1EVYA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A potential target enzyme for trypanocidal drugs revealed by the crystal structure of NAD-dependent glycerol-3-phosphate dehydrogenase from Leishmania mexicana.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
molecule keywords GLYCEROL-3-PHOSPHATE DEHYDROGENASE
total genus 131
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2000-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1evyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evyA01
4MP6A 3ZV3A 1EDZA 2P9EA 2X0JA 2SCUA 3DTTA 4A27A 3PVZA 3WOHA 3ZWBA 1G6KA 2YYYA 3L9WA 1I3LA 4XYMA 4MIOA 3Q3CA 4CM5A 4U0KA 4EDFA 3P2OA 3DL2A 2IEDA 2FZWA 4CV2A 1CEQA 4OQZA 1H6AA 3RCBA 4BKPA 4LK3A 3WSVA 3CUKA 2W2KA 5DBIA 2GPTA 1CERA 3GVXA 4DBZA 3E9NA 1KEWA 3DBLB 1ENZA 3AY3A 1PJ4A 3TZCA 3RAJA 1U4OA 2B4QA 1YO6A 1LC3A 3FD8A 4BO8A 4BNKA 2GSDA 4NU6A 2GR9A 3EK2A 3FR7A 1VJ1A 4RVDA 2O7QA 4KWIA 5EN4A 6LDHA 5C5IA 3B1JA 3GRPA 4IXWA 2P5UA 1NXQA 1ZEJA 3PK0A 3FNHA 4W82A 1H2HA 4OGWA 4I9UA 2YUTA 4ND3A 4TKLA 2PFGA 3RBXA 3WMXA 1IZ0A 3G1TA 4AJHA 1YWGO 4D43A 3WB9A 4UVEA 3X2EA 3TPCA 3NDRA 5JSFA 3JQFC 4R41A 2BKAA 4BO3A 5I7FA 1YJQA 3QWFA 3P7MA 1ADBA 3C7AA 4LN1A 4GL4A 3NT5A 2XXBA 4S3MA 4U6QA 1NTOA 1EBUA 2P4HX 1MXFA 2GCGA 4J16A 4BKUA 2QQ5A 4XGNA 3EC7A 2O3SA 5FEUA 4IGFA 5F21A 2DQ4A 1YONA 3X2FA 4GBJA 4J4HA 3S8MA 1SEVA 4BHTA 3UCXA 1HDYA 5IDYA 4GWGA 5HM8A 2B4RO 5ADHA 3D5TA 1U3VA 2X6TA 4N5LA 3JQBA 4CV1A 1K5HA 1T25A 5AXCA 3TRIA 4AJEA 2WD7A 2X5JO 1LDYA 1NWCA 3ZI0A 2DFVA 1PL7A 4WCDA 2J5KA 3C7DB 4BNUA 4YRBA 1VSUA 1BW9A 5A9SB 4PG4A 3QWBA 3MJSA 4CM1A 1NR1A 3PHIA 5TT0A 5ENDA 2FMUA 2OP1A 3M2PA 1HYGA 2X0NA 3ZW9A 1EVZA 2NVUA 5C7OO 1GDHA 3KVOA 4HP8A 4BGUA 3PJDA 3FPCA 4E2ZA 1QP8A 3PGJA 3VPSA 3CTMA 2Z1MA 3WTCA 4E0BA 4Z6KA 1OC2A 4ZVVA 3G49A 3CIFA 4IJWA 5U4QA 3VDRA 1W4ZA 4A73A 1YRLA 4CUZA 2UV8A 3HUDA 4CUKA 1P9LA 4P4GA 1GU7A 3AK4A 3DZFA 3FBTA 1R12A 3M6IA 4BGEA 4BNMA 3JQ7A 4NBTA 2FOIA 3FN4A 3JQDA 5A5FA 2AQHA 4MO2A 2JHFA 5JY1A 3C3XA 5G0TA 4YAJA 2CZCA 5I7VA 2D5AA 2CVQA 4OM8A 5BNIA 4LVCA 2I3AA 4EW6A 5L4LA 3T7CA 1AUPA 1DDOA 4WEOA 3DR3A 4CMBA 3VOSA 1NNUA 3BTOA 1KC3A 5GZ6A 3ROQA 4YJGA 4DUPA 1DB3A 5ES3A 5B4UA 2IZZA 4ZHSA 4DGSA 3RD5A 1AHIA 2JL1A 2RHRA 1NPDA 2FPIA 3JD0A 3H9GA 1HE2A 2GUGA 4GMFA 4E12A 3WG9A 1GPDG 1LRKA 1BXGB 3RFVA 4ID9A 4L73A 1B0AA 4KUHA 4CR6A 4KZPA 4CR8A 4YQYA 3O4RA 2W98A 1AXGA 3C1TA 2FSSA 3K2EA 2VUTA 4U8GA 3TOXA 3C8MA 5KVSA 4YT5A 1EDOA 2NV6A 4RQUA 3W4KA 3ZWNA 5BT9A 4AJKA 3A9WA 3GH3A 1UDAA 2ZB3A 3S55A 1UZNA 1R4NB 2B37A 1E7MA 4D79A 4DXHA 5DBFA 4PCVA 4F46A 4ZICA 2PZLA 3TFOA 3WS7A 1OBFO 1RM0A 3QA9A 4BNJA 1PGPA 2FN7A 3PWKA 4CQMB 4YJHA 1DLIA 3HB4X 4RVFA 2FSVA 3K5PA 3RUFA 1E3JA 2NWQA 1IZ9A 4FFNA 1B8VA 4IMPA 1A71A 3HDJA 1KOLA 3PIDA 3HN7A 4FW8A 2W8ZA 2Y0CA 4B8WA 5I9NA 4TVBA 4EEZA 2P91A 3AUSA 1PGOA 1BXZA 4E33A 3GMDA 2RH4A 4A0SA 4XYBA 1X1EA 3GZ4A 3PQFA 4OSOA 4AG3A 4CMKA 4R68A 1Q0QA 2Q2QA 5A9RA 5JS6A 3D1LA 3BAZA 3WYBA 1Y8RB 3PIIA 4CQMD 3WGIA 4B8ZA 1E1LA 3WX0A 3ADOA 1B14A 3WGYA 3G17A 1K6XA 3STHA 4EGFA 3FI9A 1OZAA 1SC6A 2B35A 5KVCA 4PZCA 1WDMA 2Q1WA 2OORA 3FBGA 3IKTA 2QRJA 4N7RA 1VL0A 3ROPA 2YY7A 1YB5A 2Q50A 3A28A 4YA6A 5DCYA 2PWZA 3HHPA 3I9MA 3NDIA 2Q2WA 5A9TA 4IS2A 5H82A 3VH4A 4CM4A 4WOJA 4LMPA 4E2XA 3S2EA 3GVIA 4YTEA 4NBRA 2P5YA 1Q0LA 2V6BA 4FB5A 2J5RA 4JNKA 5ER6A 3WXBA 1UH5A 2ZYAA 3WFIA 3OSUA 1C1DB 3RUDA 1JA9A 1NPYA 1MC4A 1LLDA 1GCUA 4NJMB 4DLAA 3OETA 3DO5A 1WZEA 4R3WA 3W8EA 1V0JA 4LRTB 5A3VA 1DRUA 4CLEA 1UR5A 4GMGA 5I8ZA 3LVFO 9LDTA 3BMCA 2WE8A 3KLMX 1FF9A 5LCXA 3PP8A 4HWKA 4BV8A 3PRJA 1B16A 2QYTA 3SLGA 3HWRA 5DCUA 1NBOA 1FK8A 3A14A 4FJ1A 1ADCA 1QLJA 4NZ9A 4RVUA 3JQ9A 3DC2A 2AG8A 1PTJA 3EVNA 1QYWA 5DN9A 4J7XA 1X13A 1Z75A 3JD4A 1I8TA 1P74A 5F1PA 3QQPA 3VTFA 1LDBA 3OBBA 3KOUA 1T2EA 2Z5LA 5JAZA 4AJNA 1QV6A 1RM5A 3TDKA 3Q11A 4K9DA 4W4TA 3OH8A 4CLOB 5DT9A 5KWEA 3H4VA 1E7QA 3UOGA 4UEKA 3I9OA 3NTRA 4FFPA 1VSVA 3PJGA 1BGVA 4TZKA 3OQBA 3BYZA 4XIJA 3ZWOA 1A27A 3IUPA 4GX2A 3RJ5A 4DPLA 5CFZA 2I65A 5C37A 3DQPA 4XGKA 2AQ8A 5L51A 1KBZA 2DBQA 5GZ3A 1ISJA 2NTNA 5EERA 3AFNA 3H7AA 5FI5A 4E6PA 4YAEA 4GQAA 1E3SA 2GN6A 4NQZA 4NJMA 3ICPA 1JAXA 2PNFA 4Y6SA 5BQFA 4Q3EA 3QE3A 1DAPA 3RVDA 4FSHA 2CDBA 5KJFA 3JQCA 2BELA 1U9JA 4JJFA 3L9XA 4QT0A 4W9NC 3BTUA 3R3JA 1JAYA 1FDVA 1R0LA 2I5PO 2Q49A 3GVCA 4PLHA 2FPGA 1MLDA 1LRJA 1PL6A 4CMEC 2F00A 4W99A 4CM8B 2I67A 1FDTA 2E4AA 3E5MA 2AEJA 2HJRA 2W90A 3JQGA 4MVJG 3QRWA 4OHUA 3TN7A 2CSUA 3TF5A 3EZYA 1V35A 4BO0A 1TT5B 2V6FA 3U4CA 2UVDA 1P1IA 2E6UX 4AJ2A 2UDPA 1P0CA 4R5MA 2X7HA 3KHUA 1ARZA 4CLXA 1YGYA 3FHLA 3R0IA 3H9UA 1NVMB 2XOXA 1YKFA 2OUIA 2I6TA 2YHIA 4JN6B 4L74A 4YRDA 2YFQA 1GFSA 2ZJ1A 4Q3NA 4PLFA 4D42A 3GF4A 4FGSA 4DMMA 3RIHA 4ZQHA 2XAAA 3DZGA 2PH5A 3RBZA 1NFQA 3LSYA 3RROA 3AOEA 1T4DA 1N8KA 1PZGA 3MEQA 1WP4A 3OIFA 1D4FA 4WECA 5L95A 3ST7A 1GZ6A 1D1TA 1DXYA 2OMEA 3OQ6A 2Z1NA 2HKIA 3DWFA 1EUZA 1Q0HA 3W6UA 1XQ1A 4L76A 5DOZA 1PQWA 3TJRA 3PWSA 4WASA 1VKNA 3TZ6A 3ETGA 1FDUA 1NQAO 1YXMA 3MZ0A 3OHSX 1OMOA 4L4SA 2X5OA 5ILGA 1ORRA 1S6YA 3CZRA 3W1VA 3GHYA 4QFCA 3I5MA 