCA 1DQOA 4ZGRB 4QD2C 1SR4C 3PUBA 1G9BA 4D0ZA 2FFUA 3OGGA 2MC2A 4L4IA 3I2AA 41BIA 1AXMA 4R6UB 5BQUA 1YBIA 1DJSB 1SZ6B 2DS0A 5FNXA 1CE7B 3P53A 4D0TA 2KI6B 3FJBA 3IM6A 3CQAA 4Z9WB 3ZC9A 4J23B 3FFZA 4OEFA 4X3AA 2ZR1B 2RQ9A 3BX1C 5F8YA 2MIBA 3C9ZA 4J2YA 4ZBVB 3BAVA 4KEIA 5F8SA 3RTIB 3O4DA 3CRHA 3CA4A 4A7ZA 2NYYA 3N7KA 3V79C 3BA5A 2VUAA 1EV2A 3AKIA 3VWCA 3BRGC 3VEQA 1YTOA 1V6XA 1TTUA 2VSAA 4XFTA 5BXRA 4QO3A 1RY7A 4QKSA 2K4AB 4G6JA 1GGPB 1T9FA 2E4MC 3FJAA 5GAQA 4PC4A 1ONKB 4I96A 1N4KA 4DEPA 1WBCA 5DSSB 3E8LC 1HWNB 1CVSA 3WO3A 5BOWA 1W3AA 2FDBM 3BADA 1JT3A 2L5XA 4XFSA 4ZKTB 6I1BA 1ISWA 3S8KA 3WMUA 5DVHA 1HIBA 2YUGA 4I4RA 4LO2A 4IHZA 2NZ9A 21BIA 1UPSA 3Q7WA 3S8JA 3A21A 4GAFA 1PZZA 4G9NA 3UD7A 1S0EA 3V0BA 4USPA 3IIRA 3R4SA 2HZ9A 4IY9A 2KLLA 4Q9GA 8I1BA 1VCLA 1DZCA 1V6UA 3CA5A
chains in the Genus database with same CATH superfamily
2F8XC 4EFPA 4LO0C 1XYFA 4USOA 3O4OA 1FGAA 1XG6A 7I1BA 4LO7B 3LTQA 4WBCA 4JQ0A 3RMYA 5BP5A 3BA7A 3VSZA 5FZZA 4DCKC 1HCEA 2J3PA 1R8OA 3Q7XA 1FMMS 1BARA 3AZWA 5HPZA 2GO2A 5FZUA 4Q91A 3T8SA 2KH2A 1WBAA 4MZHA 4FGFA 2P39A 2VSEA 4I2SA 2D20A 3RSJA 4LO1C 1I1EA 2IHOA 1IRPA 4OUJA 2F2FA 2M49A 4ISQA 1AFCA 3V0AB 3OJVA 3HOMA 2Y9XE 2DRYA 1HCDA 4OEGA 4P0JA 5F8WA 5G00A 5DZUA 2LIEA 1F31A 4ISRA 3WA1A 1MD6A 3VT2A 2Q3NB 3N7MA 4MZGB 1SR4A 2FFVA 4I4SA 4A7KA 1JQZA 4KC3A 4YOLA 3F1RA 3OGFA 5D61A 4JAWA 2FO1A 1IILA 3W9TA 3P6IA 4HA2A 1R8NA 3AH2A 3BAOA 4X38A 2ZQNA 1XZZA 4J2KA 4I4YA 3B9UA 5FZYA 2D24A 4QD2B 2VXRA 1XHBA 5EHAA 4HR6C 3FGMA 3FJCA 2Z49A 3O3QA 4I8MA 3O5WB 4JRAA 1DQGA 3FJIA 5BQUC 1IRAX 4G1RA 3JRRA 3O44A 2D22A 1JTCA 2X2SA 3UJ4A 1PC8B 3K1XA 3UDAA 4I4XA 4I1BA 1AVWB 2NVHA 4P0KA 1JY0A 1S0CA 4HJJA 2X2TA 2HWAA 3FJ8A 3HALA 5EG6C 4I0YA 1BFFA 2LIQA 1HKNA 2ZQOA 3CA1A 3IAGC 1W3FA 3UD8A 4ZFUB 1M16A 1MC9A 1OQLB 1ISZA 3I2XA 2FGFA 4DENA 1KNMA 3NBEA 4G9MA 2K8RA 3JUTA 1Z2VA 5JLVA 4KEKA 2K43A 2E4MA 1EVTA 1PUMB 4OEEA 4EFQA 3AH1A 3EF2A 5D63A 2AFGA 1QXMA 4X39A 1E0OA 1WD3A 3BAUA 4G6MA 3VUOA 3H6SE 1EPWA 1DIWA 31BIA 4F83A 2QN4A 1G9AA 2D44A 1BASA 4IONA 3F62B 1BLDA 1Q03A 4OWLA 4LO3A 5D62A 1S0LA 1DFQA 3WINC 2AQZA 4ZLBB 3OBTA 4GP3A 4I7IA 4EB2B 1HWMB 1HWOB 3BRFA 3IM5A 3H6QA 4QALA 4Q9PA 3BA4A 3VSFA 1RZOB 3BB2A 4X37A 3UD9A 4H75A 3OBRA 3FJHA 4F34A 3AZVA 4GAIA 4LO2C 3BAGA 3FJJA 4Z8SB 1ITBA 4I6IA 1IT0A 1TFMB 1Q1UA 3UJ0A 1YYNA 5BVPI 3V0AA 3O4BA 2ESUA 2NS2A 1EYLA 1G9CA 2D7IA 2ERMA 3ZX7A 1BFGA 1ISXA 4QKRA 4JP0A 2NM1A 3PHZA 2Y9FA 1DFCA 3FJ9A 4I3NA 4AN7B 5BP5C 3LLPA 3H6RB 4I4VA 3FUOA 2BEBA 3Q7YA 1AVUA 3V0BB 4QBVA 4P0LA 1NUNA 1S0FA 2HW9A 3OJ2A 3RTJB 1QQLA 1TIEA 1V6VA 2AXMA 3KMVA 4JPZA 3CA3A 2Y9GA 2DRZA 4I37A 3HSMA 2F2FC 5B2HA 3BRDA 1FN0A 3O49A 4I4QA 1W3GA 3FJDA 4JKQA 1AVAC 3NBNA 3FJKA 3R4UA 4IYBA 2D43A 2NP0A 3IM7A 1ILR1 1FQ9A 1RG8A 1TOOA 1NZKA 3N0KA 4ZFYB 1FV3A 4JKXB 9ILBA 1QQKA 4L4HA 1TWMA 3CRIA 1L2HA 1JLYA 1FV2A 2QYIB 2Y9WC 5FNWA 3AKHA 3AKGA 3A23A 2ET2A 3N7JA 2WRYA 3WMVA 4II0A 2VU9A 2KKIA 4CJMA 3O4CA 3WO2A 1M2TB 4EFRA 1TWEA 3I29B 1YXWA 1G82A 3CA0A 4LO8B 2D7RA 4OW4A 2XOAA 3ZXDA 5BXSA 4J2XA 1AVXB 4P6AA 5BXTA 4I1EA 1D0HA 2Q9XA 1Z4SA 4I4OA 4GOYA 3QYDA 3OJMA 2UUSA 3AJ6A 4ZOTA 1PUUB 3CAHA 2WBCA 4EEEB 3WO4A 4OWKA 1S0BA 1S0DA 4EKXB 2AAIB 3O4AA 1PWAA 4FVVA 3FUQA 1JLXA 4XKIA 2DREA 1JT5A 1BFBA 4ZFWB 1ISYA 2RG9B 1K5UA 3HMYA 1Q04A 1BA7A 3CU1B 3BAQA 3ZC8A 4AN6A 2NTDA 3HBWA 3NJ5A 4J2SA 4XFUA 3MALA 1DLLA 2VXTI 3N7LA 4IY8A 