1EVYA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A potential target enzyme for trypanocidal drugs revealed by the crystal structure of NAD-dependent glycerol-3-phosphate dehydrogenase from Leishmania mexicana.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
molecule keywords GLYCEROL-3-PHOSPHATE DEHYDROGENASE
total genus 131
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2000-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1evyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evyA01
4GKBA 4CLHA 5B4UA 3SX2A 3EAGA 3HB4X 5FF9A 1H2HA 2YV2A 4JBHA 4C4OA 4IZHA 1A4UA 1EVZA 1MXFA 4INAA 3WJ7A 4XDZA 3Q3CA 3GPDG 3MJCA 4YVFA 3KYCA 2A35A 1HTBA 5CDUA 3WTBA 1D1SA 4Q39A 4DYDA 2VNSA 2IZ0A 3E9QA 3COSA 4M54A 3KEQA 1YWGO 2Z5LA 3PI7A 3U4IA 4RPLA 2O2SA 3HDHA 1ZNQO 1CRWG 4CMGA 2Q1SA 4DREA 1O8CA 3R6DA 1PJ3A 4MP3A 2NUAA 4D0SA 3KSUA 5COAA 1OAAA 2ZTLA 4E21A 4R1TA 1ZFNA 5JFOA 4WLNA 1ZK3A 3DQPA 4AVYA 2FZEA 2EXXA 3VZQA 3WJAA 3N7UA 1H94A 1T2EA 4M8SA 4Q3BA 1I3MA 2C5AA 3HDJA 1VC2A 1FDTA 4IDAA 3GT0A 2ILTA 4OYRA 5F1KA 1QRRA 4PRLA 1HYEA 2I65A 4YACA 4P22A 3A9WA 1NBOA 1T2DA 4QFDA 1EVYA 3BMCB 4J7XA 1XQ6A 1ZK4A 2PY6A 3IJPA 2BFPA 2PKQP 1R4NA 3HDYA 3HQ4O 4A73A 2VZ9A 3HDQA 1JU9A 1P3DA 1AHIA 5U1PA 4BO2A 3WBBA 2PFGA 4CM9A 1DC3A 3DHYA 5JDIC 4ROSA 3GGOA 1XELA 5KVSA 1DEHA 1V3VA 2A9FA 3PLNA 4BMVA 4JP2A 3E5MA 5JDCC 3IAHA 3VHRA 2FP4A 2GF2A 2ZTUA 3RJ9A 1TT5B 4XIJA 4OQYA 1JTVA 5F5NA 3WQSB 1GQ2A 4IIUA 1YS4A 3F4BA 4IMPA 2YQ4A 1YL7A 5DBFA 4YYZA 4R54A 1EK5A 1UZMA 2H63A 4UVIA 1GDHA 4F3YA 5L4LA 4HADA 2PNFA 4R68A 5C7IO 2NVBA 1KVUA 1B3BA 3D4PA 1DB3A 4AJPA 3GZNB 3LT4A 4LMRA 1YOVB 3KSZO 4RQUA 4XQGA 2P9GA 1H9BA 3WQQA 5DNAA 2VZ8A 4WGGA 2BGLA 1IUKA 2BLLA 3MJTA 4CQLA 1UXGA 2FHSA 1LU9A 2HO5A 4MKXA 1HT0A 4IJKA 4W9NA 4CMEA 1ARZA 2GZ2A 1KERA 3AY6A 3GUYA 4IQ0A 4FFLA 2B69A 1A9YA 3QV1A 4IDCA 5KKAA 3RASA 3RC2A 1Q0HA 3AUSA 1MGOA 4E13A 2D0IA 4NMHA 3GR6A 4Y67A 2J5KA 2Q2VA 4PG4A 3TF5A 4XYGA 2GZ3A 3NJ8A 2VUTA 4PLPA 4B3HA 4IXWA 4RF3A 4U8GA 4WNIA 4J0FA 4F46A 3PYXA 3ZV4A 2PZMA 3ETEA 3LLVA 3GVHA 4DQUA 1IHYA 2DBRA 2JD0A 1VI2A 4LCJA 1MG0A 3ONDA 1SCUA 4PZEA 2Y0DA 1M67A 3LC7O 4D41A 4NFYA 3SC4A 1PJ4A 3G3EA 5JLAA 2FWMX 1ZKMA 2ZKLA 3Q9NA 2C2XA 2Y1EA 3H3FA 3FPLA 3KLMX 4KQXA 1DC5A 2GLXA 1SPXA 4BO6A 4M1QA 4B7CA 3SEFA 1F8FA 5A5EA 1QR6A 3RUHA 4J2OA 3VDQA 3D64A 3T7EA 3GOHA 4ITUA 1R66A 4PLWA 4JQCA 4AJ2A 1AUPA 1C1DA 2BFMA 3NGXA 4PLHA 6LDHA 3D1LA 2E82A 1C1XA 3RFVA 1YONA 4MPDA 2B83A 2J6IA 3R1IA 2BHLA 3R3JA 3NDIA 5LC1A 1JAXA 1UXHA 1KVTA 5H81A 5KTKA 2O48X 3OECA 3TSCA 4CV2A 4OHUA 3ENNA 4R41A 1KEPA 2Q50A 3JYPA 1PEDA 1PWXA 2GPTA 3TWOA 3V1UA 5ITWA 3EYWA 5EMHA 5THKA 5TT1A 3JQFC 5EL0A 4J7CA 1ENPA 1Y5RA 2Y93A 5JY1A 2SCUA 3WGHA 2OFPA 4J4TA 1B16A 2PD3A 3R0IA 1IZ9A 3EZYA 1H5QA 1U4SA 4QEDA 4NBRA 4QO8A 3W4KA 4U6SA 1NR7A 4GI2A 5G0TA 5BNIA 3RAJA 5LCXA 1VKNA 3O26A 1ONOA 1NPDA 1C14A 1DJNA 2GN9A 2YY7A 1MA0A 1BMDA 3JD2A 4MVJA 5EINA 1SBYA 1P1HA 1Q0QA 1J4AA 4OIMA 1C0IA 3LC2O 5B12A 3NTQA 2Q4EA 1I01A 4GX2A 2I76A 2QHXA 1RM5A 4IQ8A 1GZ6A 4KOAA 4XYEA 3TOXA 1WPQA 1XWFA 1XLTA 2DQ4A 3H65A 2I6TA 1BTOA 1I8TA 4KTTE 1KOLA 1ORRA 4WASA 1A27A 5DP1A 4R1SA 4ALKA 2AQHA 1WNTA 5KVQA 5BR7A 4Q3DA 1LNQA 4IDDA 3PYLA 4E33A 1PGPA 1B14A 1NM5A 2B36A 3TPCA 4IS3A 3QSGA 4ND1A 4XRGA 1DIRA 3KLPX 3R3SA 3FWNA 4D3SA 1AN9A 2OO5A 5JMWA 4RV9A 4FFNA 3H9UA 3ICCA 4MVJI 2C29D 2D8AA 4J90A 4BHTA 4PLYA 1GV1A 1V9LA 5ES3A 1PL6A 2X9NA 4CMEC 3CINA 2V6BA 3DEYX 3JQAA 1I2BA 1V0JA 1OBFO 1W0CA 3GVIA 4MP6A 5JO9A 1WMAA 1JA9A 3CUKA 4Q3CA 1QYWA 1SEPA 2WE8A 3GQVA 5IDWA 1U7TA 4RDIA 5EQDA 1S7CA 1YE3A 4WLFA 4CR7A 1P77A 2VYVD 2W2KB 4N5NA 2NV6A 3JD3A 5L40A 2AQKA 5L4NA 1PZGA 1B8UA 4OSPA 4J6FA 1UP7A 4IY1A 3GVCA 4XYMA 4G2NA 3LC1O 1N1EA 3HWRA 3TN7A 1N7GA 2QG4A 4NPCA 5TGDA 4LK3A 4GAEA 2X9VA 2O3UA 5IDYA 4CQLB 3NEPX 1W8DA 5L51A 3U0BA 3FTPA 3OM9A 4N54A 1ISMA 4CM4A 4RPGA 1I36A 2R00C 2DTDA 2VHYA 4LVUA 1ZVMA 3V1TC 2D2IA 1YVEI 3TFOA 4DRYA 1LDEA 2GUGA 5DCWA 1CDOA 1EFLA 2JD1A 4DLLA 2XXBA 2DPGA 4Y8VA 2HMWA 1YL5A 4IUYA 3FNEA 4HY3A 1Y5MA 4H16A 4E5YA 5KJ6A 3IIEA 2O3TA 4DC1A 1Q0LA 1WZIA 1J6UA 4LW8A 2JHFA 3DBHB 1PGNA 3FHLA 1E6EA 1OC4A 3WX0A 4AJKA 2XXJA 3ZNNA 1UH5A 4D46A 3KHUA 4J1TA 5ADHA 4CMJA 1X7HA 4RVSA 2DBVO 4OXNA 1WDMA 1BXGA 2YDXA 3I5MA 3U4CA 3H3JA 4NK4A 4MVJF 5KKCA 1GCUA 1IE3A 1TA4A 4LN1A 1BWSA 4OOFA 3JD0A 2QYTA 1VSVA 1U4OA 3PIDA 4Z6KA 2C07A 1T2FA 4G65A 4IINA 4WKGA 2PA3A 5JC8A 1WMBA 1DLIA 2B35A 9LDTA 1CETA 5JDCA 5IZCC 1OOEA 4MOWA 3WXBA 4CM5A 2QX7A 7ADHA 1QMGA 1NFRA 3H9GA 3NTRA 3ONFA 4E32A 4MO2A 4YEDA 2PK3A 3DFUA 4DWVA 1U5AA 3GAZA 1GL3A 2CSUA 2BD0A 4IDGA 4O5OA 1ENOA 4P38A 1N8KA 4DQXA 1W73A 1GUZA 3BXXA 4FC7A 1D3AA 2ZB4A 3HG7A 1Q7BA 4XCVA 4G5HA 1ZBQA 4DTIA 1E3SA 4HUJA 2PD4A 1GYRA 4NI5A 1X15A 4EUFA 4IQGA 2AW5A 4WPGA 1K6IA 2Y1CA 3QE3A 2AA3A 3NT5A 2WWRA 3NGLA 1XR3A 1DHRA 1GYPA 5DF1A 5IJZA 5JAQA 4KDEA 3IKVA 2GERA 2YHIA 4TRNA 2EEZA 4Z0TA 5MGBA 4I9HA 4FQ8A 1EMDA 3BMOB 4FDAA 4YRAA 1XU7A 2EKQA 3DOCA 3QLJA 3GDOA 2RHRA 2V6MA 3RUFA 3H9QA 4W9NC 4IGFA 5T6BA 3UN1A 1DLJA 2C20A 2WD8A 1K3TA 2AHRA 2IDZA 3GEGA 4OXKA 