1EVZA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase in complex with nad
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLYCEROL-3-PHOSPHATE DEHYDROGENASE
publication title A potential target enzyme for trypanocidal drugs revealed by the crystal structure of NAD-dependent glycerol-3-phosphate dehydrogenase from Leishmania mexicana.
pubmed doi rcsb
source organism Leishmania mexicana
total genus 129
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2000-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1evzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evzA01
4BQRA 4JP2A 2G76A 1XSEA 2Q3EA 4J2HA 3L4BA 5J23A 3ICPA 4EGFA 1T2FA 2YHIB 3D64A 1U2DA 1YL6A 3JQ6A 4J9VA 3W8DA 2QZ9A 3DO5A 1NTOA 1NYTA 1EEHA 4BO7A 1BHSA 1JTVA 1V6AA 5ICMA 3G49A 4MP3A 5B37A 2O3TA 3QP9A 4D3FA 3NJ8A 2DVMA 5ITWA 4H7PA 3PYMA 4FQ8A 1YL7A 1K3TA 1FDTA 3RIHA 3BMOA 1PTJA 3I9KA 3QLJA 4QXMA 1CYDA 4RDIA 1A27A 1Q0HA 3TQHA 2GN9A 5KJ1A 3NT5A 4C7KA 4E12A 4KP7A 2JL1A 5TGDA 5A4DA 3GR6A 5FI5A 4BKOA 3W1VA 3A1NA 4GSLA 9LDBA 3DZJA 2WYVA 2ZYAA 4PRLA 5L4LA 4ND5A 3HN7A 3PHJA 1I2CA 2AEFA 2DLDA 2P5UA 3DBRA 4KQWA 3E1KA 3JD3A 3ETEA 3EW7A 2D59A 3TJRA 3PDJA 3NGLA 4JJIA 2BGMA 2NWQA 1PSDA 1V3VA 5JS6A 3V1YA 1PWZA 4B7UA 1YO6A 3WTBA 3UF0A 1T1SA 3PXXA 1Y81A 2BHLA 1MX3A 4XKJA 4PVDA 4WUVA 1IL0A 1YDEA 3AY7A 2EF1A 2HK9A 2GSDA 1A4UA 3LC1O 2EEZA 1KEVA 2CY0A 3PVZA 1EE9A 4BGVA 2G82A 3E18A 1B8VA 3KLMX 4L4SA 4A03A 3TOXA 3U4CA 3AOEA 3I1JA 1E77A 5IDWA 1JLLA 3UAGA 2JAHA 4IGFA 1WZEA 1GUYA 2G5CA 4IGEA 4IXWA 3ROPA 4CMBA 5U4QA 5A9TA 4G81A 1JN0A 5LCXA 4DA9A 4N18A 1JW9B 3TNLA 2CD9A 1HE3A 2VYVA 3JQGB 2OHXA 3ZWBA 1CETA 2C29D 3OJFA 1A71A 1LLQA 2Q49A 1U3UA 3WMXA 3JV7A 4NIMA 5KVSA 4CV2A 3AM4A 2AQIA 2IXBA 3E9MA 4FC7A 4K28A 4MVJM 4FB5A 3AK4A 1GY8A 4MKRA 4W9NC 3FPCA 4A7PA 2VT3A 1WDKA 4KUGA 4E3ZA 3JQAA 3STHA 3GDGA 1C0IA 5JMWA 4GKVA 2VNSA 2X58A 1T25A 1WDMA 1ORRA 1YB5A 1YVEI 3JQ9A 2OP1A 5IZCA 1G0NA 3VVBA 1BG6A 4A73A 3IIEA 1HSZA 1LI4A 3PFFA 3GLQA 3HJAA 5KTKA 4D42A 1GZ4A 5IAAA 3GG2A 5TLSA 2JAPA 3CZRA 1F14A 1FXSA 1SEVA 1DDOA 1U7HA 2D5AA 3R3JA 4KTVE 2UAGA 3H3JA 3QW2A 4JBGA 1J0XO 1NBOA 4RF4A 1HSOA 3V1UA 1DFIA 2NM0A 4GH5A 3OQBA 4I5EA 2X1HA 1XQ1A 2PZKA 3HB4X 4HP8A 1QXSA 1HEUA 3I23A 3B6ZA 1ISJA 3V2UA 1CWUA 4RPGA 3B1KA 3L9XA 3MWDB 1DXYA 1KC3A 5JAZA 4XJSA 5A06A 3NUGA 4IQ0A 1EK5A 2UVDA 1ISIA 1K0UA 2YDXA 1Y1PA 3TZQA 2EW2A 3RASA 3ZNNA 3QVOA 3EY4A 1KETA 1UJMA 3WYCA 1B16A 1E3SA 1WDLA 2FRDA 3FNEA 3D3WB 5CAEA 2QIOA 2ZIZA 1VRWA 3COSA 4WEOA 5DF1A 1LLDA 3TFOA 2GZ3A 2JKVA 1Y8QA 1GR0A 3QVWA 3BMOB 2D2IA 1HZZA 3V5NA 2X5OA 4J6FA 4MP6A 3MWEB 5F1OA 3KO8A 5KKAA 5L95A 2C2XA 5F1PA 3HWRA 3ZN2A 2GN8A 4P4NA 2BGKA 1S7CA 4PZCA 4LW8A 2QG4A 3JQFC 3PPIA 2EP7A 1H9AA 1ZSYA 4J4TA 1VL8A 2VWGA 3DBRB 2B83A 3WQRA 4R1NA 4QO7A 3WLEA 4BNYA 3GG9A 3R0IA 4PZEA 3FF4A 4BKPA 3DHYA 2PGLA 4YACA 1EVIA 2J5QA 2AHRA 3DONA 2O48X 3FBGA 4G65A 1TT7A 5KWEA 5ILOA 3AI3A 4RGBA 2Y1OA 1GQ2A 3WFJA 3VDRA 2VHXA 3GRKA 3NRCA 3FCOA 4PRKA 2X9NA 2PD6A 1J4AA 1D1SA 3TZ6A 3F5QA 1H94A 4E5PA 2VUTA 5F3RA 3DZKA 3H8VA 3D4NA 3ZCXA 4FOOA 2VYNA 1GYPA 4CLOA 3SVTA 5H83A 2EJWA 3LT2A 2Y1DA 3OEYA 2VYVD 2PNFA 4GX2A 4IDEA 3DAPA 3WGTA 3EMKA 3DHNA 1UR5A 4DBZA 1XGKA 4I9HA 3ZDFA 2Q2WA 3KTDA 1VLLA 3C7DB 1A9YA 2YJZA 2JFGA 4B4WA 2VZ9A 4RPLA 1KEPA 1FF9A 3DMTC 3KEOA 4EJ6A 4FIZA 1N8KA 2V7PA 4BNIA 1XYGA 2HRBA 2O3SA 1K2WA 3BTVA 3VAZA 3B20A 4OIMA 1C1XB 3JQBA 1H2BA 3JQAD 3KEQA 2JCVA 3I4FA 3G1UA 5L45A 1AHHA 1JKFA 4WGGA 4NQZA 4WCDA 4J9UE 3RBZA 3RU7A 4NBTA 2FP4A 1UXGA 3JQAB 1VL0A 4D0SA 4D3SA 2AEJA 1E3EA 3ZU5A 1PGNA 2Q4EA 4U6QA 4LSMA 1EBUA 1E6UA 1ML3A 3AY6A 3MTJA 2DBRA 4IUYA 4W99A 4M8SA 4BIIA 4Z0HO 4BNUA 1QORA 4EEZA 1PIWA 1XU9A 3FN4A 4DIBA 2TMGA 2FZEA 3PHGA 4NH4A 3ST7A 1GADO 2AXQA 3RD5A 1MV8A 1NQOA 3L0DA 4B3HA 3L77A 4EBFA 2R6JA 2WDZA 1N7HA 2D0IA 1PWXA 4IQGA 1ZMOA 5F1KA 4OMUA 1C0KA 3S8MA 2FPGA 3NTRA 4FD3A 4XCVA 1LUAA 3VPSA 1V0JA 3EVTA 1K6XA 1KEWA 4EZBA 2NU6A 4QECA 3ZNPA 2YFQA 2GR9A 4DYDA 3UN1A 1NAHA 4F6CA 4CJXA 5KVCA 1B14A 2C0CA 2NLOA 2X9GA 2GYYA 1ZK2A 2J5RA 2QRJA 1PJQA 1LSSA 4BHTA 3K2EA 3TSCA 3TPCA 2SCUA 4GMFA 3K96A 5L9AA 4LSWA 5BSGA 2D4AA 4RVDA 5A1TA 2YQ5A 1HWYA 2X6TA 4MVJE 5TF4A 4FGWA 3VZRA 1DB3A 3OJOA 1Y8QB 4R1UA 1SB8A 3DZFA 5KCZA 3BA1A 5AYVA 2V6GA 3M6IA 4RL6A 5A05A 1P1HA 3X2EA 4B8ZA 5CDUA 5L4NA 3R3SA 2D1YA 2ZB8A 5COQA 7MDHA 4CQLA 2PKRA 4FFLA 1UUFA 3GFBA 3G0OA 3S2IA 3TWOA 1PZHA 4YAJA 5DCUA 1DOHA 4DIFA 1LTHR 4PLZA 2HAEA 3BMNA 1NQ5A 4M87A 5LDHA 1PGJA 1DEHA 1LC0A 2FY8A 4Q9NA 4BB6A 4HWKA 4K6CA 2UDPA 1E7SA 1DIAA 1KVRA 3RBVA 1YOVB 2VWHA 1ADGA 1C3VA 2D8AA 3GY0A 4XYEA 4JJGA 4I5GA 4HNHA 4M89A 3DBHA 2FSSA 4CM1A 5IDQA 1R4MA 4MVJP 4Z9YA 1N9GA 2RHRA 3H5RA 4KDFA 1IY8A 3OJEA 3VH1A 4INAA 4PIVA 5JNLA 5L4SA 4WKGA 4BNFA 1M6WA 4Q3BA 3OA0A 4EDFA 1PGOA 3NDJA 3SBOA 5L53A 4DQVA 4CLOB 1XKQA 1EMDA 2YYYA 3AUSA 4NNJA 5TNXA 2P68A 4HFNA 5KOIA 1D8AA 1C1DA 3AUUA 7ADHA 2YV3A 2HO5A 3F1KA 3PZRA 4KWIA 2VT2A 2BI8A 1TT5A 2W8ZA 3MJCA 1P1RA 2BFMA 2BF7A 4J7UA 4CMCA 2WYWA 2FPPA 1I3LA 9LDTA 4MVJH 1DFHA 2NACA 3BTUA 4XRGA 1NWCA 4RCVA 3D4PA 1HRDA 4KUHA 1M6HA 