1GZ4A 4BO9A 4AJ4A 4DQUA 5G0WA 2ZCVA 4YAKA 4H7PA 5DP1A 3OJOA 5A05A 4RCVA 3V2GA 4Y9DA 1YQGA 4R01A 4JP2A 1L7EA 2J3JA 4AJOA 3O8QB 4IDAA 4B7CA 5A3JA 2WYUA 3GG9A 4PRLA 1K89A 2E48A 3AOEC 1MXHA 1X7HA 3FRJA 3L6OO 4JIGA 1UXHA 2C54A 2YFHA 3MJCA 4UEOA 3JD1A 1JU9A 4UREA 3WJ7A 4D3SA 4BNYA 1MUUA 4XRGA 4NMHA 3JQAD 4Z9FA 3GGPA 4BUCA 3GRKA 5JYDA 1XCBA 2V6GA 3ZU2A 3PHGA 3U62A 5CDYA 1GQYA 3AW9A 4HY3A 3ZNNA 2V7PA 4I8XA 3RBVA 5AVOA 4KQWA 3NRCA 3UFXA 2IYPA 2NVBA 3QWIA 3DTYA 2PD3A 4R9SA 4NPCA 5JPIA 5IN5A 2NU8A 1YL6A 2CNBA 5JBIA 2X22A 4EI2A 1B2LA 2NQTA 4CMEA 2O3RA 4J91A 3UVEA 2Q1SA 3U5TA 1VC2A 2WTBA 3JQAB 1P1FA 2O3TA 3OA0A 2EG9A 2ZYDA 2C7GA 1JKJA 4PG7A 1NYTA 3ITDA 2VCYA 4URFA 3NYWA 1DFGA 5FYDA 4XDZA 1T2AA 4ZRNA 3H5RA 4XB1A 2VHVA 3RUIA 2NQ8A 2YV1A 1AXEA 1DBVO 1BWSA 4K6CA 2WM3A 1U7HA 3RUHA 2C29D 1P0FA 4Z0HO 1NP3A 4XJTA 5F1KA 3PQEA 4B3JA 1ZJZA 4DYVA 1IHXA 1N2SA 4DBVO 2IYOA 2WYWA 1WW8A 3WLFA 1M2WA 3I4FA 2TMDA 2A35A 5U9CA 3KEQA 2X58A 1R37A 4BO5A 1RJWA 5JDIC 5KOIA 4Q3CA 2Y1DA 1SB8A 1Z6ZA 2C0CA 1TB4A 1XA0A 3OICA 3DONA 4A26A 4FFLA 1ZIDA 3D4OA 2NTJA 4QFDA 4QEDA 1E5LA 2D59A 5TSDA 4RORA 3JQEA 4J2OA 2VOJA 2D8AA 2FZEA 3GDOA 4NBVA 4Z9YA 3WQRA 3B1KA 2HDHA 5K6AC 1EK6A 1YS4A 3UW3A 4EZBA 1FDSA 2JCYA 3GEGA 3LDHA 1D7OA 2HK7A 1ADGA 5AOVA 3SX2A 2EP5A 1T4BA 1LDMA 1NHWA 4Z0TA 2X4GA 2J3IA 4IIUA 4RF5A 5KVQA 1H9BA 3TL3A 4BNVA 2BFOA 2HLPA 2EKLA 2G0TA 3RASA 4N5NA 5TGDA 5EIOA 5DDIP 4B4VA 4A5OA 3MWDB 1V3UA 2W4QA 1Y81A 3QP9A 2OL4A 1ISFA 1SOVA 3LF2A 3GNSA 3JQBC 1FXSA 4KMSA 3W4IA 4IQ0A 4CMCA 1E3EA 1BRMA 1DPGA 4MKZA 5TLSA 1JTVA 1WNTA 4EBFA 1UDBA 1JWBB 4CM9D 5L53A 2V65A 4NFSA 1DC3A 4E2YA 1XR3A 4UULA 2IZ1A 1W73A 3RU9A 3IOYA 2EGGA 1W8DA 3VPXA 4CM6A 5KJ1A 3KYCA 4GLLA 1WVGA 3H9JA 5TJHA 4CL3A 3K9QO 1HEUA 2HRBA 4E4YA 3OJ0A 1HLPA 3BA1A 3NJ8A 3ZWAA 4FIZA 1CQIA 2H63A 5EPOA 1ZMOA 5J23A 1PS8A 1N1GA 2AHRA 1DOHA 3I9NA 3UCFA 3BTVA 1TEHA 1YB1A 1E6EA 1KC1A 1W6UA 3Q6IA 1NAIA 2Q45A 4ALLA 4EUFA 3WSWA 3WGGA 4HFNA 4B7UA 1U7TA 4BO7A 1GUYA 2R2GA 1PQPA 5EINA 5LC1A 3GR6A 2CDCA 2HUNA 3H3JA 4EUHA 5G0SA 3GFBA 4BNIA 4B3IA 4E21A 1N92A 1XKQA 3H5AA 4HNGA 4NDNE 3GN1A 1A4IA 1NQTA 3VKUA 3QVTA 1XIVA 3I4CA 4KTTE 8ADHA 3P5SA 1A9YA 5B4TA 1A4UA 3PGXA 4J4TA 3R1IA 1NQ5A 2BGKA 3GUCA 3B6ZA 2PZJA 1DSSG 3QVXA 4PLYA 4LISA 1W0CA 3INTA 2X9VA 1UZMA 1X1TA 5A06A 3ZWCA 2NVWA 2WWRA 1IPFA 4RPKA 4BNTA 1NAHA 3AM5A 4GGOA 4XCVA 1K2WA 3Q9NA 2IE0A 3WQSB 4TMFA 4OYRA 1E3IA 3VH3A 1QR6A 4PFJA 1N7GA 4OAQA 3RC9A 1HF3A 2X8LA 3GVPA 3QLJA 3JQ6A 3OFSA 4WK6A 1RPNA 1GYPA 1B3BA 4FBGA 1CQJA 1GCOA 3A1NA 4MPDA 3WGTA 3RSHA 4DVJA 2VNAA 2Q1UA 1SMKA 1JKFA 3JSAA 1LI4A 3PHHA 4PLCA 1CETA 4H15A 1MB4A 3I1JA 3RU7A 2Q4EA 2O4CA 3BHMA 4WPGA 3PWZA 1Y5MA 3I6QA 4H16A 1M76A 4I9NA 4MIYA 7ADHA 4RPHA 2DUUA 2QYSA 4FQ8A 1RM3A 3BZUA 4Y6RA 5GY7A 1O0SA 5ER9A 2AEFA 3R6DA 1IUKA 3NJ4A 2QZ9A 4E13A 5DBGA 1OI7A 2VWHA 2Q99A 1X15A 1NVGA 4XQCA 5IDQA 1PZEA 1R4MB 2B36A 2BHLA 2OGUA 4Z0PA 1X0XA 2XF8A 4DREA 1YDWA 2AE1A 4JP3A 4YT2A 4QUKA 4ZQBA 1PIWA 1UUFA 4IINA 1Q1NA 3IIEA 2RHCA 1KIFA 3QSGA 1PS0A 2AA3A 3ONDA 4K1LA 3KB6A 3V1TC 1GEGA 1GTMA 2FRDA 3FSRA 1O6ZA 2A94A 4A2CA 1BTOA 1GPJA 1UXIA 2ZTVA 3SJ7A 3L07A 4QTZA 5KIAA 1SNYA 1DAOA 4BIIA 2DAPA 2ZQZA 3F46A 3WTBA 3E8XA 4RPLA 3TZHA 2YDXA 4O0LA 1MFZA 3DXFA 1YOVA 3B70A 2CY0A 3GGGA 3LT4A 5TX7A 3KUXA 2YJZA 3VH2A 1WWKA 2B83A 3ANNA 4XGIA 4LCJA 4M86A 3WGOA 1E1MA 1ULSA 2F1KA 3H65A 3Q0EA 4CQMA 3LK7A 4CMGA 3AI2A 3WIEA 3IJPA 3I3OA 3JQ8B 1ZUD1 4RL6A 1VI2A 4OMUA 1LSOA 3FTNA 5LDHA 3F4BA 2Q1TA 2HK9A 4Q3AA 4D44A 1QYXA 1KVSA 1Q7CA 1PJLA 3QWHA 3UGKA 1R4MA 3E18A 3LC2O 1Z45A 3MOGA 3RC7A 4YCAA 4RDIA 3ZV6A 2I76A 2DBZA 2O3QA 1LDGA 4MVJH 3WDSA 5A03A 3KETA 4BNXA 4DC0A 4E5YA 2X0IA 1AE1A 2PV7A 1ISHA 2DM6A 3BIOA 4RLSA 4Q3DA 4WLNA 5KJEA 3JQ8A 4WLFA 2DTDA 2PKQO 2Y0EA 2QHXA 3IMFA 4GGPA 3Q9UA 4L4XA 5CG2A 1ZH8A 2R00C 5COQA 4JBGA 2I3GA 3IC5A 1KS9A 2HMUA 1XU9A 1PWZA 1ZO8A 1DRVA 3OJFA 3D4PA 4IQGA 4BO2A 4DTIA 1DO8A 4CV0A 1Y5RA 1BXGA 2RCYA 2UAGA 3C24A 3JQGB 5CHEA 4D45A 4WLEA 3NGLA 2I9PA 4DC1A 4BO1A 1KVRA 1DIHA 3NDJA 1O94A 1ZSYA 3IUSA 2Y1FA 3WQQA 4OKIA 3PFWO 5CEEA 4BMVA 1WZIA 4BKRA 4H3VA 4XD2A 4HNHA 2JHGA 5LDGA 3HNPA 5L40A 1RWBA 3C7CB 4E5KA 1YH3A 3NTQA 4BOYA 4J7CA 5F1OA 3HADA 4CL8A 4AJIA 5DOVA 1ZK4A 4KTVE 3ETDA 2OZPA 2EWMA 1P33A 3EY4A 1HYEA 4PLZA 4W7HA 4FJ2A 1TVEA 4TSKA 3ZN2A 4OO3A 2BI7A 5L45A 3GAZA 1PJCA 1UP7A 2LDBA 4PLGA 1L7DA 2ZB4A 3ZWPA 2OBYA 4L9RA 1PR9A 2EV9A 3RUAA 3H8VA 3FR8A 3AI1A 3DHEA 4CLOA 4GX5A 1SCUA 4CLHA 3VVCA 1I3KA 3IL2A 1P1HA 4Q9NA 1NPTO 4MP8A 2Y0DA 3JTMA 2P9CA 4XEHA 1PWXA 2NSDA 3H2ZA 3H3FA 1PQUA 2JKVA 3GGOA 3PZBA 3EYWA 2QW8A 4FD3A 3BMNA 2O4UX 1P1RA 3WR5A 1XYGA 4U0JA 2VYND 1Y6JA 4RZIA 3LQFA 1DHRA 2W2LA 2VUUA 3D5QA 3ZNQA 1ISMA 2DPGA 3ZCXA 5A5EA 3DAGA 3R3SA 2HMVA 2C5EA 4BKOA 3RJ9A 1ZSNA 4PVDA 1EE9A 4P22A 3S2FA 4HKTA 2UUPA 4JROA 3P19A 2QZZA 1F14A 2RIRA 3O8QA 3ENKA 4NG5A 4FPXA 1ZKMA 4DYDA 4IXTA 1I36A 3CMMA 1R15A 2NACA 3ZWYA 1WLYA 5IN4A 3GFGA 1E7SA 2PLAA 1HXHA 1I2BA 1KEVA 2E37A 4Y67A 3JYLA 2EEZA 2VOEA 3GZNB 2QG4A 1R66A 1GYQA 2E49A 4BVAA 4LCEA 3CXRA 5T8KC 1C3VA 3BXXA 5B12A 4K28A 