5B1YA 5CDGA 4TROA 1TI7A 4BKOA 3DFZA 4J9VA 3VDRA 1E3EA 2NNLD 3I1JA 1NPTO 1X13A 2O7SA 4D7AA 4DMLA 4BNVA 3LLSA 5CEFA 2YDYA 2VHXA 4WJZA 4DGSA 4NBTA 4BNJA 4BB5A 1P9LA 1JVSA 3JYOA 3LF2A 1CF2O 4H15A 1WDLA 1DAOA 4I5EA 1P0CA 1Y9EA 1EDZA 3KB6A 3Q9UA 1LDBA 2FMUA 1T1SA 5COBA 1HWYA 1LRLA 4EBFA 5I8WA 5AXDA 3WGGA 1V6AA 3P19A 2GCGA 5L9AA 4PLVA 4KDFA 4RO0A 4QQRA 4RZIA 2Y0CA 4I08A 3KM0A 4ZQBA 3G17A 5DOVA 1U2DA 4CM8B 1P1FA 3FBTA 2D3TA 4NJMA 1GZ4A 4BNMA 2G1UA 1ZIDA 3W6ZA 1XYGA 3E5RA 4NH4A 4Y6PA 2HJRA 4WUVA 1SB8A 1H6CA 1X7DA 5FYDA 3B20A 4MVJH 1RYDA 4ESOA 3RUDA 1YOVA 1PTJA 2Y0EA 3GFGA 3SJUA 3PRJA 3GY0A 1OC2A 4FR5A 4GGPA 1TXGA 1GTMA 3JQ7A 4YT2A 3IMFA 4WECA 4CM7A 4R01A 5A3JA 4Z0HO 2E49A 4Z0PA 4J49A 5HA5A 3RC9A 1GQYA 4GWGA 1OMOA 2Z95A 4B8WA 2FSSA 2FR1A 4R9RA 4K28A 4JCOA 3A4VA 3V1YA 4LRSB 3OIGA 2G76A 2ZCUA 5TSDA 2YQ5A 4BMNA 1JWBB 2V6GA 2B5VA 1M76A 2ZYGA 4YJFA 4JJGA 4BOYA 4JLWA 2Y66A 3RKRA 3SC6A 1P0FA 2VZ0A 4CM9D 2VT3A 3DOJA 1HDRA 5TRTA 3CE6A 4Q3AA 1Z6ZA 2J3HA 4BV8A 3PIIA 2X5OA 1FXSA 1KEWA 3TL3A 4PFJA 1R0LA 1BXKA 1ZK1A 5AXBA 1RWBA 3L6EA 2QIOA 5G2OA 4CMBA 4URFA 5HS6A 1VKOA 2Y1FA 1Z75A 2C54A 4IGEA 4LSMA 5ENDA 4B7UA 3UHAA 5KCZA 1ML3A 2Q1WA 2NACA 4NFHA 3GN2A 4BO7A 2VWHA 4NJMB 3EVNA 3WWZA 4RQTA 1DRVA 1T4BA 4U0JA 1V3TA 5TJHA 1T1RA 4MJLA 1PWZA 3AUUA 1PJCA 4NHEA 1E7QA 1H93A 4QSMA 5F5LA 1XIVA 4F45A 3WLEA 5G4KA 1OI7A 1DPGA 1J5PA 4MVJG 4H3VA 1B2LA 1G0OA 4Q9NA 4E4YA 1QYVA 1R12A 1IL0A 3ITDA 2PGLA 4UUOA 1H2BA 3KO8A 4ALIA 3D0OA 4D45A 1VL0A 4A03A 3MWDB 1E0DA 3D3EA 3I9MA 1QXSA 1RJWA 1WAMA 4GVLA 4I9NA 3VH4A 2CMDA 3DMTA 3QVTA 2PKRA 4GSKA 1LUAA 1Q7CA 3PWZA 3PXXA 4FFMA 1PGJA 3C1TA 3FNGA 4WLOA 4GLLA 4J3FA 4UVGA 3GN1A 4E2YA 2NU6A 1BRMA 2O7QA 5JCJA 2UUPA 4GX1A 1AHHA 1UR5A 1NPYA 1P74A 3E9MA 3AJRA 4ZQGA 3RUAA 1EBUA 2EF1A 3UUWA 4FC6A 3ZGYA 2VT2A 3AW9A 1B15A 2ET6A 4JP3A 4BNLA 3ANMA 4CUJA 2IODA 5I7EA 4FJ2A 2LDBA 2O50A 3VPSA 2Y67A 1S6YA 2EJVA 4QXMA 2GSDA 1GV0A 2EHDA 3KXDA 3GNSA 2WEKA 4W4TA 2Q4BA 2CF6A 3CTVA 3VZSA 4FGWA 3PGJA 5T57A 2B4QA 3JV7A 1T26A 3GPIA 3DL2A 1UJMA 1E3WB 2X6TA 4I5FA 1E3JA 1NWCA 1NAHA 4TRRA 5A1TA 3E18A 2VNAA 2A94A 3KRTA 5A4DA 3JQBC 4XQ9A 4NNJA 4ZU3A 1F06A 3ZCXA 2F00A 5BSHA 2VOJA 3EW7A 4K6CA 4ZQEA 1DXYA 2P5UA 2W8ZA 5HTOA 3QY9A 2ZB8A 2OP1A 2YJZA 3QA9A 3RROA 1DJQA 4U0KA 4J1QA 3DXFA 3NV9A 2CY0A 4M89A 3IS3A 2WD7B 3ANLA 3MTGA 3AWDA 3Q11A 4YRDA 2RH4A 4R3WA 3OJOA 3ROPA 3MTJA 2Q49A 1H6AA 1K0UA 1KIFA 1GEGA 1EZ4A 2AXQA 4P8RA 4ALJA 3PHGA 1PGOA 3KYBA 4OKNA 3ROKA 4BGIA 2AG5A 4D79A 4F6LA 4PN3A 2B0JA 4OGWA 4JBIA 3UAGA 4AG3A 2DVMA 1BXGB 1GEEA 5ITVA 1QLJA 5A9SB 4IXTA 1FMCA 2IEBA 3B1FA 4UREA 3FBGA 4Y9DA 4EI2A 4WEQA 4DA9A 4BNUA 4HNGA 4M86A 1SOVA 2AMFA 3D5TA 6ADHA 3ORFA 2O3JA 4DL9A 2P2SA 4WNCA 1UUFA 3S8MA 2OXIA 1UP4A 1E1KA 1HSZA 3F5SA 1IY8A 1F14A 1X0XA 3K5PA 4LRTB 1LSOA 1PZFA 4LMPA 4Y6RA 3TJRA 4HXYA 3EGOA 1NASA 3GEMA 2HUNA 4PLGA 4YT5A 3C3XA 4XIYA 1K6XA 2DKNA 2E6UX 4GX0A 1H6DA 1UDAA 3L4SO 4UVHA 3Q2KA 4UUNA 4XJSA 3WGQA 1HE2A 1J49A 2G0TA 3DZKA 3IQDB 2Y1GA 3GH3A 3QVSA 3M2TA 3WMXA 5IDQA 2Z1NA 1JKFA 1I3KA 1YB5A 2A92A 2DBZA 3F1KA 4MDHA 5I7SA 3PHHA 3TRIA 3RWBA 4YJDA 3EK2A 2C5EA 3O9ZA 4HFRA 3U3XA 3MZ0A 1C3VA 2NADA 5THQA 5A9RA 3EVTA 4L76A 4A0SA 3PWKA 3WSVA 4BQRA 4KP7A 2DC1A 1SC6A 3DHNA 3RD5A 1X7GA 2O4UX 4E5PA 4JJFA 1MFZA 1FDWA 3JQFA 3PQEA 4IIVA 1PQUA 2YHUA 3O4RA 2PGDA 3RCBA 1XCBA 1GD1O 4J4HA 3EMKA 5A03A 1DO8A 3DR3A 2TMDA 3GMDA 1LSSA 1A72A 5DOZA 4ZRNA 1HDZA 2C7VA 2Y1OA 1V3UA 4YXFA 4MIYA 3QWHA 1HE4A 1M6HA 4Z9FA 3GG2A 1YBVA 1IULA 3VPXA 1JWAB 2HK7A 1QYDA 1NWHA 4RLSA 3FWZA 1OFGA 1T24A 4TMFA 1E3WA 3T4XA 4KUEA 3LSYA 3QJ5A 2C59A 3TZHA 1UDBA 3RFXA 4PLFA 4AFNA 3ZWXA 1B8VA 3L77A 4UVDA 1YKFA 1P1KA 1LQUA 4E0BA 4KQWA 1XQ1A 4E2ZA 5FI3A 3INRA 4E5KA 1E3LA 3DBRA 1N5DA 1WP4A 2IZZA 3VKVA 3ZV6A 5IN5A 3FRJA 1TT7A 1VSUA 1E1NA 5T5QA 5TLSA 3EY4A 1U2GA 2ZB3A 3C1OA 2DT5A 3OHSX 4DLBA 4YAKA 3RBZA 1QYCA 4MP8A 4CODB 4FS3A 3E1KA 2YW9A 3RVDA 4CUKA 5A06A 1LDMA 3D4OA 5L7YA 1HDOA 4OJNA 3TQHA 4CV1A 1V35A 2HRBA 2A4KA 5JE8A 4RLHA 3KZVA 3MJEA 1UP6A 1IYZA 1I33A 3GUCA 1DRWA 1WVGA 1ZK2A 2X4GA 4EW6A 4AJLA 2IZ1A 3OICA 4YB8A 1LC3A 5F1OA 2HMVA 4JJIA 2EV9A 5ER9A 3F3SA 4JX8A 3VPGA 1NP3A 5AXCA 5JXWA 1EUCA 4MKZA 3ZW9A 5JS6A 1MC4A 4IPTA 3AUAA 4B4UA 3OFSA 3PFFA 4FOSA 1XSEA 2F1KA 4HNHA 2BMAA 3WGOA 3ZV5A 1PIWA 1QLHA 2WDZA 2X1HA 4IS2A 4AJHA 3JQCA 2FR8A 5JC1A 2UV8A 1EEHA 2GASA 4CQMA 5KOIA 4FPXA 4RPKA 3GNTA 3WS7A 1C1DB 1M66A 2QZZA 5JAMA 4MINA 3ZWWA 4ILKA 4CLRA 1D1TA 4FFPA 3NDRA 4XR4A 2I3AA 4JXKA 1E6WA 1EQUA 4L9RA 3HN7A 3TZKA 4RJTA 3AY3A 1PS9A 2O3QA 3FNFA 2D1YA 4NZ9A 1JW9B 2VWGA 3OJFA 4YCAA 3QVWA 5JAZA 2UVDA 3WLFA 4L75A 3HUDA 3I23A 2QZ9A 1O9BA 1ONNA 3K31A 1TVEA 3WR5A 3TZCA 2CNBA 1HRDA 3KSDO 3PZRA 3ZU5A 3VPFA 4GVXA 4BMSA 4EGFA 3OETA 4RCVA 4BL5A 3S1LA 1NXQA 3EUWA 4CM6A 3M1AA 3SJ7A 1KVSA 4XX0A 5KVCA 3ADPA 1E7YA 1GUFA 1O6ZA 2BFOA 4HBGA 2VYND 1BDMA 1RPNA 4M55A 1BGVA 1KVRA 3I6QA 1LBEA 3L6OO 4FBGA 4O63O 4QO7A 4KUHA 4PGFA 1I3LA 1R0KA 3VPHA 1PQPA 5L45A 3WTCA 1U3VA 4YDRA 3RBXA 3OIFA 4TKLA 2H5LA 1L7DA 5DCUA 3JQ7B 1C0LA 1DIHA 5L7TA 2ZYDA 2X58A 4DYVA 5HBRA 