2IWTB 3CRGA 4I4PA 2D23A 3WINA 1G9DA 3CA6A 4QC4A 3VT1A 5BXPA 3QR5A 2HWMA 5EC5A 4IZEA 3TC2A 1BLAA 3ZXGA 3HN1A 3SNVA 4KBBA 4LO7C 4OWJA 4LO0A 5F90A 3NBCA 3PG0A 2I1BA 3ILAA 1P63A 1HWPB 4LO3C 1A8DA 3BTAA 3H6RA 4A7YA 3MPPG 5JMCA 1YF8B 2GZBA 3D7WB 2VLCA 1FWVA 4UY4A 1WD4A 1S0GA 4KEJA 4H04A 3AKFA 1TP0A 3FJEA 4IZXA 4GP0A 2RSTA 1IOBA 5DUYA 4I4UA 3PMEA 4TLPA 4LO1A 3RMXA 1I1BA 1FWUA 3VT0A 1K5VA 1RMLA 4GOVA 1IHKA 4D8HA 1Z0HA 3AJ5A 5E24E 4H9WA 2R9KB 3A07A 1FMZA 2KI4A 3NBDA 1JT4A 4ENDA 4ZA3B 1T4QA 3FJFA 1BFCA 1V6WA 1DZDA 1IJTA 2BFHA 2Z48A 3A22A 1AF9A 2D1ZA 3AH4A 1J0SA 2P23A 1II4A 3POKA 4IQPA 1ABRB 2BEAA 3P6JA 3BAHA 1ISVA 5I1BA 1JT7A 2MLLB 4QBCA 1DQOA 4ZGRB 4QD2C 1SR4C 3PUBA 1G9BA 4D0ZA 2FFUA 3OGGA 2MC2A 4L4IA 3I2AA 41BIA 1AXMA 4R6UB 5BQUA 1YBIA 1DJSB 1SZ6B 2DS0A 5FNXA 1CE7B 3P53A 4D0TA 2KI6B 4MZFB 3FJBA 3IM6A 3CQAA 4Z9WB 3ZC9A 4J23B 3FFZA 4OEFA 4X3AA 2ZR1B 2RQ9A 3BX1C 5F8YA 2MIBA 3C9ZA 4J2YA 4ZBVB 3BAVA 4KEIA 5F8SA 3RTIB 3O4DA 3CRHA 3CA4A 4A7ZA 2NYYA 3N7KA 3V79C 3BA5A 2VUAA 1EV2A 3AKIA 3VWCA 3BRGC 3VEQA 1YTOA 1V6XA 1TTUA 2VSAA 4XFTA 5BXRA 4QO3A 1RY7A 4QKSA 2K4AB 4G6JA 1GGPB 1T9FA 2E4MC 3FJAA 5GAQA 4PC4A 1ONKB 4I96A 1N4KA 4DEPA 1WBCA 5DSSB 3E8LC 1HWNB 1CVSA 3WO3A 5BOWA 1W3AA 2FDBM 3BADA 1JT3A 2L5XA 4XFSA 4ZKTB 6I1BA 1ISWA 3S8KA 3WMUA 5DVHA 1HIBA 2YUGA 4I4RA 4LO2A 4IHZA 2NZ9A 21BIA 1UPSA 3Q7WA 3S8JA 3A21A 4GAFA 1PZZA 4G9NA 3UD7A 1S0EA 3V0BA 4USPA 3IIRA 3R4SA 2HZ9A 4IY9A 2KLLA 4Q9GA 8I1BA 1VCLA 1DZCA 1V6UA 3CA5A
chains in the Genus database with same CATH topology
2F8XC 4EFPA 4LO0C 1XYFA 4USOA 3O4OA 1FGAA 1XG6A 7I1BA 4LO7B 3LTQA 4WBCA 4JQ0A 3RMYA 5BP5A 3BA7A 3VSZA 5FZZA 4DCKC 1HCEA 2J3PA 1R8OA 3Q7XA 1FMMS 1BARA 3AZWA 5HPZA 2GO2A 5FZUA 4Q91A 3T8SA 2KH2A 1WBAA 4MZHA 4FGFA 2P39A 2VSEA 4I2SA 2D20A 3RSJA 4LO1C 1I1EA 2IHOA 1IRPA 4OUJA 2F2FA 2M49A 4ISQA 1AFCA 3V0AB 3OJVA 3HOMA 2Y9XE 2DRYA 1HCDA 4OEGA 4P0JA 5F8WA 5G00A 5DZUA 2LIEA 1F31A 4ISRA 3WA1A 1MD6A 3VT2A 2Q3NB 3N7MA 4MZGB 1SR4A 2FFVA 4I4SA 4A7KA 1JQZA 4KC3A 4YOLA 3F1RA 3OGFA 5D61A 4JAWA 2FO1A 1IILA 3W9TA 3P6IA 4HA2A 1R8NA 3AH2A 3BAOA 4X38A 2ZQNA 1XZZA 4J2KA 4I4YA 3B9UA 5FZYA 2D24A 4QD2B 2VXRA 1XHBA 5EHAA 4HR6C 3FGMA 3FJCA 2Z49A 3O3QA 4I8MA 3O5WB 4JRAA 1DQGA 3FJIA 5BQUC 1IRAX 4G1RA 3JRRA 3O44A 2D22A 1JTCA 2X2SA 3UJ4A 1PC8B 3K1XA 3UDAA 4I4XA 4I1BA 1AVWB 2NVHA 4P0KA 1JY0A 1S0CA 4HJJA 2X2TA 2HWAA 3FJ8A 3HALA 5EG6C 4I0YA 1BFFA 2LIQA 1HKNA 2ZQOA 3CA1A 3IAGC 1W3FA 3UD8A 4ZFUB 1M16A 1MC9A 1OQLB 1ISZA 3I2XA 2FGFA 4DENA 1KNMA 3NBEA 4G9MA 2K8RA 3JUTA 1Z2VA 5JLVA 4KEKA 2K43A 2E4MA 1EVTA 1PUMB 4OEEA 4EFQA 3AH1A 3EF2A 5D63A 2AFGA 1QXMA 4X39A 1E0OA 1WD3A 3BAUA 4G6MA 3VUOA 3H6SE 1EPWA 1DIWA 31BIA 4F83A 2QN4A 1G9AA 2D44A 1BASA 4IONA 3F62B 1BLDA 1Q03A 4OWLA 4LO3A 5D62A 1S0LA 1DFQA 3WINC 2AQZA 4ZLBB 3OBTA 4GP3A 4I7IA 4EB2B 1HWMB 1HWOB 3BRFA 3IM5A 3H6QA 4QALA 4Q9PA 3BA4A 3VSFA 1RZOB 3BB2A 4X37A 3UD9A 4H75A 3OBRA 3FJHA 4F34A 3AZVA 4GAIA 4LO2C 3BAGA 3FJJA 4Z8SB 1ITBA 4I6IA 1IT0A 1TFMB 1Q1UA 3UJ0A 1YYNA 5BVPI 3V0AA 3O4BA 2ESUA 2NS2A 1EYLA 1G9CA 2D7IA 2ERMA 3ZX7A 1BFGA 1ISXA 4QKRA 4JP0A 2NM1A 3PHZA 2Y9FA 1DFCA 3FJ9A 4I3NA 4AN7B 5BP5C 3LLPA 3H6RB 4I4VA 3FUOA 2BEBA 3Q7YA 1AVUA 3V0BB 4QBVA 4P0LA 1NUNA 1S0FA 2HW9A 3OJ2A 3RTJB 1QQLA 1TIEA 1V6VA 2AXMA 3KMVA 4JPZA 3CA3A 2Y9GA 2DRZA 4I37A 3HSMA 2F2FC 5B2HA 3BRDA 1FN0A 3O49A 4I4QA 1W3GA 3FJDA 4JKQA 1AVAC 3NBNA 3FJKA 