1EVZA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase in complex with nad
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCEROL-3-PHOSPHATE DEHYDROGENASE
publication title A potential target enzyme for trypanocidal drugs revealed by the crystal structure of NAD-dependent glycerol-3-phosphate dehydrogenase from Leishmania mexicana.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
total genus 129
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2000-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1evzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evzA01
4R9RA 4KP7A 3D5TA 1MUUA 3ICPA 3EK2A 4BKUA 2C20A 5EQFA 2AA3A 4RF3A 2Y67A 2I66A 3PI7A 2X5JO 3Q1LA 3NYWA 3TZKA 5CDUA 1I32A 5L7TA 3IS3A 4Q39A 3KV3O 3U4IA 1ENOA 5K0ZA 2GCGA 4E5PA 4PZCA 4GVXA 4L9RA 1GZ6A 3GFBA 2I99A 1MA0A 1NTOA 3INRA 3RVDA 3TWOA 2NTJA 2V6MA 2EF1A 3ZCXA 2VUUA 1O94A 1KERA 2BFPA 3VPGA 1TT5A 4OM8A 4D79A 3NKLA 5KKCA 4M86A 4W7HA 3TRIA 4A5OA 4XQGA 1RWBA 2AHRA 2ZB4A 3QWAA 2VUSA 4BNKA 2GZ2A 3JSAA 4M54A 2E82A 5DCWA 4FC6A 1ZCJA 3E82A 4M49A 2Q3EA 4WLNA 4HNHA 5TT1A 4BO1A 2X9NA 4G65A 4GMGA 4RV9A 5C3MA 3WYEA 2X4GA 1GUFA 4BNYA 1EBUA 4OHUA 3KUXA 4K26A 3GN2A 3RU9A 2P2SA 4YA6A 4MVJE 4A7PA 5TLSA 1PSDA 5BR7A 3TQHA 3ZWWA 1CJCA 3FBGA 1GYPA 4JIGA 4MINA 1I10A 1Y7TA 4DC1A 1PJ4A 3PQDA 1WWKA 1OAAA 5U9CA 4FGWA 4N5MA 1ADFA 2J8ZA 2ZJ1A 4RGBA 1I01A 1Z7EA 1E3JA 1T26A 4UVDA 5JAQA 4WEOA 4PLCA 3HDYA 4DQXA 5KJEA 3DHNA 1JDJA 1KS9A 2ZIZA 3QV1A 1D4FA 3BIOA 1O9BA 4DVJA 4E33A 2HMVA 1VKNA 2O23A 5L40A 3H9GA 1I3KA 2ZB3A 3ANLA 2CVQA 3GVPA 5JPIA 1V35A 4J90A 1X7HA 4WCFA 4PFJA 5G0UA 3R3JA 4RLHA 1HWYA 2YV2A 1YONA 2P5YA 1QLHA 1QLJA 4NMHA 4CLRA 1P1JA 1QMGA 3OFSA 1X0VA 4AICA 3V1UA 1PTJA 2GASA 3ONDA 3P19A 1L1FA 1NVTA 4BB6A 5A05A 2WD7A 5KKAA 2Y66A 1ZEMA 4EYEA 4IZHA 4LN1A 5IF3A 1A9ZA 3RI3A 1WAMA 2YJZA 2YFHA 4YJFA 5TF4A 5B4TA 1YB5A 3L0DA 3O8QB 4UUNA 4YEDA 5B4VA 5JCXA 1ZMOA 1N8KA 3WYCA 4Y6RA 3VZSA 3DTTA 3AI3A 1UAGA 5KOIA 5A9SA 1FXSA 1BDMA 1PS8A 4R5MA 3Q3CA 3QLJA 3JQBA 2YV3A 2FOIA 3OH8A 1Y81A 1LLUA 4ALKA 4PLYA 2O2SA 3MEQA 4OQZA 5F21A 1B14A 1Q0HA 3PP8A 2XXJA 1NPDA 3RBVA 3GVIA 1U4OA 5GMOA 5MDHA 4BKOA 4BIIA 2VTEA 2NVWA 1YRLA 1ONOA 4N5LA 4UREA 4O5OA 3VC7A 5L4LA 3TZHA 2XPCA 3AM3A 1U3TA 4EEZA 4BNMA 3IKTA 3JCZA 1P74A 4ZVVA 3TSCA 1YBMA 1Z45A 1UZLA 1BVRA 4RPHA 3E5RA 2P68A 3B1JA 3KYDA 4UUPA 2DBVO 5CDGA 1NHGA 4LVCA 3CSDA 2RHCA 1DXYA 3BHJA 2VYND 3H4VA 4R41A 3BYZA 2VOJA 3PHJA 5KJ6A 2Q49A 4J7UA 3D3WA 1QRRA 4J3FA 2FR8A 2P9GA 5JE8A 4PVDA 4B3IA 1U3WA 4HV4A 3IAHA 3MWEB 1T2FA 2VWGA 1LRKA 1IHXA 2UVDA 4JBIA 1GL3A 3RUEA 3DEYX 4H7PA 4YTEA 1BRMA 2HKIA 4M87A 3HWRA 4PLHA 1RJWA 2XF8A 3QP9A 3FWNA 5EIOA 4NI5A 1KEUA 5C5IA 1PJCA 3B20A 3E48A 4E5KA 5HRUA 3GVCA 1X1TA 2VUTA 4I9UA 2EG9A 2Y93A 4KWIA 4YJDA 2H1SA 5HBRA 3A1NA 1YVEI 4BMSA 1HDYA 1P1IA 3GT0A 3WJAA 1LDMA 4HFJA 3PJGA 3WJ7A 5B12A 1SMKA 4DL9A 1XGKA 2X9VA 3EYWA 2ZTMA 4BNHA 1DC6A 4D3FA 4JK3A 2GYYA 4RJTA 3GGPA 2PY6A 4HFMA 3RROA 4E5MA 5L4NA 4AJPA 1AGNA 4XCVA 4NJOA 4DYVA 2WM3A 1XSEA 3ZWOA 5JAIA 3WGQA 5I9MA 1EK5A 4DGSA 2R00C 1BW9B 1I8TA 4R3NA 9LDTA 3SJUA 1UAYA 1QV7A 1ZIDA 4WOJA 2O3QA 1D3AA 5BT9A 1HDXA 2YUTA 2FMUA 3C7DB 1ZK4A 5THKA 5JC1A 5DDIP 3G1TA 3MJ4A 1PWZA 3VDQA 4MIEA 1UXGA 2PR2A 5A9RA 1PJ3A 4L4SA 1LLCA 1T25A 2J5RA 4GKBA 4YAJA 4J6FA 1JWBB 2YYYA 3ADOA 3BHIA 1BMDA 4DPMA 4CJXA 4RPLA 2PNFA 1I2ZA 1UP7A 5CG1A 2W2LD 4W4TA 1P9LA 1ISJA 3S2EA 3AOGA 3I6QA 3HSKA 3MJTA 5A03A 2I9PA 4DLBA 3ZU2A 1Y8RB 3X2FA 2NWQA 3ZN2A 4L75A 4F45A 2E48A 4RF5A 2P91A 4ZQBA 2A4KA 4B4VA 1YBVA 3VH4A 4B3HA 1GZ4A 2PH5A 3V2GA 3MJEA 3GDOA 2X8LA 2QW8A 3F1KA 2CD9A 3DO5A 2PD3A 2JJYA 2O7SA 3OQ6A 1YWGO 1U9JA 4G2NA 2E6UX 3ETGA 1PGNA 1NVMB 3OJFA 2HSDA 1MG5A 1MGOA 3ZNNA 2Y1EA 3JQFC 4OKIA 2HUNA 3GVHA 1FDTA 3O8QA 1F12A 1LUAA 3DMTA 3UCFA 4WNIA 2GLXA 2NVBA 1SO8A 3ZHBA 3C1AA 1M67A 1CIVA 4RCVA 5I7EA 2C59A 1Z73A 2D5AA 4LVUA 3WIDA 1MFPA 2WEKA 3L07A 4FD3A 1HE4A 2I5PO 5GZ1A 3HNPA 2BELA 5IZCA 4F6CA 3QVOA 3KB6A 1DSSG 4NBRA 5BNFA 4OQYA 2V6BA 1I24A 1F14A 4MVJD 5BQFA 4Q3NA 1SOVA 4U0JA 3U09A 3FNHA 4ALJA 1X13A 1YGYA 2JD1A 3E9MA 4R54A 1QXSA 3OEWA 3VPFA 4PG8A 1XHLA 3FN4A 5KIAA 1VJ1A 3B6ZA 3RU7A 1P0CA 2JKVA 1HT0A 4JXKA 1J49A 3WTCA 2PGDA 5I9NA 4UVEA 2V65A 1LQTA 1ULSA 4JCOA 1OI7A 3KHUA 3SC6A 3R0IA 5TC4A 2R6JA 5T6BA 3EUWA 3I9MA 1BXGB 3JD4A 4PZEA 3QY9A 5JYEA 4MO2A 1E7WA 1RM0A 1U3VA 3B70A 2OMEA 3AFNA 4LW8A 4NDNE 1QYWA 1XQ6A 1D7OA 3S8MA 3VKVA 1ZXLA 2Z1NA 2OUIA 1OBFO 2WWRA 5IDYA 3WIEA 3M1AA 1CQJA 3INGA 3G49A 1LRJA 2ZYGA 3E9QA 3FNGA 4XYGA 1JWAB 1U8XX 4R1TA 5EJ2A 2CDBA 3IUSA 4CODB 3V2HA 1ZSVA 5U1PA 1XLTA 2GNAA 3VPSA 2O48X 3ONFA 4J0EA 5EN4A 4GKVA 3F4BA 4WEQA 1PQUA 1DJQA 4CMEC 2VHYA 3N58A 5HA5A 5I7FA 1H94A 1WXDA 1JKJA 3T7CA 4CUZA 2A94A 2HK9A 5A4DA 3NTQA 1IB6A 1V6AA 4CQMD 2AEJA 4II3A 1N1EA 4FW8A 1ZBQA 4BQRA 3PTZA 1WW8A 4X54A 1P77A 2OBNA 1ZFNA 1VE9A 4LMRA 3LDHA 5HS6A 4M89A 1W0CA 2IXBA 3DC2A 3F46A 1UJMA 3MJSA 5JNLA 5JXWA 4TVOA 1T2DA 1E7QA 3QSGA 3H7AA 3PZRA 1BW9A 5L45A 4HUJA 2C07A 4YCAA 5FI5A 3HG7A 5C37A 3MZ0A 4WPGA 3SJ7A 3NDIA 4NFYA 4EZBA 1XYGA 3FD8A 4BNTA 4HFRA 