1MFPA 2WYWA 5IF3A 1P45A 4XGKA 3F9IA 4BB6A 5K9ZA 3VVBA 1G0NA 3IOYA 4EDFA 2HCTA 5C7LO 3BA1A 2ZTVA 1D8AA 1D7OA 2GN6A 2HQ1A 1ISJA 1IHXA 3T4EA 4CM8A 2O4CA 2EGHA 3OEYA 1HDXA 5BQFA 1C0PA 5JYDA 3NT2A 3L6DA 1JLLA 4XWYA 3HN2A 2H6EA 5BSGA 1T4DA 3WB9A 3X2FA 1TT5A 3Q0EA 5GZ1A 5GZ3A 2BFAA 2FPPA 1U3WA 5DBGA 5I7VA 5CEJA 5IG2A 2VYVA 1NVGA 2G82A 4LISA 1Y7TA 1R4MB 2Y99A 5BSEA 4P4LA 1EUDA 3L4BA 2E37A 4PG6A 1UDCA 4EUHA 4FW8A 3W4IA 5JYEA 2NSDA 2E48A 3JQAD 4F6CA 2NVWA 1UAYA 1RM0A 5ICSA 4ZHSA 2X22A 5A02A 2GO1A 3IDSA 3VOSA 1N9GB 3DOOA 1K6JA 2EP7A 3BIOA 3W8FA 3U5TA 3RC7A 1IB6A 2VHWA 4PLCA 3U49A 2JHGA 3I52A 4NQZA 4CV3A 5FWNA 1NVMB 1P1IA 5EERA 3K2EA 4Y98A 3MWEB 5MDHA 3PLRA 4NJOA 5F21A 3U9LA 1NQAO 3MOGA 4C7JA 4RVGA 3F47A 4OM8A 5G0VA 3UOGA 3SLGA 1E1MA 2FZWA 1N2SA 2YHIB 4IDBA 4GLOA 4L4RA 1LEHA 3I83A 2JD2A 3MJSA 1X1TA 3JQ9C 1CERA 1LC0A 3GGPA 3GLQA 4PG8A 4OXYA 1LTHR 1VL8A 3GHHA 4CR8A 1V8BA 4HWKA 5AXAA 4BO4A 1Z74A 4BNWA 1ENYA 1DFGA 4YTEA 3KYDA 2HJSA 3A28A 8LDHA 4W82A 1ZMTA 1KY5A 2Q45A 4UEOA 4DLAA 3H8VA 1EVIA 1NQOA 3W4JA 5KVVA 3ZWMA 4GPD1 3OIDA 3BHJA 1Y8RA 1P1RA 3PHIA 2Q99A 2VTEA 3KTDA 3KYCB 3KOUA 4FIZA 3WFIA 3WIDA 3A06A 5DN9A 4B79A 1PQWA 3O8QB 5L7WA 1LLUA 4XYLA 1Y8QA 1NVTA 3E8XA 1GFSA 4MVJP 4BNXA 3IUPA 1PX0A 1B7GO 3JYNA 4B7XA 1ZEJA 3H7AA 3I9NA 2DU8A 4GSLA 9LDBA 4I5DA 2Y1DA 3JQBA 4N5MA 1PR9A 4CR6A 3DMTC 3F1LA 2W90A 3LF1A 4LCEA 4O0LA 2LDXA 3L9XA 4FD3A 3ZV3A 5TS3A 3ZWNA 3DZFA 4BNIA 3AY7A 4D44A 2ZTMA 2CVZA 1I30A 2IRWA 3ZWBA 4BV9A 1HZJA 1YH3A 3MEQA 1B26A 3IKTA 3ZW8A 3ZWPA 1N92A 4E2WA 1E77A 5EIOA 3F5QA 3RI3A 4LVCA 4XD2A 4PZCA 3ASUA 1GU7A 3K2BA 2OL4A 1ZZEA 3DBVO 3WGYA 3S2IA 3IUSA 2EKPA 4A26A 1FK8A 4R4JA 4IMRA 5TJ9A 3UKOA 3DZJA 4BQPA 3H4VA 3VC7A 1NR1A 5JDIA 2DAPA 1R37A 4KTVE 1KY4A 1WZEA 5DT9A 5TQVA 2OGUA 2W2LD 4BS9A 3JCZA 2DPHA 4FSHA 5T67A 2VYNA 3GGGA 3H5RA 1I2ZA 1Z73A 3CPSA 4TVOA 3H9JA 2FRDA 3BHIA 3OSUA 4AJIA 1KEUA 4XR9A 3DBHA 4YAIA 2YFHA 5GZ6A 2AEJA 2PH3A 3AFNA 2BF7A 1G6KA 1PJTA 5A9TA 2BGKA 1VLLA 2B37A 4TKMA 1ADCA 3V2HA 1NQ5A 3ZZNA 4D0RA 4XGNA 5B37A 4J43A 4E6PA 3RJ5A 3H5AA 4Q3EA 4AL4A 1NFQA 3E03A 3M1LA 5DCYA 3S2FA 3I9KA 4U7WA 3DBLA 3MCVA 3ZNPA 2X0RA 1DC4A 1BW9B 2NVUB 4CMIA 5TC4A 1DHTA 1U3UA 5B4TA 4Z3DA 3FF4A 3ITKA 1LX6A 4MIOA 1WWKA 5CG1A 2VRCA 3RKUA 2IXAA 2GN4A 4OMUA 3RBVA 3OEWA 3JQGA 1HKUA 3AI3A 1K5HA 3GHYA 5DDIP 3WGZA 1WW8A 3DWFA 4YAGA 4M49A 5TIIA 3VVCA 4BNNA 1Z82A 4C7KA 4YAJA 2GNAA 2WE7A 3LU1A 3EC7A 4RPHA 1F0YA 3RIHA 4QFCA 1I32A 4IDFA 5LDGA 3V2UA 4BNGA 4B4WA 3GG9A 3NRCA 3TL2A 4AJJA 3ZN2A 3ZU2A 4ALMA 4IBOA 1Q1NA 5BNFA 1MV8A 3ZU4A 2X5JO 3LDHA 4N5LA 4K26A 3QWFA 3UH1A 1KBZA 3NDJA 2AEMA 2E4AA 4XDYA 3BMNB 1HLDA 2X0IA 3LT1A 4UEJA 1PJ2A 4UEKA 4YWJA 2X0NA 4HFNA 1CJCA 3WSWA 3D4NA 3K73O 3K8ZA 3ON5A 4H7PA 4ALNA 1YQDA 4R69A 4YJGA 3JQEA 4FB5A 2V65A 5IZ4A 2TMGA 2ZJ1A 3BMOA 5BNTA 3IL2A 4BIIA 1YJQA 3CMMA 3T7CA 3DAPA 3K30A 1T2CA 3HADA 4YAEA 3GDGA 1QG6A 1DC6A 1O5IA 4IJVA 4CQMD 4DMMA 2ZIZA 1TEHA 1FDSA 2OMEA 3S2GA 1NHWA 2NU9A 1HE5A 3O8QA 4J4BA 1EDOA 3AUTA 2YZ7A 1R6DA 3SVTA 4PCVA 1YRLA 2PZJA 2NTNA 4RVFA 3ABIA 4XQCA 1R0SA 2NU8A 3PQDA 4B8ZA 1EBFA 5COQA 3KYDB 4CM3A 3O38A 1Y6JA 3MOIA 2ZJ0A 1CQIA 1D4FA 1JVBA 1UXKA 2JKVA 3NAQA 2VQ3A 4KZPA 4CLOA 3I4FA 3PDUA 3GRPA 5IDXA 3HJAA 3ICPA 3FR7A 4NBUA 1HLPA 4NG5A 2X86A 2YFQA 4KWHA 3SBOA 4DIOA 4YQZA 3BMQB 4ZQFA 2RCYA 3BHMA 5T8KA 2CF5A 1W4ZA 5JAIA 1P44A 2JCXA 5CG2A 4PRKA 1C1XB 2I5PO 1HEUA 3C1AA 3C8MA 3ETGA 3VTZA 1ZSNA 2VOEA 5GY7A 3AM3A 4BNHA 4CMCA 2EKLA 2X7HA 5CPFA 3D3WB 1IPFA 5C7OO 4Z9YA 3JQ8A 2C7GA 1XA0A 1RYEA 4BKPA 3UXYA 5K0ZA 3G79A 1A7KA 2IEDA 3FNHA 3KEOA 4RVHA 3CIFA 4RVDA 3AOEA 2OOSA 2OORA 1W6UA 2O3SA 1NYTA 4B4OA 4O59O 3EHEA 5HWSA 2WSBA 1I10A 5ICMA 3KVOA 5ILOA 4XB2A 1LSUA 4JROA 4NU5A 4IJUA 4RVUA 4W7IA 1JAYA 2B4TO 3JD4A 4GQAA 2XF8A 4L73A 4NIMA 4A27A 1KS9A 2PKQO 2QRKA 2JAPA 3FI9A 3JD1A 2GGSA 4OH1A 1EE2A 1LSJA 4PZDA 1B3RA 2JFHA 4U6QA 2CZCA 5FI5A 4DVJA 4E3ZA 4YT8A 4YRBA 5FFFA 5U9CA 4LSWA 1MUUA 3I9JA 1E7WA 1H0KA 1GCOA 1ENZA 2P5YA 3WBFA 1XEAA 4B3IA 1ISHA 4EYEA 1U9JA 2NVUA 4CMIB 1BW9A 3DZBA 1DFIA 5K6AA 4GMGA 1XU9A 2PLAA 4XEHA 5C3MA 3RUEA 2QRJA 1EUZA 2OBYA 4EZBA 5AVOA 3HFSA 4WOKA 1PS0A 2P68A 3OP4A 1M2WA 3VZRA 3A1NA 1SMKA 4CM1A 2W2KA 3I9LA 1PSDA 2NLOA 4HFJA 5JW6A 5I8ZA 3TOZA 3GMSA 2RAFA 2VUSA 3DAFA 4ZQHA 5CEEA 1YO6A 4RZHA 4ID9A 1DBVO 2ZQZA 2HMTA 3G1TA 1X0VA 2OHXA 5B4VA 4B4VA 3SXPA 4J7UA 4J91A 2J8ZA 1YDWA 3OA2A 2GDZA 3NT4A 1DFHA 3QP9A 5A9SA 1YQXA 1TB4A 2HLPA 4L4SA 5LDHA 1EK6A 3AI2A 2VCYA 1I5RA 1NAIA 3WYEA 2DFVA 4TRJA 1L7EA 4CLEA 5KJCA 5DBIA 4CLRB 2EGGA 5KNLA 2W98A 2IE0A 3D3WA 4ND3A 3TZQA 1U1IA 2JFFA 4DBVO 5IXSA 3O03A 1PZEA 4BKRA 1ULSA 2G5CA 2EERA 4OAQA 3ZWVA 2H1SA 3BMCA 4BGUA 4D43A 1QV7A 1DSSG 1Z7EA 2ZB7A 1B0AA 1CQJA 2HK8A 3E6AA 2R2GA 3CH6A 2Q46A 4GWKA 3NTOA 4MKRA 2NM0A 4ND2A 3QVOA 3C7DB 2R00A 4BO0A 5CHEA 3LT0A 3U62A 2C0CA 4ZJUA 2Q2WA 1Y81A 3WOHA 1Y1PA 4FFRA 4E5NA 3WYBA 4CLOB 1Y8QB 1I2CA 3CZMA 3NUGA 5L53A 4RF2A 2V7PA 2Q2QA 3PWSA 2JAHA 1ZXLA 2PV7A 2DFDA 2Q3EA 4CMHA 1VJ1A 3TZ6A 3VKUA 3GK3A 5HM8A 2G17A 1UXIA 4GMFA 4CL3A 1M6WA 1O89A 2VWQA 1Y8RB 2FN7A 1FDVA 