1EWCA

Crystal structure of zn2+ loaded staphylococcal enterotoxin h
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLGGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords ENTEROTOXIN H
total genus 73
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ewcA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ewcA02
2XRSD 1CQVA 3URYA 1V1OA 1M4VA 2QILA 4RGMA 1LTSD 1CHPD 4L63B 1SBBB 4DXGA 4RGOS 1FNVA 1HXYD 1PZID 2XRQD 5D3DA 1LTID 3W2DA 1YN5A 4RHRA 3R2IA 4L6TB 1HTLD 1I4PA 1DJRD 4Z9CB 3DWPA 4RGNA 1PTOB 1UUPA 1SEBD 3BYYB 2R61A 1TY0A 2NTTA 1PRTF 1DYQA 1SJED 1ESFA 1JWSD 1LTRD 2IJ0A 1AW7A 1XXGA 1L0XB 1JQYD 1D5ZC 1LTTD 2AQ2B 1BCPF 1G8ZD 3DWAA 1LT3D 1EEFD 3BZDB 1PTOD 5D3IB 3MC0B 3BVMA 4C56C 1EFID 1KTKA 3V05A 1AN8A 1KLUD 1LTBD 2SEBD 1D5XC 1I4XA 1PZKD 2XN9C 4ZYSA 4DXFA 1BCPC 4O1NA 1TY2A 1FGBD 5ELCA 3EFXD 4RH6A 3DWQA 4UDUC 1B44D 1SJHD 3BVZA 1BCPD 1MD2D 1TS4A 1V1PA 2Z8LA 1L0YB 2NTSA 2QEJC 1GOZA 1I4QA 1JR0D 2RDHA 5FKAC 1PRTB 3GP7A 3R8BA 1S5DD 1V1PB 1D6EC 2J4XA 1XTCD 3BVGA 4RGTA 3TSSA 3R2TA 1FD7D 1UNSA 1HA5A 1BCPB 1PTOC 1S5CD 1LO5D 4NZLB 2XNAC 1ENFA 1F77A 3MFGA 3EA6A 2ICIA 1D5MC 1S5ED 2AQ1B 1PRTD 3BYTB 1YN3A 4TSSA 1JWMD 1T5XD 1STEA 1LT5D 1TS2A 1ET6A 2RDGA 3OWEB 1TS5A 1PTOH 4K6LA 1BXTA 4RHSA 1PRTC 2AQ3B 1I4RA 1LT6D 1SE2A 1HQRD 1JWUD 1LT4D 1RF2D 2IPKD 1JCKB 5ELDA 5ELBA 1B1ZA 2CHBD 1TS3A 1YN4A 1KLGD 1FNUA 1SE3A 1CHQD 2O2LD 5FK9C 1ET9A 1QILA 1SE4A 1EU4A 1RDPD 1EU3A 2WV6D 1RCVD 1S5FD 1LTAD 5TSSA 1PZJD 1CT1D 5ELFA 4RFBA 1EWCA 3CHBD 1I4HA 1CK1A 2TSSA 1RD9D 4OHJA 1PYWD 4RCOA 1I4GA 3KLSX 1PTOF 5ELEA 3O13A 1FNWA 1LLRD 4BWGB 5I4DA 3SEBA 1EEID 2G9HD 1LTGD 1S5BD 1SXTA
chains in the Genus database with same CATH superfamily