3ADPA 4UUMA 1HSOA 3LC7O 5IJZA 5FI3A 1HRDA 2JCVA 3I23A 4XQGA 2CF6A 3KXDA 1YE3A 3K2BA 4DL9A 2ZB8A 4JBHA 3O9ZA 1HE5A 3OA2A 3QVWA 3AU8A 4CV3A 4J1NA 1LSJA 4YJFB 5JMPA 1EEHA 2DT5A 5BSGA 3RKRA 4IJKA 1YB4A 4MJLA 4JQCA 3GT0A 3BMNB 3LLVA 3OP4A 3Q1LA 4MOWA 4WE3A 4J4BA 1SPXA 3LU1A 4HFMA 3RWBA 2O48X 5G2OA 3T7EA 1GAEO 2Q4BA 5TIIA 4WCFA 1ZBQA 2HCTA 4FS3A 2H9IA 5CEFA 1ONOA 1MGOA 5JCJA 3BMQA 4J90A 2OO5A 3AUTA 2CF5A 3S2IA 3GMSA 2ZTLA 4PLTA 4U5QA 3U0BA 3GG2A 3HZZA 3LYLA 1MV8A 3KSZO 5C7IO 5BSHA 4GSLA 3C1AA 3O38A 2G82A 3AFMA 3Q2KA 2GN4A 4YDRA 4RGBA 1DLJA 3BHJA 3FWZA 1E3LA 1HL3A 1KVTA 2HO5A 4WLOA 1NVTA 3KRTA 2RBEA 4UEJA 1BMDA 1WXDA 3AOGA 3PPIA 4IM7A 6ADHA 1DIBA 4NU5A 1SAYA 3EAGA 1TLTA 3ZHYA 5JY6A 1LXCA 5KCZA 2DTXA 2AE2A 4G81A 4NNJA 5JW6A 1E6WA 4DWVA 4I08A 1FDWA 4HFJA 3UN1A 4O1MA 3JYQA 3AWDA 2HK8A 5U1PA 4DMLA 1IULA 4RZHA 3QW2A 4GX1A 1ENOA 3RC2A 3GVHA 5CDUA 4TQGA 3VZRA 4TRNA 4G65A 1E6UA 3AU9A 3UAGA 4O59O 4PZEA 4FR5A 5L9AA 1IYZA 4BNHA 4WCFC 4WCFB 3GA0A 2EIHA 4KP7A 4ZD6A 1NASA 2EGHA 2BGMA 5IXYA 5A04A 8LDHA 3HE3A 2Q2VA 1N9GA 4DIOA 5ITWA 2C82A 4RF3A 4FN4A 3QY9A 1XEAA 1U8XX 3DBRA 2QRKA 3WYCA 1QG6A 2WSBA 3RUCA 1JW9B 5AXAA 1M67A 4E30A 4ESOA 1IB6A 2EJVA 3GK3A 5A9SA 5ENVA 4HX5A 4JXKA 3CPSA 4CLDA 3D0OA 3TQHA 1TXGA 2NVUB 4AJLA 4NIMA 3DBLA 2G76A 3CMCO 4LRSB 2B5VA 4J7UA 4UUPA 3G1UA 4MVJD 1HWYA 2VHWA 1T1SA 1CJCA 1YDEA 2A4KA 4OH1A 4CM9A 2HU2A 5F5NA 2YHUA 2FR1A 3INGA 1C1XB 3LT2A 3MOIA 4ND4A 2HRZA 4BB6A 5JXWA 2IDZA 4J43A 4JX8A 2PKRA 4RVGA 1LQTA 3ROMA 2GDZA 3IKVA 3U4IA 1LBEA 4TRMA 5DCWA 1YBVA 2PR2A 3N7UA 4LSWA 1X7GA 2DBRA 5B37A 5BSEA 2C5AA 3GEMA 1GQ2A 2J5QA 4AVYA 3QVSA 1HETA 2O23A 1PR3A 2ZATA 1LA2A 3UHAA 1A7AA 5FWNA 5ILOA 1ZK1A 1TA4A 2CDAA 3L6EA 3L4SO 4AL4A 2VN8A 3DBRB 1MX3A 3HJAA 1Z7BA 5FFFA 1R6DA 2BLLA 3OEWA 4IGEA 3HN2A 4NFHA 3WWZA 1EVJA 1UXGA 4XYEA 1E0DA 4KUGA 1VRWA 1UZLA 3NEPX 3F1KA 3PI7A 4F6CA 1ADFA 2VZ0A 1IY8A 3TOZA 3DHNA 3F5QA 2GN8A 3EDMA 4D41A 2C07A 3JYOA 5CDGA 1ZCJA 3ZU4A 1QLHA 4IDEA 4Q3BA 4R51A 4RJTA 4WLUA 2DU8A 3CE6A 4FC6A 4ALIA 2Q3EA 4MVJE 5CAEA 4IS3A 3LT0A 3P2YA 3QWAA 1U5CA 1LQUA 3VAZA 1E5QA 4F45A 1EQUA 3KYBA 5CPFA 3NX4A 3N74A 4XRRA 1GYRA 2GZ1A 1T2FA 2EKQA 4UUOA 1XLTA 4OSPA 1NM5A 5JAQA 4J0FA 2IEBA 4R5HA 4A7PA 4CMIB 3KBOA 1H0KA 4NHEA 2PZKA 1T26A 3V1UA 3ONFA 5A4DA 5HTOA 4NJOA 2EW2A 2I66A 2DUWA 4IDDA 1WDKA 3QHAA 4LGVA 4O63O 2OXIA 4RV9A 1UAYA 1B3RA 3WIDA 1PX0A 2YDYA 4J49A 1N1EA 5G4LA 3HSKA 4PLPA 3C1OA 4PLWA 4LMRA 4WNCA 2BFAA 1Y9EA 2AXQA 2VQ3A 2HSDA 3KLPX 1HYHA 1ZVMA 1ONNA 4CMIA 4MVJF 1DC4A 4MVJP 4Z9XA 2WD8A 1I30A 3C85A 2ZTUA 1VJTA 2FR8A 1R16A 1IE3A 1V8BA 2ZJ0A 4ZQEA 4R1TA 5JYEA 1RKXA 4N5MA 3JCZA 4PGFA 4ALNA 1HDZA 4GAEA 3VZQA 3GQVA 1PGJA 1RM4A 3ITKA 4MP3A 4ROSA 1G1AA 5G4KA 3DZJA 2JJYA 3BHIA 4NH4A 3SXPA 3QJ5A 1R0KA 2NADA 2DLDA 1D1SA 4PVCA 4R4JA 5JC8A 4OOEA 2I99A 1PS9A 2BFPA 5TJ9A 4FFRA 1OAAA 2FR0A 1MP0A 2HMTA 1DHTA 4JJIA 1I10A 4YAIA 1WPQA 2IXAA 4FDAA 4CODB 1KY5A 2BF7A 3AUAA 4HBGA 2NU7A 4IIVA 1U8FO 1LTHR 3TZKA 3I83A 4I5FA 5EL0A 1FJHA 3GAFA 3IJRA 5CG1A 1ONPA 4R1UA 4K6FA 3H2SA 1HDGO 3VPGA 4W6ZA 4M8SA 1YBAA 2EW8A 5DULA 1B8PA 1YBMA 1VE9A 1ZMTA 4EYEA 1H6DA 2NLOA 4YVFA 2OBNA 4I5DA 4PLVA 3L4BC 3UCEA 1VKOA 3ZNPA 4QX6A 1U28A 3MJ4A 3BMOA 1GUFA 3FF4A 5AYVA 1PJBA 1T24A 4E5MA 1IPEA 3HQ4O 3OECA 1D3AA 3PYXA 2ZYGA 5L4NA 2ZTMA 1ISIA 5C7LO 4YYZA 1S7CA 1F8FA 1C0LA 2GO1A 3DAPA 5JO9A 1XHLA 3RFTA 5JDIA 2PZMA 1LLQA 1O8CA 3UUWA 1HDCA 1BHSA 4ND2A 1IL0A 1ENPA 4KDFA 4F3YA 1ZSVA 4BMSA 1OC4A 4RLHA 5TC4A 1QMGA 4BMNA 4C7KA 3ZWWA 1E1NA 2G5CA 5MDHA 3RUEA 3U49A 2B0JA 5DF1A 1GV1A 3V1YA 1K0UA 4BQRA 1O9BA 3DAFA 3INRA 3LZ6A 1PSDA 2J3HA 2D4AA 4RF2A 3AJRA 1U5AA 2Y1EA 5HA5A 5T67A 3U9LA 4TROA 3DFZA 5F5LA 2B5WA 2VWPA 2EXXA 2NU6A 2EF1A 2J8ZA 3HDHA 3V5NA 5EJ2A 5ICMA 2Y1GA 3NKLA 5DNAA 1WMAA 2A92A 3ASUA 2ZKLA 2W2LD 1AN9A 1C14A 1F12A 1ENYA 1PGNA 3U3XA 4YB8A 2EJWA 1QYVA 2BGLA 1ZXLA 3F4LA 3PJFA 4MVJM 3SLKA 3ZWXA 2Y05A 4CM8A 3AM3A 4YAGA 4Z3KA 4N18A 5TS3A 4Y8VA 2Y93A 1EVYA 2CMDA 3KEOA 1H93A 3LT1A 2AMFA 3E1KA 2C2YA 3EMKA 4E5NA 1XU7A 3PXXA 1GZ3A 3SJUA 4B4OA 1T2CA 2X0RA 1M6WA 3AY6A 1LDNA 2UYYA 1LSUA 3MJVA 3ONEA 1HE4A 3ANLA 4J2HA 3JV7A 4RVHA 1U1IA 1ZK2A 3AM4A 4FOOA 3UH1A 1I2CA 4NR0A 3W8DA 1QXSA 2AW5A 4G5HA 3JD2A 4EUEA 5G0VA 2BI8A 3JQFA 1H9AA 2PD6A 2UUOA 1BSVA 2AQIA 4DIBA 4XA8A 5I9MA 5IDWA 1J0XO 1LUAA 1TI7A 2J6IA 3ROKA 4IZIA 4TVOA 2DTEA 1HZZA 1FMCA 4MINA 1QYCA 2GLXA 4QECA 3WICA 1UDCA 5EMHA 4BNWA 3W4JA 1JDJA 1I33A 4AJJA 1X14A 3RQSA 1EFKA 1Y1PA 2VNSA 4KDEA 2C59A 1NHGA 4BQPA 4UVHA 1PJTA 2GF2A 4YR9A 3B1FA 1GR0A 3FNFA 2FHSA 1U3WA 3CTVA 3N58A 1ZJYA 4WLVA 1K3TA 3ON5A 4I5GA 3CZMA 4BO6A 1LJ8A 2Z95A 3VHRA 3HDQA 2YW9A 3GHHA 3DMTA 1F0YA 2EHDA 4HFRA 1E1KA 3GNTA 4JJGA 4J0EA 1DC5A 3V2HA 3NAQA 4XR4A 3KV3O 3DOJA 1Z73A 4ZQFA 4QQRA 4CM7A 1EBFA 1OOEA 1VL6A 3OM9A 2EERA 1EVIA 3KYDB 5I8WA 2GGSA 4BS9A 5JDCA 4DA9A 3GNQA 3WYEA 1QKIA 2YV2A 4TRRA 4DPMA 1DIGA 4BNZA 4M89A 1P1JA 2RAFA 4GVLA 1XQ6A 2QX7A 4W9NA 3WBBA 1O5IA 5JC1A 2E82A 4JCOA 4ND1A 4PIVA 5TRTA 2FY8A 1WAMA 4E31A 1IOLA 2XXJA 3NUGA 4KOAA 4TWRA 1XGKA 1KEUA 4CMAA 2GN9A 1H5QA 1HTBA 1KETA 