3E48A 3P5SA 2NQ8A 5KIAA 4BVAA 4BGVA 2HK9A 2QQ5A 1IZ0A 1WDKA 4AJEA 1YB4A 1T25A 5C5IA 5G4LA 3HZZA 3P7MA 2FR0A 2Z1MA 2BKAA 4A5OA 1E3IA 3C7AA 3ANNA 4NBVA 3QRWA 1DDOA 1LRJA 1ADGA 5ER6A 3ZU3A 1MP0A 2CUKA 2CDBA 3LQFA 4PG5A 4OO3A 4D3FA 4RDHA 4CV0A 1PJBA 2DBQA 2BGMA 3DBRB 5FEUA 3EDMA 3GA0A 3L4BC 1E5LA 1HXHA 1SNYA 1R15A 2GRAA 4ND4A 3UF0A 3ZHYA 4RORA 4DPLA 3VH1A 2B5WA 3DTTA 4YJGB 4GBJA 1E7SA 1VJ0A 4W7HA 2BI7A 2YV3A 1A71A 4ZD6A 1Z45A 5EPOA 3RUIA 1BVRA 2ZK7A 4J0EA 1CIVA 4CPDA 4XYBA 1DRUA 4YA6A 3W6UA 2UUOA 3BTOA 4CLDA 1ISFA 2VHVA 4CUZA 1N7HA 2PTGA 1VPDA 4BO5A 2HMUA 3PVZA 3WICA 1K2WA 1YB1A 3JSAA 1LQTA 3PHLA 4HP8A 3H5NA 4TZTA 5ILGA 3HB5X 5G0SA 5K6AC 2PZLA 1P1JA 4R1NA 1ZXBA 2UDPA 3C7CB 2J5QA 2VUUA 3BYZA 3IP1A 1XHLA 1GPJA 1R4MA 2X8LA 2O3RA 4J16A 3ZWCA 2H9IA 1MG5A 4BUCA 3ROQA 5TX7A 4RL6A 1HDGO 3PDJA 1JKIA 4DXHA 5CDTA 2HRZA 4E12A 4WCFC 4PVCA 2VRCD 4OOEA 1EE9A 4DUPA 4R5MA 3W8EA 2J3KA 1LDGA 1Z7BA 3INGA 2CDAA 5AQ1A 2C2YA 3UCFA 2JCVA 5JBIA 3LVFO 1ISIA 4PLZA 1IPEA 4OSOA 3ZHBA 4I8XA 4U5QA 5ENVA 1P31A 3PJGA 1ZH8A 4HKTA 1YQGA 3EZLA 3VZPA 5L3ZA 4PG7A 1DIGA 4O6VA 3GZNA 3VH2A 3OQBA 3N58A 3PPIA 3QVXA 4I5GA 4K6FA 3DZIA 3AM5A 4S1VA 3DONA 3S2EA 3NKLA 1BDBA 1G1AA 2V6FA 3G49A 3PP8A 4QUKA 2WYUA 2NU7A 3IC5A 5CPBA 4UAGA 1VM6A 4YJFB 3OQ1A 3UFXA 1Q7GA 5H82A 2DTEA 3HNPA 5AYVA 1GY8A 3L0DA 3GAFA 5A5FA 3GVXA 1GZ3A 2EP5A 1DAPA 1WLYA 2RH8A 3CZRA 3JYQA 5I9NA 1PL8A 2WM3A 3GDFA 5EESA 5L4SA 3ADOA 4ZN6A 2GZ1A 3PFWO 5A3VA 1LDNA 1MB4A 2IYOA 3OH8A 4IJWA 2PH5A 2EW2A 4ONEA 3FN4A 5T8KC 4NR0A 4BNZA 3B70A 2HDHA 4L4XA 4AJ1A 3X2EA 5JCXA 3FTNA 4OKIA 3WDSA 3V2GA 4FN4A 4P4GA 4WCFA 2BELA 2P4QA 2J3IA 3HSKA 4EITA 5I9LA 3ZI0A 4M87A 3LZ6A 1O94A 3GFBA 4AJOA 4XQEA 3B1JA 1ZK0A 4W99A 3B6ZA 2W2LA 2NTVA 1A7AA 2JJYA 5A04A 1SEVA 3W1VA 1CWUA 4R1UA 4ZA2A 2CVOA 2P9EA 3MJVA 4K9DA 1HSOA 1PU2A 3QW2A 4X54A 1VJTA 4XJTA 4PIVA 4R9SA 5JSFA 5T64A 2IXBA 3DZHA 3F46A 1QSGA 3LYLA 2D5CA 2J5RA 1EQ2A 4DQVA 4KWIA 4IDEA 3P2YA 4N18A 1ZSVA 3CKYA 1KEVA 2HMSA 2D5AA 4BKQA 3ETDA 3VH3A 2GD1O 2XAAA 3WGTA 4JGBA 4UULA 1HF3A 2OP0A 3GC6A 3V5NA 2PZKA 2X23A 3N74A 2Y68A 3ZHXA 2XOXA 1GADO 1E92A 2AQIA 4FOOA 1O95A 2W4QA 1ZW1A 2FY8A 2O23A 1XKQA 5AOVA 2QYSA 2HSDA 4A7PA 1XDWA 1GAEO 3ZNOA 4D3DA 5C37A 2FOIA 4HFMA 3RU9A 4AJNA 2BI8A 1ZMOA 3DTYA 5F3RA 3ENKA 4WK6A 3GF4A 3H9EO 4WOJA 4WE3A 2ZATA 3PJEA 2NTJA 4DPKA 5DULA 1F12A 5JO0A 1DIAA 3NX4A 4JBGA 4J1SA 7MDHA 4CJXA 3HE3A 4BO8A 4I1IA 1PJSA 3ZWYA 3ST7A 1NFFA 4XZ3A 4DC0A 4EEXA 1CYDA 5IAAA 3PGXA 4EJ6A 1KYQA 3F6YA 3UICA 4E31A 1LXCA 2PWZA 5H83A 1IOLA 2VTDA 3JQDA 1LA2A 2PGJA 2RHCA 1L1FA 2X0JA 1PJQA 1N9GA 3S55A 5CP8A 3AU9A 5CAEA 2Q1TA 3K9QO 3G1UA 4ND5A 4TQGA 1U8FO 1YBMA 5TF4A 4N7RA 3W8DA 4YBZA 4BNFA 3QHAA 1YBAA 3UVEA 4UVEA 4L0QA 3GEDA 4FGSA 4EJ0A 2P4HX 4XA8A 5KJ1A 2CFCA 4G81A 3Q2IA 4I9UA 3TNLA 3NYWA 2FPIA 1SZJG 2BRUA 3OF2A 4RGBA 3RFTA 4UUPA 4CMKA 1PS8A 5IXYA 4Q3NA 2POQX 1KC3A 3PQFA 4BKUA 2B4RO 4NDNE 5IFLA 1KC1A 1NTOA 2AE2A 3WWYA 2I99A 4CLXA 4XB1A 1FDUA 1XGKA 1NX6A 4WCFB 1U7HA 3DAGA 4WCDA 2AQ8A 1X1EA 1U8XX 1U5CA 3FD8A 1VRWA 4W6ZA 1MXHA 1UXJA 5CFZA 4O1MA 1DOHA 1LRKA 1QYXA 3STHA 1QV6A 4WLUA 2GR9A 3OJ0A 5KJFA 3WGIA 5TNXA 1ISGA 4PVDA 2CD9A 3AI1A 4DIFA 3WNQA 1WXDA 3UCEA 2WMDA 3UW3A 4E5MA 3RSHA 3KETA 1BHSA 1YJ8A 4S3MA 2Y05A 4NFSA 2DLDA 4E2XA 3M2PA 1LLCA 1H6BA 4GX5A 4TVBA 1EVJA 5G0UA 4BNYA 3OJEA 4Z3KA 1JKJA 1JQBA 1P33A 5HRUA 2XPCA 1I3NA 3GRKA 4YR9A 3CXRA 3ZWAA 1E6UA 4OQZA 1Q2XA 3PHJA 1NQTA 1VL6A 2JCYA 4FJ0A 2I67A 3OA0A 4XRRA 2C82A 4J1NA 4KUGA 1YGYA 1PL7A 3DHEA 4JNKA 4L74A 4II2A 1LLDA 4NBWA 1AXEA 3CMCO 4QECA 3Q1LA 1RM4A 4GGOA 4WEOA 1ZJYA 2PR2A 2HKIA 1JDJA 4JN6B 4YJHB 5EQFA 3WYCA 2I9PA 2RIRA 4RPJA 1DIBA 4CQMB 3ZH2A 3QWIA 4OL9A 3MJ4A 3PJFA 2VN8A 5IN4A 5EN4A 4BNTA 3JQ9A 3D5QA 3ZHZA 1H9AA 2WD7A 2QW8A 3GZ4A 1TLTA 3V8BA 3QIVA 1HDYA 3DO5A 4BO9A 3GVPA 1PR3A 2UYYA 1ONPA 2O2YA 3ONEA 1ULUA 4MVJM 2DM6A 1UAGA 3ASVA 3H2SA 1E7RA 3VAZA 3HFGA 5BT9A 4CMAA 3FR8A 4DBZA 2FPGA 3D7LA 1F17A 1XG5A 4Z9XA 3DB2A 3TDKA 2IYPA 1E7MA 3K92A 4K1LA 1U28A 2ZCVA 2ZQYA 4J9UE 1GUYA 1ZEMA 4B3JA 4ZRMA 4IM7A 1M75A 3WG9A 3BZUA 2HAEA 5DZSA 1F8GA 5DP2A 1QORA 2NQTA 1HYGA 3U09A 5KWEA 1GPDG 1HYHA 1ZUD1 2JL1A 2GN8A 3PTZA 1A4IA 4QT0A 2Q1UA 5JNLA 3DMYA 4MVJD 1YDEA 3C85A 3AM4A 4DIBA 4TRMA 3PYMA 3BMQA 3FSRA 3WIEA 3K96A 1N1GA 1LI4A 2OUIA 1PZHA 2P91A 1R16A 2DUWA 2P9CA 3U4HA 3WFJA 3PK0A 1ZO8A 1ZCJA 4II3A 8ADHA 1BG6A 4J2HA 1T2AA 3G0OA 5KJEA 2D4AA 2VHZA 4YT4A 1O0SA 2I3GA 3AFMA 4FJ1A 3VTFA 5G0WA 4ZICA 1RKXA 5IZCA 4P4NA 4JIGA 5U4QA 4YQYA 2YYYA 2OBNA 4MIEA 4AICA 3LK7A 4RF4A 1GR0A 3INTA 1E5QA 5BSFA 1UZNA 1SO8A 3KBOA 4KMSA 1MLDA 3WNVA 3B1KA 3IJRA 3RUCA 3F4LA 4CL8A 4UUMA 3AK4A 1AXGA 4RF5A 3ROMA 1A9ZA 3OQ6A 2DUUA 4A10A 5G4KB 3DZGA 1I24A 4WLVA 4BNKA 2EIHA 3AOGA 3H6KA 3TFQA 1I0ZA 3CSDA 2GYYA 3QWBA 4YJHA 1FF9A 4BO1A 2FSVA 1ID1A 2WJPA 3IP3A 4ZGWA 3E82A 1E1LA 1OZAA 4QX6A 1GQQA 3ZNQA 3BTSA 3BTVA 3BMNA 1LLQA 5F1PA 5JCJD 3JQ6A 4HX5A 3AOEC 4FCCA 3KV3O 4TWRA 2X5KO 3LT2A 1ADBA 4IZIA 4R16A 3WMWA 1KVQA 3UGKA 3I9OA 4GH5A 3NJ4A 1HDCA 3PJDA 3Q6IA 2BH9A 1HL3A 2QRLA 4LGVA 3FPCA 2VWPA 3L07A 