4H16A 5A04A 5ER6A 1AHIA 3ADPA 1QYDA 2QHXA 1P74A 4II3A 2NNLD 1LLUA 1U3TA 4W7HA 1LLCA 1YXMA 3SC4A 1I24A 2O3RA 4R01A 2NADA 2O7SA 1ZJZA 4RF3A 1HLDA 1ULSA 1ZK1A 5KJ6A 1H6CA 5JLAA 4LRTB 1FDSA 3KV3O 4JXKA 3DBLA 4R3NA 3SX2A 3FPLA 3PJFA 1LQUA 1QG6A 5FF9A 4NBRA 1JVBA 2VHZA 4NBVA 3GVHA 4JCOA 4U5QA 4GAEA 4RF5A 4GVLA 4DGSA 4NHEA 4K1LA 2E49A 1DLJA 1X13A 4M49A 2IZZA 2PKQO 2I3AA 1SO8A 3CMMA 3ANNA 4X54A 4NDNE 4CMAA 4E2WA 4RORA 1SB9A 3JYNA 1O0SA 3ZV6A 5AXDA 1B26A 1HDYA 1IHXA 3Q11A 1UDAA 2IXAA 3QWAA 2J5KA 1P3DA 1EDOA 4TKLA 2P4HX 1N92A 3K2BA 3UCXA 4LMPA 1PS0A 1IHYA 4IIUA 2NV6A 2DTEA 1ONNA 1R0SA 3TL2A 2VWPA 4NJOA 1P0CA 2WD8A 4Q3AA 4Y6PA 5CHEA 3JSAA 4DC0A 4XX0A 2GLXA 4YJFA 4OKIA 4D3DA 2NTNA 1BSVA 4OL9A 2AQKA 4D43A 5TJHA 2Q1SA 1E0DA 5KNLA 1A4IA 2EW8A 5L7YA 1PQPA 3N74A 5BR7A 1IUKA 2BMAA 4E4YA 2R00C 3JQ7B 5EN4A 4YQZA 1OAAA 2XF8A 4ALNA 4AJEA 4P8RA 4BO4A 1DJNA 1JVSA 1O9BA 3H6KA 4WCFA 4XGKA 3DTTA 2I66A 3CE6A 1FJHA 3A4VA 3H2SA 3BMNB 1O94A 4U0JA 3AM3A 4RLHA 3R1IA 1QKIA 1WVGA 4RVGA 5JDCC 3L4BC 4XDZA 4TVBA 4AJ1A 4XIYA 4MVJG 3WYEA 1U9JA 2O3UA 2E37A 2DBZA 1YJQA 1Q7CA 4CPDA 2YW9A 3DZIA 2WYUA 1YH3A 1XU7A 4O0LA 5FI3A 2GN6A 2VOEA 4CL8A 5B4VA 1R4MB 3E6AA 1N9GB 2Q45A 1ENPA 3DWFA 2UYYA 4L9RA 3V8BA 1N2SA 2EG9A 4AJLA 4DPLA 2ZJ1A 4B3IA 4R1TA 4UVGA 4PFJA 4XYMA 4EEXA 2HU2A 4H15A 1HDGO 5C5IA 1PQUA 3A9WA 8LDHA 5EINA 2FWMX 1PJSA 3K73O 4UAGA 1K89A 1WZIA 3OA2A 4KOAA 2WE7A 3FNGA 3U49A 3K92A 3OIDA 1P9LA 4E2XA 1RPNA 2EWMA 1TT5B 4WNCA 4CR8A 3UHAA 3A14A 5ILGA 4BGEA 4PLGA 4XYGA 1I10A 5EIOA 3G17A 4BO5A 1RM4A 1YQXA 2AG5A 1HKUA 1RWBA 3AWDA 3T4EA 3DTYA 3ZWPA 5JFOA 1JAXA 3KUXA 3GVPA 2PA3A 2EERA 1U3WA 4OQZA 3L6OO 1LU9A 1NPYA 3NKLA 5JXWA 2B0JA 3LLSA 2P9EA 3TN7A 3WIEA 4Y6SA 4YEDA 4A10A 4J43A 2UUPA 1FMCA 1PL6A 4KWHA 5CFZA 4R9RA 4BV8A 2OUIA 1IYZA 3RJ5A 2HQ1A 3F5SA 3AOEC 4B4UA 3HDQA 4CM4A 4BO1A 4NG5A 4RF2A 3P7MA 3TZHA 4CL3A 3VTFA 3JYOA 3HG7A 5ER9A 4RVFA 4J4BA 2I9PA 3GDFA 1A9ZA 1DIBA 2IEBA 5F5LA 1KY4A 4TRNA 2O2YA 2JFHA 5GMOA 3SLKA 5A3JA 4YCAA 3T7CA 3Q2IA 1EUCA 1MC4A 1IULA 5TS3A 1KYQA 1N5DA 1SZJG 1XR3A 1L7DA 4HNGA 4CV1A 5ENDA 4QSMA 3F47A 4FR5A 1F0YA 4IJKA 3RUDA 1UZMA 3LK7A 4R4JA 3WSVA 2GCGA 4I5FA 4U7WA 4HFRA 4Q3CA 3ABIA 3ZU2A 4XJTA 1JA9A 4PN3A 5JSFA 1BRMA 1EFLA 4BNHA 1PJTA 3VZPA 4GKBA 1ADBA 3Q1LA 5IZCC 3SXPA 1ISGA 3WIDA 2NU7A 1ONPA 3ZV5A 1CIVA 1HDCA 4YJFB 4E31A 5BSHA 5DP2A 4XDYA 3Q3CA 1A7AA 4YJGA 2E6UX 2DUUA 2O23A 4DREA 1E7RA 3RJ9A 1PJBA 1E5LA 3DOCA 1M66A 4J90A 2DPHA 2YFHA 4L76A 1TXGA 2P4QA 5I8ZA 4DXHA 4E5NA 1TI7A 3FR7A 2VHVA 2Y1EA 3NV9A 2F00A 3KSUA 3OIFA 3KSZO 1FDWA 4WCFB 1Z82A 1U8FO 2LDXA 1MGOA 3HDYA 1KC1A 2PKQP 4R5MA 4ZQHA 4C4OA 2C59A 4GX1A 2QRLA 3CMCO 4PG4A 4TZTA 3KB6A 3L9WA 5HM8A 4FCCA 1U1IA 5EQDA 1ZJYA 2IZ1A 4F3YA 2X7HA 1Z74A 4TKMA 1GEGA 1GTMA 1W0CA 3RI3A 2VRBA 1WP4A 1Q0LA 1SOWA 4BGUA 1R0LA 3H9JA 2RCYA 1QR6A 3I52A 1E7YA 2DT5A 4ND2A 5TRTA 2Y66A 5L7TA 2V6BA 4JK3A 4IZIA 3DAFA 4CR6A 1SC6A 3LQFA 5CEJA 3AW9A 3JQ8A 4BB5A 3W8FA 1Y8RA 1V35A 1MP0A 5HTOA 1UP4A 5IDXA 1T2CA 1YQDA 4DIOA 4B8WA 4PLYA 4E2YA 4PLWA 3ZU4A 3BTSA 1J49A 2IE0A 3OSUA 4N5MA 2JD0A 3E5MA 4CMIA 4HBGA 4GPD1 4UVEA 5DBGA 4HKTA 2QYTA 1ZCJA 1PZFA 2Y67A 4QFCA 4OXNA 2VHYA 1PJ4A 1PGQA 3QVSA 4ONEA 1SMKA 2CSUA 1BW9A 3DFZA 1ZMTA 4IPTA 3OJ0A 4XB1A 5EQFA 3ON5A 2Q99A 3ZNQA 3GEDA 5I9LA 4JX8A 1N1EA 1ISMA 1U28A 4A0SA 4W82A 2PY6A 2IZ0A 3ANLA 3I5MA 4JQCA 1DHTA 2BKAA 2JHFA 3JD0A 4B4VA 4R69A 4PLHA 2VTDA 3EHEA 3T7EA 1DIHA 1TVEA 1LDGA 4NR0A 4WOKA 4XD2A 4R41A 4CLRA 4UEJA 5GY7A 2GD1O 2O4CA 3ZHBA 3AI1A 3M2PA 1U3VA 5HS6A 2ZCVA 3K8ZA 2IDZA 3K6JA 1DFGA 4CM4B 3BAZA 3E8XA 5L3ZA 5TC4A 4B7CA 4YRAA 5JC1A 1QLHA 3GAZA 3PEFA 4GLLA 4J1TA 1I2ZA 3U4HA 1OMOA 3C8MA 1LRJA 2B35A 3INTA 1HZJA 1ZFNA 2P2SA 3WGQA 3AU8A 2YHUA 4L0QA 1OOEA 4IJUA 3OMLA 3I9NA 3HUDA 1Z73A 5FEUA 1UXJA 3ENNA 4YT2A 3RKUA 1RM0A 4D79A 4BNTA 2IEDA 1JDJA 3F3SA 4QT0A 4CR7A 3GUCA 3NX4A 1QMGA 4Z3KA 3WR5A 1NHGA 4YAGA 1CQIA 1GV1A 1SNYA 4N5LA 2Q46A 2DKNA 5KIAA 3OEWA 5K6AA 2G1UA 4J3FA 1PL7A 4NMHA 4YRBA 1YONA 2C07A 3TF5A 1E1MA 4JIGA 2J3KA 3GZNA 3C85A 4W6ZA 2QX7A 4OXKA 1FK8A 3RFXA 3H9UA 3WG9A 4CMJA 3P5SA 5CG2A 4YJGB 3JD4A 4DWVA 1NM5A 3O8QA 3L6EA 4GGPA 4RLSA 3VTZA 5ADHA 1KVTA 1GL3A 3DOOA 4I5DA 1E7QA 2GZ2A 4ZQBA 4BGIA 3VHRA 2X8LA 3PWSA 2OBNA 1DSSG 5IXSA 4URFA 4PCVA 3Q9UA 2PGDA 1Y7TA 4PG6A 3RUAA 3HFGA 5A5EA 1Y9AA 1P44A 1GPDG 1QV6A 2CF5A 3HN2A 4BL5A 3GRPA 2CDAA 4ZN6A 4CMHA 5G4LA 4PLPA 4FC6A 3SEFA 2GO1A 1JQBA 1NASA 2XOXA 3FTPA 4FGSA 4HFJA 3F4LA 3GEMA 1XDWA 1QRRA 3JTMA 3LDHA 3V1TC 5TX7A 2FZWA 1RKXA 2NVUA 1GCUA 5DOVA 3KM0A 1GYQA 3L07A 4UUMA 3RC2A 3WSWA 2I76A 2X22A 2CVZA 2PFGA 3ITDA 2DUWA 4IQ8A 2Z5LA 3JQ8B 4IY1A 1Y8RB 3N58A 3M1LA 3IDSA 5CPFA 2YY7A 3H65A 3F9IA 2VZ0A 2GPTA 2ET6A 2GZ1A 1TA4A 1J5PA 3I9MA 3IJRA 4BQPA 2BFOA 1QYCA 1SPXA 4CMIB 1UH5A 2GDZA 4GMGA 3R6DA 1LC3A 4Z9XA 3ZWWA 1QP8A 3VH4A 1B3RA 1GU7A 2ZKLA 3I6QA 2DBVO 2WM3A 1BVUA 1KVUA 3MJTA 2CF6A 4O5OA 4RZHA 4WASA 4ZHSA 1H9BA 2V65A 2VQ3A 1PU2A 2O4UX 3WGGA 5GZ6A 3SLGA 3PZBA 1MC5A 5EMHA 4IS3A 4DTIA 4JN6B 4BO9A 4RVSA 1PJ2A 5H81A 4OO3A 1KS9A 5B4TA 1KVQA 4IS2A 3KXDA 4YR9A 1D1TA 1HE2A 