1VKOA 4D42A 4Q9NA 2CUKA 1EQ2A 5L9AA 1R12A 4D3DA 3OHSX 3PZBA 4BOYA 1E6UA 3GUCA 3DBHA 3ROMA 1YL6A 5KVSA 3LLVA 4Y67A 4CUJA 3K96A 2FZWA 2FHSA 1VJ0A 3GGGA 2FN7A 3ZWPA 1JAXA 2GPTA 3B1FA 5JDIA 4MKRA 3WLFA 4YQZA 3LF1A 1IULA 4B8ZA 2C0CA 1Y8RA 4JNKA 4WJZA 1OOEA 3E5MA 4DQVA 3K31A 4FR5A 2JD0A 2Y1DA 2ZK7A 4PLTA 4J0FA 1GEEA 3CH6A 4G5HA 4R69A 3LF2A 4AJLA 4Y6PA 5LDGA 3U9LA 1QP8A 2J3JA 2O50A 1HE2A 1J5PA 2FPIA 4ESOA 1M66A 1DIGA 3I9LA 1HTBA 2BGKA 3AU9A 1V9LA 1GYRA 4XYBA 3NDJA 4IDEA 2W2KB 3MTJA 5COAA 1YB4A 1R16A 1ZEJA 3CINA 1OC4A 3L9XA 3W4JA 2C5AA 1JTVA 4U7WA 2QZZA 4J4HA 4MDHA 3ROQA 3UHAA 1Q7GA 5ICMA 4K9DA 4OSOA 4PLFA 2DTDA 4CL8A 3MOGA 2VWHA 3PVZA 3GHYA 2C5EA 3P2OA 2DKNA 4XQEA 4PG6A 4FJ0A 3M1LA 4NZ9A 3ZH2A 3ZU3A 2DAPA 5TT0A 5K9ZA 4CMKA 2G76A 1XEAA 4A26A 4BO9A 3HQ4O 2B4TO 1IE3A 2PKRA 3VPHA 1Z74A 3B1KA 1J6UA 3M2PA 1EE9A 5JFOA 2QIOA 1EZ4A 3JYLA 4L73A 1DBVO 1VRWA 3I9KA 3KSZO 5DCUA 2OBYA 4J1QA 1I33A 1PX0A 4DIFA 1YDEA 1YH3A 3RSHA 1BXGA 4RORA 1IL0A 4KUEA 1E7YA 1GAEO 1DFHA 1E5QA 3BXXA 3GY0A 4UUMA 4CM6A 3F6YA 4FDAA 3LZ6A 4XEHA 4PG4A 4YRAA 3DHYA 2YV1A 3DAPA 2IXAA 5GZ3A 1IPEA 4RZIA 4QX6A 3Q9UA 4WCDA 3GPDG 3NGXA 1A7KA 1NFQA 1XWFA 2TMGA 3JD2A 3HFGA 1XG5A 4E5YA 1IZ9A 3EVTA 4YWJA 2HK7A 1P31A 2OO5A 1I3MA 1NWCA 1WPQA 1M6HA 4RVHA 4CV2A 3PXXA 4W82A 1YJ8A 3F47A 2ZQYA 3OP4A 3TZQA 3U4CA 2Q2QA 2QHXA 1WLYA 3JQAB 1IZ0A 3H5NA 4OKNA 1CETA 4HP8A 1C1XB 3DZBA 4ALMA 4CQLB 4NK5A 3VDRA 4UVGA 4D44A 4XZ3A 3H2SA 4DIBA 2I3AA 1XU9A 1FMCA 4YRBA 5T8KA 4EI2A 1UDCA 3WDSA 1P1HA 2I76A 4J91A 5COBA 3JYNA 2NU8A 1WVGA 4C7JA 1G0OA 2PKQP 3LT1A 1E92A 2JCYA 3PDJA 2DBRA 3GEMA 4LISA 4XD2A 1Y9AA 2GRAA 4CMCA 4J2HA 3ZV4A 4Z9YA 1B7GO 1M2WA 1GTMA 3NTOA 1UR5A 4E5NA 3OIFA 4XR9A 3S2IA 3ZWMA 4FPXA 5JO9A 4DBVO 2CVOA 1FF9A 4PRKA 4YR9A 4D43A 1GCUA 2P9EA 4NBTA 2QRKA 3AUAA 4ITUA 3GFGA 3K2BA 1I30A 2VHWA 2XAAA 4DWVA 1DIAA 1G1AA 2D0IA 5KVCA 1YS4A 2HK8A 3AUTA 4ONEA 3JYPA 3UXYA 4CM5A 2DM6A 1VL0A 3RC7A 2Y99A 2PWZA 4JQCA 4AJ2A 1EK6A 5U4QA 2Q45A 6LDHA 2ZJ0A 4UEKA 3A06A 2P9CA 4I5FA 4BVAA 2AG8A 3Q9NA 3HHPA 1E6EA 2DC1A 2J3IA 3L77A 4R1NA 3AK4A 2BI8A 1QG6A 4Z9XA 1K6JA 1E1MA 4W7IA 4BV8A 1A5ZA 2VYVA 3DZJA 1YB1A 1K89A 2W98A 1H6CA 2W2KA 1H93A 3MTGA 2NU6A 5BNIA 3WGYA 1ENPA 1DLJA 4FS3A 1YQXA 3AUSA 4MJLA 4BO3A 1OC2A 3G1UA 1HDCA 5CG2A 1H2BA 3HUDA 3PPIA 3WNQA 3FTNA 4XKJA 2DT5A 3AU8A 2E49A 1NWHA 2OP1A 3O4RA 4J2OA 3I6IA 5EESA 3WSVA 3A28A 2Q50A 1O8CA 3I4FA 3VZPA 3EY4A 5IFLA 3DHEA 4DMMA 4CV3A 2GZ1A 3PGJA 3Q6IA 4IY1A 3I9JA 1KYQA 3G17A 2DFVA 2VNAA 2VRCD 5LC1A 3ZHZA 2O3SA 1DC4A 3AFMA 3TFQA 1AXGA 1BWSA 2G82A 3D3EA 4CM9D 3KEOA 3ST7A 3VH3A 1DFIA 1JKIA 2H6EA 5K6AA 2O7QA 3ITKA 4U6SA 4BNUA 1J4AA 4WGGA 1NAHA 3D0OA 2NQ8A 2Y0DA 3BAZA 2XXBA 1UH5A 4EBFA 4D7AA 4LSWA 4ND2A 1P45A 3FHLA 4U6QA 2PZJA 4CMJA 1LXCA 4IQ0A 5GY7A 4O63O 3PLNA 1B3BA 5EINA 4NNJA 4ZRMA 2AEFA 4D45A 4TZTA 4NFSA 4XA8A 5G0SA 3ICCA 4B4UA 4PLVA 1ZK3A 1S6YA 2G5CA 1A71A 4J9UE 4ZQEA 4E0BA 2DTXA 5I7VA 3DB2A 5HTOA 1U2DA 1GR0A 2AQHA 4ZQGA 1V3UA 1C0PA 2X9GA 2PZMA 4JBHA 4YJHB 3L4BC 1EUCA 4FJ2A 3S1LA 3K9QO 2DBZA 3GLQA 4QSMA 1H9AA 3JQAA 1WMAA 4GH5A 4MVJG 1VL8A 1X7DA 2UAGA 3ROKA 4BO7A 3QHAA 2PZKA 3F5QA 2HAEA 3WQQA 1C1XA 1LC3A 3ASVA 1HXHA 3OJLA 3KZVA 1NP3A 3JV7A 4CQLA 3OJ0A 4R9SA 1GZ3A 3K8ZA 1DHRA 4J1TA 4U0KA 2PH3A 1PR3A 1W73A 3DDNA 1AN9A 2IDZA 3QWFA 3NV9A 5BSHA 5IN5A 3K92A 3IJRA 4KUGA 4TRMA 1E7MA 1XA0A 2J3KA 3PQEA 1HDGO 2FR1A 3RJ9A 4RVFA 3ANNA 2NADA 2C82A 3GAZA 2Y1GA 3LC1O 4EW6A 3KYCB 5L53A 4GLOA 1X1EA 2DUWA 4IQGA 4GWKA 3WQRA 1DIRA 1SZJG 3I1JA 1BG6A 3AY3A 2C7GA 2YHUA 4YDRA 3PJEA 4E2ZA 1DJNA 4E32A 2EIHA 4RVDA 3EMKA 3EHEA 5IAAA 5IJZA 2E37A 3RFXA 1EBFA 3CMCO 1G0NA 3PWKA 1PU2A 4I9HA 3TPCA 1UXKA 2HRZA 4EJ6A 5B1YA 1CWUA 4XGNA 4RF4A 2BHLA 3WBFA 2BKAA 4F6LA 4PN3A 2VHVA 1SPXA 2RH8A 4FN4A 5AOVA 3GDFA 2SCUA 5A3JA 4IGFA 1ZXBA 2JFGA 2C29D 4J1SA 2J3HA 3UCEA 2JAHA 4BNZA 3UOGA 1P3DA 4PGFA 1HL3A 3I3OA 3K5PA 3UVEA 2P4QA 3PFFA 1R66A 1KETA 4ZICA 5JS6A 4ND3A 5JCJD 4XQCA 1NPYA 5A02A 1Z6ZA 4PLPA 5TIIA 3RASA 4MP3A 1U5AA 2HLPA 4L4RA 1X14A 2DLDA 3PYXA 3QE3A 4ZJUA 3SVTA 1XELA 5CPFA 3JYOA 4UEOA 3GUYA 2EV9A 2VCYA 4BV9A 1ORRA 2DU8A 3A9WA 1G6KA 4A0SA 1O0SA 5CEEA 2ZCVA 4IDFA 2YDYA 1R4NB 2JFHA 4XDYA 3VPXA 4P38A 4BMNA 4DA9A 3RWBA 1Q7BA 1N1GA 3EDMA 4KTVE 2EGHA 1ZK2A 1EVYA 4A10A 1F8FA 3ETEA 4JGBA 4GI2A 2IZ0A 3NX4A 1SOWA 1VJTA 4XX0A 1BGVA 1P1KA 3JQ6A 1E77A 1HE3A 4ND5A 1QYXA 1CYDA 4NIMA 5IN4A 4Z0HO 3GPIA 2YFQA 1LI4A 4KQXA 3VTZA 2O4UX 3ZW8A 4XB2A 3VTFA 4CL3A 1I5RA 1M6WA 1Y5RA 3H5RA 3CTVA 1PIWA 2ZTUA 2Q1TA 3RBXA 3UGKA 1GV0A 4ZQHA 3AOEA 4MPDA 1B15A 2JD2A 2NTVA 1RM5A 4GVLA 1XR3A 4Y8VA 4EDFA 2FSVA 1MG0A 1LA2A 4BMVA 1SB8A 1GQQA 2WSBA 3KVOA 4YBZA 4O59O 4BKRA 4IJKA 5KVVA 2OGUA 4WE3A 4AJOA 3QWBA 4NFHA 3S2FA 5L4SA 1R6DA 3H9QA 4XGKA 1TVEA 3GR6A 2CF5A 1PL8A 2NU7A 3KOUA 5JMWA 4FFNA 4YJHA 4JJIA 2J5KA 5IZ4A 3PIIA 3H8VA 4CV0A 1DPGA 3PK0A 3KLPX 3Q11A 5DNAA 4S3MA 3W8EA 1P33A 3JD3A 1WDLA 5TJ9A 1NPTO 3IDSA 3SX2A 3DBHB 2X0JA 4OXKA 5HS4A 2FR0A 4YXFA 1Z82A 2YW9A 1OMOA 3ORFA 1E7RA 2GZ3A 1YBAA 1VI2A 3TL3A 1V3TA 1B8PA 1SAYA 1SEPA 1UXIA 4WECA 1JKFA 3U62A 5CP8A 4BL5A 