4FYDA 1CQVA 4YXDB 4A3KG 4JG2A 1Q8IA 2C9OA 1R4NI 1LTSD 2VQEL 3AE1B 1HZ6A 2KQSA 1SBBB 4XQQA 2W54A 1WYGA 2KC2A 4HAEA 3RCZA 4AP4C 5EPJA 4JI6Q 3NZSA 1EF5A 1ZW7A 2JXTA 1T9HA 2L1BA 1Z6HA 4MN3A 1Q1EA 3J7AF 2LRWA 1YX5B 4IPDA 1N34L 4HIOA 2VRRB 4MM3B 1WXVA 2N49A 2BDNA 2B3AA 2K8HA 1N33L 1DYQA 2VB2X 2QIEB 2ZCBA 4IFDI 1YI2A 2IGGA 3OIPA 3K0YA 1YNTE 3TEWA 2DN8A 1G51A 4DV5Q 2BGFA 1D3ZA 4JI3L 2WXMA 5C3EH 1XMOL 2BA0A 4JVZA 2JA9A 3J7AV 4HSVA 4PS7A 1PH8A 3DHIC 2Y5PA 2K5VA 4XWTA 2AUJD 4BBNF 1KTKA 4TQ1A 2QKIC 3NQTA 3RLNA 4YY3Q 4A3MH 4N59A 4OGQC 4DV2Q 5IN7A 3ONAB 2EY5A 3PUWA 1GVPA 4LF4L 1N32Q 3H6NA 1HTOA 2B8GA 2L1AA 4K81A 2L15A 2ZPNA 1K0RA 1NR4A 1HA6A 2LWPA 4RNAA 2KMMA 3P75A 2ASBA 4DXFA 2DYOA 4A3EB 2E74C 4L5SA 1JE5A 2JPHA 5JHAA 1BDOA 1JT8A 4TV3A 3BIID 3J80i 4LNQA 2KJRA 2XK5B 3UDFA 3CSFA 3DDCB 4HMIA 2DLBA 3HOYB 1F9JA 4OIJA 1A70A 1Q1OA 2Z8LA 2Q2UA 1KNAA 2JSVX 2KQ4X 1YNNC 2L52A 3V61A 2M0AA 2FAZA 2PPHA 2MJEA 1VQFA 2HQLA 1B2TA 1H4RA 3K57A 4U673 1Y1VG 4O42A 1UBIA 3M3YB 5M3FH 1WGKA 3RFZB 3AEDB 2MQJA 4BKSD 1YQ3B 1CSPA 3O65B 4JPBW 1PLFA 4QL5A 1TWCB 2LKVA 3LJ3A 1F77A 1YITA 1FXAA 1KM7A 1QT9A 4I6PA 4DK5A 2QDFA 3HM6X 1I50H 1AP0A 5CV9A 1LT5D 2BS3B 3TEXA 4XTCS 2N7DA 2K4KA 2MPMA 5IGDA 3T51B 1VMPA 1YBYA 5DPTA 5ELDA 3PREA 2DBYA 2LGXA 4YTNB 3UQBA 3SFEB 2NVQH 2EY1A 1OXXK 1TIFA 2PW9A 1DOLA 3JVZX 5EKIA 1R7SA 4PMWA 1O7LA 4QB4A 3BS1A 2R2QA 1I5FA 2AYOB 4GNXC 2EIFA 3QO2A 3LXFA 1P0RA 1Y1WB 3HHMA 1B3AA 1OXSC 2AX5A 4I7ZC 5GAGC 1C7YA 3MXPA 1EYDA 4B3RQ 1WXSA 4KHPQ 2KTRA 3EHVA 5K36G 2F0GA 1SYDA 4BAXA 2ZZPB 2SDFA 5EGTA 3JAML 1L1OA 2F0EA 1BQQT 3J80E 2TSSA 5EJWA 2R7ZH 1CQFA 3GTOH 2ZJRA 4RM8A 3TEHB 2RDFA 3Q2AC 2A5UA 3G6EA 2Q8IB 3PO3H 