2EW8A 1JN0A 4FFOA 2ZYAA 3QWAA 4BGEA 1AE1A 2EJWA 1BVUA 3AU8A 4BO3A 4GL4A 1C0KA 3RC1A 3DC2A 3K6JA 3P2OA 4NU6A 4L8VA 1Y9AA 1ZSYA 2UAGA 1HZZA 2D59A 4A2CA 1ZJZA 1X14A 3DDNA 4R51A 1HETA 1A5ZA 3BTUA 5A05A 3JQGB 1U3TA 4WLEA 1LDYA 1AGNA 4EUEA 3I4CA 2PD6A 2VRBA 3FCOA 4ALLA 4CM4B 3H2ZA 5JY6A 4NK5A 4R3NA 2WYVA 5TT0A 3SLKA 4EJMA 5I7FA 2JFGA 2J3JA 4TSKA 3DBLB 5I9MA 4ZVVA 3U4DA 4D42A 2AG8A 3ZWOA 3ZDFA 4AJ4A 4E30A 1B8PA 3PEFA 3WQRA 2AE1A 2YV1A 2EWMA 4EEZA 4PLTA 4Y6SA 4MVJE 5GMOA 2X9GA 3I6IA 4R5HA 4QTZA 1PJLA 1J0XO 4GKVA 1MC5A 2CDCA 2CVQA 1QP8A 3OBBA 5L95A 3RU7A 5JPIA 4XKJA 3A14A 5JMPA 1NNUA 1QKIA 1UZLA 3JTMA 1YXMA 3JYLA 4TZKA 2AEFA 1HE3A 3OJLA 1YL6A 2EG9A 1GYQA 2HU2A 3JQAB 2R6JA 1FJHA 3M6IA 3ULKA 3PZBA 5CDSA 1SAYA 2OZPA 3E9NA 4YPOA 3C24A 1K89A 1RM3A 1BXZA 3CTMA 5CDYA 3JQ8B 2RBEA 4XGIA 4JK3A 2I66A 2WTBA 1R4NB 1NHGA 3L9WA 3KUXA 2DTXA 1BSVA 3CEAA 1CEQA 4DPMA 3QQPA 2YUTA 1KETA 3BAZA 2NWQA 3I3OA 1PGQA 5HS4A 3UCXA 3HHPA 5EJ2A 1MX3A 5J23A 3RQSA 1ADFA 3GNQA 1SB9A 1LJ8A 1SOWA 1VE9A 1EFKA 3OMLA 4HV4A
chains in the Genus database with same CATH superfamily
2XRZA 4U2FA 1GG9A 2R9VA 1GA1A 3GWGA 1GPBA 3SX2A 1C2TA 5B4UA 5FF9A 2OZLB 1ZM3A 4PS0A 4JBHA 3JASA 3KR2A 4Q02A 2ATVA 3CM0A 1NVEA 1EVZA 3ZY3A 1OASA 3GFTA 1DU4A 4INAA 2H59A 4EA8A 2IYFA 1KJWA 1ORWA 2GBPA 5PGMA 5JSHA 4DCGA 4Q3KA 3TB4A 2QD1A 3GPDG 3WO0A 1H1LB 4W9RA 4YLEA 3RSLA 3ZY4A 4OHKA 4X65B 5EJ8A 4C2TA 1ZCBA 5CDUA 1HTBA 2VXOA 2ZSUA 1M1NA 3WTBA 4EO7A 4Q39A 2VNSA 4E08A 5JVDB 3WMEA 2QU8A 1HNNA 2AF3C 4BEBA 2PZAA 2D2EA 1YWGO 3KEQA 3KR9A 4UHFA 5BQOA 3W3AH 1A69A 2O2SA 1ZNQO 2XOEA 1CRWG 1PO7A 2PJDA 3T94A 4DNPA 4ND8B 5B2ZA 4RJLA 1FJ2A 4YCCA 2O8DA 3R6GA 1O97D 5B57C 3KSUA 1FRVA 1SK9A 5COAA 5BR4A 2A0YA 4R1TA 4RJIA 3QUSA 2AJ8A 3R7LA 2FZCA 4WLNA 1EM6A 3PNMA 1Y3DE 1ZK3A 2GVZC 4C21A 3UK0A 2F3QA 3FMIA 1H94A 1NBMD 4TYYA 5C5DA 1RJ9B 2EDAA 2ILTA 1ZIPA 3VU1A 4DUGD 4AN0A 1M2OA 1OT3A 4LXQA 4H2DA 4PRLA 5KVAA 2B2NA 4P81A 4P22A 4QHTA 3GRCA 3AZQA 3M9XA 1JQ5A 3BMCB 4IYRA 3TVDA 1Y1TA 5F64A 2N75A 5LLSA 1FXWA 3GH1A 2GK7A 2IYYA 3CKLA 3HDYA 1F4VA 1KMNA 1XFDA 4N8SA 4A73A 4FHGA 2HA3A 1A8IA 3BL6A 4YDHB 1P7YA 1II8A 1WCIB 5ESDA 4RTLA 4ZALA 4Y1GA 1KI3A 1SA0A 2AT1A 5U1PA 3WBBA 4CM9A 2QMHA 3DMFA 2WU4A 3GGOA 1XELA 3NTVA 2Z58A 3OY7A 1V3VA 4HRAA 5CA0A 5A3SA 2QLNA 4TMVA 3RTAA 2GHRA 2XECA 4JP2A 4JI3B 4QYTA 3H83A 2GF2A 2AK3A 3EXHA 5IJAA 2ZPTX 4X90A 3HKCA 4KN5A 4HLUA 4UUAA 4YWHA 1TT5B 2C94A 3X1MA 5F23A 4G4SO 3WQSB 4QUHA 2JGLA 1H2XA 4DTCA 1AZLA 5BWLA 1K08A 3Q0IA 2XYRA 1X7XA 1V4NA 4KO8A 4PPNA 1YL7A 5L8VA 4K8RB 4YYZA 1UZMA 2E87A 4JKIA 1YA6A 1E63A 3F6EX 2ZGVA 3QFHA 4O08A 1G8JA 1GDHA 1ZC4A 3AR7A 2JGDB 2W6OA 1BMFA 4XDHA 1JHUA 3LK6A 1GILA 4AQDA 1PF7E 4R68A 5C7IO 3N0WA 3I12A 4TLCA 4EI7A 1B3BA 2H08A 1DEOA 2SHKA 2PE5A 4B0PA 3SKVA 3GZNB 1UJ4A 1YOVB 4XQGA 2P9GA 1H9BA 4IWXA 2VZ8A 4FWIB 3GA7A 3HCOA 3KU4A 2BLLA 3BB1A 4DCSA 1SG0A 4R1OA 5EP1A 5FTMA 4D9FA 3TMYA 1E2NA 1H4TA 1LU9A 1BYIA 2HO5A 4L5JA 4MKXA 4IJKA 3W1WA 4W9NA 4C4YA 3GJXC 2PUCA 3N39C 4ZAXA 2SKCA 3AY6A 2H4YA 2ACWA 3P9ZA 1FUEA 4IDCA 1YVUA 2D0PB 5KKAA 2H31A 3RVJA 5DX8A 3RC2A 3UJHA 3AUSA 2D0IA 4RFVA 2L17A 1WR8A 2X3UA 2Y76A 3ETHA 2J5KA 3L6BA 1XL0A 5GJCA 3RNLA 5G02A 3FOZA 1ESEA 1N4AA 4XYGA 3TF5A 3NJ8A 3ZY6A 1DQZA 4U8GA 3I53A 2JAXA 3SDSA 5LQUA 4J0FA 1O96A 2ID9A 1C9NA 2PAFA 4RQAA 5C8YB 2PZMA 2D1QA 1V16B 2G7MC 1SXHA 3LY7A 5E7MA 3GVHA 4QBTA 4EPWA 5HHTA 3C6BA 2AFVA 2ZAYA 4OUDB 3KLNA 3RVSA 3V8RA 2JD0A 4HB0A 4I66A 2CHFA 1ZICA 4P2BA 3DLCA 1QTIA 1FJXA 2YL2A 4M0PA 2G1PA 1EFPA 3NH9A 4NFYA 2FWMX 1ZKMA 2ZKLA 4K3UA 2GM5A 4BO6A 3E23A 3FPLA 4GNKA 1DC5A 4N3BA 4CCYB 3CE9A 4M1QA 4O29A 1ZOOA 4HAIA 4OYYA 1V3QE 4BQQA 1WBDA 4C7OA 2WVHA 1E2HA 3NHPA 5TVGA 3EEQA 3WGNA 1N6LA 1ZD4A 2ZYVX 1UJNA 4AJ2A 1AUPA 2FJUA 1C1DA 1IQUA 3DB1A 1V1RB 4PC6A 3ZDXB 5FA6A 2BFMA 2O06A 3NGXA 4YAUA 1QGUA 1UBMS 4MPDA 2J6IA 4FZRA 1E8MA 4H1VA 2D54A 3LXRA 2HHLA 2O14A 1J8MF 1OYYA 3IMGA 3NDIA 3R3JA 4GPZA 1XOIA 4LECA 3VR4D 4TZ0A 8MHTA 2G4VA 2YVLA 1T15A 5ESRA 4GNRA 2OILA 4NLLA 4D4GA 3L8GA 2GNPA 3D6AA 3TLMA 4ARSA 4CM1A 5JQWA 1NTRA 3OMWA 4CV2A 1NT4A 4R41A 3JRNA 1LK0A 1QHHB 3PSAA 4H0NA 5GWXA 5SV2A 1Q15A 2X8AA 3MLAA 1GXSA 4MCAA 5EMHA 4TM8A 5TT1A 1KA9H 5LXTF 1QH8B 3IAS1 2ZM6B 4HBZA 4FGUA 1Y5RA 3ZR4B 5JY1A 4F92B 3TGWA 3WGHA 3QG5A 1B16A 1LTKA 3R0IA 3TLCA 1IZ9A 1H5QA 3HR7A 5JTUA 2KS6A 4LHSA 4RANA 3L7DA 1TC2A 4DJAA 5IF9A 3AR5A 5G0TA 3NC4A 3SC2B 4BE7B 4F85A 2OM6A 3EXFA 4D5GA 1Y3HA 1VKNA 4F06A 5HQ3B 2XRFA 1ONOA 3GT3A 4RKWA 2RHHA 1NPDA 5M5BA 2VF8A 1DJNA 2NZ2A 3T1TA 2FPMA 1NUTA 2LE0A 3U4QA 1ZKDA 1JHVA 4NOMA 1S4QA 3C3DA 2OEPA 1N34B 1C0IA 2YVAA 5CXSA 5A5GA 3WHPA 5B12A 4DV0B 2XT6A 5BVHB 1RXWA 1PFGA 1SBHA 3P27A 3E1SA 1ZNXA 3TOXA 4AB1A 4FSDA 3UJAA 2PVPA 1XWFA 3O7WA 2JZOA 1EXWA 2C7RA 3O1LA 4C20A 1TAUA 3ZX5A 3DHVA 3UK2A 3QKRA 4N7JA 1KOLA 4UOEA 2R6FA 1LQ2A 3E9DA 4WASA 1ETHA 2YIJA 3LLCA 4MRAA 3K5HA 4RBNA 4ALKA 4QD3A 1YBHA 5KVQA 1WNTA 3BK2A 1RVV1 1BXRB 2CJYA 1XCPA 3L05A 3NPMA 3PYLA 4IDDA 4HXGA 4ZXFA 1PGPA 1B14A 1QANA 4UDOA 2B36A 2ZRCA 3HY6A 3T3MB 3TPCA 3H9CA 3QJYA 1CQPA 1ZWKA 1DQPA 5THXA 