4IS3A 3CMMA 4CM1A 4K1LA 5JYDA 3CUKA 5I7SA 2EKQA 3R1IA 4MP8A 2JCXA 5KTKA 4WLOA 3KYCA 4NBUA 1MXHA 4M1QA 2QRLA 3TL2A 1IY8A 2I65A 4I9NA 2C7VA 4QXMA 5L3ZA 3HN7A 5CHEA 3LSYA 1DRUA 1JN0A 1OFGA 1DEHA 4OOFA 5ER9A 4LMPA 1ISGA 1EFLA 3SC4A 3ITDA 3FR8A 2YQ5A 5JDCA 3D4NA 2IEDA 2Q1SA 4TMFA 4N7RA 4W99A 5H81A 2Y05A 4I5EA 3ZNQA 3VVCA 5CFZA 3R3SA 4G81A 1FDUA 3G3EA 3L6OO 1S7CA 1E5LA 4H16A 4BNGA 2DPHA 4RVGA 2W90A 2VN8A 4HBGA 1SC6A 1D8AA 3GH3A 3OJOA 2Q46A 2ZQZA 5C7OO 1R0SA 2NVUB 2WDZA 4IPTA 4WCFC 1YDWA 1ADBA 4AJHA 1GPDG 3HE3A 3V1TC 4Z6KA 1HYHA 3NT5A 4J7CA 2EP5A 4MKXA 4IM7A 1YQDA 1M75A 1KVUA 1U4SA 2IEBA 3DOOA 3RUIA 1JA9A 3VKUA 3H3JA 3KBOA 2OP0A 4HKTA 4OH1A 4QTZA 4O6VA 3PJFA 3ZI0A 3OECA 4CLOB 1HDZA 1LBEA 5F5NA 1LSSA 2O3TA 3FTPA 5DT9A 2RHRA 4QQRA 1NQAO 5TQVA 4CR7A 2X0RA 3PJDA 1GQ2A 3E18A 1KC1A 1U1IA 5FWNA 4YT2A 5F1KA 4AJNA 3IOYA 1LDYA 1YJQA 1ZJZA 4JP3A 4NU6A 5KCZA 1DIBA 3DTYA 3STHA 5DULA 1ZH8A 2JHGA 4KTTE 5IG2A 1YOVB 1R4NA 3PHHA 4FFOA 4P4LA 2CDAA 1TLTA 4UEJA 4DIOA 4K6CA 1B26A 3RUFA 2NUAA 2DFDA 2GO1A 3OIDA 3A4VA 4FFMA 3JQBC 3KRTA 4UVHA 3DXFA 3JQ9A 4BKPA 5A9TA 3NTRA 3ZWCA 4JN6B 3G0OA 1DHTA 4TKMA 1P1RA 1PGPA 5A06A 3WB9A 4YT4A 1B2LA 4XJTA 3LYLA 3BTOA 4IMPA 1DDOA 2JAPA 3PLRA 3VZQA 4R01A 4XQ9A 1LDBA 3L6DA 1E1KA 4PCVA 1ZKMA 3AI2A 1CQIA 3GAFA 1LEHA 1U8FO 1XIVA 1ZK0A 4CV1A 1QKIA 2RBEA 1LDNA 1R4MB 2IYOA 1RPNA 3WX0A 5DBGA 1A9YA 3PHLA 3I52A 1YL5A 1BDBA 2OL4A 3G79A 4MVJM 3LK7A 4CLEA 4FFPA 2C54A 1E6WA 4CM8B 4FCCA 2G1UA 4M55A 5A1TA 3ZV6A 1LQUA 1WZIA 4DYDA 3QWHA 5AXDA 4LRSB 1HLPA 1I0ZA 4OJNA 3WQSB 3WS7A 3CZRA 5ENVA 2QG4A 5DOZA 3O9ZA 2PZLA 3RCBA 4DRYA 4NQZA 3KSDO 5T57A 4FGSA 5DBIA 1TI7A 2B5VA 4R16A 2VNSA 2Y1FA 3NUGA 4F3YA 1GEGA 1DC5A 1ZW1A 4D0SA 5BNTA 4FBGA 1NVGA 3UUWA 3F9IA 4E2YA 4B7XA 1DAPA 2AXQA 3CKYA 3OF2A 1PL6A 2VOEA 1AXEA 4CM4B 4GSKA 4IJVA 5KJCA 4I08A 1N7HA 2Y0EA 4TZKA 4GQAA 2FPPA 1WDMA 4DLAA 4PLWA 3RFVA 3JTMA 1ML3A 4KWHA 2VRBA 1N9GB 1U5CA 2QQ5A 2IYPA 3DBLB 2RCYA 3QW2A 2D8AA 4N5NA 3H9UA 2O3JA 1H6DA 4P22A 3QQPA 4TVBA 2QYTA 4UAGA 4MVJF 1ADGA 1GUYA 1IYZA 1KEPA 1T2EA 2YY7A 3VAZA 4XB1A 4NK4A 4IS2A 3KETA 3GQVA 3LT2A 3RUCA 4HWKA 3T4XA 2C2YA 2BFMA 2YQ4A 2ZTLA 5TSDA 2FRDA 3OIGA 3GRKA 3TZ6A 1HE5A 1PZEA 3LVFO 4PZDA 2BD0A 3P7MA 1WZEA 2P5UA 1PJ2A 3ZGYA 1GYQA 2QRJA 3WG9A 5I8ZA 1QYVA 2B4RO 4ALLA 1SEVA 2IZZA 2NVUA 1GCOA 1QORA 3GEGA 4R4JA 3NT2A 2AW5A 1CRWG 1NR1A 5J23A 3KYBA 4IDBA 1UP6A 2PFGA 4N54A 3ZW9A 4R1UA 4BGUA 3PWZA 3WGIA 3S55A 3RJ5A 2BI7A 2PGJA 4JJGA 2B35A 1SBYA 3UF0A 5AQ1A 3WWYA 1HYGA 4CLOA 4NBWA 3QVTA 1PQWA 1Y9EA 1ZSYA 4RPGA 1H5QA 4J43A 4XRGA 1ISMA 1GQYA 5G4LA 4YJGB 1HZZA 2PA3A 5AXAA 2B0JA 4RQTA 5ILGA 1UDAA 4LSMA 4D3SA 3UAGA 3R6DA 3RKUA 5EMHA 1PS9A 3DMTC 1B0AA 4XDZA 3T4EA 1BSVA 4DUPA 4P8RA 3RBZA 3C3XA 4GX1A 4CLXA 1FJHA 2VHZA 1YOVA 1U2GA 4TSKA 1B8VA 1ZO8A 4AJJA 5IXSA 4OGWA 2H5LA 3DQPA 5DBFA 3DL2A 1DAOA 4FFRA 2PD6A 2Y0CA 5IZCC 1PQPA 1Z7BA 3C8MA 3IIEA 1PGQA 1PZFA 4Q3AA 5FYDA 1Z75A 1HSOA 4RDIA 3LT4A 4MOWA 1M76A 5JBIA 3PHIA 3DWFA 3EGOA 3AWDA 3K6JA 4RPKA 5ADHA 1NASA 1QV6A 4RVSA 1DIHA 3JQCA 4OXNA 2YHIB 4JLWA 3U3XA 5ITVA 5B37A 4K6FA 3BA1A 3RC2A 4CMHA 3BZUA 3L9WA 2X22A 1DFGA 4DLLA 1R4MA 2NACA 4FIZA 3GA0A 1IHYA 1H6BA 2Q99A 3ANMA 2HMUA 4J1NA 1IOLA 2GDZA 5KJ1A 3VZRA 3U0BA 4ZN6A 2ZB7A 3JYQA 4CM8A 2ZKLA 3UW3A 5JSFA 2EW2A 2X5OA 2HCTA 3LQFA 2OORA 1KVRA 3TZCA 5TGDA 4XIYA 5F1PA 3AI1A 2BRUA 3BMOB 4C7KA 1KY4A 3L4SO 3KSUA 4DQUA 4YT5A 5I9LA 3K30A 2X6TA 3RQSA 2RAFA 3JQ7B 5F3RA 1V8BA 1W4ZA 3RC1A 3GNTA 5T67A 4QFCA 1KVTA 4B8WA 4TKLA 2YZ7A 3JD0A 1HSZA 1MV8A 2Z5LA 3LT0A 2VQ3A 3GG9A 4NBVA 4PG5A 3JQGB 4GL4A 1Y6JA 4BNJA 4CM4A 1ZNQO 4MIOA 3WGGA 1BTOA 1MFZA 4AFNA 4KDEA 2NTNA 3KM0A 3WOHA 2XOXA 4YB8A 3PYMA 1N9GA 3DBLA 4NG5A 3ZWAA 3PDUA 2VWQA 4QO8A 6ADHA 2B83A 5H82A 2ILTA 3PRJA 1JVSA 1O5IA 3WMWA 3D1LA 2IE0A 3Q2IA 3V8BA 2V7PA 5JW6A 4XRRA 5GZ6A 3QVSA 3L6EA 4GX5A 2VYNA 1GUZA 4MVJP 3TOXA 2QZ9A 2UV8A 3D5QA 4BO2A 3HDJA 3IQDB 1GFSA 3PQFA 2ZCUA 3FI9A 1K6IA 1LX6A 2WTBA 2EXXA 3P2YA 3ETDA 4CM3A 5JDIC 3KTDA 3ROPA 2HDHA 3SEFA 1AE1A 3WTBA 1C0LA 4MP6A 1H0KA 3RIHA 4U8GA 2Z95A 2Y1OA 4MKZA 2IODA 5JY1A 5IDQA 1B3RA 4DPKA 1EVIA 3VOSA 2BMAA 3IP1A 4YRDA 5DZSA 3GRPA 4R1SA 2JL1A 2B37A 3E1KA 2GUGA 1LSJA 1A72A 4E30A 4CQMB 4YJGA 4GPD1 4OMUA 4TROA 3AJRA 5EPOA 4YAKA 1U7TA 2W8ZA 2HMWA 4E2WA 1D1SA 3ZU4A 3H2ZA 4P4NA 3HDQA 4FC7A 2POQX 1TA4A 3W4KA 1C0IA 4WLVA 1GU7A 3ABIA 1RM3A 2GSDA 3F3SA 4EUEA 4RF2A 4L76A 4DMLA 3TOZA 1KVSA 4AJ1A 1AHHA 4B4WA 4INAA 3DFUA 2EW8A 2R00A 4IXWA 4E21A 1TXGA 1T2AA 2AG5A 1P44A 4TRNA 1E3IA 1SB9A 3GNSA 4J9VA 2X7HA 1LSOA 1P0FA 2JHFA 3I4CA 1NYTA 3IMFA 5FFFA 1KC3A 2CNBA 4PVCA 1RYDA 1E1NA 4YACA 3CIFA 2W2LA 4XGIA 1E7SA 3DOCA 1JVBA 2YHIA 2BFOA 3WMXA 3W6UA 2B5WA 4J7XA 5A3VA 1PJBA 4ILKA 4BNFA 2QYSA 5JMPA 2Q1WA 2BFAA 3MCVA 1CDOA 1E3EA 1LNQA 4CM7A 4D0RA 3OJEA 4KZPA 4NR0A 2PTGA 2X86A 1GD1O 2EGGA 3RUHA 1HEUA 4KOAA 4HXYA 4OSPA 1XDWA 4U5QA 1HDOA 4EUHA 2HJRA 1ISFA 4IQ8A 3PFWO 1E3WB 3WBBA 2FSSA 7MDHA 3QWIA 4BNIA 5EERA 3U49A 1HZJA 2NNLD 3BMOA 2ZYAA 1T1SA 5DN9A 3TDKA 4L74A 4CLHA 4IIVA 1ZZEA 4IDAA 2E4AA 3OQBA 3W4IA 3MJCA 1J0XO 3AM5A 3C24A 