3K59A 1RWSA 1RYJA 4NDXA 5M3MB 1OTRB 4PYUA 1XTDA 5HKHA 4IUPA 1VQ9A 1AE3A 1RODA 3OWFA 3A7AB 3QJYA 1EZ6A 3Q8DA 1NEKB 4NB3A 3C1EA 4GKKQ 5D3DA 1SE9A 3WAPA 1TU2B 4XYOA 2EYJA 4Y52H 3FILB 4L6TB 2M19A 1ZKOA 1XPUA 3S1NH 4KKTA 5IOIA 2B63B 1SEBD 2A8VA 2FUHB 1W2BA 1WTPA 2OWOA 1TR5A 2QDBA 2WAQG 1MIUA 4X6AH 4QUFA 3JYUA 2R6GA 2EJMA 1ZXTA 5COYA 1BBWA 2M56B 2REXA 4GKJQ 3VUXA 3D4WA 1QLBB 1GUNA 1OEYA 4DR5Q 5D6JB 2MWSB 5AUKA 3I4NH 4K7UA 3AE7B 1L1OC 4NPSA 4C56C 4FXGC 1TKGA 2PTLA 2VQFQ 3MZ5A 2LVPA 2QC8A 1A0IA 4QCLA 2VZKD 4G3XB 3U50C 2HHHQ 3KBXA 3FMCA 3IL8A 4DA2A 2UU7A 2RVLA 1O7ZA 2N9LA 3L0WB 2NWGA 4CDFC 4EZLA 4DBGA 4HJ7A 3KF6B 4AYBG 5GAEC 4NXNQ 1E1OA 3HIZA 1JOOA 2Z59B 1XYIA 3ZO5B 1WY8A 3KBGA 3G71A 2ZNVC 4NAWB 2VQEQ 3ML8A 1O7YA 2MUYA 1N62A 2KTFA 2ES2A 1M90C 4DWFA 3MXNB 3W1GA 5FLMH 3DVNU 3PSIA 4JI6L 2ZTEA 1C4QA 4A3IB 1EQQA 2QEJC 2WXFA 5C5MA 4A3LH 1T0YA 2DYMA 2N1VA 3R93A 1GB1A 4HDOA 5FKAC 3NRZA 3R8BA 1LYLA 4JBWA 4RGTA 1XWEA 3B9JA 4IM2A 3M4QA 4Q5VA 1R4MI 4XDCA 3CU7A 1BMLC 2ZPYA 4X3UA 2KVRA 5A2QL 4NW2A 3SFDB 3C1FA 1YN3A 3E9IA 2Z6KA 1TWHB 3SVMA 2W9NA 3KUDB 4WWNA 2KC1A 1MJCA 3I70A 3NUHB 3SK4A 4QF4A 3HOZG 3DBSA 2KHIA 1BUIC 4P73A 4A3EH 2LS01 4RCNA 3S24A 2AQ3B 1DOKA 4LDTD 3CC4A 2Y3AA 3I7FA 5C5LA 4HVBA 3RUZA 1TS3A 2JZ3B 2RHQB 3CKIB 2KVZA 4CDCC 3VH4B 3VTUA 3VDYA 3WIMA 1QWYA 1S5FD 1UE5A 3U2SC 4BY1H 3PVLA 3UDXA 3MC9A 4QJFA 5IYCG 3R3MA 1Z7TA 3N20C 4PS3A 4RFBA 3M3YH 3TUOA 1SNCA 2F0OA 1PH6A 3OG5A 4KSLC 1Y1VH 2V9HA 5L95C 4ZK9B 1NENB 5C4JB 2JUOA 1X32A 4KI0A 1PXUA 1VF7A 4XQNA 5IGFA 3AFPA 1JJCB 3PUYA 1TVXA 3HOWH 2LGDA 3L4PA 4CHKA 3J81j 3DWMA 2WP8J 1OXVA 4X57B 1ASYA 4FJYA 2B2VA 4MDKE 5E4XA 4CYEA 2WB1G 3S15H 1MVKA 4IPGA 4IUNA 1F52A 3NVZA 