3IP1A 1G1AA 2JHGA 1N1GA 3E9QA 4OOEA 4IDBA 5LC1A 4CLRB 1W6UA 5T8KA 1ZO8A 2HRZA 4YYZA 2XXBA 4CODB 2X0IA 2OOSA 3ZWAA 4JBHA 4DLAA 4KDEA 4TQGA 1DHRA 3DHEA 3E9NA 1JKIA 4FFMA 4FPXA 2DTXA 3MEQA 4GWKA 4GBJA 4Q3DA 4TWRA 1O89A 3FWNA 2CMDA 1XELA 3GFGA 1SBYA 5C3MA 4KQXA 3BHIA 1AUPA 1LDMA 2YUTA 3I6IA 1ID1A 4G5HA 4W9NA 1DC3A 3ZNOA 4ZQGA 3DOJA 2Y99A 4BNVA 4OAQA 1QSGA 1WXDA 3TZKA 1X1EA 4IXTA 4E33A 3UICA 3EUWA 1BXZA 2A35A 1I30A 3RKRA 1XHLA 3HNPA 2ZYDA 4YPOA 4E2ZA 3U5TA 5JDIA 3AU9A 1EDZA 4BNXA 3H5NA 1YL5A 2Q2VA 3KOUA 1U5AA 4R16A 4XIJA 5THQA 5B12A 1E3WA 4FSHA 4BNZA 1H0KA 4JNKA 1A72A 2DFVA 2X5JO 3VVCA 5AXCA 1BVRA 3RUEA 2GASA 3D4OA 3GZNB 4CM5A 5JE8A 4GI2A 1RM5A 3WB9A 3WXBA 4WE3A 3CINA 3EGOA 4WLFA 4D44A 3QHAA 4TRMA 3VPFA 2B69A 4AG3A 3I9JA 3H2ZA 4EJ0A 3GN1A 3IKVA 5MGBA 4WK6A 1FDUA 2RBEA 4AJ2A 3EK2A 1HE5A 3ADOA 1R37A 3IC5A 2AW5A 4RO0A 3V2HA 1X7HA 3NGXA 3OQ6A 4IZHA 4DL9A 3A06A 4XR9A 1I3NA 5T67A 4LVUA 5DOZA 5I8WA 5U1PA 2J8ZA 1B0AA 3H4VA 1W8DA 1KVSA 3ROQA 3LT4A 2OORA 3WBFA 1PR9A 4MIOA 5BSFA 1XQ6A 5A3VA 2A9FA 1ISHA 4OM8A 1XEAA 3KHUA 3O9ZA 3ONEA 4CV3A 3IUSA 2W2LA 4IDAA 4M54A 1ZNQO 2NUAA 1X14A 4ID9A 1E5QA 3DAGA 1AN9A 2WWRA 3BIOA 4OSOA 1C0PA 3MZ0A 3WQSB 3FI9A 4FJ1A 2NVUB 4IMRA 3GA0A 3ZHXA 4BO2A 4XWYA 3PRJA 3D1LA 1R16A 3WGZA 5JAQA 3WTCA 5K0ZA 3ZWVA 3HDHA 3KYCA 3ULKA 3LT1A 2FN7A 3U4DA 2NU9A 1VKNA 3QWBA 1E7MA 3VPXA 1GDHA 3IUPA 4JP3A 4WCFC 1H6DA 1NVTA 1CQJA 4QO8A 4IDGA 1OC2A 1K6JA 1Y6JA 4FS3A 4GGOA 3CPSA 1UXIA 2NQTA 4BNMA 2PZMA 4I08A 5JAIA 4XGIA 3WWYA 2GF2A 2VYND 3UGKA 4J7CA 5AVOA 2HDHA 1I0ZA 2EGGA 4IMPA 3ONDA 3RC9A 3RC1A 4BKRA 2F1KA 3K5PA 3LZ6A 4IDCA 2JCYA 5TJ9A 2JJYA 3GUYA 1MFZA 4ZRMA 4NJMA 3EAGA 2O3JA 1E1LA 3ZGYA 2OXIA 3RUHA 1XA0A 4B79A 1SOVA 3C3XA 3ZHYA 5JY1A 2BRUA 2CDBA 5KKCA 4Y67A 2YV2A 3IQDB 3PIIA 5HWSA 3I3OA 4ITUA 2ZTVA 2WMDA 3ZWYA 4PG5A 2OP0A 4XQCA 5JO0A 1B7GO 4J1QA 3WLFA 1H5QA 3DMTA 4U8GA 3C7CB 3ENKA 2NU8A 3OP4A 4O59O 4G2NA 4WLNA 1GUZA 1YBMA 1H93A 1NR1A 2WD7A 2AQHA 3KYDA 3UOGA 1CF2O 3VKVA 2XXJA 1QYXA 4Q3EA 5DBFA 2NVWA 4BVAA 3CTMA 2E48A 4NK4A 3NTOA 1WPQA 1P1IA 1E1KA 2J6IA 1R6DA 2AE2A 2OZPA 1T4BA 1U2GA 1OBFO 3BXXA 5BNIA 2FHSA 2W98A 4YJDA 3MOIA 1P1KA 4YAEA 1N7GA 1Z6ZA 4MVJA 1WW8A 4CM9A 4Y6RA 2H9IA 2W4QA 1KIFA 4FJ2A 4RVHA 5TQVA 4O1MA 1NWHA 1GQYA 2DQ4A 2B4QA 2HMTA 3BTOA 1E3WB 4FOSA 2Y0CA 2DAPA 5DZSA 3ZW9A 4HX5A 4MO2A 2IYOA 4M1QA 2OFPA 3Q2KA 4Y8VA 3S2EA 2Q1WA 3FSRA 2FOIA 4UVIA 4EITA 4LGVA 5L7WA 3VH3A 4A27A 3MCVA 3QVXA 4HUJA 2EXXA 1DJQA 2QRKA 3QV1A 3DZGA 4YWJA 1GZ6A 4FBGA 5T57A 2W2KA 3INRA 3NTQA 3ROKA 4E13A 2VOJA 1DPGA 2RH8A 3B1FA 4Z3DA 4Q3NA 2CUKA 3BHMA 3I9OA 2B5VA 3FNFA 5BSEA 2W2LD 3GAFA 5DP1A 5F21A 1E7WA 4ZVVA 1HDOA 4DLLA 1I32A 6LDHA 4IIVA 5IN5A 1LDYA 1I3KA 5JAMA 5BT9A 4BKUA 1ZKMA 5G4KA 2CVOA 1PGPA 4MINA 3ETGA 4CQLB 2PD3A 3U09A 3QY9A 1OC4A 1Q2XA 1J6UA 3D7LA 3UFXA 3ZWXA 1ZZEA 1VC2A 3S55A 5T5QA 2XPCA 1NQTA 4BO3A 3KYCB 3ZZNA 4D46A 3H9EO 4TROA 2GNAA 1DRWA 4TZKA 5JC8A 4E21A 1GYRA 3UCEA 3PQEA 2VRCA 2HLPA 3WJAA 4ALLA 2B4TO 4PVCA 4MVJF 4QQRA 3VDQA 3D5TA 1VJ1A 3D0OA 3DBHB 1PEDA 2C5EA 3QWIA 1O6ZA 1UZNA 1EE2A 2ZB4A 3F4BA 4BO8A 1Q7GA 5JW6A 5JBIA 1UP7A 2YZ7A 5TSDA 3GHHA 4YBZA 3GMSA 5HRUA 4FFPA 3LF2A 1WNTA 3QJ5A 1B3BA 1GD1O 4NJMB 3PFWO 4UEKA 5EL0A 2Q2QA 4IJWA 4PLVA 5CDSA 1C1DB 5FFFA 1ZIDA 5CPBA 1EUZA 1YKFA 1NVMB 2E82A 5EPOA 2EIHA 3BHJA 2BELA 1YS4A 1EUDA 2AG8A 3ZV3A 3ZWNA 3EYWA 4ALMA 3AI2A 4YT4A 1BDBA 4BNGA 1YB4A 1IE3A 3PGJA 2ZTMA 1P0FA 4PG7A 2NVBA 1NNUA 3DZHA 3VPHA 3GEGA 3C1OA 3KYDB 3CTVA 3PP8A 3VC7A 3C7AA 4AL4A 3OECA 2GRAA 1GFSA 1Y9EA 3GNSA 4J49A 1BMDA 4E5YA 3PK0A 3HSKA 4UUPA 4MVJD 5I7EA 3WNVA 2DU8A 4CM9D 2OMEA 3PWZA 1PZGA 3DBLB 3DZBA 4CUKA 2DFDA 1NP3A 4CMGA 2NSDA 3MTGA 1EVZA 2VUSA 1BDMA 3PJDA 1UXHA 4IM7A 2HK8A 4R68A 4YAKA 1B2LA 1LNQA 1SAYA 2Q4BA 2X23A 1YJ8A 2CDCA 3Q6IA 1NXQA 2EP5A 1RJWA 1ZUD1 4L74A 4Q39A 3LVFO 4J91A 4J7XA 4MOWA 4XYBA 3GH3A 3Q0EA 4YRDA 3I9LA 1ENOA 1HYEA 4ILKA 1NHWA 2IYPA 3ZWOA 2Y1FA 4I1IA 1YWGO 2JD2A 4MP8A 4B3JA 4J1SA 1LDEA 4BO6A 1LSJA 1KEUA 4CUJA 4F45A 4BOYA 2JCXA 1IPFA 4NBUA 5U9CA 3ASUA 2Q1UA 4YXFA 5KVVA 2VNAA 2Y93A 1A7KA 2W2KB 3JQ9C 1V3TA 4LN1A 4DPKA 4E32A 4II2A 1C0LA 3RWBA 2C2YA 2HCTA 2O50A 1VE9A 2A4KA 3UKOA 4XA8A 1H2HA 2CVQA 2X0RA 5KJEA 1CJCA 4D0RA 1G6KA 3ORFA 6ADHA 3EZYA 2ZJ0A 3ANMA 1C14A 4DBVO 1IPEA 4AFNA 1GZ3A 4HV4A 5G4KB 4P4GA 1XWFA 1PJ3A 1UXKA 1T1RA 4TMFA 4CLHA 5THKA 1X15A 4KTTE 4F46A 3RQSA 2WSBA 2PV7A 1B15A 1E3JA 3LSYA 4CV0A 4RVUA 4U6SA 3RCBA 2VHWA 1R66A 2V6FA 2X86A 1LX6A 3RUIA 5MDHA 1ZK3A 4ZQEA 2CFCA 1T2AA 5JDCA 4P38A 5JPIA 2A92A 4W7IA 3JD1A 4HADA 2PWZA 1V9LA 3PLRA 4HXYA 2X0NA 3OICA 3H5AA 4L4XA 2AA3A 3D3WA 1LA2A 3GVIA 5G2OA 5COBA 3CUKA 4EUHA 1WMAA 5GZ1A 1E3LA 1X1TA 3JQCA 3SJUA 4M86A 2Q50A 1RYDA 5G0TA 3VOSA 3FRJA 5JCXA 1HYGA 3B70A 4ZQFA 3PDUA 4GWGA 2LDBA 1F17A 1IZ0A 4WOJA 3RU9A 1H6BA 1M75A 3FWZA 4PG8A 4NFSA 4UUOA 1UP6A 2B4RO 1VSUA 1MLDA 3WOHA 3GPDG 3QIVA 4BNKA 4W4TA 1D7OA 5IXYA 3GDOA 2JD1A 2C7VA 4P4LA 3F46A 1B8UA 1R15A 1S6YA 3PQFA 3PHIA 3P19A 4ALKA 5AOVA 3QSGA 3GPIA 4GVXA 3HFSA 1B8PA 1LRKA 3QWFA 3GGOA 1DBVO 2GERA 4L73A 1ZXBA 3BZUA 1Q1NA 1AXGA 