4N18A 1O6ZA 2PD4A 3JQ7A 3OICA 3LU1A 1Q0QA 3JQFA 3V2UA 2D2IA 3IC5A 1P1FA 2F00A 2IZ1A 3VHRA 1WDKA 3QIVA 2P4HX 5G0TA 4E3ZA 5CDSA 3CTMA 2ZATA 4ZA2A 3GOHA 4BHTA 3DAFA 1EUDA 5T8KC 2ET6A 3JQGA 4MVJA 2IRWA 3DAGA 2R2GA 5MGBA 1LC0A 5B4UA 3CE6A 2CFCA 3WGZA 3O03A 4M8SA 2AQ8A 5JC8A 4AJKA 3FNFA 3GC6A 3W8FA 4J16A 2TMDA 1L7DA 5DOVA 4NU5A 5L95A 1YXMA 4II2A 1PJLA 1Y8QB 3ZNOA 1PJSA 2EHDA 2NU9A 3MOIA 4MVJH 4IJWA 5A5EA 5IDWA 3ADPA 2GN9A 4L4XA 4L0QA 4Q3DA 1QYDA 3H3FA 5AVOA 4A03A 1UDBA 3RC9A 1N2SA 1R37A 2GERA 4JX8A 4UVIA 4BNXA 4FQ8A 3ZZNA 5KNLA 1HF3A 3FBTA 3DFZA 2Q4EA 1GY8A 1LDGA 3D64A 2PV7A 1HRDA 5JO0A 1FDVA 1PZGA 4W9NA 3U5TA 1UXJA 1LDEA 5EQDA 5COQA 4B7CA 1LLDA 5FEUA 1MP0A 4RZHA 1Y5MA 2VWPA 2EERA 3RUDA 1W8DA 3M2TA 4Y98A 4DTIA 4B4OA 2GN8A 2BLLA 2V6GA 4QEDA 4LRTB 4IJUA 4RLSA 2HRBA 4EUFA 2OXIA 3GZ4A 2FY8A 4OYRA 4BO6A 3GZNB 4BNLA 1CERA 3QVXA 3TJRA 4CQMA 1T4BA 3OQ1A 4A27A 1K6XA 3KO8A 3PWSA 4CMEA 2NLOA 3SLGA 4A73A 3GHHA 1DB3A 1NAIA 5CDYA 5CPBA 1T2CA 4Y9DA 2JFFA 3ZU5A 2OFPA 3OBBA 3I83A 3JQ8B 4OO3A 1ONPA 1YQGA 2VYVD 3IKVA 2NV6A 2VZ0A 3COSA 2ZB8A 5ILOA 1R0KA 3T7EA 1RKXA 1MXFA 1GADO 3V1YA 1X0XA 3F4LA 3MWDB 2UUOA 1W6UA 1PWXA 1EFKA 3D4OA 1NQ5A 2GN6A 3DBRB 5CEFA 2X0IA 3DR3A 1T24A 4BO4A 2G0TA 2OHXA 3HB4X 3MJVA 4WNCA 4BNNA 4KUHA 1C1DB 1E3LA 3ZHYA 4BNVA 4KQWA 5TJHA 4BGIA 5BSFA 3ZWBA 3DMYA 1DLIA 4JJFA 2WJPA 4BB5A 5K6AC 1F8GA 2WD8A 2VZ9A 3AY6A 4J4BA 1AHIA 1ARZA 2EWMA 2WMDA 4D41A 4DPLA 3TF5A 4BO5A 3HDHA 3KLMX 1ONNA 4TWRA 5TRTA 7ADHA 4QUKA 5HM8A 1PGJA 1LU9A 1PL7A 1EEHA 2B4QA 4IDGA 1K5HA 4DBZA 4HADA 4A2CA 3AY7A 3BTSA 3S2GA 3WR5A 1BVUA 1Q7CA 2LDXA 2VT3A 2EJWA 1QYCA 1E3WA 1NM5A 2VTDA 5FI3A 3UN1A 2DUUA 4GSLA 1YO6A 2GF2A 4IDDA 4E6PA 1A27A 5LDHA 3I23A 4AL4A 8LDHA 5L7YA 1H9BA 3ZWYA 3C1OA 3PEFA 1I2CA 2I3GA 2O3UA 3PGXA 5LCXA 1T4DA 4O0LA 3HADA 3WGOA 3DONA 5C7LO 5JY6A 2BGMA 4WOKA 2CY0A 1NR7A 4IZIA 1XKQA 1VC2A 2V6FA 3I5MA 1SCUA 1ISHA 1KBZA 3NEPX 4W6ZA 3X2EA 1FK8A 4WK6A 3JQAD 4ZQFA 5AXCA 4Y6SA 3ZV5A 2CSUA 3DZIA 4CR8A 3C7AA 3KEQA 5TNXA 8ADHA 1VLLA 3V5NA 2CF6A 1RM4A 2AQIA 2O3RA 2VT2A 4ID9A 3RD5A 3AM4A 1Y8QA 3UICA 3E6AA 3H5AA 2D3TA 2WYVA 2FP4A 3DZHA 4XWYA 4AG3A 1NX6A 3WWZA 1WNTA 4AVYA 5KVQA 3ONEA 2A9FA 4LCEA 5H83A 1XCBA 4TRJA 1TEHA 1EDZA 5G0VA 1N92A 1EUZA 1NXQA 3WYBA 3WFJA 3BMCB 4BGEA 3H9JA 5ES3A 2I6TA 3ZWXA 2Q4BA 3NGLA 4J4TA 4QECA 4FOSA 1ZUD1 3WFIA 1XU7A 3PIDA 3LC2O 5G2OA 4CMIB 1CF2O 4BO8A 1VPDA 1BXKA 4URFA 4TQGA 4ZU3A 3IL2A 2AE1A 1X15A 1BHSA 4RPJA 2D4AA 4CUKA 3VH1A 5IXYA 5ENDA 4Z9FA 1TB4A 1ZVMA 1F0YA 2RIRA 4F46A 4WLEA 4O1MA 3N7UA 4I1IA 4JBGA 2GGSA 4GGOA 3GK3A 4YAEA 1LLQA 4Z0TA 1N7GA 3TN7A 4PRLA 4ZRNA 3GZNA 3ZNPA 4FB5A 5A5FA 3Q0EA 5DF1A 1E0DA 2Q1UA 2H9IA 1H6AA 5KWEA 2HMTA 5JAMA 1E1LA 4LGVA 1ULUA 1I36A 2C2XA 2JCVA 3ENNA 3GF4A 1AUPA 3JQ8A 4IGEA 1NNUA 4Z0PA 1KOLA 1YL7A 4BQPA 3OM9A 4GGPA 5IDXA 3C85A 4W9NC 2F1KA 3FWZA 1DRVA 4R51A 4GX0A 3PYLA 4EEXA 2NSDA 1OZAA 3WSWA 2YDXA 2OZPA 3BMQB 3GG2A 2BGLA 1V3VA 4NJMB 4GWGA 1I3LA 4PIVA 3BMNB 1NQOA 1ZJYA 4EJ0A 3TNLA 4MVJI 1YKFA 1MB4A 3JD1A 3RUAA 3DBRA 4FSHA 3GEDA 4EITA 1UP4A 1ZSNA 3K73O 4Q3BA 4ALIA 1KEVA 1C1DA 5CDTA 4IXTA 4PG7A 2WE8A 3FNEA 3UKOA 4Z3KA 5BSEA 1KVQA 2BH9A 4S1VA 1K3TA 3HN2A 2GR9A 1VSUA 1PJQA 4E2XA 3C7CB 2ZTVA 3JQDA 1VM6A 3AOEC 1ADCA 4K28A 4WLUA 2HQ1A 1A4UA 1H2HA 4ALNA 2W4QA 3NDRA 3FPCA 3E9NA 3EZYA 3HB5X 4WKGA 3EZLA 4KMSA 4CMGA 3WGHA 2CVZA 4QFDA 1V0JA 4XIJA 3IUPA 3WXBA 3EW7A 3OA0A 1K0UA 4PLZA 4RVUA 4BUCA 4YYZA 2UDPA 3UCXA 4CLDA 2J5QA 3AW9A 1C3VA 1X7GA 2DTEA 4AJ4A 1C0KA 3ZDFA 2HMSA 1HETA 3GMSA 4PLGA 5G4KB 1PS0A 4E13A 2D59A 2X58A 2EEZA 5F1OA 4RO0A 5DP1A 2WYUA 2Q2VA 1RYEA 1WMBA 2NM0A 2X23A 3K2EA 4FOOA 2Z1MA 4FJ1A 1JQBA 3D7LA 5JLAA 2O4CA 3RAJA 3W6ZA 1UUFA 3E03A 3W1VA 4YVFA 4XYLA 3I9NA 3JQEA 4R5HA 4BNWA 3FPLA 1BXZA 2VRCA 4GLLA 3SLKA 4HX5A 3GNQA 4WASA 1Q0LA 2RH4A 3WGTA 3GDGA 5G0WA 1R0LA 4YT8A 3NJ8A 4CM9A 3DZFA 3AUUA 3DOJA 4CMBA 1A7AA 4OAQA 3OETA 3SXPA 1T1RA 4LK3A 3C1TA 1LTHR 1C14A 2NQTA 5T5QA 1DC3A 4I8XA 5I8WA 5JDCC 1U3UA 1EDOA 2UYYA 3KXDA 1EMDA 2X1HA 4E12A 3BMCA 1O95A 3ZWVA 2GD1O 2FWMX 1NFRA 2H63A 1HKUA 3ULKA 1EQUA 4XYMA 5BSGA 4P4GA 2B36A 4YQYA 2PLAA 4YPOA 4DC0A 4IMRA 4CMIA 2J6IA 1CEQA 2I67A 4H15A 1Q1NA 4ZGWA 3LLSA 2B69A 4RL6A 1NFFA 3HJAA 4JROA 1UXHA 2WE7A 3QRWA 1ZMTA 2O2YA 4OL9A 4NPCA 2D5CA 1HLDA 1UZNA 4WUVA 1NBOA 3GMDA 9LDBA 3INTA 1QR6A 4LCJA 4Q3CA 3DZKA 4FFLA 3P5SA 4B79A 1UZMA 3GGOA 3Q2KA 1GPJA 5CEJA 4J49A 3L4BA 2PK3A 1GDHA 1JU9A 2CDCA 3RKRA 3EC7A 3OEYA 2Q2WA 4R3WA 2QX7A 2ZYDA 1TT5B 4I5GA 1WP4A 4UULA 1K2WA 1Q2XA 4E4YA 4YAGA 1PGOA 4Q3EA 2DQ4A 2OOSA 1N5DA 3UH1A 1EE2A 4IDCA 1B16A 3BMQA 4QO7A 1JLLA 1MLDA 3IP3A 4NJMA 1MC5A 3ON5A 3I9OA 3ZHXA 2AEMA 2A92A 3BMNA 3RFTA 3WICA 3HZZA 1ZK1A 1IUKA 5CAEA 4ND4A 1KEWA 3JQ9C 4KDFA 4DXHA 1PZHA 1LRLA 2PGLA 2WYWA 1Y1PA 3N74A 4DREA 3NAQA 2PKQO 1FDSA 3FRJA 2AMFA 2D1YA 1KIFA 3O26A 3PHGA 3ASUA 3OA2A 3W8DA 4NH4A 5FF9A 4BKQA 4B3JA 5TS3A 3NT4A 2FPGA 4C4OA 5A04A 1NHWA 4MIYA 2HO5A 5ICSA 2AE2A 4GAEA 3ZV3A 1EVZA 1LSUA 1SNYA 2VHXA 5ER6A 4I5DA 4Z3DA 4CMAA 1IPFA 3BTVA 4XJSA 1F17A 3EVNA 1O89A 3LC7O 3DBVO 3FCOA 1DOHA 3FSRA 5AXBA 