3R4UA 4IYBA 2D43A 2NP0A 3IM7A 1ILR1 1FQ9A 1RG8A 1TOOA 1NZKA 3N0KA 4ZFYB 1FV3A 4JKXB 9ILBA 1QQKA 4L4HA 1TWMA 3CRIA 1L2HA 1JLYA 1FV2A 2QYIB 2Y9WC 5FNWA 3AKHA 3AKGA 3A23A 2ET2A 3N7JA 2WRYA 3WMVA 4II0A 2VU9A 2KKIA 4CJMA 3O4CA 3WO2A 1M2TB 4EFRA 1TWEA 3I29B 1YXWA 1G82A 3CA0A 4LO8B 2D7RA 4OW4A 2XOAA 3ZXDA 5BXSA 4J2XA 1AVXB 4P6AA 5BXTA 4I1EA 1D0HA 2Q9XA 1Z4SA 4I4OA 4GOYA 3QYDA 3OJMA 2UUSA 3AJ6A 4ZOTA 1PUUB 3CAHA 2WBCA 4EEEB 3WO4A 4OWKA 1S0BA 1S0DA 4EKXB 2AAIB 3O4AA 1PWAA 4FVVA 3FUQA 1JLXA 4XKIA 2DREA 1JT5A 1BFBA 4ZFWB 1ISYA 2RG9B 1K5UA 3HMYA 1Q04A 1BA7A 3CU1B 3BAQA 3ZC8A 4AN6A 2NTDA 3HBWA 3NJ5A 4J2SA 4XFUA 3MALA 1DLLA 2VXTI 3N7LA 4IY8A 2IWTB 3CRGA 4I4PA 2D23A 3WINA 1G9DA 3CA6A 4QC4A 3VT1A 5BXPA 3QR5A 2HWMA 5EC5A 4IZEA 3TC2A 1BLAA 3ZXGA 3HN1A 3SNVA 4KBBA 4LO7C 4OWJA 4LO0A 5F90A 3NBCA 3PG0A 2I1BA 3ILAA 1P63A 1HWPB 4LO3C 1A8DA 3BTAA 3H6RA 4A7YA 3MPPG 5JMCA 1YF8B 2GZBA 3D7WB 2VLCA 1FWVA 4UY4A 1WD4A 1S0GA 4KEJA 4H04A 3AKFA 1TP0A 3FJEA 4IZXA 4GP0A 2RSTA 1IOBA 5DUYA 4I4UA 3PMEA 4TLPA 4LO1A 3RMXA 1I1BA 1FWUA 3VT0A 1K5VA 1RMLA 4GOVA 1IHKA 4D8HA 1Z0HA 3AJ5A 5E24E 4H9WA 2R9KB 3A07A 1FMZA 2KI4A 3NBDA 1JT4A 4ENDA 4ZA3B 1T4QA 3FJFA 1BFCA 1V6WA 1DZDA 1IJTA 2BFHA 2Z48A 3A22A 1AF9A 2D1ZA 3AH4A 1J0SA 2P23A 1II4A 3POKA 4IQPA 1ABRB 2BEAA 3P6JA 3BAHA 1ISVA 5I1BA 1JT7A 2MLLB 4QBCA 1DQOA 4ZGRB 4QD2C 1SR4C 3PUBA 1G9BA 4D0ZA 2FFUA 3OGGA 2MC2A 4L4IA 3I2AA 41BIA 1AXMA 4R6UB 5BQUA 1YBIA 1DJSB 1SZ6B 2DS0A 5FNXA 1CE7B 3P53A 4D0TA 2KI6B 4MZFB 3FJBA 3IM6A 3CQAA 4Z9WB 3ZC9A 4J23B 3FFZA 4OEFA 4X3AA 2ZR1B 2RQ9A 3BX1C 5F8YA 2MIBA 3C9ZA 4J2YA 4ZBVB 3BAVA 4KEIA 5F8SA 3RTIB 3O4DA 3CRHA 3CA4A 4A7ZA 2NYYA 3N7KA 3V79C 3BA5A 2VUAA 1EV2A 3AKIA 3VWCA 3BRGC 3VEQA 1YTOA 1V6XA 1TTUA 2VSAA 4XFTA 5BXRA 4QO3A 1RY7A 4QKSA 2K4AB 4G6JA 1GGPB 1T9FA 2E4MC 3FJAA 5GAQA 4PC4A 1ONKB 4I96A 1N4KA 4DEPA 1WBCA 5DSSB 3E8LC 1HWNB 1CVSA 3WO3A 5BOWA 1W3AA 2FDBM 3BADA 1JT3A 2L5XA 4XFSA 4ZKTB 6I1BA 1ISWA 3S8KA 3WMUA 5DVHA 1HIBA 2YUGA 4I4RA 4LO2A 4IHZA 2NZ9A 21BIA 1UPSA 3Q7WA 3S8JA 3A21A 4GAFA 1PZZA 4G9NA 3UD7A 1S0EA 3V0BA 4USPA 3IIRA 3R4SA 2HZ9A 4IY9A 2KLLA 4Q9GA 8I1BA 1VCLA 1DZCA 1V6UA 3CA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8X C;  4EFP A;  4LO0 C;  1XYF A;  4USO A;  3O4O A;  1FGA A;  1XG6 A;  7I1B A;  4LO7 B;  3LTQ A;  4WBC A;  4JQ0 A;  3RMY A;  5BP5 A;  3BA7 A;  3VSZ A;  5FZZ A;  4DCK C;  1HCE A;  2J3P A;  1R8O A;  3Q7X A;  1FMM S;  1BAR A;  3AZW A;  5HPZ A;  2GO2 A;  5FZU A;  4Q91 A;  3T8S A;  2KH2 A;  1WBA A;  4FGF A;  2P39 A;  2VSE A;  4I2S A;  2D20 A;  3RSJ A;  4LO1 C;  1I1E A;  2IHO A;  1IRP A;  4OUJ A;  2F2F A;  2M49 A;  4ISQ A;  1AFC A;  3V0A B;  3OJV A;  3HOM A;  2Y9X E;  2DRY A;  1HCD A;  4OEG A;  4P0J A;  5F8W A;  5G00 A;  5DZU A;  2LIE A;  1F31 A;  4ISR A;  3WA1 A;  1MD6 A;  3VT2 A;  2Q3N B;  3N7M A;  1SR4 A;  2FFV A;  4I4S A;  4A7K A;  1JQZ A;  4KC3 A;  4YOL A;  3F1R A;  3OGF A;  5D61 A;  4JAW A;  2FO1 A;  1IIL A;  3W9T A;  3P6I A;  4HA2 A;  1R8N A;  3AH2 A;  3BAO A;  4X38 A;  2ZQN A;  1XZZ A;  4J2K A;  4I4Y A;  3B9U A;  5FZY A;  2D24 A;  4QD2 B;  2VXR A;  1XHB A;  5EHA A;  4HR6 C;  3FGM A;  3FJC A;  2Z49 A;  3O3Q A;  4I8M A;  3O5W B;  4JRA A;  1DQG A;  3FJI A;  5BQU C;  1IRA X;  4G1R A;  3JRR A;  3O44 A;  2D22 A;  1JTC A;  2X2S A;  3UJ4 A;  1PC8 B;  3K1X A;  3UDA A;  4I4X A;  4I1B A;  1AVW B;  2NVH A;  4P0K