4U0KA 4BV9A 4DQXA 1T4DA 1ONOA 3G3EA 4AJJA 1V3UA 4GLOA 1KOLA 4WECA 3WGOA 1PS9A 3U0BA 5F5NA 2RIRA 1Z75A 2O2SA 1E1NA 5CP8A 3OF2A 4QTZA 1T24A 1M76A 3PJGA 1HDXA 4M55A 3BMCA 3KETA 3DXFA 3LC2O 4O6VA 4B4OA 5T8KC 4R9SA 3DL2A 4PLCA 4E6PA 2B5WA 1ZXLA 2G17A 4RDHA 4N54A 3TL3A 3UCFA 3ITKA 2X9VA 3JQBC 5HS4A 3H7AA 2O3QA 1YQGA 1PJCA 3LT0A 3RBXA 3EVNA 2QW8A 4DUPA 1C1XA 4MKZA 2I5PO 3P2OA 4FN4A 3UXYA 3S1LA 2FMUA 3ZHZA 3WMWA 2HKIA 4CUZA 4CMEA 5A03A 1GCOA 4L8VA 1HDRA 4K9DA 5ES3A 1MXHA 4PGFA 4TSKA 3W4IA 4AJNA 4B7XA 1BXGA 3TZCA 3WGIA 3EC7A 3CKYA 3WICA 1HF3A 3PLNA 3IJPA 3GHYA 1LSOA 2OBYA 1MUUA 1NVGA 2EJVA 3GMDA 5JDIC 1ZSVA 2FPIA 1VKOA 3B1JA 3LC7O 3ZI0A 2DPGA 3QQPA 4MPDA 1JKJA 4FW8A 3PGXA 2ILTA 4XZ3A 5DCYA 4XRRA 1IZ9A 4K6FA 1SCUA 3KBOA 4IJVA 2GUGA 5KVQA 2HMUA 2NQ8A 3GC6A 2I65A 1DO8A 5I9NA 1X0XA 1DLIA 1X0VA 2UUOA 1BWSA 2ZK7A 2BFAA 4PZDA 2YQ4A 4GL4A 4CMKA 4CM6A 1O8CA 1AGNA 1QLJA 3I83A 3JYQA 1Z7BA 5CEFA 5CEEA 2J3HA 3GT0A 3HB5X 3MJVA 4KMSA 4C7JA 4CLEA 3BYZA 5HBRA 4DLBA 5C7LO 4I8XA 3PWKA 3TRIA 2H6EA 2EKQA 3RFVA 4O63O 3CXRA 2RH4A 3HE3A 3HDJA 3DEYX 4WLVA 1EVYA 3WNQA 1U4SA 5G0SA 3O4RA 3U4IA 3LF1A 4FFNA 1Q0QA 4LK3A 4J0FA 1VSVA 2G0TA 4NPCA 4YA6A 1VJ0A 4NK5A 1NQAO 2XAAA 2D3TA 1D3AA 1QYVA 3W4KA 4R51A 3FTNA 4XYLA 4E0BA 1MXFA 2IODA 2RHCA 4WLUA 3W8EA 5DBIA 5KJFA 2Q1TA 4D45A 3H9GA 3L6DA 4DMLA 5IZ4A 1ULUA 1BW9B 3DR3A 1CRWG 4JBIA 3KZVA 3DDNA 3U3XA 1UAGA 2I99A 1W73A 2C54A 2V6MA 1YDWA 1I36A 2WJPA 1YOVA 3IP3A 3OJLA 1GAEO 2EKLA 4BMVA 3LU1A 1DRVA 3NAQA 4WLOA 2C82A 3E5RA 3GQVA 2NTJA 2HMSA 3FBTA 2BI7A 3PTZA 3RC7A 5IFLA 5K9ZA 5L40A 5BQFA 1PQWA 4J0EA 1VL6A 1MB4A 3D5QA 3DFUA 4NU6A 3HHPA 4CM8A 1R4NA 4IDFA 4S1VA 2BLLA 3OM9A 1WAMA 2AE1A 4YB8A 5IF3A 3BMCB 3CZMA 4CLDA 3JCZA 1F12A 1VPDA 4R54A 4F6LA 4BNWA 1PZEA 2I3GA 4BUCA 5COAA 2Z95A 5EJ2A 1JWAB 4EW6A 2PH5A 5C7IO 4EJMA 2Y68A 3PHHA 4BMNA 5TT1A 1HLPA 4RJTA 5JY6A 1F8GA 4ZA2A 3RROA 1I01A 1QV7A 5ITVA 1P1FA 2HUNA 1LEHA 1ZK4A 2WE8A 4D7AA 1MG5A 1CEQA 4WNIA 2DBQA 1ZK0A 2HJSA 2ZTUA 2ZCUA 1ZH8A 4DVJA 4YT5A 2W90A 5DT9A 1BXGB 3JQEA 1Z7EA 2WTBA 2A94A 3HQ4O 1VM6A 2EGHA 3RSHA 1FDVA 5T6BA 4HY3A 3NT2A 5JMPA 3TOZA 5A5FA 1EFKA 1U4OA 5FYDA 1MFPA 1X7DA 2H63A 3ZH2A 3PIDA 4LISA 5IG2A 4XGNA 5AXBA 3W6ZA 1Q7BA 1WLYA 2P91A 3PHLA 4BNJA 4CM7A 1P45A 3O8QB 1UZLA 1KERA 3WFIA 1NPDA 4L4RA 1HTBA 4ZGWA 4AVYA 5I7SA 1K5HA 2QQ5A 4ZU3A 1TLTA 3DMYA 3OETA 3TDKA 4FJ0A 3GK3A 5JCJA 1HDZA 3AUTA 4WLEA 4ESOA 1A5ZA 4LMRA 4AJIA 2HSDA 1ZEJA 2VZ8A 2AEMA 4YJHA 3LLVA 4OYRA 2C20A 3K31A 5G0VA 1BTOA 2ZATA 4ALIA 3AOGA 4A2CA 4LCJA 4D41A 4BNLA 2O7QA 1JWBB 3C1AA 4QUKA 5GZ3A 2DC1A 4PLTA 5EERA 4XQGA 1KY5A 1M2WA 2HMWA 1LJ8A 1ISFA 4ALJA 5C37A 5KJCA 2FR0A 4YAIA 3PYXA 3VZSA 3D3EA 1UAYA 2B36A 3EZLA 3M1AA 2I67A 3GGGA 3WS7A 1ZEMA 1ZW1A 5G0WA 1DIGA 3JQFA 1OZAA 5JO9A 1L1FA 3H9QA 5DNAA 1L7EA 1X7GA 4UVDA 4E5MA 1YBAA 4A5OA 1F8FA 1VJTA 1JU9A 4QEDA 4WPGA 8ADHA 3WGHA 3JQ7A 3QA9A 4QFDA 4DQUA 1I3MA 3GZ4A 1DC5A 3QVTA 3GNQA 3PJEA 1U7TA 2QZZA 1WWKA 1NFRA 2H1SA 4EUEA 4Z9FA 4XQEA 2ZTLA 2D5CA 4I9UA 3AY3A 1T2EA 3AFMA 3G1TA 4AJ4A 2VCYA 5H82A 4N7RA 4EUFA 4EYEA 1R12A 3ETDA 3OH8A 3VKUA 4JLWA 2H5LA 1WMBA 2HMVA 3S2GA 4CM3A 4UEOA 4RV9A 1E6WA 1E3IA 1UDBA 2P9GA 3DC2A 3LYLA 4UVHA 1OFGA 1BXKA 4J4HA 4E5KA 4Y98A 3DBVO 3G79A 4BS9A 4CM8B 1PJLA 1R4NB 3NDIA 5DN9A 3T4XA 3GVXA 2QYSA 1GV0A 1XIVA 3GVCA 3JQDA 3PQDA 4OQYA 1RM3A 1CDOA 3UW3A 1R0KA 2GN4A 2EV9A 3WX0A 4AJHA 1DAPA 4ZRNA 5B4UA 1U5CA 5I7VA 4DYVA 5G0UA 3C24A 3FNHA 3IS3A 1EZ4A 2BD0A 4S3MA 1U8XX 2DM6A 1KBZA 2TMDA 1EK6A 1SEPA 2X0JA 2VN8A 4L75A 1EQ2A 1XG5A 1ZVMA 4ZICA 3I4CA 3FHLA 4UULA 2OGUA 1UDCA 1F06A 3SJ7A 1Y5MA 1ADFA 1PS8A 1PL8A 1GQQA 2PH3A 3BMQA 3QE3A 4RZIA 2GGSA 5EESA 2NTVA 3F6YA 4R1SA 1Z45A 2R2GA 2ZB3A 3ICCA 4CQMA 3OBBA 1ENYA 3RVDA 4XQ9A 4QX6A 4TVOA 1W4ZA 1JAYA 5A9RA 2OO5A 4NBWA 4GQAA 4XEHA 5A9SA 4ZD6A 3IMFA 4NFHA 1YBVA 2FSVA 5DDIP 1YE3A 4J2OA 1I5RA 2AQ8A 4YT8A 1LDBA 1LDNA 2C7GA 2PZJA 4YDRA 5C7OO 5JCJD 2Y1GA 2Y0DA 1YRLA 5DULA 4TRRA 5ENVA 1I33A 1HL3A 3IAHA 3ZWCA 5JYEA 4MJLA 3OFSA 3GOHA 4YTEA 1T2DA 2P5YA 4UREA 4BO0A 1I8TA 3WQQA 1MG0A 1D4FA 4YJHB 2HK7A 4MVJI 2YV1A 2Y1CA 3MJSA 2EKPA 1O95A 1I2BA 5AXAA 5HA5A 1HE4A 2CNBA 3WGYA 3WWZA 3ZV4A 3AJRA 5JYDA 2ZYGA 3UUWA 2RAFA 3N7UA 2PZLA 2PLAA 2C5AA 4LVCA 1DAOA 1IOLA 1VI2A 4ND4A 4NI5A 4Z0PA 5BNTA 3E82A 2BH9A 4R3WA 1EBFA 3RUCA 3U62A 4DPMA 4EI2A 1ZBQA 3HADA 3NDRA 4CLXA 4Z6KA 3EDMA 3MJEA 3CSDA 3K30A 3WJ7A 3WDSA 4GX0A 2B37A 4FDAA 1LRLA 1NR7A 1LSUA 1PR3A 3NEPX 2BGLA 3ASVA 1ZSNA 3CEAA 1EQUA 2ZQZA 4A26A 1AE1A 3AUAA 2FR1A 4HFMA 4R5HA 4DC1A 4FFRA 1LQTA 3JD2A 3GF4A 2UV8A 2YHIA 2P9CA 5CG1A 1E92A 3W6UA 2DTDA 3P2YA 2ZQYA 4AJOA 3KSDO 4N5NA 1E6EA 4BNNA 4IDDA 2PK3A 1DC4A 4OKNA 3AM5A 4XR4A 2X4GA 2I6TA 3QRWA 4LRSB 4OHUA 3TFQA 2Y0EA 5IJZA 2EHDA 1Y5RA 3GGPA 2IRWA 1YGYA 4DMMA 4AJPA 3CH6A 4TRJA 3F1LA 1G0OA 1ENZA 1MA0A 4ND1A 5CDTA 4H3VA 1O5IA 1DRUA 3IL2A 4RPJA 1YB1A 2PD4A 1TB4A 4RPHA 4YVFA 5A02A 1NAIA 1K6IA 3AFNA 4IBOA 2J3IA 3FR8A 2VTEA 3INGA 1GPJA 4MDHA 4UUNA 3FD8A 3V2GA 1P33A 4GSKA 1CERA 2JFFA 2WEKA 4DRYA 2J3JA 3E03A 3MJ4A 4XB2A 3RAJA 5AQ1A 2ZB7A 4MIEA 3C1TA 1OI7A 3IKTA 