1NWHA 1F17A 2DKNA 2HAEA 1EE2A 1Q7GA 2PH3A 2OHXA 2VTEA 2Y66A 4II2A 4XYLA 4EITA 5IZCC 3PJEA 4XJSA 3PHLA 4R1NA 4JLWA 1I5RA 1XWFA 1JQBA 4N54A 3ZHBA 2VHXA 4L0QA 4MVJI 4ILKA 3FNEA 4MDHA 2IZ0A 3K31A 2H1SA 3FWNA 2QRLA 1GV0A 1EMDA 1PGQA 4PG5A 2X1HA 4XQ9A 1B26A 1NX6A 4I1IA 2JD2A 1I0ZA 3I9JA 3L77A 1NFFA 4O5OA 2A9FA 3COSA 4ZJUA 4K26A 4OQYA 3QVOA 4IJVA 3CH6A 4BGVA 1LEHA 4BV9A 1CWUA 4IQ8A 1GUZA 3D7LA 3PHJA 3I9KA 2W2KB 4XR9A 4D0SA 5KJ6A 1PZFA 1XDWA 3G79A 5L3ZA 3H5NA 1AGNA 3GN2A 4CQLA 3NGXA 1D8AA 4XZ3A 1JVBA 1UP6A 3PDJA 5B4VA 4QO8A 3V2UA 1I3MA 1DJQA 2PK3A 4GVXA 4KWHA 4RDHA 3CKYA 3ZDFA 1KVQA 2R6JA 4WGGA 4XQEA 4AJPA 2PA3A 1HZJA 4M54A 5L4SA 3RKUA 1HLDA 5DP2A 2PY6A 4D3FA 4ONEA 4G2NA 5I7EA 4GLOA 2JFGA 3T4XA 4HV4A 3DMTC 9LDBA 4UVDA 5JCXA 4M87A 3MTGA 3JQ7B 3NT2A 4BNNA 4CQLB 5CEJA 1E7WA 3WJAA 5BR7A 2GYYA 1PJSA 2JCXA 1A9ZA 1LSSA 3BMQB 3M1AA 4DPKA 2H5LA 3GY0A 3KM0A 3A06A 4II3A 4WUVA 1Y8QB 1UJMA 3DOOA 3HFGA 4KQXA 3WGQA 1QRRA 4L75A 1NFRA 1LLCA 3SC4A 4EJ0A 3OJEA 2HMSA 4LSMA 4YJGB 1C1XA 2BRUA 3PQDA 4ND5A 4IZHA 4FFMA 5TT1A 4Y6PA 2VYNA 3K73O 2AQKA 4GI2A 5CP8A 2VHYA 1JVSA 5GZ1A 3TZQA 4M1QA 1KY4A 3T4EA 1SZJG 2AG5A 5L7WA 5AXDA 3VH1A 3WLEA 4RPJA 4E32A 4D7AA 4OXNA 1HSZA 3GLQA 1RYEA 1C0IA 1Z7EA 4D3DA 1QYDA 1KYQA 3A4VA 3CINA 3MWEB 4FC7A 5TQVA 4PG8A 1T2DA 1B7GO 4WKGA 5T64A 1Z74A 4B7XA 1XG5A 2DVMA 4GPD1 1BW9B 4JK3A 2CVZA 1R0SA 2IRWA 5C3MA 1P45A 4R69A 2FP4A 2XPCA 3FNGA 3KZVA 5BNFA 1VJ0A 3ICCA 3TFQA 1J4AA 4PZDA 3OJLA 4XWYA 3S2GA 4AFNA 3HFSA 2P2SA 3W8FA 3GC6A 2YQ5A 1CYDA 4P38A 3DZKA 4D0RA 4WEQA 5JNLA 1VLLA 4CMHA 1HT0A 1SO8A 1E7YA 1P77A 5IFLA 5IDXA 3F5SA 1V6AA 4IJUA 1JWAB 1KEPA 1CDOA 2WEKA 4WOKA 1HKUA 4D46A 1VM6A 2C7VA 4J3FA 5F3RA 3DOCA 1DRWA 5FF9A 3VVBA 3ENNA 5KJCA 3PEFA 1BXKA 2WMDA 4BGIA 3PDUA 2B4TO 3SBOA 4DLBA 1MFPA 3E9MA 4LVUA 3K6JA 1U3TA 4IBOA 4C7JA 2HJSA 3MCVA 1I3NA 4PN3A 4RF4A 4FGWA 5HBRA 3M2TA 2OOSA 1U2GA 1QSGA 4OXKA 4UVIA 2VRBA 2X9GA 5T57A 1LU9A 1QV7A 2IXBA 4YEDA 4ALKA 1ZNQO 5T6BA 5EQDA 3K8ZA 3O03A 4BB5A 5IAAA 2G1UA 3V8BA 2POQX 5CDSA 1A7KA 4R16A 4B79A 1VPDA 2O2SA 3MTJA 1G0NA 2BH9A 1LX6A 1GADO 1Y9AA 2B69A 3DFUA 2JAPA 3KTDA 2GZ2A 4CUJA 3KYCB 3DHYA 1MG0A 3MJEA 4WNIA 5EQFA 4KUEA 1ML3A 2VYVD 3W6ZA 3ZHZA 3SC6A 3ZGYA 1UAGA 4ZRMA 5IZCA 3L4BA 3TWOA 4MKXA 1P31A 1YVEI 1C1DA 3WBFA 2CD9A 1Y7TA 3K96A 4YXFA 2WD7B 4OL9A 1I32A 4J6FA 5DZSA 4QSMA 2YQ4A 1GL3A 2BMAA 3EHEA 4HUJA 4JBIA 3MJTA 2FPPA 5CDTA 3I9LA 1M75A 1CRWG 3IP1A 3VKVA 3WNVA 1VL8A 5A1TA 4GX0A 1H6BA 7MDHA 4F6LA 4IMRA 4EEXA 4S1VA 3TL2A 1C0KA 2O2YA 1PEDA 2GRAA 3PTZA 1MC5A 2Y68A 5JDCC 1C0PA 1EUDA 1N7HA 3HB5X 1N9GB 3JD3A 1F8GA 4TRJA 4XKJA 3U4HA 4L8VA 1BVRA 3L0DA 3NTOA 4JGBA 3DBHB 1DJNA 3G3EA 2VWGA 1K6JA 2X86A 3UKOA 2NU9A 5HRUA 3ABIA 3HDYA 2Q46A 3ANMA 4O6VA 1E3WA 1LDEA 3EW7A 4B4UA 3JYPA 4UUNA 1H6CA 3UXYA 3E9QA 3BMOB 1YOVB 5CPBA 4ZGWA 3CEAA 1E7RA 2GD1O 2NUAA 2GNAA 5JO0A 3K30A 3I6IA 1F06A 4GKBA 2LDXA 4NBUA 5BNTA 4R9RA 1DC6A 4AJ1A 1ZK0A 3GPDG 3B20A 3IDSA 3D64A 2QIOA 5IZ4A 4BNGA 3FPLA 2X23A 1U4SA 1X0VA 1GD1O 2JD1A 1E3WB 2DFDA 3CSDA 4IUYA 3EGOA 4MIEA 4P4LA 4J9VA 4ZN6A 3ETEA 1TT7A 2WJPA 3EVTA 5H83A 4BL5A 2C20A 3S1LA 4DRYA 1QORA 4Z3DA 1KERA 4IDGA 3SVTA 2H6EA 4X54A 4CPDA 3LLSA 4R54A 4EJMA 5HS4A 4XX0A 1B8UA 4HXYA 4CM4B 4HADA 2GZ3A 4AICA 2ZK7A 1E77A 1A5ZA 4LW8A 3VPFA 4CMJA 4CM3A 2VHZA 1L1FA 3ZW8A 2OP0A 2D0IA 1YQXA 3DEYX 4FOSA 5THKA 1CF2O 1Q2XA 3WWYA 2DC1A 1AHHA 1JN0A 1TT5A 3H6KA 3DBHA 5ICSA 1PJQA 4GH5A 4MKRA 3OF2A 1ZK3A 4QXMA 4RPGA 3EUWA 2FWMX 4M49A 3BMCB 2GERA 1LNQA 2DBVO 4B3HA 5IG2A 3TSCA 4NK5A 4PRKA 1R4NA 4R3NA 5JAIA 4BKQA 5I9LA 4GKVA 1P1KA 2O3JA 4YRAA 5JMWA 2VTDA 3U4DA 5K9ZA 1LC0A 4E5PA 5KTKA 4NI5A 5JAMA 3VTZA 3WGZA 3IS3A 4W7IA 1X7DA 2CVOA 2GASA 5COAA 1NR7A 2OFPA 1PL8A 3WNQA 1RYDA 4J9UE 3E6AA 4Y98A 4FFOA 2VYVA 4TZTA 2PD4A 3OMLA 1YL5A 2HQ1A 1ZFNA 4UAGA 5H81A 5KKCA 4PG6A 4ZU3A 3IAHA 1P3DA 4U7WA 4DQXA 3DDNA 3VZPA 3DZBA 4NFYA 3ORFA 1WMBA 1Y8RA 1UXKA 4ITUA 5JFOA 1PJ3A 3GPIA 1DFHA 3Q2IA 3ZU3A 3DB2A 1UXJA 1BDBA 4FCCA 1LRLA 5GMOA 3O26A 3VC7A 1PJ2A 1ZZEA 4OJNA 2NNLD 1A72A 2VRCD 3IQDB 4M55A 2YV3A 4IDBA 2D3TA 2PKQP 3AY7A 3PYLA 1U2DA 2X5KO 4CLRB 1UP4A 5COBA 4A03A 4A10A 2ET6A 5KVVA 1V9LA 5KKAA 3ZWVA 3AI3A 1OFGA 5IXSA 1J6UA 2ZCUA 1CIVA 3OEYA 4TKMA 3E82A 3I52A 1Q7BA 4GSKA 5AXBA 2JAHA 3F9IA 3LF1A 5L7YA 2PGDA 2ZIZA 3QV1A 4YPOA 3GDGA 3WGHA 2WYVA 3PLNA 3WFJA 5G4KB 3VZSA 3PZRA 1NQOA 4YWJA 1H94A 1KVUA 1MA0A 1JKIA 3GOHA 3ZNOA 4CLRA 3DBVO 1EZ4A 1GQQA 3EZLA 1J49A 2ZQYA 4J1QA 1BG6A 1IHYA 4RQTA 4E3ZA 3M1LA 4EJ6A 1M6HA 2O7SA 2IODA 2YHIB 1ZXBA 4Q39A 4OKNA 1LLUA 3GEDA 3OIGA 3OQ1A 3NV9A 2D2IA 3ZHXA 1I24A 3GZNA 3KSDO 4I5EA 4L4RA 4IDCA 3NT4A 1EFLA 2JFFA 4OXYA 4E2WA 2ILTA 4OOFA 5BSFA 2V6MA 1GY8A 2CFCA 1PZHA 4YJHB 4YT8A 4C4OA 5I7SA 4CJXA 1EQ2A 1HDXA 3ASVA 5JCJD 3L6DA 4XYGA 2D5CA 3E5RA 4J1SA 1HDOA 2WE7A 1HDRA 4FJ0A 1B15A 5HWSA 3PFFA 1DIAA 2R00A 5EESA 4YT4A 1H2BA 1Y8QA 5MGBA 4XB2A 4ALJA 1DEHA 3F1LA 2Y1CA 5IF3A 4YACA 1V3VA 3H9EO 3VPHA 3PLRA 5L7TA 4RVSA 1P44A 2AEMA 3F6YA 1ID1A 3D3EA 2JD0A 3ZZNA 3AUUA 2O3UA 1DFIA 1SOWA 4IDFA 5JLAA 2P68A 1BDMA 2YZ7A 5T5QA 4XDYA 