A;  1JY0 A;  1S0C A;  4HJJ A;  2X2T A;  2HWA A;  3FJ8 A;  3HAL A;  5EG6 C;  4I0Y A;  1BFF A;  2LIQ A;  1HKN A;  2ZQO A;  3CA1 A;  3IAG C;  1W3F A;  3UD8 A;  4ZFU B;  1M16 A;  1MC9 A;  1OQL B;  1ISZ A;  3I2X A;  2FGF A;  4DEN A;  1KNM A;  3NBE A;  4G9M A;  2K8R A;  3JUT A;  1Z2V A;  5JLV A;  4KEK A;  2K43 A;  2E4M A;  1EVT A;  1PUM B;  4OEE A;  4EFQ A;  3AH1 A;  3EF2 A;  5D63 A;  2AFG A;  1QXM A;  4X39 A;  1E0O A;  1WD3 A;  3BAU A;  4G6M A;  3VUO A;  3H6S E;  1EPW A;  1DIW A;  31BI A;  4F83 A;  2QN4 A;  1G9A A;  2D44 A;  1BAS A;  4ION A;  3F62 B;  1BLD A;  1Q03 A;  4OWL A;  4LO3 A;  5D62 A;  1S0L A;  1DFQ A;  3WIN C;  2AQZ A;  4ZLB B;  3OBT A;  4GP3 A;  4I7I A;  4EB2 B;  1HWM B;  1HWO B;  3BRF A;  3IM5 A;  3H6Q A;  4QAL A;  4Q9P A;  3BA4 A;  3VSF A;  1RZO B;  3BB2 A;  4X37 A;  3UD9 A;  3OBR A;  3FJH A;  4F34 A;  3AZV A;  4GAI A;  4LO2 C;  3BAG A;  3FJJ A;  4Z8S B;  1ITB A;  4I6I A;  1IT0 A;  1TFM B;  1Q1U A;  3UJ0 A;  1YYN A;  5BVP I;  3V0A A;  3O4B A;  2ESU A;  1EYL A;  1G9C A;  2D7I A;  2ERM A;  3ZX7 A;  1BFG A;  1ISX A;  4QKR A;  4JP0 A;  2NM1 A;  3PHZ A;  2Y9F A;  1DFC A;  3FJ9 A;  4I3N A;  4AN7 B;  5BP5 C;  3LLP A;  3H6R B;  4I4V A;  3FUO A;  2BEB A;  3Q7Y A;  1AVU A;  3V0B B;  4QBV A;  4P0L A;  1NUN A;  1S0F A;  2HW9 A;  3OJ2 A;  3RTJ B;  1QQL A;  1TIE A;  1V6V A;  2AXM A;  3KMV A;  4JPZ A;  3CA3 A;  2Y9G A;  2DRZ A;  4I37 A;  3HSM A;  2F2F C;  5B2H A;  3BRD A;  1FN0 A;  3O49 A;  4I4Q A;  1W3G A;  3FJD A;  4JKQ A;  1AVA C;  3NBN A;  3FJK A;  3R4U A;  4IYB A;  2D43 A;  2NP0 A;  3IM7 A;  1ILR 1;  1FQ9 A;  1RG8 A;  1TOO A;  1NZK A;  3N0K A;  4ZFY B;  1FV3 A;  4JKX B;  9ILB A;  1QQK A;  4L4H A;  1TWM A;  3CRI A;  1L2H A;  1JLY A;  1FV2 A;  2QYI B;  2Y9W C;  5FNW A;  3AKH A;  3AKG A;  3A23 A;  2ET2 A;  3N7J A;  2WRY A;  3WMV A;  4II0 A;  2VU9 A;  2KKI A;  4CJM A;  3O4C A;  3WO2 A;  1M2T B;  4EFR A;  1TWE A;  3I29 B;  1YXW A;  1G82 A;  3CA0 A;  4LO8 B;  2D7R A;  4OW4 A;  2XOA A;  3ZXD A;  5BXS A;  4J2X A;  1AVX B;  4P6A A;  5BXT A;  4I1E A;  1D0H A;  2Q9X A;  1Z4S A;  4I4O A;  4GOY A;  3QYD A;  3OJM A;  2UUS A;  3AJ6 A;  4ZOT A;  1PUU B;  3CAH A;  2WBC A;  4EEE B;  3WO4 A;  4OWK A;  1S0B A;  1S0D A;  4EKX B;  2AAI B;  3O4A A;  1PWA A;  4FVV A;  3FUQ A;  1JLX A;  4XKI A;  2DRE A;  1JT5 A;  1BFB A;  4ZFW B;  1ISY A;  2RG9 B;  1K5U A;  3HMY A;  1Q04 A;  1BA7 A;  3CU1 B;  3BAQ A;  3ZC8 A;  4AN6 A;  2NTD A;  3HBW A;  3NJ5 A;  4J2S A;  4XFU A;  3MAL A;  1DLL A;  2VXT I;  3N7L A;  4IY8 A;  2IWT B;  3CRG A;  4I4P A;  2D23 A;  3WIN A;  1G9D A;  3CA6 A;  4QC4 A;  3VT1 A;  5BXP A;  3QR5 A;  2HWM A;  5EC5 A;  4IZE A;  3TC2 A;  1BLA A;  3ZXG A;  3HN1 A;  3SNV A;  4KBB A;  4LO7 C;  4OWJ A;  4LO0 A;  5F90 A;  3NBC A;  3PG0 A;  2I1B A;  3ILA A;  1P63 A;  1HWP B;  4LO3 C;  1A8D A;  3BTA A;  3H6R A;  4A7Y A;  3MPP G;  5JMC A;  1YF8 B;  2GZB A;  3D7W B;  2VLC A;  1FWV A;  1WD4 A;  1S0G A;  4KEJ A;  4H04 A;  3AKF A;  1TP0 A;  3FJE A;  4IZX A;  4GP0 A;  2RST A;  1IOB A;  5DUY A;  4I4U A;  3PME A;  4TLP A;  4LO1 A;  3RMX A;  1I1B A;  1FWU A;  3VT0 A;  1K5V A;  1RML A;  4GOV A;  1IHK A;  4D8H A;  1Z0H A;  3AJ5 A;  5E24 E;  4H9W A;  2R9K B;  3A07 A;  1FMZ A;  2KI4 A;  3NBD A;  1JT4 A;  4END A;  4ZA3 B;  1T4Q A;  3FJF A;  1BFC A;  1V6W A;  1DZD A;  1IJT A;  2BFH A;  2Z48 A;  3A22 A;  1AF9 