1HDRA 4OOEA 1VSVA 3HFSA 4TRRA 4HY3A 3UFXA 2A35A 3BTUA 3ENKA 3H6KA 1MX3A 4XR4A 4RDHA 3NJ4A 4L8VA 3H9EO 3VH2A 4EGFA 4WCFB 5F5LA 3WNVA 5JCJA 2Y68A 5AYVA 3DZGA 1JW9B 4IUYA 4BO0A 3A14A 1F06A 3D4PA 4CLRB 4UUOA 4IINA 1D1TA 2EJVA 5DCYA 2BF7A 4WLFA 3F1LA 3ZWNA 4AJEA 4JP2A 4GMFA 5DP2A 4YAIA 3WLEA 2GN4A 3FR7A 2WD7B 4GX2A 3O38A 1L7EA 4ND1A 5G4KA 3BHMA 3CXRA 5T64A 4B7UA 3TFOA 1PR9A 5L51A 5HWSA 3U4DA 3GVXA 4ZHSA 2EKPA 3CPSA 3SBOA 1ENZA 2Y1CA 3QJ5A 4YJFB 4BGVA 1B8UA 2VZ8A 4IBOA 1A4IA 1TT7A 2G17A 4IIUA 4BS9A 5C7IO 5JAZA 5L7WA 2AQKA 2HJSA 1E3SA 1JAYA 2CZCA 1FDWA 3U4HA 1DRWA 4RQUA 2X5KO 3H65A 1YE3A 4EJMA 4XYEA 5A9SB 4ROSA 1ENYA 1PEDA 2EKLA 3VVBA 3FF4A 1U7HA 4ZD6A 1HYEA 4CPDA 4R68A 4HFNA 4OXYA 1U28A 4H3VA 4OIMA 1KY5A 3IJPA 3M6IA 3OSUA 1I3NA 3NRCA 2DVMA 5EL0A 3GN1A 5KJFA 1ID1A 1MC4A 4HNGA 2FZEA 4D46A 3QA9A 1GV1A 2DBQA 3EAGA 1EVJA 1ISIA 2EP7A 2UUPA 3E8XA 3OMLA 4QT0A 2LDBA 1DO8A 4AJIA 4NHEA 2CMDA 1R15A 2X0NA 4CR6A 1LJ8A 1VL6A 1QSGA 1PJTA 1XQ1A 4E31A 5ITWA 3F5SA 4GBJA 3KYDB 1I2BA 3QVWA 5TX7A 3CZMA 2HU2A 2DPGA 3CEAA 3D3WB 5THQA 1NQTA
chains in the Genus database with same CATH superfamily
3IKJA 3FUUA 4JFRA 3RSGA 1RYBA 5M7EA 3BGVA 3S44A 3GLHB 3EHDA 3BUSA 3EK2A 4BKUA 2XCQA 3O4VA 4JR1A 4LY3A 4HNAB 1PP4A 5L6LB 1N2OA 3PI7A 2OESA 1I7DA 2Q5LA 4BZQA 5E2AA 2ZULA 1U9CA 2PYDA 3CLUD 2C4KA 5K0ZA 1IIBA 4L5BA 4E5PA 3TSWA 4D4GA 3QEMA 1YMUA 2I29A 1MA0A 1MT3A 1NTOA 1TF5A 2EX0A 3INRA 3TWOA 3IV9A 1KY3A 1KERA 2A9QA 3N53A 4K5QA 3SYLA 4WZBB 5CJPA 1EUYA 3I39X 4A5OA 2CLHB 2K7ZA 3K1AB 5DTQA 1RJ9B 2VUSA 4KQ6A 5D86A 3PEWA 5DCWA 2E82A 3MLAA 2NUTA 3CF2A 3WMGA 5EEGA 3R20A 1QHNA 1K0FA 1XZDA 4HNHA 5DEIA 1OE0A 5T6MA 4G65A 1UK7A 2ZRCA 1ZGZA 1MJGA 2QR3A 1UMDB 3I6ZA 1EBUA 4OHUA 2PX0A 3FMOB 4GXNA 3HBJA 1X9IA 1XRMA 1ZRSA 1JIKA 2JVIA 2XMZA 4FVTA 4RJLA 1YE8A 5JAUA 3NV7A 1SULA 1PSDA 1DG3A 1OXKB 2PZBA 3I37X 4MINA 4JIGA 5GJBA 1I10A 3N8HA 1PJ4A 2JGDB 3PQDA 1WQ3A 5LZ8A 3OLQA 2J67A 3QKSB 3RRMA 2WTEA 4N5MA 1ADFA 3KQTA 2CHUA 2C3PA 1COZA 1Z7EA 1T26A 3OOHA 5JAQA 4TT3A 1JDPA 1VLMA 4DQXA 1HO3A 3BVPA 3D2LA 4WVFA 3QV1A 5KJEA 4WN9B 5SV2A 3WB0A 1D4FA 2RHHA 4WA8A 3ZLBA 1FLDA 4C6SA 4NCXA 5DHUA 2AJDA 3R7BA 4X71A 1HH4A 1EK2A 4DVJA 5HBGA 5K8UA 2MWMA 2HMVA 1VKNA 4YALA 5EXTA 5L40A 2SBTA 2ZB3A 4ARZB 4C9BA 2VHJA 1RWXA 1SVMA 2ZRMA 3KV1A 3DAYA 2BMJA 5F4ZA 5P8WA 2HF2A 4GLFA 5A4FS 4RLHA 3U26A 3UQYS 2GWRA 2OV4A 1P60A 1ULZA 4ZI3A 5HUJA 3R3VA 4QAQA 5KSPA 4QOHA 3H6HA 3GPBA 4LIPD 5IMBA 1PN3A 1Z5OA 1TKCA 2Q4OA 3ANSA 3FCYA 4XPZA 2JCBA 3VRHA 3YASA 1L1FA 3N5CA 1XBTA 4RZSA 4MA4A 1NR5A 3ZCSA 4C1BA 1UC5B 3EUFA 4ME6A 3L01A 2Y66A 4EYEA 4GMXA 1IEWA 4I5IA 1QUEA 3C3MA 3CT4A 4IXMA 1WAMA 2ABWA 2GNOA 2JHAA 5A3RA 2BP7B 4LV8B 2WT4A 4GZ6A 2OECA 4YJFA 1YB5A 5B4TA 1LGYA 3L0DA 1IWOA 1ESMA 1N5LA 2PMEA 3UGTA 1C4OA 4PE5B 3I5YA 3RSFA 1S02A 1R10A 5JCXA 1RD4A 5F3WB 1W87A 3JX9A 4Y6RA 2PT7A 5DX8A 3SIWA 4O4HF 1C9YA 1G7RA 4QDUA 1UAGA 1G6Q1 5LZ5A 3AY0A 1V45E 3L8FA 3RVKA 2UYGA 1NBIA 2ZIXB 2QRVA 3O4GA 5AESA 5LMZA 1BXRA 3LY8A 3H75A 1Y3CE 1HG1A 3TW4A 2R60A 1P6XA 2IV2X 2XYQA 4DAEA 4PLYA 3D6HA 1E0KA 2O2SA 2FUCA 3MEQA 4Z8YA 1R5BA 4RSGA 1B14A 5F21A 4PFKA 5F12A 4BFXA 1PR0A 3KOYA 1FS4A 2QTHA 3TRKA 4NU0A 1ZHFA 2FZVA 1FRQA 1ONOA 4GC5A 3OJWA 3AR9A 4MS1B 4O5OA 4Q66C 2ZOSA 1FP6A 4ZC8A 5L4LA 3TZHA 1TO2E 2E4WA 1U3TA 2QN7A 3AM3A 3ASZA 4EEZA 2HSZA 5K8IA 4BNMA 3IKTA 3JCZA 1P74A 4QXRA 4C0XA 3S28A 3TSCA 2YBDA 1T9GR 1Z45A 2WZQA 4R84A 2GAAA 4MUYA 1BVRA 1T0BA 1E79A 2P65A 2P68A 4IIYA 1O8BA 3WLHA 2DBVO 3KWLA 1P7YA 1NHGA 2WICA 3KXPA 3Q3JB 4EPXA 4F60A 1CEXA 5CDGA 2NXCA 3UJCA 3NC0C 2EFHB 1TQ8A 3H4VA 4IXNA 1RHRA 5FPHA 3BYZA 3CURA 2PG3A 1U0SY 2Q49A 5GJCA 3D3WA 1U0RA 4J3FA 2P9GA 3VBEA 4HV4A 3A70A 1U3WA 1Y1SA 1P72A 2VSQA 4JI0B 1N33B 3IAHA 1LRKA 1Q7TA 3VYTB 4DB2A 1GL3A 1QHYA 2Q3JA 2IV7A 1MAVA 3GLHA 4BRWA 5TF0A 4CKYA 2W2PA 1Y1KE 3EXFB 4ERNA 1F6DA 2A0KA 4WSOA 3FIUA 4HNAA 5K51A 5FKJA 3VDXA 4B2PA 1P8JA 1BCSB 3LC0A 2C3YA 3TS1A 1RJWA 1BWQA 4YUXA 3FWNA 4KU4A 3SAJA 2RBGA 3VO8A 5C5IA 3KKQA 3N0WA 4H6WA 1QGYA 1NW6A 3A9UA 3GVCA 1X1RA 2VUTA 3KHSA 1R9NA 4KXFB 4CKEB 2Y93A 4QG7A 1YK0A 4KWIA 2WWFA 4DA6A 3FDXA 1T0UA 2NPOA 3TRDA 1G9TA 1LDMA 3PJGA 1S01A 4WZBA 3QENA 2JIBA 2ONYA 3OEEA 3ZGOA 3T3PB 2ZUUA 3OLVA 3K1AA 3LUPA 5D3QA 4DCGA 1RJ9A 4RTLA 2ZTMA 1TUBB 4F6RB 1I3CA 1CHNA 1CHDA 421PA 2HF8A 3EIUA 4EENA 2OAP1 4I4NA 5LQSA 4X8LA 3SDBA 3LXMA 5ELXA 1ZN2A 2ORED 1DEOA 3GCGA 3RROA 4E5MA 5L4NA 4JMLA 1AGNA 4XCVA 5EXDA 5AW0A 4XAQA 3VNSA 1UMDA 2D0OB 2H1CA 1I4TD 2BTEA 4EFDA 2A3RA 3WGQA 1L4KA 2HT1A 1M8KA 1O1YA 4UUQA 4HWGA 1NN3A 3ZVLA 1RAFA 3G82C 3GJQA 3V8RA 3S29A 2YVLA 1ZIDA 2DR0A 1QFYA 5DNUA 2E21A 2PGAA 4R2HA 2JGDA 2YR0A 3QKSA 4DV4B 1EFAA 3RVJA 1TZJA 3OVMA 4DE5A 2ZSBA 3FW1A 3MJ4A 1XI2A 4PX3A 4DLWA 1JI0A 4MIEA 1UXGA 2PR2A 5A9RA 1CUVA 1Z4MA 2A0XA 3LUBA 4GHWA 4GOND 4NVRA 4R8RA 4D0LB 4RD1A 4WN9A 4ZALA 5LBTA 1LLCA 1T25A 4KN8A 1J8QA 1JWBB 2YYYA 2WUEA 4CN8A 3WL8A 2WHQA 1V11B 2PKYX 1P7PA 4RPLA 2IH4A 2PNFA 1I2ZA 1UP7A 2YYAA 4L5AA 1RXSA 2FFHA 3A10A 4ARZA 3IQWA 5JECA 3S2UA 2EJCA 1PWYE 4DLBA 2GBIA 4X60A 2AN9A 3BIJA 4KDCA 2C7BA 5FLEX 3A1FA 