4OIMA 3KSUA 1I01A 2DPHA 4ALMA 3SEFA 1BVUA 3KO8A 2EP7A 4NK4A 1MG5A 1ZEMA 3FTPA 4BNLA 5HS6A 1XSEA 1YL7A 2BFMA 1G0OA 2O50A 1I2ZA 4XIYA 2PGLA 5ITVA 2ZB7A 4DLLA 1SB9A 5AQ1A 4P8RA 3ZWMA 1SBYA 3DZHA 4MVJA 3D3WA 3JYNA 3WMWA 1E92A 2VZ8A 4NBWA 5G0UA 1ISGA 4B4WA 5B1YA 2Y67A 1N5DA 1HE3A 1DIRA 4IPTA 2EKPA 3LC1O 3FCOA 4YBZA 2Y1OA 3RFXA 5K6AA 1M66A 1ULUA 1JLLA 3ZV4A 2NTVA 3GDFA 4DIFA 4BO4A 1YJ8A 4BNFA 3ZU5A 2PGJA 1U3UA 3D3WB 2VRCA 3KYDA 4IY1A 3ULKA 2VZ9A 3VDQA 1EK5A 2HMWA 4YJDA 2JFHA 3RC1A 2P4QA 2VWQA 3JQAA 3OIDA 2P9GA 4RO0A 2PTGA 2VT3A 3RI3A 5T8KA 3E48A 2VUSA 3E03A 4J1TA 1O95A 2WDZA 4R1SA 3UICA 4DQVA 5KNLA 1K6IA 3H9QA 3PYMA 3HG7A 1ZW1A 2RH8A 3G0OA 2Y99A 3D4NA 4I9HA 4CR7A 1SEPA 2NM0A 3UF0A 3DZIA 3ZV5A 1WDLA 5K0ZA 1PU2A 3K92A 4YJFA 3ZH2A 2G17A 1EUCA 3F47A 2C2XA 3BTSA 3U09A 1Z82A 1T1RA 3TNLA 2J3KA 1O89A 4ZA2A 1V3TA 2X9NA 2BD0A 2D1YA 3GUYA 2TMGA 4UVGA 5JE8A 4P4NA 2CUKA 4U6SA 2VT2A 4QO7A 5TF4A 5THQA 4INAA 3DMYA 4WJZA 4YQZA 5A02A 1XELA 4ZQGA 1J5PA 1YQDA 3F3SA 1GEEA 3IP3A 3QIVA 5TNXA 3JQ9C 4GWKA
chains in the Genus database with same CATH superfamily
4MP6A 4RLQA 1EDZA 1J0EA 2AK3A 2X0JA 2QN9A 5ELMA 4D26A 2PWPA 2ISSD 2SCUA 3QVMA 3DTTA 3ZWBA 3FCEA 1D2MA 4EKDA 3UW1A 1TYDE 1DWPA 1SXIA 1QGZA 2QAIA 4Z9AA 4CM5A 4EDFA 3P2OA 4MR8B 4PINA 2IV7A 4YDSA 4CV2A 1H6AA 4XCQA 3RCBA 2PX5A 4LECA 3ZQUA 2KLHA 3IUQA 4LK3A 1UOPA 2R4TA 4RZ3A 2PGAA 2GPTA 3BH7A 2RH9B 4MMZB 3BD7A 2CHVA 3THRA 4MRNA 4AI6A 4HNVA 3LWBA 4I9GA 1N57A 3DBLB 3MBIA 2O2XA 2XMPA 3PNLA 1NXPA 2HM7A 2I2WA 3VGJA 3EXFA 4MRVA 4PGMA 1FUIA 1PW5A 1QOPB 1U4OA 1AO3A 1XQVA 1YO6A 3KT0A 1TADA 4MW4A 3QBDA 2H2IA 4OVKA 2MDTA 1ECGA 1SCKA 3CO5A 5A7GA 2ZDQA 2YKGA 4X6UA 4NHOA 2DMRA 1VJ1A 4RVDA 4KQKA 5C8YB 2O7QA 3H4MA 3SN6A 1L5KA 3PR3A 2J7PD 5C5IA 4YRQA 1KK3A 2RMKA 4LX8A 1HDIA 1VBNA 5CDFA 1NXQA 3JARA 3HU1A 1AA9A 1E2BA 4OGWA 4TYPA 4U8HA 1NNSA 3G2KA 2AG0A 1KPIA 1Y3FE 3BPSA 4ND3A 5J5CA 3WMXA 1IZ0A 4QPZA 2QSJA 4IHQA 4LYDA 2WPNA 5HCNA 4GM4A 3WB9A 2AV6A 4UVEA 1MC8A 3NDRA 1W25A 2DFTA 2W48A 3JQFC 4KWCA 4RMHA 1JWLA 1SQ0A 5EIXA 5I7FA 2I4IA 4G0OA 4LRYA 4RK7A 4DNXA 4L9AA 3U4MA 1VQ1A 3QWFA 1P7PA 1H4VB 4L8YA 1VGQA 3DTVA 1RI1A 1TRHA 4GECA 2RK4A 1L1RA 1NTOA 1EBUA 3VM6A 2VVTA 3GFPA 3QYAA 2KBFA 4K88A 2C9OA 5C8VA 4A8JB 3N2ZB 2O3SA 3AF3A 5BPFA 5FEUA 2ZRHA 3A1FA 1FUUA 2BM8A 3B6KA 4UARA 3R6TA 2BZSA 1QH1A 1V4BA 3X2FA 4O3MA 3TQQA 1IXYA 4UCWA 3HDVA 3UCXA 2BM9A 4BHTA 1CSEE 4F9GA 1TU4A 3FTEA 3WK5A 2O8EA 2WHYA 1H42A 2E4WA 1SUDA 1M8PA 2E4VA 3U16A 4HNAB 1NRIA 3D5TA 2X6TA 4N5LA 1PV1A 1W8IA 3FYTA 4MQFB 1K5HA 1T25A 1YZVA 3K8OE 3U3MA 1JYEA 2O0MA 4AZ3B 1J97A 4FB4A 4IV8A 1HEIA 1NWCA 2C4NA 3EOAI 3LXMA 3ZI0A 3K1JA 1EA5A 1KYWA 1PL7A 2CCJA 3C7DB 3PXUA 3W2TA 4F92B 4YRBA 1BW9A 2UVQA 1DKOA 2VHTA 1OZFA 4MPPA 1UBMS 2Z6VA 4PG4A 2HZBA 3OFND 5A5DA 3L0PA 3MJSA 4JU9A 1KJ8A 2C3MA 5LA6B 4AKEA 2JGKA 4BB9A 1L0BA 4J0DA 1G64A 4X8MA 4NOMA 3ZW9A 1EVZA 2HQBA 4HP8A 4FWTA 3WL4A 3FPCA 3D3QA 1XPUA 3GFSA 3NBMA 4B47A 4PHTA 4G97A 4X6YA 2ABWA 4RELA 5LOVF 3LHIA 4MUYA 3BXZA 3BDAA 3GBVA 3SICE 4Z6KA 4ZVVA 4RQBA 3QITA 2OXTA 5JNLA 4BJ5A 3CIFA 5C0OE 5CA1F 1KGSA 2R7LA 4G5QA 3BAFA 4TV8F 4JVMA 1ZR4A 3VJKA 2AN1A 1I9GA 1CR6A 4FYYA 3STVA 1WY5A 2UV8A 2WUDA 1N2ZA 3S3TA 3PGA1 3LAWA 2ZJOA 2WD9A 1RYZA 3RVJA 4N12A 3O4HA 3EF0A 3KB2A 1V8ZA 5H80A 1CS4C 5F2OA 1WPRA 3A2KA 3SEZA 3PBKA 2WTMA 2FPIB 1NC3A 4Y2YA 2AQHA 2X0DA 3C3XA 3HBLA 3PDIA 3UA4A 5I7VA 3VNUA 3CR3C 2CVQA 1Z8FA 3K9LA 1QX4A 4LVCA 2I3AA 5HZKA 5L4LA 3T7CA 1BVYF 1DDOA 3CLTC 3QGMA 1YKGA 2F48A 4OLFA 4WEOA 1F3OA 1Y1SA 1GPKA 3VOSA 1FJ2A 2ZR7A 1KC3A 2GLUA 3CLSC 4LIPD 5GZ6A 3ROQA 4DUPA 4N0MA 2W43A 1VDZA 5ES3A 4RTKA 1E9EA 2IZZA 3PC8A 3SC3A 3SHFA 1K0FA 3DPUA 1O97C 3E9EA 3H16A 3MTQA 4MUIA 2F1JA 5KNBH 1G20A 3OHMA 2XVXA 3PRHA 1C7FA 4LHSA 1WD7A 4GMFA 4Q7MB 4XUDA 2HU7A 3WADA 4CXMA 1RRFA 5BQXA 3O92A 3UMCA 3HHEA 2O0LA 1P4HA 3O47A 3Q8WA 3LBIA 1L1EA 1RXYA 2BGNA 2X15A 4G5FA 1SBNE 2IHNA 3O4RA 3E2PA 4BQFA 4YV2A 4U8GA 3MXTA 5J5AA 1J9EA 2J45A 1FNMA 4YT5A 5KVSA 2NV6A 4RQUA 1BJTA 1O03A 3W4KA 4G0ZA 3BK7A 3MPOA 3A9WA 5L3SA 2BJVA 2X1VA 3A6KA 2B8TA 2ZB3A 1R6AA 3LNCA 3ZQ4A 2IFTA 2Y77A 2OAP1 1IJFA 3EPLA 1E2NA 3PHBE 1GPLA 1R4NB 2B37A 2FMFA 1WB5A 2VJKA 4D79A 5DBFA 4F46A 1EB9A 3CBGA 3WS7A 2EKDA 2PXXA 3TRDA 3AQIA 5M2QA 1KI2A 2HJWA 4BNJA 2FN7A 3IBCA 4KQFA 4R2WA 5CK4A 5B64A 3R24A 3H4TA 1DZIA 3PL1A 4KGZA 1O08A 5ALRA 1EUDB 4RVFA 2J7KA 4K0RA 3S0JA 2YFYA 1CUFA 2FSGA 3TO5A 4MDEA 3RUFA 1IZ9A 4FFNA 1Q7RA 4RWZA 3W3ZB 2O20A 3HDJA 4K2HA 4LAFA 1B1AA 1KOLA 4UBOA 5FUQA 3HN7A 5MHTA 1T1IA 2RHWA 4DVGA 2P91A 3W2FA 2YZMA 1O8BA 4B2LA 1JQAA 1IATA 2RH4A 4RE6A 2QM8A 3GZ4A 4OSOA 4AG3A 4E1BA 4R68A 5D7BA 5A9RA 4ZALA 2WWVD 4RK5A 3WYBA 4JODA 3F6BX 4KFRA 3U81A 5IT0A 1JR6A 1G4AE 2VDNB 3C3AA 3UA3A 4XFKA 2YN0A 4PTYA 2IXFA 2WIGA 4Q7QA 3DOFA 3KQWA 5AW1A 3WGIA 1MR3F 1RPTA 4XLZA 1NSFA 4LDPA 3WGYA 3B9BA 4RNCA 4EY6A 2X0EA 5AHRA 3T3MB 5JNWA 5LP6C 1OZAA 3C5WP 5EIHA 1SC6A 3KOWA 2YXBA 4PZCA 4IO1A 3UT5A 2Q6VA 4V0QA 2DX7A 1JTFA 4KLNA 1Z6XA 2QRJA 4KMMA 4N7RA 3ROPA 2LZ0A 2Q50A 1LD3A 2VR1A 1YVUA 4GP6A 1IG3A 2R96A 1XQ9A 4P54A 3AL2A 