4JE3B 1FCLA 3A54A 5G5GA 4YSYB 4N58A 5G3LD 1UZXB 4DHJB 3K5MA 4DV4Q 4WAAA 2OJRA 1NR2A 2B2TA 3NTKA 4I7AA 4DNRB 3RULA 2PCFB 5BN5A 2O5JC 3FP9A 4Z9CB 1S40A 3N1YC 5C2TB 2K33A 3W1SC 2EYPA 2C7HA 2V4DA 3J81L 1WZ0A 4EE2A 3A5ZB 2FCMA 4AS1A 3QARA 3T4AC 4KIKA 4US9A 4HWIB 3PIPA 4ASWC 1TJEA 1XXGA 3FDTA 3EIVA 1GNUA 1WWTA 1KOTA 4RMFA 1KH0A 2Z0EB 4QIWB 4KV6A 3KFUA 4K5WA 2WU2B 1FL0A 4H2AA 3OSOA 1STAA 2PVOD 2N9EB 4AYBE 4KD4A 2O6VB 2X6GA 3E0JA 2IX0A 3JAME 3P20A 1I4XA 4GN4B 2K8CA 2WDVB 1E7VA 2KKCA 5G3LF 1H9RA 3PSEB 1J5EL 4IPCA 4ID6A 5C3WA 3VA7A 3HK0A 4EZKA 4PZ8A 1CZPA 1OXUA 3T56B 1SR3A 2QCZA 2WXIA 3I5JC 3S2AA 2CHXA 3L9AX 4JI0L 3T1HQ 1SNDA 1Q46A 2B63H 3VAWA 1FYCA 2H89B 2GMIC 2DWQA 4XQJA 3TS0A 3PGZA 2D2QA 2INCC 2NR2A 2OHFA 4WIPA 4BBSH 1GOZA 2YYZA 1VQJA 4YWMA 3RLFA 1F9QA 4A3DB 5AZGA 1TWFH 2PW7A 1SNPA 3GP7A 2CWAA 1EIFA 5I6WA 3CC7A 1CKOA 3KOJA 3H0GH 1NJIC 4JI7L 4DV1Q 5FO8B 1FD7D 1UNSA 1YHAA 1N60A 3QCAA 4M02A 1XLPA 4HJGE 5CMDA 2R93B 4PT5A 2H1EA 3VFKA 4A20A 4KKJA 4HLEA 3DEOA 4KVGB 5J18A 4MHEA 4L2YA 4EOYA 4M0WB 4B0MA 2M4NA 2CH4A 1CKMA 1GXDC 5ELNA 3MHBA 1NTGA 2I1KA 3S2HH 2WB1E 4OZBA 1UWMA 4XIGS 2D3AA 4AIMA 2EELA 3GE3C 1YQ4B 4K6LA 4BOSC 2HHHL 1BXTA 4LW1A 3OW2A 1XNRQ 4MIUA 1LT6D 3AE6B 2JY6A 4GSWA 2YEPB 3I2ZA 3TDQA 3I55A 4G57A 4JX1C 5K5PA 2NBFA 4A6QA 4LFBQ 2NS5A 1YJ1A 1NSNS 3TCAA 4A3IH 1DOXA 4K3BA 1G6ZA 2ZVOA 4ZRQA 4K3CA 2F0UA 5TSSA 1KF6B 4DR3L 1EO6A 1WGHA 1EOTA 1Z5SB 4GOCA 2FNJB 2M9VA 3N6RA 3UINB 3NBHB 2J0MA 2WWZA 4FP5D 2DYBA 1EIYB 1OO9B 4IDIA 4JI2L 3C3LA 4E3CA 3MWYW 4NXMQ 2M8SA 2XBBC 4H7BA 1T6BX 1RD9D 4XYCA 2ICEC 3CRKC 3B2GA 3X23A 4JOIA 2JE6I 2ZEQA 1Q90A 3H7PA 4JV5Q 3M85A 3V2TA 1P3QU 3AU5A 1PH5A 4TQUS 4BWGB 2F0HA 2Q8RE 