2NWQA 3P9QA 4N8SA 4IHJF 4JQSA 1ST2A 3CYFA 4Z7NB 4B3HA 3H5WA 3PBKA 3QVUA 4H0FA 4NF2A 2UXCB 4PSVA 3W90A 1WMEA 4B9AA 4BPBA 2X8LA 3G8YA 5K7SA 4O1HA 1SKYB 1T2NA 3KQOA 1NW7A 1G8KA 1RI1A 1TC2A 1JRLA 3F1KA 3N2NA 4CKWB 1LS1A 5KAPA 2VYFA 2H92A 2JJYA 2XOEA 3VSBA 3OQ6A 4O4HB 3DE6X 4AG5A 4A2QA 3FHTA 1U9JA 3O7MA 1Q14A 2FPIB 4MEJA 5JAPA 4EYQA 1R9JA 5K8VA 5M2QA 1W2HA 1NVMB 3OJFA 3HYNA 2HRCA 3SJZA 1MGOA 1FXWF 2X15A 3ZNNA 4BZZA 2P2LA 2QTVB 1WUHS 2BP7A 3N86A 4FYVA 3GVHA 4ON9A 3N59A 1F12A 1OWPA 2GLXA 3C1AA 1UJ4A 4NZMA 4KPEC 2IYSA 3AHJA 1M67A 1Q1GA 3FUVA 1LD3A 3RTGA 1F9EA 1SD2A 2BKXA 1JS1X 3L7JA 4DV7B 4W5WA 2WIJA 3NEAA 2WEKA 3UAWA 4CCWA 3WYGA 3EJWA 1HE4A 1Q57A 2E5FA 2ZIXA 2BBWA 2FW1A 4FOTA 1NXSA 3IMEA 4IVNA 4NYIR 4G0VA 1KZ4A 3QHQA 3SSNA 3PC8C 5BNFA 3L8DA 4J16C 3FCEA 2V6BA 3BDIA 3CX4A 1PTJC 4QNNA 4D9KA 3ESCA 1RRGA 1NT4A 3SS9X 3FNHA 1X13A 1WXWA 1ZMRA 4HNVA 1PSWA 5JZMA 1QXSA 5HIIA 4MS1A 2CE7A 3VPFA 1XHLA 3FN4A 4HX2A 2ODTX 3KSMA 3RVNA 1VJ1A 2CFIA 3B6ZA 3TCKA 2CC2A 2GN0A 2JKVA 1HT0A 4JXKA 1E5TA 2PQ2A 1KO5A 2C84A 3OZWA 1NL3A 1XD8A 2X0KA 4EVQA 1ULSA 1GKYA 1CQZA 1OI7A 5C18A 3DFKA 3AKZA 3R0IA 1J20A 1KMIY 2PRKA 5IC6A 2FFAA 5KOHB 2XEXA 5F9FA 2HU7A 1WBDA 3QY9A 5JYEA 1EXDA 4QPZA 2V59A 4B85A 2VDPB 3CZ5A 4C5CA 2R5NA 2JIPA 3AFNA 4XCQA 1XQ6A 3RJZA 3OBIA 4IWNA 4BBJA 5B7PA 2R85A 3NGMA 4KQFA 5A5VA 2GRUA 3I01M 2ZYGA 1SXJE 2IIPA 4BXOB 1BHQ1 4Q9DA 1U8UA 3A6ZA 3EXFA 5AIAA 4R1TA 3KJXA 5BSKA 3M3DA 2GB4A 2CDBA 1BCSA 3FSGA 1RMTA 4N3NA 3T1YB 1Y0BA 1GL9B 4P08A 3U17A 1YVRA 2GNAA 2ODBA 1OFUX 1SUWA 2O48X 2AGVA 3CISA 1L5WA 4J0EA 3ONFA 5LLSA 4CKEA 1ODIA 2BI4A 2BE7A 3QEJA 3PSHA 1GG5A 3TTSA 1XFDA 1D2GA 1DJQA 1PQUA 1QDLB 2QVLA 3GRRA 3TMAA 5E2IA 1H94A 5JTUA 3E7PA 4CUZA 5TXGA 3DVRX 2HK9A 1KIMA 3BJRA 3NTQA 4DV1B 3LCJA 3IESA 1V6AA 4MJ3A 2YJ5A 3CNLA 2AEJA 3SKVA 1TUBA 3P2EA 2B0CA 1N1EA 2Q8PA 2Y27A 4FW8A 4HLUC 3G2KA 3VFDA 2BT4A 3VV2A 2ZE5A 3FI0A 2YJ6A 1N3IA 1XDUA 1XZIA 3LDHA 4DLTA 3FLAA 4BQNA 1OAOC 1Q92A 3NZEA 3GJ6A 1XTBA 1UJMA 4KIUA 3LQYA 1ZUWA 4TVOA 3GFFA 3FGNA 3ELWA 1SBQA 2BC9A 1XYYA 4DSZA 2A88A 1MQSA 2C07A 4NONA 2WY2D 3WZLA 4DIDA 2D3WA 4WPGA 2B9VA 3SJ7A 1WX1A 3LLMA 2VP4A 1XYGA 3DWGA 4YJ2F 4GI5A 4RMNA 3TAUA 3PD1A 3D8RA 3OLYA 2Z8YA 4YMWA 2X13A 2QM0A 4MV9A 4RYLA 1CP3A 2RSLA 2XWSA 4ZYLA 3D5EA 4BOYA 1E6UA 3G8CA 4IHJB 3DBHA 3GPCA 3ROGA 4ZCTA 4X7MA 3IVCA 3B6EA 1X3SA 5KVSA 3U4GA 2V7XA 1T3SA 3S27A 1V11A 2B1GA 3K96A 1UBHS 3ZE8A 4CTNA 3EISA 1PNOA 3WQHA 3AILA 3OD1A 1RI4A 2FN7A 2C3UA 3C48A 2GPTA 2QJTA 1KOJA 4IP0A 5EIWA 4DADA 3R6GA 2XDAA 1VMEA 2FAXA 2XNDD 3OE7A 4DDWA 3LWBA 4JNKA 3DE5X 2WIGA 3MMSA 1KY2A 1OOEA 4PZZA 5C8ZA 1JHZA 1UBRS 3K31A 4K40A 4PLTA 1AA9A 3E35A 1U9ZA 1GEEA 3I05A 2GJ4A 3SOZA 1T1IA 2ISCA 5JLJA 1DKQA 1LPBB 3ZG6A 4AJLA 4CKWA 5EG5A 4EY6A 2YZKA 4O4HA 5C53B 5AK3A 3LDUA 2J3JA 2QT0A 1NRIA 2FPIA 2OV3A 4BVGA 3LD9A 4NV0A 1NIJA 4UHFA 5E6RB 5LOVF 1VJRA 3GD5A 4KFRA 4KWCA 2SKCA 4OFWA 4XYBA 1L2TA 2QTVA 3OQVA 1BYUA 4U00A 4TTSA 1YB4A 2Z8ZA 3CINA 4X7RA 4JKOA 5CNIA 5BNZA 1MX9A 3TLJA 1NJSA 4QYWA 4KCGA 3RWMB 4RJIA 4EY8A 1YA4A 2BOVA 3ROQA 3UHAA 4FFDA 4EVSA 4HQLA 5ICMA 3J81A 3HABA 1M2NA 4LSGA 3TD2A 2VDQB 4HMOA 1Y8CA 1MTZA 3ZXUB 3JZIA 3LCVB 2G1AA 3R0VA 4EGAA 3ETHA 3TVTA 4YV2A 3PVZA 2VZEA 3GHYA 2IOFK 4EG7A 1Z68A 3T0FA 5E3HA 1W25A 2JH8A 4PG6A 5HFJA 4FJ0A 4BPRA 1P1BA 2Q9CA 2YRFA 2XNCA 1UFKA 3GJ4A 3HEMA 3M0EA 4KBYA 4PIPA 5AQEA 3RS7A 4EYGA 2P6UA 4CMKA 4MW1A 1N6OA 1JQ3A 4A26A 4BO9A 4AWAA 2G8NA 3LRXA 4L0CA 4UM8B 1I6WA 3KR2A 3VPHA 4KOEC 4X65B 3PGKA 1SVUA 3RNOA 1Z74A 4OU4A 2Q0XA 3OZVA 4URWR 2RB4A 3M2PA 2ZAIA 5B64A 5KU7A 4PCLA 2QIOA 1QKJA 2Q3HA 4DWOA 4DXDA 3V42A 2HZBA 5TPZA 2GA9A 4C01A 2ZQ5A 4J1QA 5AW3A 5DYNA 1IFXA 2D5IA 4MJ7A 4DIFA 1R3UA 3RSHA 4E7PA 5KOHA 2IS1A 3LL4A 2JJ8A 1RACA 1GAEO 4IGIA 2NZ8A 3TZLA 1U7OA 2NPIA 3F6YA 4FDAA 4ITRC 4EKDA 4CL2A 2FEMA 3DHYA 1SBHA 1V8DA 3EIOA 1U2TA 2IXAA 2LPMA 3AQ4A 3KBBA 3KFLA 4D9FA 4RHCA 5DM70 1OLSB 4LCBA 2GEBA 4BXOA 2BW0A 4WCDA 4CEHB 2R0QC 1F2TB 4UMVA 3V4ZA 2YZNA 5JAHA 1UBEA 1I7LA 1CUJA 1L4YA 1W36D 1G9XA 1T15A 2ZRQA 3ME5A 1WHTB 3Q3VA 1P31A 4ZO6A 5IH3A 1E9CA 4KACA 3H84A 3QTTA 5AO9A 2D6FA 4RVHA 4C0KA 4ZP1A 1EUCB 5HEKA 4QDJA 2GAFA 2ZQYA 3U4CA 2A5GA 1IAQA 1YFKA 1PJ8A 2FOXA 2Q2QA 3JQAB 3L8YA 4POAA 2Y9YA 4PR0A 3MB8A 3WY9A 1CETA 3QXJA 4HL6A 4HP8A 1C1XB 5HUQA 3RSSA 1RRKA 2D62A 3SLRA 1G6OA 2ZM5A 1UC9A 721PA 1DZ3A 3H2SA 4YJ2B 2V6JA 1FMCA 3KR1A 1QRTA 1FTSA 3Q8XB 1QLWA 5JUWA 2D1SA 4Y6OA 1VSTA 3C16C 1UDCA 2NOAA 4L1KA 3STUA 4EA8A 1NUPA 3CLSD 1P7WA 2IOYA 4J91A 3RT1A 4C0WA 4Q21A 4JYAB 1GQOA 2WILA 5E1BA 3RGWS 1S3GA 1WVGA 3THSA 4NCBA 2BUBA 4TS3A 2JCYA 3GV0A 1QQAA 1AK2A 1WP9A 2W43A 2X0EA 1Y9AA 2WAXA 4CMCA 3L6BA 2NYUA 5FOVA 5EMLA 1YTLA 3ZOZA 1X86B 4URZR 3N07A 3MRXA 3BWVA 1H2ZA 4IWYA 4XR9A 3T3IA 1V43A 1QPBA 1RJEA 4IHJA 4WUTA 1QWSA 3DFMA 3C39A 5DSZA 4DBVO 1VRVA 2CVOA 5FTMA 1FF9A 2WA1A 3N8KA 3QTLA 1GCUA 2P9EA 2QE7D 2FSGA 5A4KA 2QRKA 3AUAA 5EOVA 4JUBA 1GXSB 1I30A 2XAAA 3NM4A 2A2ZA 2D0IA 2C8JA 3C4JA 4DNFA 3C5CA 5KVCA 1YCFA 5LOVB 1G5FA 2H0AA 1PTKA 1VL0A 1N9ZA 1YRWA 2LRHA 4W8GA 3RC7A 4CHTA 4DG9A 2ZYUX 5J4KA 2OCDA 