4QDXA 1M8FA 5HF8A 4E5VA 2JGEA 2YY5A 1UDXA 3K15A 3GFTA 4TVSA 5H82A 1UWKA 4GOMD 1TZCA 1AIPA 3BB1A 3JRXA 4LMPA 4TWBA 5DX1A 4CM4A 4D9GA 3O2SB 4NBRA 4E2XA 5AH0A 1EXDA 2CXSA 2P5YA 1IY2A 4MEAA 2EFHB 3F49S 4KOEC 1Z4NA 3EFBA 3KXIA 1IK6A 1CZUA 3HYLA 1GCUA 1V8FA 3ENVA 4AX8A 3OETA 4DLAA 3TG8A 3B3QA 2GOYA 3DO5A 3W0LB 3W8EA 3D7NA 4LYJA 2C57A 3KZMA 1VLVA 1SQ6A 1DRUA 4CLEA 1UR5A 1GIAA 1FA9A 5REQA 1JMYA 3LVFO 1T5BA 1HQYE 4GOXA 3U1TA 3WBKA 5FUMA 5KS2A 5FA6A 2G88A 4HWKA 3EBPA 2ID9A 1ILEA 6REQA 1P18A 4ZEWA 5K0EA 4L3VA 2QYTA 1USVA 2Z2YA 1T9GR 5DCUA 3HKCA 2GPWA 1FK8A 4HJRA 1BMQA 1BN6A 1QLJA 5LLSA 3EJ6A 3IAM6 4H4CA 2OVBA 1ZJ6A 3EVNA 3CNLA 3WJ2A 3PNSA 4F7DA 1QYWA 1KBQA 4J7XA 1CJTC 2C9BA 2C99A 4QUGA 3C0KA 2F62A 1Z38A 2JJ8A 5F1PA 4ER0A 2GEUA 1VLJA 1G9XA 1H66A 1T2EA 1WXQA 1UFOA 1D4AA 1X9GA 2D54A 2YMQA 3BRCA 2KWIA 3W2HA 1FYWA 3G6WA 3TDKA 2X6QA 1NUPA 5EGNA 3ER8A 4JOCA 3CX8A 3I8SA 2PZBA 2HSGA 4OGLA 5IAGA 4CLOB 2R8EA 2PCJA 1M2NA 2W5UA 3I9OA 3NTRA 3LCRA 4FFPA 3WO0A 1D2NA 3PJGA 3NFYA 4XH9B 5J4KA 2QXTA 2H8KA 3OP1A 1BKSB 1K98A 3AH8A 3EVFA 3KT3A 4JWKA 5ALQA 5DM70 4PZ0A 3RJ5A 3QU4A 3TOSA 2XE8A 1QHNA 3DQPA 4XGKA 2AQ8A 4XXHA 2YYAA 1UFKA 3QZUA 4FUQA 4JLKA 4Q16A 1RJDA 3PFKA 5K3EA 5FI5A 3ELDA 1JJBA 4OKSA 4E6PA 2O8FB 3O2NA 5BQOA 3VHQA 2M1XA 4CFZA 1XTPA 1YUBA 1JFFA 4Y3UA 4FMPA 4UHBA 5CNIA 4MUEA 4NJMA 3ICPA 1VLMA 4UM9D 4Y6SA 4L1KA 2Z3WA 1QGAA 1W34A 1HKHA 2HJGA 4FSHA 4ZCRA 3Q3HA 5CFQA 4M9XA 4ZIRA 3W5BA 1VJDA 1WSBA 3CISA 4B4KA 4OH7A 1EX9A 3DZ8A 3L9XA 4WH0A 3SG0A 3ZY2A 4CIVA 4YV1A 1OH7A 5DO9A 2YY6A 3E5NA 3KWFA 4AO8A 5BR4A 1NW6A 1ODTC 2I5PO 2Q49A 3A1EA 5B58T 3GPCA 4B9EA 4BC0A 3JPYA 3ROTA 4CMEC 4CM8B 1G8KA 1PSZA 3TM4A 3LFTA 2E4AA 1PBTA 2BBOA 2I54A 1OGYA 2HJRA 1WMSA 3DAYA 1F2DA 1FNCA 3AP1A 3JQGA 4IFIA 4MVJG 4BLPA 3HMKA 4MCIA 2H29A 4RZXA 2CSUA 3TF5A 2HPVA 1TT5B 4MUMA 5GAJA 4P7BA 5GADl 2B9EA 3FTFA 4ZXFA 1P1IA 2E6UX 4FHGA 3RRZA 1P0CA 3M7IA 1LPAB 4R5MA 4DSOA 5IXJA 4K9NA 4UU0A 4ZAXA 2EYUA 4EVSA 2PKYX 3R0IA 3LRTA 3DYBA 4G1CA 2OUIA 3GBPA 2J5XA 5IT5A 2XRYA 1QDLB 1SURA 1JMVA 1EJ2A 1COWA 1TM5E 2H4YA 5G3ZA 2FSHA 2ZU0C 2R66A 4EDHA 3VDNB 1KI3A 4FU0A 2ZJ6A 1NNEA 3AOEA 2G63A 1JDNA 3DM5A 2IU3A 2XGGA 2X4IA 3CRQA 4YRRA 1K86A 2ODQA 1G5FA 2J87A 1GZ6A 1D1TA 1DXYA 4LY0A 4FKMA 4MEBA 4QUAA 521PA 2B4YA 3ZK8A 5JJCA 1UBGA 3W6UA 1X7WB 4XFDA 4U2KA 5ICEA 4YMSA 3CX7A 3GLTA 4X84A 1KQNA 4MS4A 3ETGA 1FDUA 1NQAO 1YXMA 1UBTS 4J03A 3OZSA 4ZDWA 1N9KA 1RZVA 1OMOA 1P6QA 2YIDA 2VH1A 4PQFA 1ORRA 1S6YA 3KJGA 4LMBA 4TLDA 3TKYA 2H1VA 1E20A 2VPIA 3KQPA 3UJ6A 1QP0A 3WRVA 3D6FA 4QFCA 3ORHA 4L50A 1N6HA 1OW3B 3HJHA 4D9IA 1E9CA 4LHWA 4DQUA 4YAKA 1EFVB 2DPLA 3WKBA 4DB4A 1RQLA 3TX2A 4D9JA 4BE4A 2I4TA 3OJOA 1GVHA 4KPUA 1GZDA 2IH2A 5HHTA 1T9BA 1KKLA 1W5SA 1Z17A 3H8WA 3N39C 1YQGA 3V2GA 2H85A 2AN9A 4RTMA 4JP2A 3OTOB 2Q41A 3IXQA 1P4AA 1MIOB 3IPRA 3QEKA 1TUIA 3HCNA 1Q0TA 1HUQA 4WNAB 1UPUA 4MXDA 3OZDA 2IYXA 1S2NA 1BA3A 2QNBA 1CZNA 1RXWA 4WNYA 1UEIA 4RC9A 3KT8A 1MXHA 3EMDA 5KC9A 4JFAA 4UBNA 4U7JA 4BECA 3FCXA 1LGYA 3UUEA 1ZN9A 3MJCA 4ED9A 3LKZA 1Y89A 4HO1X 3F2VA 3LXXA 5BNWA 2MMCA 1MUUA 1Z0IA 2UYQA 5EMJA 4MVYA 2EU8A 4MI3A 3JQAD 1QONA 1T8SA 1TZBA 4LRUA 5ECDA 4ZI2A 5JYDA 5JSUA 4KQ9A 4R7TA 1FB5A 3PFCA 1K3FA 1EIWA 3RW9A 1L8LA 4MV1A 1E2EA 1CDEA 4TN1A 3PKJA 1DCMA 3OOYA 4P3KA 2NYVA 3ZVKA 4HDOB 3LTEA 1U7DA 2V7PA 2BEUA 1I6LA 3E4CA 1R88A 1MQSA 1M7GA 1T5DX 1KI4A 2IYPA 3UFXA 2NVBA 3BOSA 4XQ0A 4BC1A 2W2OA 1M1NB 5AVTA 4KPYA 3EEFA 2W00A 1E1QA 2NU8A 3K5HA 4CTMA 2CNBA 2EZTA 3SJBA 3FYHA 3SZ3A 1LLFA 1B2LA 3ELBA 3ESCA 4MB0A 3KSBC 2EJUA 4CMEA 2O3RA 1ZWKA 4D4IA 3B6EA 7AT1A 3WLOA 1VC2A 1V37A 5HIIA 3ROGA 5ADWA 5AR1A 2ZYDA 3D6TB 4FHDA 4OQXA 3PDWA 3ZIDA 2G07A 1OE0A 2P30A 1HOXA 2FWPA 3NYWA 1XRNA 5EE0A 5FYDA 4BZXA 4C6RA 2CE2X 3AX6A 4K8OA 4ZRNA 4BFLA 3WA7A 3A6PC 3R4VA 3H6GA 3FNIA 4XB1A 4ZAYA 3NHAA 5BP7A 1FSPA 2YV1A 1AXEA 3DV2A 4KGVA 1QIIA 1BWSA 3U26A 4CDMA 2WM3A 1WCIB 1DBWA 1U7HA 1LVHA 1RHMA 1ISSA 1BO6A 4Z0HO 3EWNA 3ABRB 3C8HA 4NONA 1DMRA 5F1KA 4HB2A 2ZUBA 3QI7A 3O82A 3WLQA 5DYNA 4DYVA 1N2SA 1GNTA 3OWHA 1BJKA 5EJAA 2PLRA 2XIQA 3KLNA 4N0EA 4R2IA 5FPSA 5K3OA 1YAHA 3HYRA 1Z2OX 2P2CA 3OC0A 5DN6A 1Z4PX 1EU1A 1AKWA 1URPA 1Z56C 3M5WA 3QVVA 2ZI3A 1ZM3A 1D04A 4ZOEA 3KFLA 5DTMA 4C76A 2ZS8A 3OO1A 3T94A 3KUKA 4UASA 4QPPA 1JJAA 3RS5A 1BQ3A 3WO1A 1P5HA 1Q1GA 2Q5HA 5GVSA 2NTJA 3EEIA 4QEDA 3DD5A 2WIJA 2D59A 5EZQA 3AEYA 4PCLA 5HDQA 2F8TA 3N70A 1WMFA 4HDSB 4LJ9A 1GNQA 3BH0A 4JOQA 1YQUA 3I2JA 4GC5A 1UFVA 4KGDA 3C87A 3WQRA 3B1KA 4UDOA 4EKEA 2V6JA 5K6AC 2W9XA 4O2AB 1EK6A 3OIUA 2GHQA 1ZHFA 2DRIA 1D7OA 3AT1A 3AILA 2E6KA 4PSAA 2D13A 1ADGA 4RD2A 5AOVA 1R6UA 1NHWA 1ZVVA 2X4GA 1T6ZA 3K5IA 3M34A 4DGQA 1VG1A 5AVVA 4FM9A 1B6RA 3ABSB 3C2QA 1QG0A 5EFOA 1BDJA 3N6XA 3TLEA 5KSYA 2HLPA 2BGWA 1YS9A 1GXSA 3RASA 2C04A 3U7RA 1ZINA 4I55A 1H3EA 2JC3A 3E7WA 1ZOOA 2JVKA 1WXHA 4MUJA 1LPMA 1U31A 4TMTA 2EATA 3ABOB 1OLUA 5FPTA 2VZLA 5T4EA 3OPVA 1M1UA 4MW7A 1AQIA 1USIA 4JBYA 2P2GA 1OWMA 1BS1A 4UTXA 3UK1A 4DEXA 2IXGA 4L15A 2HF7A 4Q82A 4DY6A 4HAXA 3ZEIA 3JQBC 4WN9A 2OFWA 5EP4A 1DPGA 4MO9A 1QQTA 4UXIA 1WNTA 4EBFA 