4KZPA 2WD7B 3W4JA 3WBBA 4BMSA 3GNTA 2Z1MA 4OSPA 5DCWA 4PLFA 1V8BA 2Y05A 3VZQA 1P1JA 2POQX 3JYPA 1LBEA 3H3FA 4WJZA 5B1YA 3WYBA 4WEQA 3CIFA 3O26A 4NU5A 1QYWA 1NFFA 5TT0A 4CQMD 4J16A 3IOYA 5CDYA 1GEEA 1XCBA 3KVOA 3X2FA 4MKXA 3RUFA 3OHSX 3BMQB 4Y9DA 1M67A 3JYLA 3ONFA 4J1NA 2FR8A 3O38A 4LCEA 2Z1NA 1HXHA 1P31A 1H6AA 4YQYA 2VWQA 1NPTO 4OJNA 4CQMB 4BKQA 3ZWMA 3VPGA 4OH1A 5I9MA 2HJRA 4P22A 4K26A 2OL4A 2E4AA 3JQGA 4MIYA 3UVEA 3VH2A 4ND3A 2PR2A 3DB2A 1NX6A 1ADCA 4RPKA 3E48A 1HT0A 4GX5A 5A9SB 5I7FA 3KYBA 5FWNA 3NYWA 4RQUA 1AXEA 4NZ9A 1BGVA 3NJ4A 4OXYA 2PTGA 5TIIA 2AMFA 2VUUA 3QWHA 3UH1A 3M2TA 4Z0TA 3K9QO 5CDGA 1XLTA 3Q9NA 5T64A 1DIRA 3DQPA 4JROA 4OGWA 4NFYA 4OOFA 3KLPX 4JGBA 4AICA 2CZCA 3KRTA 5ICSA 3PYLA 5IN4A 1EVJA 3GN2A 3S2FA 4RQTA 5L51A 4CMEC 3L4SO 2YDYA 1P77A 3PI7A 2BFPA 4ROSA 4KUEA 3HZZA 1NFQA 3ZW8A 1HETA 5K6AC 1IB6A 3O03A 1HYHA 1T26A 5IDYA 4JJFA 5BNFA 3U9LA 3NT4A 1TEHA 3ROMA 3RFTA 4I9NA 5LDGA 3OQ1A 3A28A 4IINA 3SC6A 4E30A 2X5KO 1RYEA 2R00A 1PX0A 1DC6A 3MOGA 1ARZA 3OIGA 2PGJA 3ZU3A 1LXCA 1GUFA 2VRCD 4AJKA 4FFOA 4ZJUA
chains in the Genus database with same CATH superfamily
3R0JA 2BFBB 1FXWA 1YB2A 2P30A 3N9IA 1N2OA 4HX2A 4JP2A 3MPOA 2JK1A 4MWOA 3UUFA 1TMGE 2BFFA 3MAJA 4Q34A 3WIUA 4P93A 2G36A 3SEQA 2PPLA 2IYNA 1G21E 3LC0A 3SP1A 4UBIA 3W8DA 1NYTA 5AVJA 5ICMA 4J0IA 4GPZA 2V4ZA 3UXEA 2UVQA 3HKBA 5IBQA 4D3FA 1LK0A 1AO3A 5IT0A 3HLTA 2AD1A 3FPSA 5DX0A 1G63A 1PR4A 1RRMA 1W4CA 2W71A 4J94A 3SDSA 1YC5A 3U9TA 3CKKA 3WK5A 3ZJUA 1Y7PA 4JEMA 4AD8A 5CB0A 1FDTA 5G3ZA 3BMOA 1CR6A 3QLJA 4MQFA 4OHBA 2PWPA 4OA5A 1XJ0A 4QXMA 4URUR 2DT8A 4XUGB 1DVRA 1IQUA 1V2GA 3SIPA 3TQHA 3OE5A 3F8WA 2GNOA 3MWEA 4MROA 2BEWA 1OGYA 2JL1A 4P3NA 3C8HA 4P4SA 5A4DA 5JQGB 3FFXA 3U0VA 3X1WA 3ZVMA 4JMLA 3FLEA 4YDHB 1GNQA 3A1NA 4ZDWA 4CZ2A 1R8SA 3FMFA 4V1CA 5A0FA 9LDBA 2PRKA 3LA8A 1L1EA 2FP3A 5KX5B 2HM7A 3AETA 3SNHA 1ZAYA 3HN7A 4HGRA 3PHJA 1DAFA 3CF4G 1SZCA 3BSSA 2WV7A 3DTVD 1BYUA 2OVBA 2JGRA 4M2LA 2WSMA 3DBRA 4K6GA 4F56A 1VHWA 2NSHA 2N42A 9MHTA 1TC1A 3WA7A 1J2JA 2O9JA 2QXYA 3ETEA 3EW7A 4HGPA 4UQPA 3PDJA 3QE2A 4KQIA 2P65A 2BGMA 3AJDA 4Z99A 4ZRDA 4XVQA 2NWQA 3IP5A 4F93B 4IL5A 4BJ3A 1KGDA 3V1YA 4LF7B 2K5UA 1YO6A 2W00A 2ZS8A 1NMXA 3PXXA 4CKBB 3CPEA 2BHLA 2H07A 1NZFA 3HCEA 4PF1A 4BP9A 4XKJA 4PVDA 1I7DA 1IL0A 5KEIA 5IYZF 4X95A 3PE4A 3B48A 4C3VA 2R1VB 1P9NA 5CMLA 1A4UA 3LC1O 1L4HA 2EEZA 2GAOA 1UWCA 3PVZA 1EE9A 4BGVA 2G82A 2ODTX 1TEVA 1ZD1A 1J8MF 3NLLA 4WZ6A 3TOXA 4QFBA 1CZNA 2FF7A 3AOEA 3U4CA 3VI4B 1W5AA 3JVVA 3W9YA 3FTQA 4RSMA 1E79A 4NOMA 4BFSA 5IDWA 5HW0A 4D56A 1TJNA 2JJ8A 2YQZA 5LB2A 5T4FA 1Z17A 4WESB 3UAGA 4CTOA 4P3XA 1G20B 4TV9B 1WSBA 4L5AA 5DN6A 5U4QA 3QUAA 5A9TA 1EESA 1JN0A 5FBRB 2XSZD 3OEEA 3IKLA 4NYIR 1W48A 4R8LA 3GOQA 5AKHA 1X8KA 4HDMB 4C2AA 1JW9B 4DQKA 3TNLA 2CD9A 1HE3A 1JF8A 4GHWA 3ZWBA 1VSTA 2PSHA 1CETA 3DEJA 4X44A 5ALQA 4D9FA 4OB6A 2PE5A 2YZKA 2OENG 1SVWA 2NUPA 3N1UA 4NIMA 1E32A 2OCKA 4ZVMA 3CS3A 3O1IC 4N3AA 3LKVA 3M4JA 3K0HA 1RU3A 2QR3A 5GM1A 1JXAA 4YX9A 4K28A 1QRDA 1M33A 4UU1A 2CVHA 1K8QA 3WGKA 2CD7A 4AUKA 1W59A 3R76A 4A0QA 5DX1A 2R7NA 4Y1RB 1NSTA 2QGNA 3NTLA 4X85A 3S29A 3M1YA 1G4UR 1NJGA 2YFYA 1TAGA 2PEZA 3BEDA 4XUDA 1GPAA 4GKVA 5E0OA 2ATXA 2V0CA 1ORRA 2WI8A 3B9PA 3K4QA 2BI4A 4M46A 3VVBA 1GLNA 5CK5A 3IIEA 2F4VB 1T3GA 2B1JA 3B52X 4P4UA 4HDQB 3ZGNA 2PUWA 5FPSA 3GZJA 2EWVA 2HYIC 1KAOA 3HJAA 4O3FA 1U3CA 1GZ4A 3L8MA 4EQ6A 4LMBA 2JAPA 3CZRA 4EYSA 4D26A 1FXSA 3PUKA 3J7AC 2WYHA 2FPLA 4BX8A 2UAGA 3GJ7A 4K3UA 3Q9SA 1J0XO 1NBOA 1VL5A 2XGSA 1OU0A 3L82B 5AUQA 2NM0A 3AO0B 4MWDA 5CW2A 4RIEA 4BFYA 3KVYA 4I5EA 2W37A 2X1HA 1XQ1A 2KQUA 2PZKA 3SBEA 2QK4A 2BEJA 3NKVA 3I23A 1G8KA 5HKAA 1NVUQ 3B6ZA 1KJNA 3AUXA 3MWDB 3OOJA 5IH7A 2CXSA 3HCFA 1RLTA 1QF6A 4L4UA 2QP3A 2XUPA 4C7XA 5A06A 2QRHA 2H51A 5T7BA 2QVBA 2UVDA 4P08A 2YDXA 3PGKA 3P9CA 4UBOA 1XCJA 3BE5A 5LLSA 1SBCA 4N49A 1KETA 1KMQA 4MVWA 4S24A 1V1RA 1JR6A 1B16A 2AFIE 3LZCA 2DEUA 2EGUA 1C8BA 2FRDA 1Z88A 2O5RA 1D2MA 1KJWA 2WW8A 3FNEA 4F7DA 4ZHQF 1OX6A 2XADA 4GBGA 4R6XA 4YP1A 5FLKA 2OHGA 2REOA 3AF6A 2VSNA 3EXHA 4EGQA 2JKVA 4FHCA 4B5LA 1E0KA 4UUQA 2GEUA 3CNBA 4BN5A 2WR8A 1E1RD 3FCUB 3E7FA 3E35A 2D2IA 1UPUA 3R44A 3V5NA 1A5AB 3LCMA 2WP8J 2GCNA 2ZE8A 3I9V1 1CJVC 4MP6A 1K97A 3U3MA 3Q8MA 1FFXB 5L95A 3AKCA 2C2XA 3P9PA 2BPOA 2OXEA 4H6PA 2VK8A 5F1PA 2JAOA 3M9WA 3X1JA 1Y8ZA 2GN8A 1MCZA 1U8ZA 2P2YA 1K66A 1S7CA 1L4BA 1XUOA 3DVQX 3QOXA 5IU6A 1JJ7A 2QG4A 2W7TA 3MERA 4F84A 1J2YA 1WTAA 1ZSYA 2QRGA 4J4TA 1L4NA 1VL8A 3CNEA 4FHDA 1CY4A 2OFXA 4FKZA 3BS4A 5AKIA 4DF3A 4F5YA 5KHOC 1Q1QA 2W6NA 1IBCA 2G06A 3AKYA 5IJ0A 4N8DA 4ZO9A 1L5GB 1JDUA 3KR9A 1VMAA 2YBDA 4MO9A 2J09A 2JFBA 3U48A 1EVIA 2J5QA 5TV2A 3WA6A 3FBGA 3QUBA 1TT7A 1Z5WA 4Q00A 5CB4B 5ILOA 4M36A 1YZTA 2JIRA 3OJCA 1WZ2A 2IPMA 2IYWA 1EYZA 2XTMA 4MR8A 3WFJA 4MW4A 4RY2A 5L3QA 5CB8A 1FP7A 3W04A 1K4YA 1XD2B 2X9NA 3NBQA 4UNQA 1JUDA 3W2TA 5KOHB 3P2MA 3IEIA 3F5QA 4RJJA 4EHIA 2FGKA 2ZRFA 3F6RA 5F3RA 3DZKA 3H8VA 3EZXA 2FOLA 3U7RA 3VZBA 4TT3A 3ZCXA 4EW3A 1K3UB 4DW8A 3QX9A 3CVYA 3SXUA 2UYQA 1JPVA 1U0NA 2PNFA 3FPBA 2II6A 2JNWA 2J5BA 