A;  2D1Z A;  3AH4 A;  1J0S A;  2P23 A;  1II4 A;  3POK A;  4IQP A;  1ABR B;  2BEA A;  3P6J A;  3BAH A;  1ISV A;  5I1B A;  1JT7 A;  2MLL B;  4QBC A;  1DQO A;  4ZGR B;  4QD2 C;  1SR4 C;  3PUB A;  1G9B A;  4D0Z A;  2FFU A;  3OGG A;  2MC2 A;  4L4I A;  3I2A A;  41BI A;  1AXM A;  4R6U B;  5BQU A;  1YBI A;  1DJS B;  1SZ6 B;  2DS0 A;  5FNX A;  1CE7 B;  3P53 A;  4D0T A;  2KI6 B;  3FJB A;  3IM6 A;  3CQA A;  4Z9W B;  3ZC9 A;  4J23 B;  3FFZ A;  4OEF A;  4X3A A;  2ZR1 B;  2RQ9 A;  3BX1 C;  5F8Y A;  2MIB A;  3C9Z A;  4J2Y A;  4ZBV B;  3BAV A;  4KEI A;  5F8S A;  3RTI B;  3O4D A;  3CRH A;  3CA4 A;  4A7Z A;  2NYY A;  3N7K A;  3V79 C;  3BA5 A;  2VUA A;  1EV2 A;  3AKI A;  3VWC A;  3BRG C;  3VEQ A;  1YTO A;  1V6X A;  1TTU A;  2VSA A;  4XFT A;  5BXR A;  4QO3 A;  1RY7 A;  4QKS A;  2K4A B;  4G6J A;  1GGP B;  1T9F A;  2E4M C;  3FJA A;  5GAQ A;  4PC4 A;  1ONK B;  4I96 A;  1N4K A;  4DEP A;  1WBC A;  5DSS B;  3E8L C;  1HWN B;  1CVS A;  3WO3 A;  5BOW A;  1W3A A;  2FDB M;  3BAD A;  1JT3 A;  2L5X A;  4XFS A;  4ZKT B;  6I1B A;  1ISW A;  3S8K A;  3WMU A;  5DVH A;  1HIB A;  2YUG A;  4I4R A;  4LO2 A;  4IHZ A;  2NZ9 A;  21BI A;  1UPS A;  3Q7W A;  3S8J A;  3A21 A;  4GAF A;  1PZZ A;  4G9N A;  3UD7 A;  1S0E A;  3V0B A;  4USP A;  3IIR A;  3R4S A;  2HZ9 A;  4IY9 A;  2KLL A;  4Q9G A;  8I1B A;  1VCL A;  1DZC A;  1V6U A;  3CA5 A; 
#chains in the Genus database with same CATH topology
 2F8X C;  4EFP A;  4LO0 C;  1XYF A;  4USO A;  3O4O A;  1FGA A;  1XG6 A;  7I1B A;  4LO7 B;  3LTQ A;  4WBC A;  4JQ0 A;  3RMY A;  5BP5 A;  3BA7 A;  3VSZ A;  5FZZ A;  4DCK C;  1HCE A;  2J3P A;  1R8O A;  3Q7X A;  1FMM S;  1BAR A;  3AZW A;  5HPZ A;  2GO2 A;  5FZU A;  4Q91 A;  3T8S A;  2KH2 A;  1WBA A;  4MZH A;  4FGF A;  2P39 A;  2VSE A;  4I2S A;  2D20 A;  3RSJ A;  4LO1 C;  1I1E A;  2IHO A;  1IRP A;  4OUJ A;  2F2F A;  2M49 A;  4ISQ A;  1AFC A;  3V0A B;  3OJV A;  3HOM A;  2Y9X E;  2DRY A;  1HCD A;  4OEG A;  4P0J A;  5F8W A;  5G00 A;  5DZU A;  2LIE A;  1F31 A;  4ISR A;  3WA1 A;  1MD6 A;  3VT2 A;  2Q3N B;  3N7M A;  4MZG B;  1SR4 A;  2FFV A;  4I4S A;  4A7K A;  1JQZ A;  4KC3 A;  4YOL A;  3F1R A;  3OGF A;  5D61 A;  4JAW A;  2FO1 A;  1IIL A;  3W9T A;  3P6I A;  4HA2 A;  1R8N A;  3AH2 A;  3BAO A;  4X38 A;  2ZQN A;  1XZZ A;  4J2K A;  4I4Y A;  3B9U A;  5FZY A;  2D24 A;  4QD2 B;  2VXR A;  1XHB A;  5EHA A;  4HR6 C;  3FGM A;  3FJC A;  2Z49 A;  3O3Q A;  4I8M A;  3O5W B;  4JRA A;  1DQG A;  3FJI A;  5BQU C;  1IRA X;  4G1R A;  3JRR A;  3O44 A;  2D22 A;  1JTC A;  2X2S A;  3UJ4 A;  1PC8 B;  3K1X A;  3UDA A;  4I4X A;  4I1B A;  1AVW B;  2NVH A;  4P0K A;  1JY0 A;  1S0C A;  4HJJ A;  2X2T A;  2HWA A;  3FJ8 A;  3HAL A;  5EG6 C;  4I0Y A;  1BFF A;  2LIQ A;  1HKN A;  2ZQO A;  3CA1 A;  3IAG C;  1W3F A;  3UD8 A;  4ZFU B;  1M16 A;  1MC9 A;  1OQL B;  1ISZ A;  3I2X A;  2FGF A;  4DEN A;  1KNM A;  3NBE A;  4G9M A;  2K8R A;  3JUT A;  1Z2V A;  5JLV A;  4KEK A;  2K43 A;  2E4M A;  1EVT A;  1PUM B;  4OEE A;  4EFQ A;  3AH1 A;  3EF2 A;  5D63 A;  2AFG A;  1QXM A;  4X39 A;  1E0O A;  1WD3 A;  3BAU A;  4G6M A;  3VUO A;  3H6S E;  1EPW A;  1DIW A;  31BI A;  4F83 A;  2QN4 A;  1G9A A;  2D44 A;  1BAS A;  4ION A;  3F62 B;  1BLD A;  1Q03 A;  4OWL A;  4LO3 A;  5D62 A;  1S0L A;  1DFQ A;  3WIN C;  2AQZ A;  4ZLB B;  3OBT A;  4GP3 A;  4I7I A;  4EB2 B;  1HWM B;  1HWO B;  3BRF A;  3IM5 A;  