4MQUA 4N4AA 4UEKA 1MRSA 2MYTA 4I5FA 3ND9A 2AG8A 3I2GA 4BVAA 3R41A 3Q9NA 1E6EA 3ED1A 4JVOA 3AK4A 1NMSA 3UWPA 1OASA 3ZPXA 5KNBA 2BI8A 1QG6A 2ZR0A 5EJMA 2FWBA 1K6JA 2PYZA 2ZIVB 3F96A 4WY5A 5E6RA 3SKYA 4RXMA 2Y9ZA 2EDAA 1L5KA 4Q82A 3WK7A 4BV8A 4KR9A 4CF5A 3EGEA 3OT5A 1PQ4A 4U4AA 4B0PA 4NABA 1F0PA 1MB9A 3KDAA 3ZCVA 2IW3A 3HH8A 1ENPA 1W76A 1YTUA 1BU8A 1EU1A 5D1HA 4CETA 1D6MA 3U7GA 1UT5A 2FOLA 1H2BA 1XAHA 3HUDA 2CXSA 4JLKA 4RD4A 3FTNA 3TIGA 4MS4B 1KHTA 1PUJA 4Q1BA 4RE6A 4UPVA 1T1EA 2ZBGA 2JI6A 1HM5A 2V45A 4Y6GB 3O4RA 4F6RA 2PKEA 4ZJPA 3WSVA 1CQPA 2JI4A 2L42A 1O8CA 1CRQA 2RK6A 3O2NA 3Q5EA 4DMMA 3RS5A 4CV3A 1AKNA 1TM4E 2GZ1A 1VMDA 2G9UA 3OZIA 2UVPB 2Z4RA 1H2RS 1U2RA 2YHBA 3I04A 2RAVA 2N46A 4H7KA 2DFVA 3SIPA 4XX0B 2G70A 2VNAA 1BU5A 2Q6LA 2OYCA 3U31A 2WHYA 4H35A 4QZVA 1WF6A 3KWJA 3PR1A 1IVSA 2BY4A 1QGDA 4CIWA 5F7OA 1VPVA 1IRIA 4XLLA 4QQKA 2PUJA 2RJNA 5I4KA 3B5JA 1AXGA 5B3JA 5FTNA 4OU5A 3A7DA 4CM9D 1FW8A 4Q4CA 1GILA 5BOSB 4O2LA 2H1IA 2V55B 3CGWA 3ITKA 3IPXA 3LV8A 2NQ8A 2BR3A 2E4VA 2Y0DA 3A05A 4BC0A 4YK7A 1TYDE 2CXTA 3OX1A 1I1HA 1O95D 2PWBA 1DARA 2Q5HA 3A4TA 3AW8A 4U6QA 2JIZD 2HBZA 2NYAA 4CMJA 4O63O 5EINA 1B3BA 1AKEA 1GHTA 2YWDA 4BTEA 4JI4B 3IALA 1TKRA 1SUCA 4A82A 1OLSA 1SRQA 3TW6A 4C4PA 3HO8A 5LQKA 3KOZA 2YWGA 4GYWA 4CEHA 4CCSA 1F2TA 1ODLA 3ICCA 1ZK3A 2P69A 2G5CA 5E9QA 1A71A 3MAAC 2ZR9A 1WHTA 2DTXA 2IGBA 121PA 2NU7B 3HZHA 3M89A 1U0JA 4H1TA 1UJ2A 3LYUA 5AW6A 1Z83A 2AJ8A 2GPBA 4EYSA 1V3UA 3UA4A 3MA0A 4JBHA 3FZYA 1EUCA 4PYLA 3CCCA 1IEVA 2P9BA 1NSYA 1PNRA 3GLQA 3DJFA 3EAFA 2ZPAA 3JQAA 1WMAA 4S1OA 3TDNA 1VL8A 1X7DA 3VSDA 3F5QA 4FDUA 2B7LA 2HAEA 1C1XA 2HRQA 3NUQA 4QUDA 2VA9A 3WQQA 4EGCB 5LWQA 3FGZA 2XB4A 1DHRA 4P84A 4WRRA 4YJ2A 4ARCA 1T5SA 4ZOBA 5F77A 3DDNA 3EW9A 2BM1A 3DM9B 2IDZA 3MUFA 1P2TA 1JIJA 2C98A 1DAEA 3TKAA 2QN8A 5IN5A 1MORA 1ORVA 2GA8A 3HU5A 3PUZA 3PWTA 2CWWA 2OV1A 3ZGLA 4QTYA 5EHZA 1XA0A 1DEAA 1MR3F 5GVRA 3F7OA 3LQ4A 3JWIA 3I34X 4G4IA 2EARA 3LC1O 2ZM6B 3I09A 4EW6A 4J2TA 3HFRA 5L53A 5IDVA 4JHLA 2G9QA 1X1EA 3MPUA 3ROEA 1T4GA 2AXNA 5MN6A 3KDSE 4D9CA 2G67A 3I1JA 1CIJA 1BG6A 1QGAA 1M6YA 4W6QA 4YDRA 5KDLA 1O97D 3PJEA 1ZIYA 3KLOA 3U7EB 3UT5B 5IT9A 2ERYA 2OGTA 3B9QA 4JZKA 2WSYB 3S68A 2C5SA 2EIHA 2QLJA 3GBPA 1MIOB 4PS0A 2MYPA 2RKOA 3DP9A 1EBFA 2AD5A 1UWKA 3CMCO 4TUYF 3EIFA 3RFXA 1GXSA 2GD2A 1LX7A 1UXKA 4I9HA 4DJAA 4G1EB 1JQ5A 2R7AA 1AKWA 4Q1VA 5AKYA 1KXJA 4PC1A 4XGNA 3T7SA 4A0QA 1IBKB 2BHLA 2RHJA 2BKAA 4OM7A 1B4DA 3WBFA 3BF7A 5EE0A 4CIYA 5LOVA 4XASA 2VHVA 5EZYF 3T7JA 3AKYA 4G1BA 3S7ZA 4B40A 4Q6BA 5DHTA 2IOQA 1F8XA 3VAAA 2XVAA 4FZRA 4IGFA 3RVOA 4F72A 3GEPA 1G8PA 3CZAA 2P3SA 2ZJ4A 2FGKA 3I3OA 3K5PA 1ZD8A 2YZMA 4LG1A 3ORYA 4LZPA 4WN3A 1KRWA 4FKMA 4MWDA 2H00A 1ND5A 2Q29A 8ABPA 1ZI8A 3QLUA 3C6ZA 3KQYA 4DSNA 5JS6A 2BZSA 1H69A 4JVNA 1U5AA 3V4LA 5IXJA 4L4RA 2O07A 1Z7WA 5HKAA 3K4QA 3MWLA 2DLDA 1XWWA 1N78A 4YMUA 3WLAA 1KJIA 3QE3A 1V95A 3URMA 4ZI2A 4DCSA 4B35A 3N0VA 4H3HB 3DDWA 4P5EA 4HQKA 1YFZA 2E18A 3JYOA 3U61B 2PXHA 1BA2A 1YZQA 1GNTA 2ORIA 3F6BX 4OFBA 4MS4A 4F3CA 1ORRA 2AG6A 2DU8A 3A4NA 3SS8A 3Q3HA 5IS2A 4A0SA 2ZSJA 3CF4A 1O0SA 5KTTA 1ZM4A 5JJKA 1NOIA 1NVDA 1Z0ZA 2YDYA 1R4NB 3AL2A 1VIAA 2EBWA 2IU3A 3MCTA 3OJXA 4F2WA 1TQDA 2FMTA 2IK8A 3RWBA 4A15A 1Q7BA 4Z0NA 3HJTA 4N3GA 1N1GA 2O0MA 1NNSA 2ODAA 2XKAA 3ZJYA 4KTVE 5CM2Z 3HCOA 2UVPA 5AHXA 1EVYA 4QBKA 3PV0A 1F8FA 3ETEA 4ZO9A 2V7WA 3R09A 4C3VA 3NIGB 3NX4A 1SOWA 4XX0A 3UENA 4A23A 1ZGBA 1BGVA 1V5EA 4DHEA 1HE3A 1L7VC 1QYXA 1XJCA 3E5NA 4D8UA 4ENPA 2P41A 2VJKA 4Z0HO 3U7RA 3MQFA 3PR2B 1ZLYA 1GZDA 1LI4A 1N2GA 4HRXA 3VTZA 1WDWB 2O4UX 3VVLA 5KMGB 1F6BA 4XB2A 3CUSA 4G67A 1QRSA 1KI4A 4GEKA 5BOSA 3SI7A 2BR4A 1G3IA 1EFRD 1QYIA 4DUZB 3WO1A 4RZQA 2Q1TA 4ZVNA 2XZLA 4MYRA 1SN7A 4JJ8A 3AOEA 2P7IA 3NNNA 1OFUA 4FBMA 2NTVA 3R8FA 1I3OA 3H8SA 3ICOA 3IV6A 3KT8A 4KI7A 4LWQA 5F4BA 3OTHA 4HPJB 1QO7A 1NULA 5FBZA 1CTQA 2EWVA 4HB0A 4DZTA 4EDFA 1JJIA 1SB8A 3BORA 2WSBA 3H42B 2V5VA 3SVZA 1T5OA 2ONKA 1XVUA 3GW8A 2GCNA 1RAHA 5EMNA 4CW7A 2RHWA 2J6HA 3I53A 2C4VA 4QJ5A 4NFHA 5L4SA 3H9QA 4Z9BA 1TVEA 1U1GA 4GBMA 2HIGA 1FTNA 1PL8A 4TKVA 2NU7A 3ZD6A 5HPYB 2II6A 3FTCA 1RPZA 1D2AA 1WW3A 3ESDA 4FFNA 1H0HA 2GZSA 1W5TA 3OCUA 3S4YA 5DU2A 5IZ4A 2O2DA 3H8VA 4CV0A 1DPGA 2GVZC 3Q11A 1WVMA 4DM3A 3MHTA 2H3EA 3ZJ4A 5KPJA 3O8LA 4IIEA 3JD3A 3LBYA 3WICA 2IEYA 4IH1A 2AIRA 2ZB2A 1RPAA 1JHYA 1OMOA 4ZDKA 4Y1FA 3RRNA 1KFEB 1YBAA 2JI8A 4N0QA 4DLNA 2LW7A 1A2BA 1B8PA 4LGCA 1KGDA 5TPWB 5HX7A 1C4XA 4QUHA 3KP1A 4DC9A 1KZ9A 4QGFA 1ZMBA 3R0ZA 4E6EA 1IM8A 4K1LA 1TYAE 3CUKA 4TUYB 5HTKA 5I7SA 1NC1A 5IEJA 4ZTBA 4ARBA 5KTKA 1WETA 3WLMA 2P67A 1XQYA 4GZMA 1G18A 5JHHB 2QRLA 4KNVA 1KRHA 4FXOA 4I9NA 3PQ8A 2ROQA 3IUNA 1YR1A 5L3ZA 3U3DA 1Y1TA 2H08A 5EZYB 2ZBQA 4LMPA 3H9CA 1ISGA 2WUFA 3EQ8A 2QUAA 2R68A 4PC7A 3Q3GE 3UT5A 4N7RA 1BE1A 3QXCA 5H81A 1N8TA 1RYZA 2OLEA 4GRDA 3WIOA 1MIOA 1P3JA 3BSWA 4G81A 4XE5A 2EZ4A 1FDUA 3B3QA 2EZ9A 4KXQA 3V3TA 3ZX4A 3VKHA 1ZRHA 2I4IA 4P86A 2OCAA 2W90A 4LZLA 3GJ5A 4TT3D 4UPDA 3SFTA 1OKKA 2VN8A 1TTPB 1IG0A 4KDRA 2Q46A 5FNZA 1S7GA 3FAKA 2HFJA 2ZQZA 3DPUA 5C7OO 1JB1A 