2VSOA 3AP2A 3DAPA 3OAAD 3C39A 4IDEA 5BQOA 3EDRA 1V43A 4DBZA 3M7IA 4G5QA 4NHOA 4BAUA 2UXDB 4R2WA 4P58A 2ZJAA 2OA0A 2YJZA 5J40A 2XQKA 2VZ9A 1KEPA 2H1HA 3AFGA 3KEOA 3SFZA 2J6HA 5E2AA 2WWHA 2GD0A 2YOGA 2V7PA 2O59A 3IT1A 1ADYA 3B20A 2XD4A 1C1XB 3ZBTA 1W4RA 1YE5A 2PZGA 3RLFA 3BCHA 2JJ1D 4E1AA 5KNDA 1AHHA 2BBTA 5L45A 3ACCA 5CA0A 3EISA 1UFVA 4NQZA 4ZU6X 5FRDA 1WMDA 4AAYA 4WCDA 2P9TA 1NV8A 1FTWA 4BRUA 1CJKC 1IBKB 2FP4A 2O52A 5JR3A 3JQAB 1E1QD 1UMDB 3N0VA 4ID3A 4RMJA 1I4DD 2OHIA 5LP6C 4HDRB 1E3EA 2ZI6A 4GLBA 1PGNA 1VDMA 4BX2A 1QTRA 4Y6GB 2ASVA 2MU1A 3RABA 1FSPA 5IKOA 4G0MA 1JA0A 4BMZA 3H84A 2FPIB 3IO3A 1AGRA 1E9VA 4M8SA 1Z28A 3DQZA 4MUYA 3RRZA 4BIIA 2XJ4A 1S3FA 3A4TA 3FZEA 3II6X 1XU9A 2I4LA 2Z2IA 3SVLA 4B3TB 3FOEC 3KSRA 4HPWA 1X3LA 2QLTA 2F1OA 2FZEA 2PCJA 3ST7A 2ZBVA 4HGQA 1G7CA 1E89A 1ZUNA 3LWDA 3N76A 1Z6GA 4RKWA 4YAFA 4B3HA 5P8WA 5K5EA 3JS5A 4JVNA 3W6PA 1G3UA 1N7HA 5ERGB 1ZJWA 4YJ3F 4IQGA 2M2IA 4HUQA 1C0KA 4K81B 5M5BA 2FUNB 1L7VC 2O1SA 3IBCA 3IOMA 3DOFA 2WOJA 3NATA 3EVTA 3QXHA 1EIZA 5C8XA 2HPZA 1SBNE 5E1MA 1KEWA 4EZBA 3E7DA 3QBDA 4V02A 1N6RA 1MABA 2GN0A 4QECA 3NRBA 2GR9A 2QMEA 4LXUA 3BRWD 3RR2A 1DPFA 1G2PA 2PN1A 2DQKA 1L7MA 4WBNA 5K0BA 5ELXA 4RZUA 2C0CA 1NI3A 4D25A 4BQNA 2WZQA 2X9GA 3NORA 2V4MA 1NUTA 2VDWA 2IS2A 4LK2A 5L3SA 4HNQA 4KXUA 4OUKX 5FBWB 3LK6A 4D5EA 2WUFA 3DE0X 4F06A 2EDCA 2IUEA 3LBYA 1L4UA 1SBZA 3N53A 1VKHA 5IPFA 1U6KA 3IP6A 4BTEA 3IPCA 5E4FA 1QFYA 2O7NA 5DBHX 4DDMA 1ANKA 4ENRA 5A1TA 1J20A 3NH9A 4CU5A 2X6TA 1XZBA 2I4MA 16PKA 4IOLA 1HDEA 3TMAA 1CY2A 3K71B 2ZVPX 1SB8A 3DZFA 2BM8A 3BPSA 3H2KA 4H9GA 3CU5A 2FN3A 4RL6A 3DYIA 1EIWA 2P3LA 4RL4A 4ASUA 5GPBA 2W2TA 1VBMA 3O4VA 4LXQA 4DCMA 1UFOA 7MDHA 1PW7A 4F11A 2R1TB 5K4GA 4EG8A 1KZ1A 1XALA 4FFLA 2ZJ4A 4UBLA 4CEHB 3EARA 4HB3A 4HEA1 3S2IA 2XT6A 1PG0A 1E20A 3D0QA 2WDPA 1PZHA 4NONA 4XFJA 2IEYA 3P5BA 1D6JA 2BGIA 4UUBA 2HAEA 1JXOA 3BL5A 1SKUA 3BMNA 4ABTA 1HFJA 1PGJA 1G6HA 2G63A 2FW6A 1SWVA 3B6MA 5CJ2A 4C30A 4ACAA 1PFGA 4K6CA 4DZZA 3DVAB 1T4CB 3UG7A 4IHJA 1DIAA 3MWFA 1W2GA 3CN9A 1CR2A 1QRUA 3TB6A 3ZLUA 5D3MA 1C3VA 2PRSA 1YGPA 4HVTA 1VECA 2OHJA 5G1NA 3AY0A 3SS7X 2QN2A 3X43A 1TYEB 2DHDA 1R4MA 3ESRA 1IU9A 3WAJA 1S2DA 3ZDZB 1N9GA 1Z39A 4AMYA 1EINA 4KDFA 2XMZA 1YS9A 1IY8A 3A2MA 4R7TA 5CTAA 1Y4UA 4GOMD 4M9SA 5L4SA 3QKRA 1EVKA 1R4ZA 4WKGA 4NECA 1PSWA 1DS6A 1YS6A 3NU1A 5BWMA 2BFEB 3ICWA 3CX8A 1E9AA 4CLOB 1KP3A 3BGWA 1EMDA 2LVBA 2YYYA 2VH2A 4NNJA 4P92A 4RU1A 1OZFA 4OCZA 3T4PA 1Y63A 3DW1X 2YV3A 4Q05A 4KWIA 5D7NA 2AIRA 2YRXA 1UBKS 2IYLD 1P1RA 1OR8A 3VO2A 1SXGA 3EZ6A 2PX4A 1P2SA 1Y8CA 1I3LA 9LDTA 4RMIA 3I04A 1DFHA 4ARUA 2VKQA 1B23P 1U9CA 4IKPA 5HJ7A 1E2HA 3OM1A 2C78A 2WIGA 2E0IA 1L5OA 2XWSA 1QYDA 1FB5A 1WQ4A 1SXJB 1GTVA 3ISVA 3SZMA 1U3TA 4DJAA 4DV2B 4KK3A 1RXWA 1UFRA 4YQEA 1LLCA 3HN6A 3N5KA 2VDKB 3PDWA 5EP3A 2JCBA 3N87A 5BV8A 5KQLA 2KYRA 5KJ6A 4V03A 4DUGA 2M32A 1IY9A 3QMVA 5D86A 3G2QA 4LRTB 3QEAZ 1FDSA 1ZZGA 3NHAA 3FVTA 4JXKA 1N2XA 1YQ9A 2HA6A 4WK2B 1Q7TA 4MTCA 4BMCA 3FPLA 3KQUA 2FVXA 3PJFA 4C0WA 1EX1A 3K05A 4NX2A 3IPYA 1TYDE 2QUAA 3K72B 1LQUA 1QG6A 3X0DA 4ABYA 1UKAA 3GVHA 4LF6B 4UHHA 3TLBA 1DXQA 4KRYA 4GAEA 4ESEA 3WMEA 4GVLA 2QTRA 4O2LA 1QRSA 1NMQA 1YUMA 2QRQA 3PCRB 4EB6B 1RZVA 2A0YA 4IOJA 4KLCA 4NHEA 3AEZA 5A4IS 1GGMA 1X3SA 3KQYA 4K1LA 1PNRA 4L7VA 2E49A 3T34A 4M49A 2GBCA 2NG1A 1AV7A 4KO1S 5J2TA 5KNBD 1TC2A 4L8WB 1WA5A 2JCSA 4M21A 3AJAA 3LV8A 3U44B 1O0SA 2F64A 3DE1X 1WHTA 1HYBA 3A0UA 2FFRA 2UZ1B 3KFXA 5JG7A 1IHXA 1QO7A 1I6LA 4F8JA 2IXAA 4L5BA 3T7AA 2PGAA 5JRDS 1EDOA 2BH2A 2WAAA 2F1IA 1NW7A 5HCUA 1WDTA 2PCLA 2VPIA 3A4MA 3TE6A 1N92A 3BGSA 5HQ3B 4ZIRA 3T52A 4D57A 2ZSAA 1NKSA 1SVKA 3PV0A 5CFPA 1R0SA 1QTIA 3A7EA 1F0KA 3IAEA 1DDIA 3BIJA 3F71A 5DNVA 3T7TA 1P0CA 2R6AA 1KQPA 4IXNA 4Y6PA 1Z38A 3EQ7A 5BRJA 3JSAA 2A4MA 1NN1A 3B9BA 2GLXA 1V41E 3D7KA 1CUGA 1TKCA 2ODEA 5E1BA 3RIEA 3NOQA 2PZEA 2G9QA 5J9FA 4GRDA 2Q1SA 4RHFA 1A4IA 1Z6YA 3S2YA 1SUDA 1ZNWA 1P9WA 3VYSB 3BJIC 3CRNA 3R0QA 5DRTA 1L5SA 4E4YA 2YXEA 1KHTA 2J6CA 2J9FB 3JQ7B 3E15A 4B9EA 3AHIA 1DJNA 4HEA6 1EP3B 2CGEA 4R1QA 1NVVQ 2GCPA 3WVNA 1NATA 1Z4IA 2QTVA 4HEQA 4HYEA 4MDEA 3H2SA 1EBBA 2QAGC 1D2HA 2XUGA 3NWJA 5JDCC 3B12A 4DR1B 1EWQA 2VHTA 5EE5B 3HKEA 1B00A 2O3UA 3KOWA 5EIHA 4UHKA 2JB9A 2YXLA 1KP2A 1Q7CA 4NYMR 1FMJA 4PCLA 3B9RA 2WC1A 4I19A 2O20A 1UIRA 5H9WA 1TQ4A 1T36B 4O0LA 5FI3A 4DA6A 3E6AA 1YRAA 1TYCA 2G8LA 2Q45A 2IBMA 3ERCA 1MOQA 1Z2NX 4ZJYA 4LDNA 3HBJA 1AY0A 3AT1A 4P9NA 3PFKA 4UTRA 4OK6A 1HNZB 1HORA 4DPLA 4U3JB 3RG2A 5AW1A 3KSBC 1GAJA 4Z7OB 4UVGA 3R0XA 4EEXA 2HU2A 4YYEA 5C5DA 1NLMA 5E6UA 5C5IA 1ST2A 2IBTA 2HSWA 2W6QA 1PJSA 2DWOA 2WSSA 3LPDA 1V5GA 1G64A 4Q9LA 2WE7A 1AMNA 1NIJA 3LBFA 4L4ZA 1XPUA 1LVGA 2XRYA 4ERXA 2QLJA 3KQOA 4DNXA 1P9LA 1BE6A 1RPNA 4WNCA 4XLZA 3AHJA 3NG1A 4I6JA 3A14A 4CR8A 3R75A 1HMYA 3DPIA 4ZZ0A 5J4LA 1JA1A 2VNKA 3G17A 4OGLA 1VB3A 2OYSA 3LLMA 1RM4A 2AG5A 4I9FA 3HSSA 3P9RA 5F76A 3ZWPA 2ZE5A 5JFOA 3KUXA 2NOGA 1U3WA 1L0BA 4IW3B 3WMRA 5ALNA 1Q3HA 3NKLA 3G6WA 1L4LA 3LLSA 2QUKA 3LFUA 1PG2A 2HZBA 3QVJA 4PHFA 4O4IB 4PSUA 3TN7A 3G8AA 5CFLA 3MUOA 4HTFA 