3H6Q A;  4QAL A;  4Q9P A;  3BA4 A;  3VSF A;  1RZO B;  3BB2 A;  4X37 A;  3UD9 A;  4H75 A;  3OBR A;  3FJH A;  4F34 A;  3AZV A;  4GAI A;  4LO2 C;  3BAG A;  3FJJ A;  4Z8S B;  1ITB A;  4I6I A;  1IT0 A;  1TFM B;  1Q1U A;  3UJ0 A;  1YYN A;  5BVP I;  3V0A A;  3O4B A;  2ESU A;  2NS2 A;  1EYL A;  1G9C A;  2D7I A;  2ERM A;  3ZX7 A;  1BFG A;  1ISX A;  4QKR A;  4JP0 A;  2NM1 A;  3PHZ A;  2Y9F A;  1DFC A;  3FJ9 A;  4I3N A;  4AN7 B;  5BP5 C;  3LLP A;  3H6R B;  4I4V A;  3FUO A;  2BEB A;  3Q7Y A;  1AVU A;  3V0B B;  4QBV A;  4P0L A;  1NUN A;  1S0F A;  2HW9 A;  3OJ2 A;  3RTJ B;  1QQL A;  1TIE A;  1V6V A;  2AXM A;  3KMV A;  4JPZ A;  3CA3 A;  2Y9G A;  2DRZ A;  4I37 A;  3HSM A;  2F2F C;  5B2H A;  3BRD A;  1FN0 A;  3O49 A;  4I4Q A;  1W3G A;  3FJD A;  4JKQ A;  1AVA C;  3NBN A;  3FJK A;  3R4U A;  4IYB A;  2D43 A;  2NP0 A;  3IM7 A;  1ILR 1;  1FQ9 A;  1RG8 A;  1TOO A;  1NZK A;  3N0K A;  4ZFY B;  1FV3 A;  4JKX B;  9ILB A;  1QQK A;  4L4H A;  1TWM A;  3CRI A;  1L2H A;  1JLY A;  1FV2 A;  2QYI B;  2Y9W C;  5FNW A;  3AKH A;  3AKG A;  3A23 A;  2ET2 A;  3N7J A;  2WRY A;  3WMV A;  4II0 A;  2VU9 A;  2KKI A;  4CJM A;  3O4C A;  3WO2 A;  1M2T B;  4EFR A;  1TWE A;  3I29 B;  1YXW A;  1G82 A;  3CA0 A;  4LO8 B;  2D7R A;  4OW4 A;  2XOA A;  3ZXD A;  5BXS A;  4J2X A;  1AVX B;  4P6A A;  5BXT A;  4I1E A;  1D0H A;  2Q9X A;  1Z4S A;  4I4O A;  4GOY A;  3QYD A;  3OJM A;  2UUS A;  3AJ6 A;  4ZOT A;  1PUU B;  3CAH A;  2WBC A;  4EEE B;  3WO4 A;  4OWK A;  1S0B A;  1S0D A;  4EKX B;  2AAI B;  3O4A A;  1PWA A;  4FVV A;  3FUQ A;  1JLX A;  4XKI A;  2DRE A;  1JT5 A;  1BFB A;  4ZFW B;  1ISY A;  2RG9 B;  1K5U A;  3HMY A;  1Q04 A;  1BA7 A;  3CU1 B;  3BAQ A;  3ZC8 A;  4AN6 A;  2NTD A;  3HBW A;  3NJ5 A;  4J2S A;  4XFU A;  3MAL A;  1DLL A;  2VXT I;  3N7L A;  4IY8 A;  2IWT B;  3CRG A;  4I4P A;  2D23 A;  3WIN A;  1G9D A;  3CA6 A;  4QC4 A;  3VT1 A;  5BXP A;  3QR5 A;  2HWM A;  5EC5 A;  4IZE A;  3TC2 A;  1BLA A;  3ZXG A;  3HN1 A;  3SNV A;  4KBB A;  4LO7 C;  4OWJ A;  4LO0 A;  5F90 A;  3NBC A;  3PG0 A;  2I1B A;  3ILA A;  1P63 A;  1HWP B;  4LO3 C;  1A8D A;  3BTA A;  3H6R A;  4A7Y A;  3MPP G;  5JMC A;  1YF8 B;  2GZB A;  3D7W B;  2VLC A;  1FWV A;  4UY4 A;  1WD4 A;  1S0G A;  4KEJ A;  4H04 A;  3AKF A;  1TP0 A;  3FJE A;  4IZX A;  4GP0 A;  2RST A;  1IOB A;  5DUY A;  4I4U A;  3PME A;  4TLP A;  4LO1 A;  3RMX A;  1I1B A;  1FWU A;  3VT0 A;  1K5V A;  1RML A;  4GOV A;  1IHK A;  4D8H A;  1Z0H A;  3AJ5 A;  5E24 E;  4H9W A;  2R9K B;  3A07 A;  1FMZ A;  2KI4 A;  3NBD A;  1JT4 A;  4END A;  4ZA3 B;  1T4Q A;  3FJF A;  1BFC A;  1V6W A;  1DZD A;  1IJT A;  2BFH A;  2Z48 A;  3A22 A;  1AF9 A;  2D1Z A;  3AH4 A;  1J0S A;  2P23 A;  1II4 A;  3POK A;  4IQP A;  1ABR B;  2BEA A;  3P6J A;  3BAH A;  1ISV A;  5I1B A;  1JT7 A;  2MLL B;  4QBC A;  1DQO A;  4ZGR B;  4QD2 C;  1SR4 C;  3PUB A;  1G9B A;  4D0Z A;  2FFU A;  3OGG A;  2MC2 A;  4L4I A;  3I2A A;  41BI A;  1AXM A;  4R6U B;  5BQU A;  1YBI A;  1DJS B;  1SZ6 B;  2DS0 A;  5FNX A;  1CE7 B;  3P53 A;  4D0T A;  2KI6 B;  4MZF B;  3FJB A;  3IM6 A;  3CQA A;  4Z9W B;  3ZC9 A;  4J23 B;  3FFZ A;  4OEF A;  4X3A A;  2ZR1 B;  2RQ9 A;  3BX1 C;  5F8Y A;  2MIB A;  3C9Z A;  4J2Y A;  4ZBV B;  3BAV A;  4KEI A;  5F8S A;  3RTI B;  3O4D A;  3CRH A;  3CA4 A;  4A7Z A;  2NYY A;  3N7K A;  3V79 C;  3BA5 A;  2VUA A;  1EV2 A;  3AKI A;  3VWC A;  3BRG C;  