1GQFA 2FWIA 2H17A 1RCUA 2VHUA 4NONA 2C29D 4J90A 1J00A 3RLIA 3BHNA 5C52B 2ZUEA 1TM2A 3E9ZA 3CRVA 3H0KA 4V0KA 2WQ7A 4KNYA 4PSKA 1DDIA 4GVPA 4CF3A 3AKEA 3R3YA 4LHZA 4BATA 4CMEC 1VJDA 2OHVA 2QLFA 2DKOA 2GK4A 1I2BA 1W0CA 2EL9A 4G0YA 2R2AA 3AJ9A 5AM1A 2OOKA 5IRCD 1AZWA 4Z2AA 5JR3A 1V16A 1QYWA 3EVCA 3FFAA 2PN1A 5M04A 5FWDA 4RDIA 4YO7A 5SICE 3BQNB 1CVIA 3JARA 1QOPB 2CLIB 2BY4A 2VYVD 4Y9TA 3IMKA 4OAOA 2W2KB 5FB3A 5KYKA 4NATA 1KWKA 3JD3A 3NIFB 1Z4JA 5K2MA 1BFKA 3MFQA 4O2BA 2VK8A 1F48A 4TMXA 1ICEA 1CUJA 4HWTA 3SKYA 2B92A 1B8UA 1EHYA 1KU6A 2XMRA 3KD3A 2AKEA 4YFVA 2Y1LA 3LUAA 3GVCA 1AIPA 2GUWA 2OVFA 5DI3B 4BEVA 1K5PA 2C9BA 2PYIA 4ZO8A 3B1WA 4HCJA 4YRSA 3BEDA 4R2WA 1P7WA 1X6VA 2X9VA 4MJ3A 1E0KA 4G85A 1FNDA 2W7TA 3K94A 4GI5A 3FTPA 4GO1A 2VYFA 4IQ4A 2G0NA 3G2HA 4FQ7A 4N54A 4CM4A 2PVSA 5GGYA 5JG7A 1W76A 3H4TA 4AP9A 2H54A 1YRQA 1FU4A 1ZVMA 4LVUA 5CT5A 4DB2A 2YYAA 1Y3CE 2PT9A 5FWAA 3IIIA 2FH5B 1LDEA 3K9GA 5LKRA 4Z86A 1PKXA 2AC4A 4C0HA 5CB4B 4DLLA 3KDSE 2HLHA 3Q7SA 4PFQA 4Y8VA 4IUYA 1QFZA 3EAFA 3I6YA 1EQAA 3FBWA 2XUKA 1LZKA 4MI1A 2O7VA 4H16A 3VX4A 2VLIA 3CX7A 3CLUC 4E5YA 4TLLB 4PYIA 1NBHA 2WJYA 1EDDA 1X7XB 3KTFA 1J6UA 2QROA 3G6WA 3T99A 3A9TA 4BQEA 3C8UA 4LW8A 5UKDA 3H1BA 1E6EA 4AJKA 1A3CA 1KEEA 3DC7A 4LZWA 2HRDA 3ZNNA 3EXHB 1MX9A 3KHUA 5ALEA 4D46A 3DT8A 3CB2A 4I2NA 3S44A 7GPBA 4X24A 1SH7A 3A1DA 3DDWA 4M9RA 4OMDA 5BWBA 2QT0A 4RMGA 1FJGB 4YJ2B 3ZU6A 4OTZA 1L8AA 4A0QA 3N3AC 2OAEA 4G4JA 1OIWA 3H3JA 1SA0B 2OCGA 2FZ5A 3M49A 3Q9LA 2I1VB 2V98A 4DBLC 3TD6A 1NW8A 1E5XA 1YR6A 4IV8A 4REOA 2H1OA 1TA4A 2BGNA 3SJAA 3KKPA 3KWLA 4M0FA 4J94A 3JD0A 3HS3A 5EC8A 4GXTA 1K9SA 1VSVA 2ECPA 3HEBA 3K09C 4G09A 1U4OA 1E3DA 3MA0A 1NRIA 3HP7A 3MF4A 5MHTA 2C07A 3UHOA 4IINA 5FORA 4QM6A 1JKMA 5DNEA 3EBOA 4YMUA 5JC8A 1DLIA 3KV1A 1UJBA 1MJFA 4KQCA 5IYZA 1V7CA 2CXTA 9LDTA 4R31A 3VSDA 1XVIA 1ESNA 3GUVA 1S5PA 2P9BA 5IZCC 2ZSFA 4MOWA 3SQDA 5JD6A 5H8WA 2QX7A 2V03A 2FW7A 2Z2KA 1QMGA 4ZHQB 1NFRA 2VJMB 2G36A 1NNSA 3DBIA 4OK6A 4AO7A 2PX5A 4MO2A 4YEDA 1RAIA 4BJ6A 2FSVC 3A6FA 1QO9A 2CLOB 4XASA 3V46A 1GL3A 2HWUA 5D5HA 4AIRA 4KN6A 4O5OA 4N41A 3VYUB 4WXHA 4QTXA 2PPLA 3OQHA 3R44A 1MC8A 4X91A 2IY8A 3DFKA 1UK8A 1OLSB 5K5EA 3H1EA 1U2SA 3PEVA 4BUJA 5FPQA 4O1IA 3BXXA 3PNYA 1LPSA 2PWYA 2WJ6A 3LCJA 3LP6A 1NATA 1NDHA 4MTLA 1FZQA 3K4QA 3NNSA 2LCIA 4M0EA 4XCVA 2J3EA 4HUJA 4NEQA 3ASZA 2CK3D 2HPVA 4GKAA 4QQFA 5DHQA 3WK6A 2J9ZB 4A82A 1QG2A 5HQTA 5IVDA 1GVHA 1AHPA 1P5RA 3H2KA 4WPGA 1K6IA 1Y3AA 2C96A 2QMUA 3QE3A 3UPUA 4RIFA 2WWRA 2HYDA 3NGLA 1XR3A 4OP2A 1TA0A 4TWAA 2D2FA 1DKUA 1JFVA 3TW8B 4LFAB 1U1GA 2GERA 5B58T 3MXTA 4NY1A 5MGBA 5DN6D 1UC9A 1IRXA 1Y3IA 1EMDA 1ZESA 5AFSA 2IYSA 2MSEB 5EP4A 1K92A 3GCWA 4TXHA 2V6MA 2IQ5A 1L6IA 1P9NA 1X1CA 2WOJA 4IGFA 5T6BA 1KHTA 2WD8A 4K8OA 1M2FA 1TLLA 4RL4A 5B1YA 3D2AA 1QB7A 4IFTA 5CDGA 4TROA 5KOYA 3T7DA 3VDRA 2NNLD 1I7LA 1X13A 3SD7A 5DLQC 4QUBA 4D7AA 3LLSA 4R0VA 4DGSA 4BNJA 4DJJA 1P9LA 3TECE 1QHEA 1C81A 1Z8FA 4RGQA 1PK7A 1YU6A 3JYOA 3I0ZA 2MU1A 4DY4A 4ZYUA 1R3DA 1IN5A 5FI1B 4TWJA 4FGLA 5KSOA 1M3SA 2EFJA 2YZMA 1ZOIA 2A1UB 2FG7C 5DFAA 3T52A 5KNBH 1Y9EA 5COBA 3KB6A 4JVLA 1OH7A 2FMUA 4EBFA 1LRLA 1TZ2A 1WXGA 3T3PB 5CYOA 4AUMA 5CB6A 5AXDA 1W5AA 4EGSA 4QOFA 2FR8C 3WRYC 3P19A 2WNIA 3STYA 4FTWA 3PD1A 3IUMA 4I6GA 3TQCA 1VCMA 2CJWA 1PCXA 3URMA 4I08A 4CM8B 5DOVA 3G17A 1Z6XA 1U2DA 3W2EA 3WL6A 4ZVKA 4LEIA 1CFZA 2GEUA 3LQYA 3FBTA 1RQPA 2D3TA 2RGEA 1NVFA 1TVMA 1GKLA 2NXNA 3ZPXA 3HXOA 5E4TA 1B8NA 2HDOA 4L95C 2W6ZA 1H2ZA 2W6MA 3F3KA 2JARA 3FHCB 4Q1FA 5HMLA 2KPOA 4C07A 4K6MA 4R0NA 5LKAA 3LHIA 1H6CA 3I3SR 1X7DA 5AKZA 2WLSA 5D3QA 3QMMA 1G6OA 5LSAA 4PCUA 2H7YA 3FYCA 2A5GA 1G5HA 5GM1A 2GF0A 4HAWA 3WKEA 1E9BA 3GY0A 1EXMA 2WSIA 3CCBA 1GTMA 3P5BA 4UNNA 5EQTA 4YT2A 3KR0A 1WO8A 1X80B 2G77B 3P9RA 2OB1A 2RGWA 5J40A 4Z0HO 3OO0A 2E49A 5JJIA 4Z0PA 5NULA 1YNSA 5JJCA 1GSIA 1YZGA 2XNKA 3KQPA 1T4MA 1MV5A 3ZCVA 2FR1A 4NZMA 4R9RA 5CX1B 1CYEA 1BROA 4LRSB 1GITA 2ZCUA 1NOIA 2FFBA 2YXBA 2Z4RA 3Q87B 1M76A 3HLKA 4RY0A 4JJGA 4YJFA 3TLBA 2Y66A 2CKDA 1PZMA 3UENA 1BJKA 2V45A 3N86A 4DM7A 1YNOA 2NYVA 4L2IA 3DOJA 1HDRA 5K45A 1POXA 3CE6A 4Q4JA 5TB5A 3TEFA 2GMWA 4IMIB 5EXDA 1GAJA 1XO1A 3K0CC 4R2IA 1FXSA 1WZUA 4P3PA 1YHYA 4PFJA 5J9FA 4KYVA 3RROA 4UZSA 4M98A 4OP1A 2JJ8A 2PMCA 1NJ8A 1AKRA 2QUBA 3IXMA 4BFWA 1QTNA 2QNRA 1RWBA 2X2EA 2QIOA 3IYLW 4TSRA 4H7DA 3MVEA 5HS6A 2JLBA 2Y1FA 2C54A 4LSMA 4EFKA 3WLKX 1M73E 1QH1B 2ZWOA 4B46A 3WKDA 521PA 2J9FB 4E14A 5IS2A 2NACA 4N01A 4KPFC 2Q4RA 4BLPA 4ID3A 1BN6A 4YXWD 1LVHA 2IHKA 3EVNA 3UUEA 4H6XA 3OX1A 1L5SA 1T4BA 4RQTA 4NC9A 4U0JA 1TTPB 2R7LA 4BQOA 4YRZA 4QQKA 4G1VA 1RTTA 1KORA 1T1RA 4MJLA 4X1KA 3HB1A 3L0BA 1PJCA 3HNOA 4NHEA 2QZSA 1E7QA 4D56A 4KHPB 3LGXA 2PMEA 3PGKA 2WINI 3WLEA 1DPGA 4MVJG 3WLTA 4BE9A 4F5WA 4H3VA 1B2LA 2IXEA 3K32A 5EOVA 2HLNA 1GNLA 1R12A 3R2JA 4E4YA 3I72A 4RACA 3PNKA 4ERXA 1H2BA 4RH1A 4DG8A 2JGRA 8ABPA 3I2IA 5AIBA 1KI8A 1Z2EA 4A03A 4P0QB 2GJ4A 2Q27A 1E0DA 2AN3A 1C3EA 3D3EA 3KKKA 2OBMA 5CITA 1Z5OA 1AO0A 3WNZA 3VNUA 4EHLA 1WAMA 4CRWB 2C7PA 1V1MB 3M4XA 4F6RA 3DMTA 2H2DA 2RIPA 4GSKA 