1R0SA 2G9VA 1E9BA 4MARA 1YDWA 3Q88A 5C2JB 1YKGA 4AJHA 1ECCA 5BW5A 2Z08A 4Z6KA 2E3JA 4IMIB 3HL4A 4J7CA 2EP5A 2QVBA 4GZ3A 4RTNA 3DOOA 1KVUA 3OLZA 1BDIA 4XVHA 1JA9A 3R7AA 2IYVA 5FTJA 4ZCLA 3KBOA 3BB1A 1G5IA 1R3DA 1XTIA 2QD4A 3ROTA 4EYKA 2PMCA 4WOPA 2X1VA 1WE2A 3PGA1 1LSSA 1ZHOA 1FX1A 5DT9A 4QQRA 1NQAO 2G9RA 2HQRA 2YIDA 3VSAA 4FOPA 1GQ2A 3G6WA 2P30A 4M7RA 4QEZA 1DTEA 2O52A 3QMVA 4E4TA 5FWNA 4EYOA 4L51A 4BRSA 2VTVA 1ZJZA 1OIVA 4JP3A 2WPDA 4NU6A 1DIBA 3AKCA 5CVUA 5KCZA 3O8CA 5JATA 1AQNA 1E58A 3HCNA 1YOVB 3M4JA 1R4NA 3PHHA 5D6OA 1KI9A 3ABOB 3TLMA 4PZLA 3PJRA 3TIVA 1EZZA 2HA6A 4Z9AA 1B26A 1Y5NA 3ZHQA 4DMKA 4BZXA 2GO1A 2ODWA 3KB2A 3PT9A 2GFIA 1SG9A 5ALRA 3JRWA 1UJNA 1IXRC 1DHTA 1JP7A 1ICEA 2PDAA 3STTA 5DKFA 3TLGB 3TQIA 4N3BA 1DQZA 1W48A 3EYAA 3JVUA 5J4YA 1QRUA 4XJTA 1L4UA 2XA2A 2WYHA 2ZREA 2CNDA 4RSMA 3REQB 1Z0FA 4HGPA 4R1PA 5LNK6 4MGEA 1XK6A 5HKLA 3PLRA 3N70A 5IKOA 3VZQA 2Q6VA 3L6DA 2F8MA 4CG0A 2YASA 3G9UA 4OLBA 3ISJA 1KEZA 2QUZA 1DI0A 2FDXA 3CW9A 1V8PA 1QKIA 1VRCA 3L1JA 5CW1A 3CO5A 4K9RA 3G8BA 2JFNA 1L3BA 1TZCA 1RCTE 4OHWA 5DBGA 1A9YA 3DD5A 3DKPA 3FNQA 3Q7TA 3OU6A 4IICA 5ALSA 2AZMA 4MMXB 1BDBA 4R98A 1UODA 3LK7A 1GSAA 1E79D 4PSCA 4AN1A 2FR8C 5IANA 1U04A 4GYJA 3HMQA 5CFQA 4EHAA 1MKYA 4QUGA 1EVKA 5HE8A 5KTYA 1W4BA 1W96A 1A1VA 3FWHA 3U6BA 3QWHA 5AXDA 3GLUA 2AF4C 1QO0A 1HLPA 1I0ZA 3AP3A 4KQIA 1ODFA 4QPPA 2G04A 4FHEA 4GGMX 3RH0A 4HPWA 4ND7A 2OPHA 1RIFA 3V8PA 4NESA 2QVXX 2GQ0A 2PZLA 4RC9A 4X85A 3RCBA 3F74A 5FBLB 4EI7A 2C4WA 2ECFA 4X92A 5HOEA 4V0QA 5T57A 1Y4UA 5DBIA 1TDJA 2P2YA 3FCUB 3SSMA 4QREA 4B82A 1L1QA 5LYYA 2X14A 4FFWA 4K05A 4X1IB 2QYHA 3ILVA 5HZHA 1BD4A 4L08A 4WFIA 4L3OA 3MCZA 4XQ0A 2Y1FA 5G3ZA 4D8WA 2CCJA 3ZXSA 3I5XA 1GLGA 3LGAA 4U1RA 2IC5A 1YIAA 3GT7A 3UUWA 1LTKA 4RHYA 3WLSA 3OEED 5TPWA 4B7XA 1E2HA 4DV0B 1DAPA 3QXGA 3H19A 3WLOA 2X1MA 1I4OA 4MQMA 4B6RA 5CD9A 1M7HA 5BOVA 2VOEA 5FAKA 3FOCA 4K6MA 5IHXA 2FYTA 2BHTA 3NHJA 4IJVA 4LI3X 4XSGA 2IP1A 1Q3KA 3RVQA 2Y0EA 1SXIA 3CM0A 4MB2A 2VS1A 4TUYA 4TZKA 1WDMA 3PNSA 2JGKA 4MW9A 5D5PA 4IYJA 3UATA 4RULA 1N6HA 1EAYA 1K08A 3CZ9A 4HLNA 2QQ5A 3DBLB 4N0EA 1UBLS 2GVDC 3EOBI 4U6NA 4A0HA 4DZRA 2D8AA 4N5NA 4YQEA 4H18A 4G84A 5EZYA 3QQPA 2AWOA 3LM8A 4Q37A 1JDNA 2PU5A 4UAGA 1ADGA 4F5ZA 2A30A 1KEPA 3RYFB 3G9QA 4UOEA 2YY7A 4XB1A 3LUKA 5CYPA 4N7JA 2ZYVX 5B55A 2W2VA 4H7DA 5CLJA 4PPFA 1WQ4A 4YGXB 5CB6A 3I62A 1DCMA 2OD9A 2BFCB 1XZGA 1WQ1R 4HWKA 4ESVA 2BPOA 5IFKA 5TSDA 4KPGA 4RANA 4FP9A 1O0CA 4V03A 2ZRNA 1V5FA 4INZA 2JLVA 4ZEXA 2PMBA 1OW3B 1RAAA 3I3SR 4U7TB 3USZA 3M6XA 5E7JA 1GQFA 1HQYE 1QYVA 2HI0A 3LTEA 2PSHA 4YY3B 5E1OA 2IZZA 1VG1A 1FVXA 1GCOA 1W75A 2WJ6A 2AF3C 3NT2A 1A97A 1CRWG 1JMKC 1UWLA 2P0AA 3EF3A 5FORA 4YR7A 3HCAA 4NMXB 2F55A 2HXYA 1SC4A 3AGQA 2WA2A 3EVCA 4BFCA 4EG1A 3LUHA 4R1UA 3LPDA 4D99A 1J8VA 2DSNA 3GUZA 4JU9A 5ALXA 4ZTZB 5NULA 1KI6B 3UF0A 5AQ1A 2CUNA 4FGLA 1YQEA 3WWYA 1HYGA 3QVTA 1PQWA 4HDSB 4A6XA 1Y9EA 4RPGA 5B3LA 1H5QA 4J43A 1JXOA 3R9XB 1ZIXA 2CMHA 2ZUCA 4JT8A 4QLOA 5FV7A 1SU8A 5KYWB 1WUTA 4MLPA 3UOWA 3ZZMA 5DHRA 2ZXEA 4YGYA 5AXAA 1EXWA 3AEZA 4DJEC 1UDAA 3UAGA 4KQKA 4EL5A 1E8MA 2QUBA 3FPGA 3H2IA 3RKUA 4OMDA 2LKCA 2WC1A 4K9SA 4H60A 4P83A 4R9NA 4KE8A 4XDZA 2FCRA 1V7ZA 2G9ZA 4FN5A 4PICA 1ODKA 2KWIA 4PR3A 3K6SB 5FTLA 3C3XA 2NUPB 2KJQA 1FJHA 1PVVA 3K1JA 4FW9A 5AM0A 1YOVA 3A6KA 4CLXA 4TYQA 4OGWA 4OGFA 1XDBA 4UAVA 5K0JA 2FW6A 5A7HA 3D4IA 3AP1A 4BQIA 4FFRA 1UKYA 2PD6A 2XUAA 1TCCA 4FXPA 3PQ5A 3BL8A 4FDVA 3IIEA 2M6RA 1AQLA 1U6IA 3LUFA 4MUAA 4P3XA 4Q3AA 4UMFA 5FYDA 3RG8A 2B6NA 1NUTA 1PV1A 3IRVA 3GO4A 2E6KA 4JB2A 1P61B 4LE1A 4MOWA 4S1TA 3TLGA 5JTTA 4LDPA 5FYQA 3K9FC 5JNWA 4R8VA 2QJOA 4CRWB 3IQGX 4RY2A 3REQA 3A36A 3EGOA 1CJKC 1YDMA 1LPPA 5DLDA 5BY2A 1O2DA 3QKUA 4U3JB 2XNJA 3H1AA 1K8ZB 1VYUA 3U7IA 3M5CA 2HW8A 1GNQA 1S9DA 1TMGE 3DMRA 1CT9A 2IFTA 3PKJA 5JG7A 2Z2XA 2E4XA 5ITVA 4K6FA 3BA1A 1O4VA 5ELLA 2D5LA 2NACA 4KIWA 3T99A 4DV5B 4MWGA 2O2CA 1TW3A 4AY2A 4FDLA 1ITZA 4LMBA 1OREA 4DWWA 4Q02A 3TK1A 2PJUA 2VP5A 4MWBA 4YV1A 2NSLA 1TAUA 2GDZA 4ZVSA 4ZARA 5JSYA 3KYIB 3QVKA 1JJFA 2FMKA 4QYMA 3WK5A 5LWHA 1RXEA 1XP5A 3GX1A 4BVLA 1XRNA 1IY9A 3N2ZB 1BHJA 2H29A 2QUHA 5F2NA 2EW2A 4X9XA 1L5GB 10MHA 4UCFA 2D74A 1QGOA 2RBKA 3COYA 5B58T 1L8QA 1FFHA 2OORA 3ODPA 1H0RA 1KZGB 4OJKA 2XOKA 4XIYA 1E69A 3HP4A 4CT5A 1J9EA 3AI1A 1F2UB 3FWYA 5H3CA 4TTVA 4R8MA 3RF7A 1MTOA 5JJ5A 5HQTA 1XLTC 4E1AA 3BIXA 3NTUA 3L4SO 1KQ3A 2ATCA 2WTMA 3G2MA 3KSUA 2J09A 3V97A 3PHCA 4DQUA 2VP6A 3MM4A 1QOZA 3FSGD 4G5FA 4RJ2A 1AMOA 3HXTA 1R8QA 3P52A 1G7SA 4RKYA 4F2PA 4X1IA 1I7SB 2A5DA 3RC1A 5T67A 4NPHA 1IHDA 1S2OA 4AD8A 4EHDA 2ZJ5A 4IOKA 1HNXB 1R0ZA 4S2EA 3SJBA 2YZ7A 4ZYZA 2AJBA 1HSZA 1GL7A 1L9XA 2Q9BA 3LT0A 4Q7MB 1SCJA 3KT6A 4UDXX 2VQ3A 1Y42X 3GG9A 1YHYA 4NBVA 3CX7A 1EK0A 4GL4A 3KWMA 3TAHA 3T5BA 4B09A 3ZKWB 3G2JA 2R7NA 4MIOA 5CVVA 3WGGA 1DKLA 4MAAA 3W2TA 4CIVA 1MFZA 1PFWA 4ZVMA 5KBYA 4KDEA 2NTNA 3KM0A 3WOHA 1JT2A 2XOXA 3L7DA 1NQWA 3FFTA 3IQFA 2FG5A 1U0GA 1JG2A 2VTKA 4UTZA 3ZZ1A 2CLDX 2FLKA 3DBLA 5C0OE 1H8EA 3WL3A 3QEAZ 1RYMA 1KAQA 2VWQA 2B83A 1P2VA 2VHUA 3DTVD 4OMFG 2WKSA