3VEQ A;  1YTO A;  1V6X A;  1TTU A;  2VSA A;  4XFT A;  5BXR A;  4QO3 A;  1RY7 A;  4QKS A;  2K4A B;  4G6J A;  1GGP B;  1T9F A;  2E4M C;  3FJA A;  5GAQ A;  4PC4 A;  1ONK B;  4I96 A;  1N4K A;  4DEP A;  1WBC A;  5DSS B;  3E8L C;  1HWN B;  1CVS A;  3WO3 A;  5BOW A;  1W3A A;  2FDB M;  3BAD A;  1JT3 A;  2L5X A;  4XFS A;  4ZKT B;  6I1B A;  1ISW A;  3S8K A;  3WMU A;  5DVH A;  1HIB A;  2YUG A;  4I4R A;  4LO2 A;  4IHZ A;  2NZ9 A;  21BI A;  1UPS A;  3Q7W A;  3S8J A;  3A21 A;  4GAF A;  1PZZ A;  4G9N A;  3UD7 A;  1S0E A;  3V0B A;  4USP A;  3IIR A;  3R4S A;  2HZ9 A;  4IY9 A;  2KLL A;  4Q9G A;  8I1B A;  1VCL A;  1DZC A;  1V6U A;  3CA5 A; 
#chains in the Genus database with same CATH homology
 2F8X C;  4EFP A;  4LO0 C;  1XYF A;  4USO A;  3O4O A;  1FGA A;  1XG6 A;  7I1B A;  4LO7 B;  3LTQ A;  4WBC A;  4JQ0 A;  3RMY A;  5BP5 A;  3BA7 A;  3VSZ A;  5FZZ A;  4DCK C;  1HCE A;  2J3P A;  1R8O A;  3Q7X A;  1FMM S;  1BAR A;  3AZW A;  5HPZ A;  2GO2 A;  5FZU A;  4Q91 A;  3T8S A;  2KH2 A;  1WBA A;  4MZH A;  4FGF A;  2P39 A;  2VSE A;  4I2S A;  2D20 A;  3RSJ A;  4LO1 C;  1I1E A;  2IHO A;  1IRP A;  4OUJ A;  2F2F A;  2M49 A;  4ISQ A;  1AFC A;  3V0A B;  3OJV A;  3HOM A;  2Y9X E;  2DRY A;  1HCD A;  4OEG A;  4P0J A;  5F8W A;  5G00 A;  5DZU A;  2LIE A;  1F31 A;  4ISR A;  3WA1 A;  1MD6 A;  3VT2 A;  2Q3N B;  3N7M A;  4MZG B;  1SR4 A;  2FFV A;  4I4S A;  4A7K A;  1JQZ A;  4KC3 A;  4YOL A;  3F1R A;  3OGF A;  5D61 A;  4JAW A;  2FO1 A;  1IIL A;  3W9T A;  3P6I A;  4HA2 A;  1R8N A;  3AH2 A;  3BAO A;  4X38 A;  2ZQN A;  1XZZ A;  4J2K A;  4I4Y A;  3B9U A;  5FZY A;  2D24 A;  4QD2 B;  2VXR A;  1XHB A;  5EHA A;  4HR6 C;  3FGM A;  3FJC A;  2Z49 A;  3O3Q A;  4I8M A;  3O5W B;  4JRA A;  1DQG A;  3FJI A;  5BQU C;  1IRA X;  4G1R A;  3JRR A;  3O44 A;  2D22 A;  1JTC A;  2X2S A;  3UJ4 A;  1PC8 B;  3K1X A;  3UDA A;  4I4X A;  4I1B A;  1AVW B;  2NVH A;  4P0K A;  1JY0 A;  1S0C A;  4HJJ A;  2X2T A;  2HWA A;  3FJ8 A;  3HAL A;  5EG6 C;  4I0Y A;  1BFF A;  2LIQ A;  1HKN A;  2ZQO A;  3CA1 A;  3IAG C;  1W3F A;  3UD8 A;  4ZFU B;  1M16 A;  1MC9 A;  1OQL B;  1ISZ A;  3I2X A;  2FGF A;  4DEN A;  1KNM A;  3NBE A;  4G9M A;  2K8R A;  3JUT A;  1Z2V A;  5JLV A;  4KEK A;  2K43 A;  2E4M A;  1EVT A;  1PUM B;  4OEE A;  4EFQ A;  3AH1 A;  3EF2 A;  5D63 A;  2AFG A;  1QXM A;  4X39 A;  1E0O A;  1WD3 A;  3BAU A;  4G6M A;  3VUO A;  3H6S E;  1EPW A;  1DIW A;  31BI A;  4F83 A;  2QN4 A;  1G9A A;  2D44 A;  1BAS A;  4ION A;  3F62 B;  1BLD A;  1Q03 A;  4OWL A;  4LO3 A;  5D62 A;  1S0L A;  1DFQ A;  3WIN C;  2AQZ A;  4ZLB B;  3OBT A;  4GP3 A;  4I7I A;  4EB2 B;  1HWM B;  1HWO B;  3BRF A;  3IM5 A;  3H6Q A;  4QAL A;  4Q9P A;  3BA4 A;  3VSF A;  1RZO B;  3BB2 A;  4X37 A;  3UD9 A;  4H75 A;  3OBR A;  3FJH A;  4F34 A;  3AZV A;  4GAI A;  4LO2 C;  3BAG A;  3FJJ A;  4Z8S B;  1ITB A;  4I6I A;  1IT0 A;  1TFM B;  1Q1U A;  3UJ0 A;  1YYN A;  5BVP I;  3V0A A;  3O4B A;  2ESU A;  2NS2 A;  1EYL A;  1G9C A;  2D7I A;  2ERM A;  3ZX7 A;  1BFG A;  1ISX A;  4QKR A;  4JP0 A;  2NM1 A;  3PHZ A;  2Y9F A;  1DFC A;  3FJ9 A;  4I3N A;  4AN7 B;  5BP5 C;  3LLP A;  3H6R B;  4I4V A;  3FUO A;  2BEB A;  3Q7Y A;  1AVU A;  3V0B B;  4QBV A;  4P0L A;  1NUN A;  1S0F A;  2HW9 A;  3OJ2 A;  3RTJ B;  1QQL A;  1TIE A;  1V6V A;  2AXM A;  3KMV A;  4JPZ A;  3CA3 A;  2Y9G A;  2DRZ A;  4I37 A;  3HSM A;  2F2F C;  5B2H