1Q7CA 3I73A 2BFFB 3FLAA 3HRKA 3G68A 2INGX 2BIFA 1U1CA 4DV4B 3FNGA 4WLOA 2DQZA 3O6VA 4F2PA 4PPYA 2O0KA 1J97A 4QOJA 2NG1A 4EG1A 1BRMA 2O7QA 1N75A 2AEEA 1ZIXA 1JYFA 3WB2A 1UR5A 4IDQA 2YXDA 1QGAA 1E79D 1WTCA 2PUWA 2XB2A 2Q6KA 2JI6A 3ICQB 3AUXA 3AJRA 2HFJA 3PUZA 3UUWA 2NO4A 2FV8A 1P2TA 3ET5A 2FRDC 3GMTA 2ZAMA 3R7WA 1OYWA 2VT2A 1AOXA 2ID7A 2WICA 1WXFA 4PYKA 4RNCA 3I2YX 1AZTA 4BNLA 3MC1A 4CUJA 2LKCA 2OCKA 1T1JA 1N2OA 3ISJA 2LDBA 2O50A 2Y67A 2VHJA 3F90A 1U0LA 2GSDA 4QXMA 1DMSA 3OX2A 4QU9A 5ALIA 2TS1A 5BV8A 3ZG6A 2I87A 1PE0A 1BMTA 2Z56A 2ZBRA 3AV0B 3QVUA 4TTPA 3NVKI 2G72A 2ODNA 1ZIOA 4I2VA 1J25A 1OXTA 1QZZA 1HTTA 2OECA 2Q0XA 4H1UA 4QJBA 3CTVA 5D00A 2E7ZA 4FGWA 3KB2A 2PH1A 3UWSA 2WG0A 3HWX1 4IILA 2O7NA 4WKOA 5ESWA 3JV7A 3N05A 1NURA 4XQ0A 1T26A 3GPIA 5K8JB 1V26A 2ZXEA 4FYVA 5DASA 5ECYA 4X3PA 3PQ6A 1COWA 2AL7A 2GN2A 4Q5IA 3X1JA 3T1OA 1D0IA 1Q0ZA 5LMUB 4R83A 5A1TA 2JLQA 5DKFA 2A94A 3KS9A 4P93A 2CLMB 1F06A 2PJUA 4DCNA 3TLKA 1W5SA 1F5SA 1P8AA 2F00A 4G1EB 2IU3A 1KQNA 1O6GA 2B8TA 1SQ0A 2VPYA 3R41A 3QY9A 2YJZA 3UJ7A 2FQYA 3VYWA 1P9RA 1P5FA 4DA8A 1FYVA 2Y9MB 1L5KA 3WXMA 4C4XA 5DB4A 5EJ9A 2FUCA 1Z22A 4RY2A 2HADA 2XBUA 3AWDA 4Q24A 3WLOA 3E3MA 5H4HA 1MW9X 5AW9A 1SGWA 1UKAA 3HCFA 4B4DA 1RZVA 1K0UA 1RT9A 4EW1A 1HR0B 2AXQA 3TTTA 1XD2B 3NBAA 4DABA 1VE7A 1ZG3A 3VV2A 5K3CA 1STOA 3AGPA 4MRRA 1ZA2A 2JHPA 1Y9JA 1J0AA 4JBIA 4ARZB 5HBGA 3VKHA 1GEEA 5ITVA 4Y6GB 5A9SB 4QUGA 4IXTA 4ZDJA 5BUCA 2VZEA 4BDSA 1FMCA 1QGYA 3ZX4A 3EEBA 2FOLA 3KD2A 4TLAA 1NOKA 1ORTA 1WM1A 2FXIA 3JXEA 4NZNA 2PKWA 2HSGA 4JUAA 2I1QA 4BFVA 3KZNA 5AW1A 4N1AA 3V34A 3QE9Y 4NTZA 4HQOA 4RFSB 3LUFA 3GLSA 3S8MA 1H69A 1KPHA 2GBGA 1UP4A 2GTIA 3NPAA 3ZD7A 1HSZA 2QW1A 2HQSA 4LRTB 1VE3A 2WDPA 2WJ3A 1LK7A 1YHNA 1H66A 1PZFA 4XSGA 5FUXA 1ZD9A 3M3DA 4AP5A 2H0QA 2AJBA 4HB2A 3F7OA 4Y6RA 1DBQA 3GEMA 1OBVA 2HUNA 5LQSA 2B7LA 4XIYA 1K6XA 3M3HA 2AJLI 4UU8A 3LBAA 4DEVA 1YCHA 3BBPA 1X87A 1TKCA 3H97A 4LOHA 3F67A 4P31A 4UUNA 2D0OB 4US1R 1UK7A 1ZUNA 1HE2A 1J49A 2H16A 3GH3A 3WGQA 2J32A 4M38A 4P4SA 3K0BA 4XGRA 1USVA 2A92A 4TWIA 4ZT3A 2QIPA 5I7SA 1W48A 2EQ5A 2ZWAA 2BE7A 3CEPB 1HQCA 3PHHA 4NMXB 3O90A 3TRIA 1W85B 4Z54A 2B0CA 4II7A 4BVBA 1XZ8A 3WIOA 5THQA 2NP7A 2NUBA 4KHZA 4ZMRA 2FFQA 1K8XB 1RZUA 3HYSA 4HQ0A 2GN1A 1X7GA 1SC1A 4S1WA 2X13A 3R3HA 3T1YB 3AEZA 1MFZA 3PQEA 3JQFA 4IMJB 4D4HA 2YHUA 3KEFA 1JFSA 5GM2A 4MPJA 3A9CA 2CDNA 3KVVA 5E3IA 3ZZUA 4J4HA 1RW4A 4ZT6A 5CURA 4DV7B 3EWIA 5JNRA 2TMDA 4QC2A 3D8NA 2ZBVA 1LSSA 1NKVA 2Q41A 2YTZA 4YQFA 1A72A 2GKGA 3BF8A 4OHRA 4Q3OA 4C2AA 1PNTA 2A5DA 3GRVA 2QGFA 1NGSA 2Y1OA 3MQFA 4OH7A 2RONA 3A3PA 4EB3A 1I80A 4NXMB 5BNWA 1YBVA 4MV1A 4WJKB 4C14A 3AGQA 1JWAB 4QEKA 2R4QA 3CLSD 2DE0X 3FWZA 1OFGA 1T24A 1UC4B 4R9NA 4TMFA 5KTNA 1E3WA 3H18A 3T4XA 4KUEA 3S1SA 3LSYA 1PEYA 3QJ5A 2PNJA 5GINE 3TZHA 1N0IA 1ZVJA 5FOTA 4QEZA 5F35A 5IX8A 1U28C 4UBKA 1YRWA 3OWOA 4H0CA 3R5FA 4X71A 4FKZA 4KQWA 4LHXA 3INRA 3TRJA 4E5KA 5JYCA 5KQMA 1WP4A 2FVXA 2WSYB 4WZBE 2XMGA 1BJTA 2XNDD 3SQLA 1FBNA 1Q95A 3CLUD 3FPJA 3FPAA 4QUAA 3OOWA 2QF7A 1BCSA 3N0TA 2PKXA 4LI3X 2WHRA 3CNQS 3TK1A 2QVXX 3LUCA 1U2PA 3RBZA 1BCSB 3WMGA 4CODB 3E1KA 5A06A 2VUHB 2HHCA 1QC5A 3QVGA 1O77A 1T6XA 1HDOA 1U02A 1IK6A 9LDBA 3OPXA 1NP6A 1YZTA 1VHWA 2FQQA 3ZDAA 1LPBB 4KVZA 2CHUA 4FYMA 4BDTA 3N53A 4DAEA 2C4TA 3AR4A 2V9PA 4KXQA 4W5WA 5AJZA 5FKJA 1IYZA 5LQCA 3C48A 3H1FA 1N9KA 4FHEA 4M9ZA 4N6NA 4DV5B 1MNAA 3IEVA 2ZSHA 1PEKE 1DTWB 2B1GA 4QAQA 2WU0A 1AM4D 1SCDA 3C7TA 5GADl 4AJLA 2E4YA 1TAHA 2ZUFA 2GSWA 5CYGA 3GJ8A 1EDEA 2PUJA 10MHA 1X8JA 3ZJ4A 1YE5A 3TTXA 3T3NA 3AT1A 4ASUA 1YQUA 3A3YA 3T8YA 3EMBA 2WJVA 3KOZA 3PQ7A 5ELXA 3WB1A 1DEKA 3FMFA 1SBCA 2V7BA 1R4AA 3C98A 4GI3A 3RSFA 4RZSA 5JS6A 1NY6A 3G2OA 4B4UA 3HKBB 5BNZA 1XSEA 4HNHA 4RSRA 4PM4A 4N3CA 3IDOA 2WDZA 3IIMA 1N5LA 2OUKA 3AHCA 2P6NA 4D9BA 2W70A 4MQFA 5JC1A 1DG1G 3QEKA 4FPXA 5BN5A 3GNTA 1BKSB 3WS7A 1M66A 2E4WA 2QZZA 5BPHA 4P08A 3U56A 1JSCA 3LBHA 2FU5C 3ZWWA 3JWPA 1CDZA 1XZQA 1ZL0A 4XWWA 2R8ZA 2QRHA 3NDRA 4XR4A 3TZKA 1EQUA 1KE1A 5I4KA 1N78A 1L5WA 2O3QA 3SOZA 1JR3D 2ZRMA 4V02A 2QTNA 4NZ9A 3S3TA 4YV2A 2ONKA 2O1SA 4JOSA 1E2GA 2WFLB 3OJFA 4AF6A 5DT2A 4F4HA 4CGZA 3QVWA 5JAZA 1QBKC 3WLFA 5BRNA 4U9IS 2J30A 1T8UA 1MO6A 2G83A 1DI0A 3CBGA 3I23A 3K31A 5AJHA 1AURA 3WR5A 3STTA 3TTYA 1WUYA 2WIGA 1L5GB 5B6PA 4DHEA 3PZRA 5BQPA 4ZVPA 3G2LA 1AQYA 2AV6A 3OU2A 3ACCA 4GVXA 1D6SA 4Q9AA 1WPRA 1WSDA 1Y34E 2Z4SA 2ZIXB 4S1TA 4XLZA 3ND8A 2XI4A 3EW9A 4BL5A 1IH8A 4CM6A 4D80A 5KEIA 2QN6A 3H2IA 4Q1EA 3SJ7A 3PC6A 2CHQA 4GOJA 2IOFK 5EWJB 3I0NA 2VSOA 5KVCA 3ADPA 1E7YA 4ECEA 3KQKA 1AS3A 2P90A 3G5TA 1S3FA 3EA4A 1O6ZA 3T54A 4HBGA 5DX0A 1BDMA 1E18A 1UWLA 1W5TA 3AYZB 5AI5A 5D8DA 5LP1A 4M55A 2YCBA 2IELA 4Q4CA 3L6OO 3I6QA 4UAJA 4FBGA 4O63O 4KUHA 2Q3LA 1R0KA 1DBWA 3Q85A 3JZFA 4BQNA 3MGCA 1U3VA 4DSZA 1PJRA 4TKLA 5DCUA 1L7DA 3JQ7B 3D54D 5FBZA 1C0LA 5L7TA 4O2AF 3FTDA 4P58A 4XUDA 3WLIA 3DGFC 2WBLC 3M6MD 1N32B 3SS8A 2AMYA 2GAAA 1R9MA 4ARZA 5IF3A 4XGKA 3LX6A 1UBOS 4Q4AB 4ZEXA 5D3MA 1YS2X 2FX3A 3WL5A 4Y6OA 1YZFA 1QCZA 1ESZA 2YKGA 3SSOA 4LWOA 3PRHA 4A8HA 