4H44C 2VUMG 2K8BA 1E8YA 1EY0A 4A93G 3U4VA 4P72A 1G2SA 3NE5B 2RD0A 2VNUD 3FC4A 3FILA 1N63A 4RGOS 1FNVA 1XLNA 2MBOA 1CMXB 1ICWA 1MFWA 3DQVA 1MHWC 4IUMB 1GUTA 4ZKBB 2WP9B 1XD3B 4J8QA 2V3PA 1HTLD 5KIXA 3OMCA 3DWPA 3I57A 2FHTA 1UAPA 4BY1B 4REZA 3F2UA 3GZNB 4CDEC 3NWTA 1K8AC 4KTAA 2UUAQ 2AEHA 2FUG1 3V62A 3KK7A 4JBJA 2UYZB 3EUB2 4FA6A 2B2TC 1F9SA 3S16H 5KNCA 4A3GH 5LMNQ 3ALBA 4UPAA 2YTYA 3NHHA 1OQYA 2ZT9C 1K53A 1NI3A 2W3RA 5M5WB 4WAFA 3RI7C 3ZTCA 3HZXA 1NBWA 1F2RC 4IUUA 2OF1A 1JW9D 2X69A 2KWDA 4TKOB 5BR8L 2JX5A 1ZXHA 2BVCA 2CWPA 1P8LA 3PZ7A 5JEAH 3M3JA 3LYYA 3GTLH 4GOPA 2KACA 3AECB 4ZDVA 4RAUC 2HD5B 3DBRI 4X65Q 2A1AA 3BU2A 1MJEA 2JA6B 1W6JA 4YTMB 2A6EC 2N55A 1E7ZA 1NY4A 3QA8A 1V1PA 1L6VA 1JMLA 3NSWA 1MI0A 1ACCA 4PV1C 1P9DU 3IXSA 4PMBA 5K36H 4AQYL 1ILPA 3DM3A 1D6EC 4A9AA 2O2VA 2IY5B 2LXJA 2WKDA 3AH7A 3RZDB 1JWBD 3SDLC 1SB3C 1ZE3D 3VUWA 3HRZC 2GBNA 1TYGB 4QQBX 1K51A 4ZRJA 1ZDVA 5T1IA 5FLXc 4O2DA 1ZYRD 4DUYQ 3AULA 4UP7A 3PMFA 1WIAA 1HHVA 5CHVC 2PMVA 5LXHA 4WWOA 3UI3A 2WXLA 3OTOL 1P7FA 4APVA 4R8NA 4A3CG 4HTHA 3RZOB 1K8RB 3N32A 4R4CA 1E0ZA 4R4TA 5FR3A 2NBUA 1Y8NB 4GOPC 1CSQA 2KEEA 1O78A 5IE8A 2KX0A 2DJFC 2R92H 2E2JH 4BY1G 5E6OA 3WCQA 1JQ4A 1QILA 5BYSA 1A3UA 4BBSB 1E90A 4F7XA 1FXTB 1VQ8A 2GN5A 4JI0Q 2KHWB 2ZVNA 3ZVVA 1BBUA 4IG7B 1SNOA 3RT3B 1ISNA 5M5XB 3T16A 1QG7A 2K14A 5HGQA 2XEWA 1WD0A 3BK1A 1HJPA 3KYDD 1V81A 1UE6A 2H5XA 4R1JA 2DAFA 2W55A 2DGYA 4HKZE 1YHQA 1QQRA 4DHJD 1G6JA 5CR3A 1H9SB 1EEID 1QUQA 3X0WA 3S2HB 3W1BA 3MFGA 1DGJA 4HRSA 1ICFB 4N9PA 3URYA 4DV7L 1KDAA 1SSNA 3PV1A 4X64L 2J0KA 1I35A 2K5HA 4KHVA 1J7CA 3I8ZA 2JA7H 2LUMA 2PNHA 3QIJA 4DDID 5D14A 4LJPB 2PE9A 5DPWA 1XNRL 3STBC 3PLUA 1I4PA 1Y1WH 5FOBB 