A;  3BRD A;  1FN0 A;  3O49 A;  4I4Q A;  1W3G A;  3FJD A;  4JKQ A;  1AVA C;  3NBN A;  3FJK A;  3R4U A;  4IYB A;  2D43 A;  2NP0 A;  3IM7 A;  1ILR 1;  1FQ9 A;  1RG8 A;  1TOO A;  1NZK A;  3N0K A;  4ZFY B;  1FV3 A;  4JKX B;  9ILB A;  1QQK A;  4L4H A;  1TWM A;  3CRI A;  1L2H A;  1JLY A;  1FV2 A;  2QYI B;  2Y9W C;  5FNW A;  3AKH A;  3AKG A;  3A23 A;  2ET2 A;  3N7J A;  2WRY A;  3WMV A;  4II0 A;  2VU9 A;  2KKI A;  4CJM A;  3O4C A;  3WO2 A;  1M2T B;  4EFR A;  1TWE A;  3I29 B;  1YXW A;  1G82 A;  3CA0 A;  4LO8 B;  2D7R A;  4OW4 A;  2XOA A;  3ZXD A;  5BXS A;  4J2X A;  1AVX B;  4P6A A;  5BXT A;  4I1E A;  1D0H A;  2Q9X A;  1Z4S A;  4I4O A;  4GOY A;  3QYD A;  3OJM A;  2UUS A;  3AJ6 A;  4ZOT A;  1PUU B;  3CAH A;  2WBC A;  4EEE B;  3WO4 A;  4OWK A;  1S0B A;  1S0D A;  4EKX B;  2AAI B;  3O4A A;  1PWA A;  4FVV A;  3FUQ A;  1JLX A;  4XKI A;  2DRE A;  1JT5 A;  1BFB A;  4ZFW B;  1ISY A;  2RG9 B;  1K5U A;  3HMY A;  1Q04 A;  1BA7 A;  3CU1 B;  3BAQ A;  3ZC8 A;  4AN6 A;  2NTD A;  3HBW A;  3NJ5 A;  4J2S A;  4XFU A;  3MAL A;  1DLL A;  2VXT I;  3N7L A;  4IY8 A;  2IWT B;  3CRG A;  4I4P A;  2D23 A;  3WIN A;  1G9D A;  3CA6 A;  4QC4 A;  3VT1 A;  5BXP A;  3QR5 A;  2HWM A;  5EC5 A;  4IZE A;  3TC2 A;  1BLA A;  3ZXG A;  3HN1 A;  3SNV A;  4KBB A;  4LO7 C;  4OWJ A;  4LO0 A;  5F90 A;  3NBC A;  3PG0 A;  2I1B A;  3ILA A;  1P63 A;  1HWP B;  4LO3 C;  1A8D A;  3BTA A;  3H6R A;  4A7Y A;  3MPP G;  5JMC A;  1YF8 B;  2GZB A;  3D7W B;  2VLC A;  1FWV A;  4UY4 A;  1WD4 A;  1S0G A;  4KEJ A;  4H04 A;  3AKF A;  1TP0 A;  3FJE A;  4IZX A;  4GP0 A;  2RST A;  1IOB A;  5DUY A;  4I4U A;  3PME A;  4TLP A;  4LO1 A;  3RMX A;  1I1B A;  1FWU A;  3VT0 A;  1K5V A;  1RML A;  4GOV A;  1IHK A;  4D8H A;  1Z0H A;  3AJ5 A;  5E24 E;  4H9W A;  2R9K B;  3A07 A;  1FMZ A;  2KI4 A;  3NBD A;  1JT4 A;  4END A;  4ZA3 B;  1T4Q A;  3FJF A;  1BFC A;  1V6W A;  1DZD A;  1IJT A;  2BFH A;  2Z48 A;  3A22 A;  1AF9 A;  2D1Z A;  3AH4 A;  1J0S A;  2P23 A;  1II4 A;  3POK A;  4IQP A;  1ABR B;  2BEA A;  3P6J A;  3BAH A;  1ISV A;  5I1B A;  1JT7 A;  2MLL B;  4QBC A;  1DQO A;  4ZGR B;  4QD2 C;  1SR4 C;  3PUB A;  1G9B A;  4D0Z A;  2FFU A;  3OGG A;  2MC2 A;  4L4I A;  3I2A A;  41BI A;  1AXM A;  4R6U B;  5BQU A;  1YBI A;  1DJS B;  1SZ6 B;  2DS0 A;  5FNX A;  1CE7 B;  3P53 A;  4D0T A;  2KI6 B;  4MZF B;  3FJB A;  3IM6 A;  3CQA A;  4Z9W B;  3ZC9 A;  4J23 B;  3FFZ A;  4OEF A;  4X3A A;  2ZR1 B;  2RQ9 A;  3BX1 C;  5F8Y A;  2MIB A;  3C9Z A;  4J2Y A;  4ZBV B;  3BAV A;  4KEI A;  5F8S A;  3RTI B;  3O4D A;  3CRH A;  3CA4 A;  4A7Z A;  2NYY A;  3N7K A;  3V79 C;  3BA5 A;  2VUA A;  1EV2 A;  3AKI A;  3VWC A;  3BRG C;  3VEQ A;  1YTO A;  1V6X A;  1TTU A;  2VSA A;  4XFT A;  5BXR A;  4QO3 A;  1RY7 A;  4QKS A;  2K4A B;  4G6J A;  1GGP B;  1T9F A;  2E4M C;  3FJA A;  5GAQ A;  4PC4 A;  1ONK B;  4I96 A;  1N4K A;  4DEP A;  1WBC A;  5DSS B;  3E8L C;  1HWN B;  1CVS A;  3WO3 A;  5BOW A;  1W3A A;  2FDB M;  3BAD A;  1JT3 A;  2L5X A;  4XFS A;  4ZKT B;  6I1B A;  1ISW A;  3S8K A;  3WMU A;  5DVH A;  1HIB A;  2YUG A;  4I4R A;  4LO2 A;  4IHZ A;  2NZ9 A;  21BI A;  1UPS A;  3Q7W A;  3S8J A;  3A21 A;  4GAF A;  1PZZ A;  4G9N A;  3UD7 A;  1S0E A;  3V0B A;  4USP A;  3IIR A;  3R4S A;  2HZ9 A;  4IY9 A;  2KLL A;  4Q9G A;  8I1B A;  1VCL A;  1DZC A;  1V6U A;  3CA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...