4F3RA 5C1PA 4BFSA 1SUAA 4D5GA 4MV7A 2XNKA 4RIHA 4V3CA 4DNFA 1DC3A 4E2YA 1XR3A 4V2UA 3RHTA 2B6HA 3T3DA 3RU9A 5BV0A 1QR2A 3UAWA 1W8DA 1MB3A 3FWYA 1C7JA 4GLLA 4M6WA 3R7SA 3ZHOA 2OBLA 2R0QC 5JU6A 3IIMA 2FPUA 4I46A 1YB6A 4E4YA 3TW8B 4B32A 3NJ8A 4DN6A 4G5SA 4C29A 1Z62A 3GFFA 2BHTA 2H63A 3WWOA 2ZUVA 3HCEA 5L3RA 4QM6A 3IOBA 3LRPA 2HDOA 2DLNA 2ADMA 1EG7A 2B8JA 2X0KA 4Q00A 1DNPA 3CWCA 4H3SA 1I4DD 2DF8A 3HCOA 2QX6A 3T4UA 3VV2A 3ZYCA 2GM9A 4JI7B 5F51A 3TZEA 2OORC 1YVDA 4UQOA 4X6LA 1W6UA 2FGKA 2R5NA 3FMVA 4P86A 5CFPA 1SH7A 4IYJA 3RVPA 4CTOA 3G7NA 3SM9A 3WSWA 1G20B 4B7UA 5E1DA 5JS1A 1L3CA 3OLWA 2E1RA 3EDOA 4HXGA 4N3NA 3WRXC 3NIFB 2Y27A 5K8CA 4CDNA 2AFIB 1KOJA 2ZPAA 3OCXA 5LC1A 3EGVA 1YNSA 1PEAA 2HUNA 5HILA 5CMLA 4QYSA 1M8KA 1WF3A 3C6KA 3QXJA 4K6OA 2OHHA 5CNMA 1RT9A 4B3IA 3GFBA 1XKQA 3H5AA 2BY4A 3N76A 1RTKA 1SXJB 4YWHA 2PL3A 3N8KA 4OXXA 1ABFA 3GN1A 4OSEA 2O8CB 1NQTA 2BCEA 3NMUF 1XIVA 4FT4A 1K5DA 3MD0A 4UPEA 1A9YA 4JSYA 4AN4A 3WIBA 5M04A 3R1IA 3Q7SA 1P6UA 2YOFA 4PZUA 3B6ZA 4EAQA 2NUAB 1XP8A 2Q6TA 1NW8A 4IIJF 5KAMA 3INTA 2ZJ7A 1UZMA 3AKEA 4TXNA 3DM9B 3WZMA 3M70A 4Z8YA 2NVWA 3T0FA 5CXUA 1XYVA 2C4MA 3V1LA 2VJCA 3QKTA 1CF4A 1B1CA 4GGOA 2GBCA 2GETA 1K2WA 2VNJA 3Q9NA 4A8TA 1AGRA 3ZKAA 3SZGA 1G8AA 2JKZA 4PFJA 3QYFA 4YUAA 1Q0ZA 3KR9A 2W0MA 3BGSA 2MR5A 4L72A 3D8UA 2X8LA 5I5EA 4W8OA 3WHLA 3QLJA 1G9SA 4L78A 3WIUA 3ZXSA 3CVJA 4OBBA 5E7IA 1T2UA 2NO0A 1EHIA 1IOVA 3PG5A 2XCSB 3DE7X 3B1YA 1H2EA 3A1NA 3ETLA 4I8IA 5FB3A 1PT9A 2AZMA 3RSHA 4DVJA 5FH9A 2VNAA 1KFEB 2HPHA 1YTUA 2PS3A 1EFPA 1KYZA 2WP0A 2X4LA 4LZAA 3H7IA 4PLCA 5H8WA 4L5CA 4H15A 1MB4A 5H16A 1P7VA 2W6QA 1UKZA 3EISA 4M99A 2YBDA 1Y5MA 4H16A 4WPGA 5IAKA 1MJHA 2GRUA 2DUUA 4N3CA 4RPHA 4F85A 2AJDA 4L8LA 2Z56A 3UT5B 4EG4A 1W88A 2AEFA 1IN8A 3R6DA 4KE6A 5EWMA 2QZ9A 4BX9A 1IVYA 2QTBA 1BU8A 4WA7A 5SICE 4DZZA 1P80A 3BWYA 2V7WA 2BHLA 1A98A 2B36A 2OGUA 1CB0A 3DO8A 5AVSA 2O5EA 2ZREA 4RV4A 2W2XA 4DREA 2VQEB 1Y1LA 3DKPA 2CB0A 2W22A 1NI4B 2AE1A 3QYJA 1QHHB 2KX7A 3OX1A 4P82A 5AHOA 4JLNA 3HH8A 4ASUD 1SVNA 2P6RA 1G3MA 2GX6A 4MWBA 3AJEA 1KZ7B 1Z08A 2OV4A 4JMPA 1IBRA 2LVBA 4K1LA 3WLLA 2FXVA 5DBOA 1EX1A 1WUYA 1X1AA 1FRNA 2FRDA 1E4EB 3FSRA 5FBWB 4LE2A 4MMXB 5BN4B 4A2CA 2JLYA 2EFEB 1BTOA 2ZTVA 4RKRA 4U2FA 1K5PA 2AX3A 3JWGA 3SE0A 3LBAA 3ID6C 3OIVA 2RK3A 1W2HA 2GNOA 4N7MA 2ZQZA 2PBZA 3WTBA 5K20A 5KQSA 4GU5A 2NXWA 3U3KA 1YOVA 5C2JB 2WK1A 2D1SA 4IKEA 3NM6B 3GGGA 1S2GA 4V0KA 2YJZA 1UDRA 1WWKA 3N2LA 3CW9A 4XM1A 1VIMA 3WGOA 4A1FA 4ESEA 3OM0A 3C7TA 1O96A 3LPMA 5FNZA 3A7EA 1WX1A 2AD5A 2TS1A 4CQMA 4H17A 4CF4A 4D8YA 3G2OA 2ZETA 1DO2A 5FOWA 2ZE5A 4RSRA 3WIEA 3SHVA 3QJGA 2FWAA 2A3NA 3SQNA 4QNNA 1X8KA 2I33A 4JC0A 4D9HA 4U9IS 1ZUD1 3MELA 1N5OX 4RL6A 1VI2A 2YWFA 1LSOA 3FTNA 3QBJA 1M7BA 2CWWA 2DG2A 2HK9A 4G9BA 4Q3AA 3TQIA 4D44A 3OAAA 1Q7CA 3BD9A 1K8RA 1Z9BA 3IA2A 1G2PA 4DC9A 4DIMA 3MOGA 1Z45A 2E5FA 3RC7A 4G5RA 4ITVA 4RDIA 4C6TB 1TUBA 2DBZA 1RU3A 1AA6A 1CP3A 2O3QA 1CZHA 3T99A 1ODIA 2GSWA 4I99A 2DWUA 2WJVA 2PV7A 1Z4KA 2A2ZA 3E8MA 3HKDB 4R9UC 1B41A 4WLNA 5KJEA 1RC0A 1V5EA 4PYIA 3I61A 2RGNA 5HUQA 3DYIA 5CVJA 3ZJTA 1P0MA 1WO8A 3IMFA 3KOYA 1FFSA 4L4XA 4RY0A 4V0NA 1E1CA 5K3DA 3TTSA 2D5LA 4MV8A 1EM8B 3IC5A 3BE4A 3QVLA 2HFKA 1F9EA 3WYNA 1DQSA 1UBSB 4NZOA 3SSAA 3PUWA 1QG4A 3ZBUA 3CA8A 1DMSA 4GOLD 1PZXA 1SULA 4E22A 5IT4A 1CEYA 4DTIA 5B3JC 1WXWA 3AEKA 4G0MA 1YCHA 4JQYA 3D59A 4B3MB 2HTEA 3C24A 3JQGB 3NUQA 1WTAA 5CHEA 2HTFA 1US8B 3K1ZA 3NAMA 3U7QA 1P2BA 5HKKA 1VJ5A 2XCOA 5LYJB 1NC1A 3A3YA 3EOBI 1MD9A 3FB1A 4URYR 2Y1FA 4BJ6A 2ADFA 3ZLVA 4OK5A 2FA9A 3L1VA 4V0SA 4YECA 5GQSA 5CEEA 2BF4A 5GM2A 2CKMA 4X61A 1FP4A 3LGAA 4OV6B 3U7JA 1R4AA 3U7IA 3W79A 2J9XB 4KV9A 4N1AA 3DFMA 3NTQA 4GUAA 4KQMA 1Q1AA 1R9GA 2VK8A 4IUDS 4EJFA 4EJSC 4F3TA 2ZITA 1P2FA 4CL8A 5TMEA 4YP7A 1N77A 2SECE 3HA7A 2W8BB 4YUXA 4LVOA 3OE4A 1P33A 2YASA 5SYAA 3U6KA 4CIDA 5L45A 1TVEA 1SXPA 3NLLA 1PYOA 1UP7A 4PLGA 2P27A 1K8QA 4G8JA 1PR9A 2DXIA 5EUQB 1JEYA 4AQYB 1SU8A 3HJNA 1TF2A 4N8EA 5C34B 5EIAA 3HNRA 4HVTA 3PICA 1FVOA 2WJAA 1SCUA 4UMFA 4C4TA 3VKGA 1OV6A 4G0XA 1U2RA 2JCGA 4M9RA 1PJ8A 4JI6B 3JTMA 2D0PB 4G1VA 1PWXA 2IPNA 3H3FA 3G0IA 1PQUA 4D9CA 3SZMA 4GD3Q 3EYWA 1UBRS 3OE7D 2ZT5A 4NCJA 2A5LA 3HTXA 4H27A 4BTEA 4P0QB 1XYGA 4YRFA 3ACBA 2VYND 4RY9A 1G9TA 4RZIA 3DKRA 1MAAA 4MWCA 1DHRA 1XXHB 2C9YA 1RQRA 2Q21A 2VUUA 2W2LA 2IOYA 2J6CA 1QK4A 5ALNA 3ZNQA 3GLGA 5AJTA 1ISMA 4FN5A 4QHTA 2FZGA 1EDDA 1MZVA 1K7CA 1HFJA 5D3ZA 2C5EA 1TK3A 1ZSNA 4PVDA 1EE9A 3DS8A 4JROA 1MCZA 2J4FA 3STUA 2QZZA 4HDMA 1A69A 3KKPA 4R1QA 3SOPA 3M8KA 4YUWA 2OCLA 1I36A 2PVPA 2XRMA 3A1UA 4QRHA 1R15A 2EVWX 2HLHA 4F71A 3VNBA 2C4VA 1K5GA 1MJGM 1LPBB 2PLAA 1PWHA 1UJ5A 1SIBE 1KEVA 1EFCA 3FMOB 3GZNB 3ZX4A 5HSGA 4Q9KA 5DSXA 4C9BA 1NV9A 3KS9A 5B3AA 4BVAA 1JI3A 4LCEA 3KHTA 1OX6A 4YC7A 4GYWA 1BDIA 4QBHA 2I1VB 1C3VA 2JIOA 1Z5PA 3L1UA 4QD3A 4BQNA 3CT6A 4MICA 2FZLA 4OA8A 3GP8A 3LC7O 4TTPA 4X60A 5GWXA 1MRZA 3KR0A 1YFLA 3I23A 1QU2A 1PR4A 2Q27A 1U1DA 2XLCA 3C3DA 3MAJA 3MYYA 4CTJA 5H9WA 1YE3A 4OYHA 3UK6A 2C7OA 1ORWA 3K0BA 1L4BA 2H5EA 4ZJPA 2FPKA 3A9TA 3QVWA 