2UUPA 3EGCA 1FMCA 4PR3A 2PT7A 1UC4B 4EHFA 2H18A 4BV8A 5DHQA 1IYZA 1K8YB 4DA4A 2Y4NA 1SVSA 4CM4A 2ODNA 3OPYI 4H7JA 4ZZIA 4RF2A 3P7MA 2CLHB 4XIFA 5EKDA 2JFUA 1WCIB 4D9BA 3VTFA 4DCNA 1SCQA 3HG7A 3OCCA 4UTXA 3RT7A 2FZKA 3N6VA 4C7VA 2ZUWA 2I9PA 2Z6AA 2IEBA 4AKHA 1FS4A 1KY4A 1RFGE 1R00A 1X1CA 3FH0A 2GM9A 4KLAA 3M6AA 5GMOA 4L02A 4Z1OA 1L4GA 1FRQA 4CKZA 2VYFA 3RM3A 1E5XA 3T7CA 1SD5A 1VP9A 2H92A 3JTEA 3S70A 2HJVA 1GN8A 1EUCA 4LOHA 4YPVA 1XZAA 3C7KA 1Q1BA 3D7SA 3PXCX 3LCRA 4FFSA 5TS3A 4H3KB 5TQ2A 1V7PC 3WE7A 4LCEA 3UMSA 5ENDA 1A76A 3F47A 2ZSJA 4FR5A 121PA 3RUDA 1QIEA 2VNIA 6REQA 2JLAA 4XYLA 3B6KA 4I5FA 4U7WA 13PKA 1GZDA 2GBIA 2MSDB 5JSFA 1DT3A 1DGQA 1ZUWA 3DO8A 1BOFA 4IWXA 1SHLA 3VZPA 2HBZA 4N9QA 1L5YA 1ZM2A 4HXFB 4X24A 1HNNA 3UWPA 5F64A 2CJXA 1T8YA 2HWXA 2NU7A 4HEJA 1WLSA 1Z33A 1ZG3A 2V7VA 1SUSA 5FNVA 1JDTA 3D3KA 3AYXB 4RVNA 4RZSA 4E31A 5A4JA 5HX7A 1X7WB 2YMLA 5LXTF 3V8MA 3ZS8A 4Y6LA 3AB7A 4D2IA 5GJBA 1KE2A 3MSCA 3Q3CA 5LQDA 2DUUA 1TF5A 3UG6A 2GJKA 2B1IA 1E7RA 5KDLA 1PJBA 4MQMA 1QVZA 4QD3A 4JSTA 3VR4H 1S9HA 2CK3A 3WB1A 4WWHA 3R9XB 1A88A 4J90A 4A3SA 4L76A 4YRTA 1RVDA 2P4QA 5CNJA 1VCIA 1VSBA 1TI7A 3HWWA 3TLKA 1O94D 2VHVA 1P81A 1JEYA 2F00A 4KITB 1HO3A 1DDGA 3K09C 3KSUA 4PS0A 3KSZO 1F1BA 1FDWA 4LBVA 1Z82A 2Z43A 2CMFA 3QXJA 1WU7A 2QTMA 3FYUA 4JQYA 1RXEA 1KC1A 1BFDA 2L17A 2PS1A 1N4DA 3ORYA 3QF7A 5EHGA 1NF3A 1FQWA 2QRLA 3RS8A 5FWXB 1Y4DE 3VSCA 3ZEAA 4FCCA 1U1IA 1GOTA 2RHMA 5KYXA 4CEIA 4H1VA 4IV8A 4C88A 1KZ4A 4TKMA 1YIOA 1GEGA 1GTMA 4B6OA 2VRBA 3UOWA 1Q0LA 2ES4A 1FYDA 1HG1A 4JQSA 4WFJA 1U5BB 1U7OA 2RCYA 4JOBA 1MNQA 1RBQA 1X1QA 2QORA 1KSJA 1YD7A 4X3PA 3O3MB 1KAHA 4DMKA 1FTGA 4JK3A 2PGXA 2HIHA 3E2MA 1SC6A 3I3SR 3LQFA 4RK0A 1V35A 1HZZC 5KPDA 1BQEA 4UCWA 3DP9A 2QI9C 5FQOA 3EVZA 2C83A 3WRXC 3ZUPA 4ZI2A 4FKMA 2I1LA 2XTZA 4E2YA 3UAYA 3UA3A 2XCIA 5AJYA 3ZU4A 4QYIA 1DV1A 4AKIA 1AF4A 1XX6A 2R4UA 2JD0A 4OLFA 2GYVA 4UVEA 4GLFA 1YJCA 4HKTA 2ID9A 2Y67A 3SHVA 3DT6A 1Z4LA 1IUOA 2ZYWX 1PGQA 4FZRA 1BWQA 3VHLB 1DX9A 1JSCA 3C43A 1N0WA 3HVRA 1ZMTA 2XVZA 1HRKA 4IPTA 3FWHA 4Q9JA 4RH3A 4XB1A 5EQFA 1K2VN 3ON5A 3KL4A 5F7XA 1Y37A 1TD9A 4JC5A 4QXRA 3AVYA 1ML4A 3G2MA 4W82A 3ANLA 2IZ0A 3ZXYA 3H11A 1N0IA 1EFHA 3JD0A 1DEAA 3BD6A 1JQJC 5DYNA 3WLHA 2EFCB 2Q0HA 3BRQA 5REQA 4Z4GA 3EHEA 1JGTA 4WOKA 4NR0A 2A7XA 4AO7A 1Q50A 2WQ7A 2OKGA 4G07A 2QD1A 2PR7A 5LIPA 2O4CA 1EHCA 1F0PA 3KPYA 4FFVA 3S44A 1XXHB 1ZH2A 4QU8A 2HSEA 1LB1B 3OLCX 1Y6FA 4YRAA 1OGIA 2PBLA 2ZBFA 5DM2A 3PEFA 4BB0A 3G2KA 3A6FA 3C8MA 1ODSA 3WLMA 3SSNA 5H3HA 3WV5A 1O96A 2OQ2A 4YFYA 1NMZA 1WCWA 3E3MA 3D2AA 5A4MS 2UYCA 1VE7A 4DKXA 1VP3A 3G7SA 4MR7B 3VR6A 3O93A 4GECA 1TK3A 2YHUA 4KNWA 1OOEA 4L0QA 3G13A 4YALA 3RHSA 2W83A 1Z0KA 3HUDA 1Z73A 4UE2A 4C7MA 2BM0A 4IIJA 1REQA 4IX1A 4AJ9A 3ENNA 4NFLA 5FEUA 2WHRA 4OHYA 5ISMA 5FA6A 3BJEA 3LW7A 3K0KA 1PVDA 3ZU6A 2B20A 4MQEB 2ZP1A 3C3EA 2VQ6A 3GUCA 1XE3A 2C42A 2O2EA 2B3TA 4Z3KA 3LA6A 2CXNA 1OH5A 1CQIA 1GV1A 1XRMA 3PENA 5AM5A 3UO8B 4BAZA 4BRSA 1B6SA 4QNMA 3CLVA 2DKNA 1HL7A 1T0JB 2D2EA 5JNWA 4JI2B 2NTEA 4DDUA 1QONA 2XMPA 3A27A 4ENSA 1Z16A 3PQ8A 5EGNA 4YRBA 1ISPA 2C07A 4UEWA 4RD1A 1P5RA 5IAGA 1WM1A 3E84A 2GN1A 3K9CA 3GZNA 1DKNA 4HNSA 2QNRA 3RFXA 5ALIA 1NN0A 4PGMA 3P5SA 2R2AA 4YJGB 1N2CA 3O31A 4P82A 3ROZA 3E3OA 4Q4AA 5I01A 3O8QA 4GGPA 1BMFD 4UMDA 2EJUA 3VTZA 4OF4A 4CKWB 3ANTA 4XB6B 3C6YA 5JXIA 1E7QA 4IOKA 3NVKI 2JIQA 5AKKA 3VHRA 5CVDA 2V98A 1IOWA 1EK2A 1QK5A 1S2IA 2W70A 2C7QA 5KYGA 1WUKS 3QZUA 1W4BA 2PGDA 1ZPDA 4B2PA 4O1IA 1DEKA 5A5EA 3SU8A 1E64A 4JP8A 4ZVKA 3I0MA 2PUEA 1QV6A 2CF5A 1EQAA 1N5OX 3OZVA 4JVOA 4MK4A 1PUJA 1X77A 3MD0A 4KQHA 1O58A 1UBUS 4CMHA 3QE9Y 3W7BA 2I1QA 1NASA 1N36B 2DRIA 4Q03A 1RHQA 4HFJA 3F4LA 1DQYA 1IZZA 3C5VA 1HNXB 1XDWA 2VUHB 3EOZA 3V2IA 3JTMA 5KWIA 2XOKD 5TX7A 3WWEA 2GD6A 2NVUA 4P3YA 4RQAA 2X9QA 2GXUA 3AQIA 3TO5A 2V5AA 1NXVA 1PYDA 2I4RA 5AWFC 4RK4A 3VO9A 1MU0A 2CVZA 1PK8A 1QANA 1Z7GA 3ITDA 4QGBA 4ZYWA 3FG9A 3JQ8B 5CH3A 4S2EA 3SQWA 2I54A 2CN1A 1A4XA 2FNAA 2BC9A 4R2LA 4AC9A 2FEAA 3AHEA 3DCIA 3N58A 5D51S 4R8MA 3VXKA 3K9FC 5IM4A 4DKJA 4G0WA 3RSGA 1Q0SA 4JASB 2B8EA 5EUQB 1TA4A 1J5PA 2Q62A 3EIFA 4X3CA 1D2GA 3LY8A 4UJ5A 5KYWA 1SPXA 4YFVA 2GDZA 3IEPA 3DMNA 1J06A 2IYRA 3R6DA 5KTPA 1YCHA 3IBFA 1B3RA 1XP8A 2ZKLA 1PSZA 4H4EA 4MUBA 1IHUA 4O5OA 2V3VA 3TIXB 1E99A 2K7FA 2GCIA 1M6VB 2V65A 3LTEA 5LMCA 1PU2A 2QTHA 3A36A 5H0IA 3SLGA 3Q3EA 2ZSUA 4OG2A 1AIPA 5EMHA 4Y18A 3A6EA 3LDAA 4RVSA 3K0FA 4M9CA 5K99A 3TECE 3TTVA 1HE2A 1CIJA 3T7IA 1NUHA 4KX5A 2JHGA 1AC5A 4KV7A 4NZPA 4B09A 5SYNA 4BFTA 4E08A 4N3CA 1NNEA 1W6UA 4LI3X 1OBCA 2YWCA 3ZBQA 2LKCA 2HRZA 4BNDA 1U4NA 3ILVA 3OY2A 4CODB 1CUAA 4KQFA 4YYZA 2K87A 4JBHA 4DLAA 4A2QA 4N7BA 1ZGHA 3Q0IA 4GUDA 3ZGXA 4FFMA 4FPXA 1BFUA 1DMRA 2DTXA 4GWKA 2VXCA 3MEQA 3P4YA 1U6JA 4JB0A 4PRZA 1O89A 4TWRA 3FWNA 2CMDA 1U6IA 2XQIA 1DZ3A 1UOEA 1SBYA 4FQ5A 4LI0A 4MV7A 1NIPA 1NBME 3VYUB 4E5DA 4DV5B 3MBIA 4G4JA 4AO8A 3OVMA 1RAGA 1T0PA 1TO1E 3DPUA 4C0XA 4D9JA 1EP9A 5AW4A 1CKEA 3AR4A 4M1YA 3C14C 3PXGA 4BNVA 3KKZA 1CXZA 1A3CA 4MA4A 4Q82A 3K70B 1X1EA 1RWPA 3AKDA 3LHIA 4IXTA 4E33A 