2JEBI 1CJEA 1KLVA 3HOUB 4Q0FA 4PZ7A 4B95A 4JGHB 2NTTA 4RKBA 4DV0Q 2F3IA 4EQNA 4FF1A 4TUUA 1LTTD 2UXBQ 5E6NA 2WXRA 4GLVB 3HUIA 1BCPF 3PO2G 1DONA 3DWAA 2G1EA 3U7ZA 1B3QA 5CV6A 3DXJC 1VZ8A 3A0JA 3MC0B 3BVMA 2VUMH 2NVTB 2PIAA 2D5GA 3Q8EA 4II2B 1HZBA 2MJ3A 1TXYA 1QVGA 3ZKJC 3A8JE 4FADA 3Q6BA 2N9XA 4POFA 4LNIA 1ESRA 3EGRA 2CKZB 3DMUA 5J1ZA 5HFYA 4FXCA 1D5XC 5NUCA 4GNXB 4K0KQ 1GUSA 2UUBL 1E8XA 1IGDA 2YLMA 3L17A 4ANVA 2GBRA 1E5WA 2K01A 2KZRA 4PK1A 2BYVE 4O1NA 1TY2A 1YNND 1VQPA 2KMCA 1L0VB 4KZCA 2BS4B 4QAYA 4L5RC 1WRDB 1BVSA 5EBCA 1E22A 3ND9A 1C4AA 2WU5B 3T1YL 4LF5L 2V0GA 1YNJC 4YWGG 1ONLA 4PYZA 3DBHB 4OX9L 2NTSA 3B08A 4XYQA 1WMHB 1IXRA 2L0CA 1EM7A 3TZDA 2AMCB 2MNAA 4W9IA 1HFNA 4S3SA 4IJHA 4GB9A 3HVDA 2WACA 1R9TB 3ITPA 4MM3A 2UUAL 5BO4B 2HIXA 1S5CD 3H94A 3PV0A 3J7A5 2N0SB 2MBBB 1WI5A 5M5WH 3TREA 1VCBA 1XJVA 2Z4HA 3BK2A 3BYTB 4WRDA 3M4OB 3GZNI 2WKCA 4RMAA 1EUVB 2JRHA 5G5HA 1V80A 4GMVA 1RIPA 1QE6A 1S4ZA 2A4ZA 1M1KC 2MGSA 2YVCA 4CQNA 1ZP0B 5BR8Q 4ULLA 1HH2P 3ZDTA 2L4NA 5I9PA 1FRDA 2K04A 1KRTA 2K6AA 3ZNZB 2Q8TA 4F8CB 4P74A 2PQEA 1ZPSA 5D7GA 1XPRA 3RN5A 4B6WA 3I4MG 1EIGA 2L76A 1XLQA 1E0BA 2JWZA 1FO4A 5IO9A 1EL0A 1CT1D 3FVQA 2IO1B 2ZW0A 1IL8A 4HIDA 2JN4A 4JK1C 2KANA 2JK8A 4C1NK 3CW2C 1H9JA 4JBKA 4D2KA 5MPOA 1WR6E 4HCNB 1E2VA 4AQYQ 1IBLQ 2IO3B 4MNOA 3PIP3 4WJNA 4JI1Q 2ZNVB 2O5IC 3AMZA 2Y5CA 3IG3A 1S5BD 4B08A 4DXAB 3TP7A 2OJWA 1KDBA 3CQZH 3CIRB 1M4VA 1PH7A 3HOVH 3I4MH 4K8IA 4L63B 4BKSA 3QAQA 1G91A 4C2MH 2E6XA 1A3TA 1E3PA 2L12A 3VVWB 1FJGQ 4HR7B 5IWAL 3AU4A 3HOYG 2LHDA 3MTSA 2E2JB 4GS3A 4LFCL 4BA2I 2R3ZA 4HPPA 4XXEA 3EN2A 3FKYA 1KIXA 1YOVB 4S17A 1PTOB 2CS4A 3G48A 3GOEA 2PE6B 1B4OA 1EUJA 3HVZA 1J7AA 1UWVA 