3Q7TA 4KAXA 2Y4NA 3OX2A 5JMPA 2C58A 2H7CA 2DT5A 3PX2A 1C30A 3SWWA 3BEOA 1GUAA 4IJKA 4B40A 2PKCA 1CHDA 3LUGA 7REQA 1D0SA 1CNEA 3GELA 1SPXA 3CRZA 5D6OA 5TIIA 2O48X 4FBMA 1GAEO 2Q4BA 3IOCA 3T7TA 5HW0A 2Y2UA 3BQMB 1FRZA 4H31A 2I2CA 3MYRA 4FS3A 1T0BA 1H2FA 1VB5A 3H86A 3LK6A 1MGOA 2B1RA 5JCJA 1MOZA 2HCBA 2VAWA 1BRTA 3AUTA 4IRXA 4JS0A 2BFDB 2NYAA 3MG9A 3ZGLA 3LYLA 1DX6A 5JRDS 5HKBA 2AH5A 2UZ1A 1G20E 1OROA 1DEOA 2YJNA 4GSLA 3FBWA 2VP3A 1ETUA 1XDGA 4ZXPA 2E0IA 2J48A 4PC1A 3UO8B 1L7XA 4RPCA 3AFMA 4YRNA 1HE1C 2GN4A 4YDRA 4UEQA 1CU1A 3I5XA 2CLHB 1R0BA 1DLJA 5ESRA 1TRKA 3FWZA 1JXQA 1HL3A 1KVTA 4MRAA 3RYTC 2EARA 3HABA 1WUIS 4YP9A 5BURA 4LF8B 2L42A 1NVTA 2NZYA 3IIIA 3KWLA 2RBEA 3ONVA 2ZBGA 1Y6ZA 3OC6A 3SE7A 1WXDA 3EIEA 3PPIA 4IM7A 2O6HA 1DIBA 5AM1A 4NU5A 4GGMX 3TMYA 5CCDA 4OFWA 2AE2A 4NNJA 4YASA 4NCXA 1Z2PX 2FW1A 4YREA 4D0LB 3L02A 4RS3A 4YI3A 2LWIA 1FMTA 1IBCA 1Y1KE 4HFJA 4DR4B 3UXMA 4QELA 3K20A 1F3LA 3QVGA 3UN1A 1WKBA 1R18A 2MYTA 3L8CA 4GZMA 2AL7A 2ZSFA 3KJIA 4EW1A 4DMLA 3HSYA 4BE7B 4RZHA 3QW2A 4DQKA 1ENOA 3AYXB 2Y3IA 4Q4JA 4F97A 2B25A 4W1RA 3LP5A 4WKPA 3RUPA 1AOXA 1NXVA 2PPLA 4WADA 3RYFB 4KHPB 2XYQA 3B1VA 3L01A 2QRNA 4JT9A 4LJAA 1JECA 3L8DA 3RK1A 2BW0A 4PZEA 2H48A 1KK2A 2VK2A 1OY1A 1OFVA 2EIHA 2FEXA 1X87A 3QE9Y 1XTTA 1GXSB 5IXYA 5IUJC 2VFAA 1SUFA 4LWPA 4D9KA 3GYGA 4K7JA 2Q2VA 1XMPA 1FL9A 2OY0A 1N33B 1CUVA 1VDMA 2C82A 2L2QA 5AVUA 1OH8A 5I7HA 5HGXA 4F04A 4A16A 3HXMA 5DIFA 2HSJA 1I4LD 2P2NA 4IX9A 4EMSA 1QG6A 1FNDA 1ECFA 1SK8A 2GTPA 2WSBA 3BE5A 2WHPB 3JAWB 3I09A 5HQ3B 4E30A 3EWIA 3OQVA 1Y3CE 4ESOA 4JVOA 1J06A 4QFBA 2A9PA 3NEYA 1VLHA 1Z16A 3HJUA 3EODA 4CLDA 1ZMXA 1J8YF 1V41E 2RGYA 3D0OA 3ONNA 3PXDA 2GK7A 5DIZA 3W5SA 1RDFA 4BFWA 1Y3HA 1JKJB 3L7DA 4AJLA 5F9HA 2V7GA 1TKCA 4NIMA 3DBLA 2O07A 2BFFA 4NYMQ 1QH9A 3THSA 8OHMA 2QG9A 1CP2A 2M6RA 1QQBA 3BX1A 1U0BB 4ML3A 4I7EA 2M1ZA 1ABBA 2YVKA 1YDEA 1T9DA 3RLFA 3TQCA 4CM9A 1QWOA 3QXGA 4CEJA 2H07A 2HU2A 4XTCS 3FUTA 4ANFA 5JAUA 4UNIA 2HBZA 3GFOA 1QRUA 2ERYA 4PX3A 4JBNA 1YDGA 5JEEA 3INGA 4G36A 1C1XB 4DA8A 2GPAA 2GXQA 2GJ9A 1SXGA 2IDZA 4J43A 4DIUA 5JXWA 5F7OA 5ISMA 4RVGA 1LQTA 2CLIB 2IEIA 2OLEA 2CLKB 2JAXA 4HDNB 4OCZA 4URVR 4MRRA 3U4IA 1Y8CA 4QTTB 4ZQCB 5IHPA 2UUAB 2H7XA 1AUXA 5B37A 3N7UA 2CNNA 2XDQA 5BSEA 3MLBA 2C5AA 1XD8A 4RFLA 3GEMA 1VI6A 2EWWA 5C4GB 3LW7A 3A3NA 2DPXA 3EIHA 3QVSA 4Z1OA 2AZ4A 2O23A 1YAJA 2ZATA 2RHBA 4QUHA 9ABPA 2WABA 1GNRA 2NP6A 2VPQA 2XUZA 2X8WA 3K1AA 1I7DA 5E8JA 1OLXB 2ZIXA 5ILOA 1TA4A 4FHFA 2GEDA 1ZICA 2IU6A 1NZFA 3R77A 3AHFA 4KZKA 4OQFA 2QL5A 3RF7A 1IN4A 1MX3A 4F2WA 1Z7BA 2O14A 5FFFA 3O8RA 2BLLA 5HQJA 3OEWA 4HGOA 1YB2A 4UHEA 3HN2A 3ICEA 2IS2A 2EX1A 5ITSA 4ZZ3A 4AQDA 1UZLA 3IE0A 4QBIA 2K7ZA 5D3QA 3HM9A 1WBDA 1Z33A 2FLWA 1C8BA 2VZ0A 3FWHA 5HUJA 5EVCA 2OHGA 2OMKA 3DHNA 3JVIA 4Y0NA 3EDMA 5DNEA 2NUTA 1VPEA 5C31A 4K6KA 4FNGA 1ZRNA 1OB5A 4NC9A 5C4IA 4Q3BA 1HTWA 2R4UA 1NVKA 4KL8S 3AJDA 2XUJA 4MVJE 2I1WA 5IULC 2FUEA 1NXXA 4IS3A 3LT0A 3QWAA 2JPDA 1TMKA 5JAOA 1NVWQ 1U5CA 2JBHA 1DAHA 3QEJA 1HNZB 1EQUA 2ZXEA 1F8YA 1YMUA 3I4LA 4JKOA 4ZDJA 2AI3A 2UUBB 3DEIA 3KPUA 1FZTA 1VSTA 5LUBA 3R0ZA 2O2GA 4DW8A 4OSPA 1EFTA 5BOSB 1RMYA 1RPJA 1SC4A 3KBOA 1U8CB 1MO2A 2APJA 2PZKA 4HNRA 4HQ0A 3TCXB 2PRZA 1T26A 3LY5A 4BVLA 1L8AA 1R8YA 1XN1A 1SQFA 5ELLA 5HE8A 3IKMB 3URKA 3YASA 4CE6A 4NJOA 2J0UA 1T6BY 1Z3IX 1FE8A 2I66A 2O19A 2DUWA 4IEEA 1KZ1A 5E7JA 1WDKA 2H57A 5E6RA 2OXIA 5FV4A 2AG6A 2PE5A 5CW2A 4UHKA 3JVVA 1PX0A 3V9PA 3KNZA 1Z83A 4J49A 2ZRNA 4PLPA 4PLWA 2FU5C 2IKSA 1Z6YA 2AXQA 2VQ3A 3Q98A 1T6YA 4HWTA 5B1IA 3MGGA 3KLPX 2XGOA 3QX7A 1HYHA 3PGMA 3QPVA 2G9VA 3Q1KA 4CMIA 4HGRA 4F4FA 4MVJF 1DC4A 2G7ZA 2I71A 1MVNA 1I30A 2PHZA 3D7RA 3N8NA 3O9MA 1SRQA 3C85A 4IX1A 2ZTUA 3THOA 3ZQ6A 3IEIA 3A9CA 3CWQA 1R16A 3BCRA 5DNWA 1U7PA 4LHXA 4S24A 4R2XA 3SAJA 5ECYA 4PGFA 3PNPA 5KWIA 1E96A 4L08A 2ZJYA 4WMLA 3THYA 4QREA 3GQVA 5JXGA 3X1XA 1X1BA 1FXWF 4MP3A 5DLPA 2RI0A 4QRIA 3BHIA 2IY7A 4Q93A 4R4JA 1D1SA 1Q6ZA 3Q6NA 3CVUA 1A4RA 3HRHA 3USES 3ZZ0A 4RHXA 2GPSA 5A4JA 3C8UA 2HMTA 1CY7A 1DHTA 1PFVA 4JJIA 2K6GA 2JGJA 4JH0A 2PO5A 5IKXA 2XKKA 1A8HA 4NCAA 2Q3MA 3HYTA 2Q8NA 4PIMA 3KQLA 3M3DA 4FOLA 4CODB 2WPDA 2PKWA 2ZRDA 3C6BA 4LF5B 1LTHR 2QG6A 3OURA 4NEQA 8AT1A 1AJEA 3I83A 2OCPA 2FZCA 2IC5A 2V55B 2X2OA 4JKYA 4KVGA 1MORA 2C2WA 4K05A 4L4YA 3GAFA 1EGVB 3IJRA 1ITZA 2PJZA 3GJXC 3HV2A 2VUHB 3Q4GA 5CRIA 2YMLA 1VSQA 2QUAA 4IZ6A 4K6FA 4OAOA 2C3OA 3O8NA 1S8OA 3RR2A 3UYKA 3R6GA 2H1FA 1Q5PA 3I32A 4W6ZA 5JI2E 3A0RB 4JC8A 1YQWA 4EYEA 1KHTA 1HNXB 5BRJA 4RTNA 3W5VA 3K0HA 3L4BC 5FLKA 3ZNPA 3MUEA 2OCXA 4GE0A 3ICOA 1IC6A 1TCVA 1U9IA 1NW9B 3HVIA 2OAEA 4X7PA 2PRSA 3WL3A 5FPYA 1UMBA 5AYVA 1PJBA 1QYIA 1RI5A 2VBGA 1MO5A 1TUBB 1X6VA 1T24A 4XM0A 3S29A 5ALLA 3WKCA 4E5MA 1E5DA 1IPEA 3HQ4O 3L8GA 3PYXA 2AN5A 3NW9A 4UXHA 2ZYGA 4ARBA 1K75A 2ACEA 1BHO1 1OIVA 1ISIA 3O5AA 4AS1A 5C7LO 3SVLA 1B76A 2IYRA 5H02A 1MW8X 5H0IA 5IM4F 4URFA 1YA4A 4YAFA 4IG4A 1OH5A 3CRMA 3KUCA 2NTYC 3RFTA 1QZUA 5EWLB 4C7MA 4Y2UA 2Z5GA 1C9KA 4ROTA 3WIOA 2VXCA 1BHSA 1GKKA 3M4ZA 4MITA 4JLVA 1BE8A 4N6GA 2QNRA 3FVWA 5E2IA