5LOVA 1QCDA 1EYZA 1T4CB 2G28A 2HCTA 2WTAA 3DVRX 5C7LO 5IHXA 2ZTVA 2CXUA 2A9PA 3WWDA 2GN6A 1RYMA 4FMPA 2ZJ6A 3RE1A 1PT7A 2J4DA 1FNBA 2CZGA 3CR7A 1BOOA 1ISJA 1HORA 3TOSA 3G2KA 3T4EA 2CLFB 4HRXA 2O4CA 2RGNA 4MGZR 5LXTA 2D2XA 3OMXA 4UMVA 3HN2A 3BJMA 2FNAA 1MABA 2Y0PA 1OKKA 1SKBA 5GV8A 1WCXA 4REQB 1RXVA 2V1UA 1RBYA 4EG5A 4AN4A 4LWZA 2EL7A 2BFAA 5BURA 5DBGA 5I7VA 5IG2A 5CEJA 2WYIA 3R6LA 1L5MA 1NVGA 1C7EA 3S68A 1RC1A 2EW1A 4GM0A 3JPWA 1HNXB 4AUEA 3RS2A 3QZUA 4EF5A 2C4KA 2GJ9A 4QDZA 5JYEA 1C1HA 3A4MA 5TQ2B 3ZQ6A 3ZDEA 1D0VA 2AMVA 3DOHA 4ABYA 4L5AA 3LWBA 2X22A 3OLQA 5K0CA 3SICE 1DE0A 4JUBA 3KXLA 3BIOA 2ZRGA 2X8BA 4NECA 4UCWA 4ME6A 5DN6A 1DUIA 3UT5B 3U5TA 2P9TA 4PLCA 4CKBA 2QRVA 3MB5A 1KJYA 1PN3A 4MQLA 4NQZA 3UJ3X 3BB3A 1OIXA 2POCA 1ZBDA 5EERA 5IJ9A 2WW8A 3SKXA 4E3WA 3PLRA 5IJ0B 5JD4A 4LNUA 4HZGA 1JX6A 4F7WA 4PZAA 3O83A 2MJLA 4EKIA 4IDBA 2O2ZA 5K05A 2CDRA 3I83A 2JD2A 1HLGA 1X1TA 2QSZA 3JQ9C 1CERA 3SZRA 3UHPA 2A59A 2X2PA 1LC0A 3GLQA 3WRXC 4BC1A 5ARDA 1CQZA 4OXYA 1VL8A 3PNSA 3OWXA 3U4MA 4CR8A 3NMUF 3FAKA 1RLUA 3BJEA 2N1BA 3L84A 4BO4A 2Z43A 3SZOA 5JTTA 4EX6A 4ZYWA 4YTEA 4OLAA 2WK1A 1X7ZB 4H7IA 4JJ6A 1QZUA 1U8YA 4JI0B 5DGXA 3QKSB 3H8VA 1S02A 5AKLA 3W3AD 3KUDA 3UY4A 4H6PA 3ZBUA 3OIDA 4ESHA 4ZTZB 4D57A 4WK2B 5AESA 1A9RA 3MG9A 1EFCA 3KZKA 1SHKA 1A2KC 3AX6A 3KTDA 4J29A 1XNHA 2ACKA 3GLFB 4FIZA 1THGA 3T3IA 3WIDA 3LUDA 5DN9A 4ZHQF 1PQWA 2YWHA 3O8QB 2XTZA 3AF1A 3A10A 3HU1A 5BV1A 4XYLA 2EAUA 1Y8QA 1FUUA 3E8XA 4GPIB 5E9JA 3ZTWA 5HK8A 4BNXA 3I6BA 3ZDYB 1B7GO 3RVQA 4CBVA 2IOHA 4B7XA 2DU8A 1E2LA 1PHPA 4RZUA 2EZTA 1SBNE 1H22A 3F1LA 3W7AA 4L22A 4DE5A 1JG1A 2OCXA 4PXSA 3ZV3A 1Z6PA 2BCEA 3QW4B 4C6TA 1KI4A 2IRWA 2JEZA 4Y6LA 4EAAA 2XWQA 3Q7TA 4CTKA 2ZUVA 1J5XA 3MEQA 2PUVA 4EG3A 4F21A 5KQGA 5DK6A 2Z9BA 3IKTA 1RKQA 4X95A 4UQPA 2A0KA 2P0EA 2ZUWA 4LVCA 1HK7A 1X19A 3IA7A 4F3TA 3DBVO 2M98A 3HI6A 2CHVA 4MAMA 2J9FA 2NPIA 2R6CA 2WD9A 4IMRA 2IEGA 2OLEA 3VC7A 4JODA 3OE7A 5HZKA 4MGHA 3GD5A 4KTVE 1R37A 1IXYA 4UUQA 4W5TA 4TV9A 3VBEA 2YHSA 5T67A 2FLKA 2QLJA 3EZ6A 3QELA 1JF8A 1JS1X 1Z73A 3H9JA 3PX3A 2YC2C 5J2TF 4CWAA 1QRDA 4L2IB 1XHEA 3OE5A 1EGAA 1RHKA 4WZBA 1OWPA 3UK1A 1OILA 2PAAA 5P21A 2YFHA 5GZ6A 1FLVA 3C70A 1T0PA 3ZXUB 2E18A 1PJTA 4I0WB 3IP7A 5EZYF 1NA5A 4EF4A 1CUGA 2BGKA 4ENPA 1VLLA 1KYTA 2Z5VA 1G21B 4FI3F 1M7BA 2C4NA 3ADCA 4AI6A 1PVDA 2MHCA 4R6WA 3VR5A 3D6FA 3ZS9A 1I4EB 1QJ4A 4J43A 2D2VA 4MR8A 1O03A 2DCUA 4AL4A 2I62A 1MAWA 4MW9A 3S2FA 5EMKA 4F1KA 4JLKA 5BWOA 2AYYA 1EJ6A 3E5NA 4NL4H 1KZ1A 5HCIA 4B3DA 2R3SA 1PWEA 2PLNA 1BW9B 2IHJA 2NVUB 2QPOA 3DOEA 3EWNA 3X1WA 3FF4A 1QQAA 1FVXA 2H1RA 3FF1A 1G5FA 1GPH1 3NS7A 4WBNF 3M5CA 3RKUA 2GN4A 1KI9A 2CLLB 4MW5A 1F8UA 4LTDA 3REGA 5JXHA 4IRXA 2AMJA 2WPDD 3TAUA 1CUEA 1MNQA 3AI3A 3WSTA 1K5HA 3CRZA 3ECSA 1L5HA 4DSAA 3DWFA 2CJWB 3FHOA 4M49A 3TCKA 1BZYA 2R8XA 2WR8A 4IH9A 2MSDB 3ZK9A 3UT0A 5DM2A 5DNDA 1R50A 3HVRA 1GNQA 4OHXA 4LFBB 4C4PA 1XDGA 2A57A 3KQMA 2BPOA 5LDGA 3RIHA 2YRXA 4H7FA 5E95A 1DZIA 1HDEA 1QZTA 1UJCA 4YRTA 3ICVA 3OZAA 5HTKA 1D6NA 5DNWA 1Q1NA 5BNFA 1PSWA 3AUYA 4FEYA 3ZU4A 3CNLA 3LDHA 4EHAA 4N5LA 1JG6A 16PKA 3NBFA 3NDJA 1HLDA 2XX3A 2PBRA 3BXZA 3LT1A 4UEJA 1JB1A 3EXG2 4QNMA 4G9BA 3WSWA 1L5FA 4G07A 2BKXA 4IZOA 1U81A 4AKSA 1YQDA 5D51S 5TGTA 4YJGA 4K2HA 3TS1A 5CT6A 5IZ4A 2R8BA 3M5WA 3OU7A 4WGFA 3WISA 3IL2A 5K4AA 3HJGA 4KLNA 4C7XA 1ZD2P 4BIIA 3B82A 1YJQA 3C6XA 3CMMA 3K30A 3T7CA 1ZGAA 1ZNWA 1QG6A 5CU7A 4IJVA 3C3MA 4IZ6A 2YWRA 4N9QA 3A37A 2C3PA 5F52A 3SN6A 4B09A 3OHMA 4DMMA 5I48A 1XTSA 3F9CA 4MV8A 4JL8A 4PFSA 1ZRNA 4R2LA 4ZCRA 2OMEA 3S2GA 3IALA 1NHWA 3DDUA 4CN9A 4JJ4A 1AGYA 2O6HA 3AUTA 2ZIEA 5EHQA 5J2UA 4ECAA 1P1BA 1UQUA 2SNIE 3DDHA 3E7WA 3TH5A 1PT8A 4PCVA 2GILA 2BDUA 2Y6UA 2PSDA 4GRAA 3S6JA 2DSNA 4BBPA 5HUQA 5L3QA 1ZOSA 2HRCA 5GONB 4ZWNA 4AWBA 2DH6A 2J07A 3ZXYA 1SKAA 4V1CB 2NTNA 3PUVA 2V3VA 3T5CA 3ZW7A 1VLHA 2J0EA 4LYFA 4UTVA 1EBFA 5COQA 1O3YA 1VL5A 3IA2A 1K75A 1WZCA 2CLCX 3KFXA 3O38A 4H3SA 5E8JA 1X86B 5LA6B 4G23A 2XZTA 4MWTA 7YASA 2C04A 3NAQA 1SU8A 1XQXA 4KZPA 4BEWA 3VPAA 1B43A 2OBLA 3FCEA 3GRPA 5DM60 3HJAA 3ZQUA 2JBWA 4ZDKA 3DEJA 5BUSA 5J43A 5J4HA 3NI2A 3U7IA 5B3JA 1FP7A 2VJMA 1I1QB 3N8KA 2AI2A 2I2WA 2QLTA 2QLLA 4S1NA 4PHCA 2XJ9A 4KWHA 4LYAA 3ZCRA 2YMPA 5AI8A 2XE6A 1CUIA 5HM6A 3EBLA 4DNXA 5J2TB 3O93A 1NMEA 1CQJB 3A2NA 3IBTA 3HJUA 1RSZA 5CYPA 1U0OC 4OU5A 3O8OB 3ZK8A 1RIIA 4PRKA 2F1OA 2H5JA 2I8AA 5IUJC 4M4SA 3QVLA 4FEEA 2QE7D 1J90A 1HUQA 1NULA 2NT4A 2WRZA 4W6QA 5EXTA 5B1EA 5GY7A 1YMUA 2WZCA 4IP0A 1Y4SA 2RAPA 3CG4A 3D3WB 2YFKA 2A0WA 1W25A 1Y48E 2IE8A 4Z9YA 2JFWA 3KQTA 4PN7A 1O08A 1P18A 3IPXA 4BKPA 5K0ZA 2XB9A 5EEHA 1TQ2A 4LMAA 4K9LA 1OB2A 1A7KA 2IEDA 2XZDA 3AF3A 4FGJA 4MWZA 2HV8A 1V5WA 3FNHA 2EFGA 3O94A 4ZPXA 4YJ2A 2FEOA 3MT9A 4Z4QA 4RVDA 5DRTA 1MN6A 2BM0A 2OORA 4INOA 2O3SA 3EZ7A 4B4OA 4KXMA 4UD2A 3TD9A 5KNDH 1BX1A 2QN7A 1AXRA 3DKIA 2IY9A 1UMCB 1ECBA 4CKEA 2LZ0A 1WMFA 4G0NA 4CQNA 1FP6A 3CWCA 3D7SA 4DAOA 621PA 2H1FA 3L7CA 4B6QA 4BB9A 3LPLA 1TUBA 1GTJ1 5CVUA 4C3OB 4OHCA 4K9NA 3DKRA 2UZAA 2EBFX 1NW7A 3CLTD 3JD4A 3ZK7A 1KH2A 3KJGA 4L73A