1USIA 4XTRA 3UICA 1WB6A 5IT4A 1BXZA 2VDJA 4D4IA 5JH7B 2E4ZA 3HNPA 4Y3UA 5L6MB 5BNZA 4L0DA 3UJ6A 3JAMA 3VPDA 3U5TA 2O8CA 5FPTA 1CR4A 5D01A 5F7ZA 2IKSA 3A9VA 1RABA 4BNXA 2RJ3A 3FE2A 1NQVA 2HHAA 3RS7A 3IV9A 2VDOB 3AP3A 1Z0IA 1U5AA 1T91A 1JEJA 4BP1A 4LHYA 3LHSA 1L5QA 2QF7A 3LDFA 3DSRA 1H0KA 5CURA 4BGDA 5JWHA 1QC5A 5TPZD 3VGJA 5EJ7A 4ZZ1A 4X65B 2FSVC 4U9IS 1BCSA 1UM8A 5B7PA 3BHNA 5AKJA 1KA9H 3D1JA 3MWYW 1W1IA 2BHTA 3Q4GA 1F4VA 2WVJA 4GI2A 4L9AA 5CXSA 3WB9A 3TAHA 3GRRA 3WGTA 4ZT2A 4D44A 1R9NA 1JEEA 3QHAA 2NXNA 4HATA 4RENA 1R2QA 2B69A 4PANA 2PSEA 3CWQA 1UC5B 5HE9A 2P7IA 4N8SA 3GN1A 4K9SA 1YSCA 3I2FA 1RQRA 4WK6A 5DSZA 2B21A 2CJPA 4Q9AA 4DY6A 1QHHB 4OQ4A 4ZC8A 3ADOA 3WOVA 3L0BA 4LJRA 2F43B 1YHYA 3V2HA 3RVBA 1EM8A 1KK0A 2FWBA 2PXCA 5GM2A 2Q4DA 1XZFA 1R0BA 4JLBA 5T67A 2YASA 4AKTA 3HO1A 1U8AA 2DWCA 3NR2A 5DOZA 3SC2A 4CT4B 5I8WA 2J8ZA 2ADOA 4JLVA 2H08A 4MTLA 4K46A 2XA1A 2IJGX 1C80A 5BSFA 4ZT7A 1XQ6A 2PG3A 3ID6C 1ZX1A 2A9FA 3KHUA 1XEAA 4GYKA 3ONEA 3SM3A 4NXMB 4RDXA 1ZNQO 1JJVA 4FCTA 1X14A 2FRXA 4YV7A 1E5QA 3ZKWB 1WB4A 5C8ZA 3IELA 3WQSB 4TTQA 2NPIA 3FI9A 2C2KA 3L93A 2GHIA 4IMRA 4BO2A 5CA0F 4FZ3A 2V74B 1AS2A 4ATNA 3KWJA 2EW1A 3FCXA 3WTCA 1ZI6A 3AX6A 5HFJA 5K0ZA 2P6MA 3KYCA 2A67A 2PMBA 3LT1A 4U7FA 2IP1A 2WQ6A 1PNQA 3VPXA 4CFZA 2VBGA 4HMOA 1LVHA 4HNRA 2R7AA 4I1OA 4U8HA 1FFDA 4EVIA 1IBMB 1H6DA 4QO8A 4FLMA 4LTNA 4CI9A 2QJRA 4QGAA 4KPEC 4D8WA 5JZSA 1KKMA 4FLEA 3KTOA 4OJQA 4EGAA 4UM8B 1UXIA 3AIIA 2PTHA 4GDMA 1KQ3A 4BNMA 3RB8A 1O94C 2ZU6A 4TS9A 4XGIA 2FW8A 4DRXA 2GF2A 2VYND 4ZANA 3MPUA 4QUBA 1WP9A 2E6KA 4OHXA 3EZNA 1QGAA 4GYWA 3L1UA 4J7CA 3V4VB 4B4OA 1Y1SA 5JNRA 1FDIA 5LQCA 5DEOA 3RC9A 1RTKA 4P3PA 5LBIA 4BKRA 2F1KA 3Q7IA 3R7LA 3WNBA 1RPJA 3AHDA 3CT6A 5C3UA 1SKYB 1RP7A 1D4OA 2AJDA 2PM8A 3NH6A 4NYJR 5DKFA 4ZRMA 5EIBD 4NJMA 1TF7A 5B36A 3ICQB 4EF6A 2O3JA 3C3YA 1E1LA 1TQDA 2BKLA 2JGLA 3CZPA 4I7EA 4TMVA 5AI4A 4PYJA 4B79A 5KKCA 1F38A 2BRUA 3BB4A 4Y67A 3IQDB 1X1BA 3ITNA 2FW7A 4UHFA 2G9ZA 3GJ3A 1XMXA 4PG5A 3V7WA 2HU8A 3L7DA 4J1QA 5EJMA 1FU4A 3WLFA 3NPAA 1QIFA 4ZU1X 1VMIA 5A4KA 2CHVA 3ZHUA 3OP4A 2I4NA 4G2NA 3T7DA 3ER6A 1KOFA 1GUZA 1YBMA 2RI0A 1XMVA 2IHUA 4HGYA 3VKVA 1P62B 2IHJA 2XXJA 3TBFA 3ZQUA 2P3QA 4BVAA 2VDVE 4MUGA 2F9FA 2R7MA 1CJUC 1WPQA 3A11A 3MQ2A 4OL0A 4RYLA 1NQWA 2AE2A 2OZPA 2RAUA 4TGLA 4MW6A 4YREA 1GA1A 3RWOA 3EEQA 4DCGA 4URVR 2AXPA 3E61A 3HU2A 2FHSA 2DFLA 2DF8A 4NZOA 3VISA 2WTMA 1QGUA 4CKCA 4OFWA 3OUTA 1P1KA 3HSYA 4YAEA 1N7GA 1GRVA 1CHNA 1Z6ZA 2BFDB 3O5AA 4MVJA 4Q15A 4DQLA 4Y6RA 2EDAA 2H9IA 4CKEB 2UZ0A 4LYGA 1DOZA 1C9MA 3SQNA 3LZDA 4YI5A 3LHDA 1L5WA 1R9MA 3C8ZA 3K0AA 3MQ4A 5KDOA 2DQ4A 4C2UA 4UM7A 3EIHA 1E3WB 1ULBA 3IT2A 2RGYA 3PGVA 4FOSA 5DZSA 1RIIA 1ZGBA 2W2OA 1E1DA 5CFQA 5BQ5A 4MO2A 1KRWA 3FZGA 2ZVJA 2ZRJA 1OLXA 3HUTA 3Q2KA 4EAAA 2QLFA 3S2EA 2R48A 3JALA 2Q1WA 1JDBB 4J3NA 4HD8A 4OHVA 1ZVVA 3QX3A 4NCNA 1CP3A 2VPWA 3MAGA 3O8BA 3SWWA 4D4LA 3PA6A 3KQKA 1VGQA 4BMYA 1JNXX 4MQUA 5IKXA 3BJRA 3WISA 3QV1A 1GKUB 5IT9A 2XVXA 1PCXA 3DZGA 2WIFA 4KODA 4DIEA 1VBNA 3D7NA 3Q2OA 5T57A 2IS4A 2AJBA 3INRA 3G23A 4R8RA 5E95A 3ROKA 3VQTA 1R4AA 1JPUA 4Z3DA 1Q1AA 2NNWB 1BA3A 3G89A 3HXPA 4WQMA 3THYA 1ZU5A 4DABA 3CVJA 4UM9B 4WY2A 3SF8A 1K7XB 5IC5A 5DP1A 4ZVVA 4RFLA 3R3HA 4DLLA 1I32A 2XMSA 1KI4A 5IN5A 1OPXA 3N8HA 2A0KA 1OZGA 4IVQA 3E53A 2BKXA 5M3BA 4DDHA 4WY8A 5ALSA 1CJBA 1J0AA 2MINA 2MTBA 3RE1A 3ETGA 4HGNA 2NUAB 3OZCA 2QVYX 3OQIA 4TQ9A 1T9HA 1SKQA 2ZJ3A 3QTBA 4AUMA 1Q2XA 1J6UA 4UE3S 4HQNA 3HFRA 3DS8A 1UFQA 2AJCA 4EHLA 4FYJA 1E9DA 1RMTA 4JB3A 3S55A 1JR2A 2HA3A 1V48A 3KE8A 4P0TA 1A9SA 4NDZA 4D46A 3B1YA 5P21A 2GNAA 2GZSA 2J9ZB 1WVMA 3SDBA 5B7NA 4E21A 1Q83A 1GYRA 1EXMA 1T5BA 1VRCA 2QM7A 2VTKA 1L4MA 2VT6A 1NY6A 1QZXA 2F48A 4FMDF 2NO0A 2HBYA 1MOPA 4X61A 2I7CA 4Q19A 3BX1A 3H2GA 3WJAA 1NE7A 2BTOA 4PVCA 3DDWA 3OMXA 1KYWA 1PEDA 3P96A 3VR3D 5A7GA 3W2IA 4MLZA 3MS7A 1KAMA 2Y1XA 5JARA 3QPVA 4EGCB 1MIOA 4EHNA 3DV2A 1AH2A 2WF8A 3PX3A 2IPXA 2OK7A 2AVNA 1BGWA 1O97D 1UP7A 3KZMA 5TSDA 3D5EA 2QTCA 1OE0A 3CPJB 2HWKA 4JGIA 3IVMA 3KS9A 5E4JA 2A0FA 1YRYE 3O90A 3RU2A 4BRWA 2E4WA 1ZITA 1WNTA 2QMUA 4YR7A 1B3BA 3KZCA 4CIVA 3QEBZ 2B6HA 4X6LA 4UEKA 5EL0A 4PLVA 5CDSA 2RGNC 1MNAA 3F2IA 5CPBA 4HH4A 4DR2B 1NVMB 5JHGB 5EPOA 3UJCA 2EIHA 3BHJA 3GGDA 4LDJA 4B46A 4ALMA 4GM0A 1I1NA 4ZMSA 1DJMA 2ESRA 1IEXA 1GG2A 1O6GA 3LTNC 1BDBA 1Z2PX 4BNGA 1NNI1 2ZTMA 1Y1TA 2BP7B 1J07A 2P9BA 5DM4A 2PVSA 1U81A 4CDMA 3KKOA 4GZMA 4HI0E 2NZWA 4MX8A 2MSEB 3K9WA 3PP8A 4Y2SA 3S2SA 2ZBGA 3OPMA 4AL4A 3OECA 1GFSA 3NVAA 4H17A 1Y9EA 1V9CA 4WINA 1S2GA 3HB7A 5A5GA 9GPBA 1BMDA 4Z8YA 1A97A 3AIOA 1X74A 3NYIA 1SUCA 4IDOA 3WMGA 1HTWA 2DU8A 2CUNA 1Z8HA 1T9GR 3HBMA 4J7AA 2G08A 2FETA 4L8GA 4CM9D 1PZGA 1U28C 2EFJA 5TMPA 2ZAYA 2NSDA 1AD2A 2VUSA 4MB2A 4EMBA 4ESVA 1G19A 1UXHA 2CLEB 5SICE 2C1ZA 3PF9A 5FBVB 3D6FA 4GXQA 5FOQA 4Z9AA 3H16A 5TPWB 3OCVA 4YAKA 2JGAA 2X23A 3HV0A 1W25A 3PR2B 4LZWA 5JZ9A 1YJ8A 2CDCA 3LQ1A 2VHCA 2E4UA 1NXQA 5CYPA 2EP5A 4TV9A 3V8NA 1JE1A 1RJWA 1NG1A 5ADUS 1C1YA 4HDNB 2GS9A 1HH4A 1Z4QA 2FSUA 3SDZA 4G1MB 3A4NA 3VVLA 4FDUA 4YRDA 2H1LA 3DHWC</