5C3JB 3AE4B 2L11A 2IJ0A 3GTGB 2LXKA 4BBNC 5KHQA 3HOVG 4F87A 5LXIB 3TN2A 4OO1I 2JSOA 3EVQA 2KCCA 2RPQA 3M7NA 1NE3A 3MTNB 3NPPA 4LK1C 2PI2A 5KHOA 2ZJQA 1MHXA 4NPNA 2Y0SE 3C8YA 1X3QA 1CFMA 2L9HA 2ZXRA 3U9OA 2F1MA 3Q8FA 2L8JA 4USAA 4A3BB 1A8VA 3S1RH 2JA7B 3QR8A 2ENBA 3W9CB 3H9DA 4JIOU 3SR1A 2K39A 4X64Q 4CHTB 4BXXH 5M5YB 1K73C 2WQYB 1R4PB 1KFYB 2HD3A 3P4QB 3Q3OC 1II3A 1TWAH 4HEDA 1PMRA 2EJGC 3RNBC 3BVZA 1GC6A 3VYSA 4XE0A 3EFUA 5D94A 2KOLA 2E8GA 2HUGA 1WXQA 5AFWA 1N34Q 1JR0D 5TR5A 1PRTB 3P4PB 4QIWE 1S5DD 1WSPA 4HN7A 4POGA 2A74C 1PTOC 5GQOA 5IOCA 4DV5L 1MSGA 1Y56A 1ZEQX 2LXCA 2UXCQ 4MGIE 1SAPA 2V4IB 1WGYA 1C3TA 3A8KE 3NVYA 5FLXE 1JORA 5LMUL 1STEA 2DJGC 2I07B 2RDGA 2O4XA 4LFAQ 3VR5A 3R7RA 3I4OA 4IOAA 4GIVA 1YNXA 3H3VH 3J81i 1N32L 1SYBA 3EQLC 2GBMA 4OIKA 1DCZA 1HEZE 1LT4D 1RF2D 4F7ZA 3K5NA 4K0KL 3LNNA 5EKLA 1PFNA 4MGKE 1GPXA 1KC8C 3BDCA 1SE3A 1CHQD 1LGRA 3ZJUA 1MHHE 1BO0A 1SE8A 1ET9A 3MHZA 4O0AA 1N9WA 3UE0A 1YQBA 1EU3A 1F2ZA 2Y5BB 3HKZE 4LUOA 2X8XX 3FAHA 1JB3A 4EFOA 2M2LA 3T1YQ 1VQAA 4LF5Q 2QJLA 4JI4Q 4ITKA 1H8CA 1EY9A 1K28A 1XT9B 1SLJA 1A2UA 4QGUA 4QMGA 5JPMC 1E8ZA 1RL2A 4IUQA 1Q5WB 1RFKA 2WS3B 1CZWA 1H9SA 2EYFA 4OHJA 1PYWD 4ALPA 2KFJA 3I90A 4YIJA 3T3OA 5M9OA 2PLPA 4C4VA 1KXLA 1RRBA 2KN4A 1V9PA 2E76C 3BJUA 1HNWQ 1XF5L 4FLHA 5H92C 4EEWA 5FR6A 2CVRA 1EQRA 3QOLA 2ZJDA 4A75A 3K80C 4G0NB 3TRZA 4IWQA 2MO1A 1TWCH 5HGTA 2IYDB 3D6WA 1PZID 3D8GA 4UP9A 2G45B 1YN5A 3HRDD 3R2IA 2NBVB 2MH7A 3RMHA 1I6VC 2PQAB 1EYAA 2WXPA 1VQDA 2KQ7A 1UUPA 1WTOA 5FJ8H 5LL6X 4A3OA 4DHZE 1UGMA 1NAPA 1WGDA 2RA4A 1C48A 3E6ZX 2LFIA 1HUNA 2BTEA 2NVQB 3QC8B 1LTRD 1V5OA 3S1MB 3AEEB 1PFMA 1SRUA 2EMTA 2RCFA 2J0JA 2VZAA 4G50A 2JQRB 1IYFA 1FM0D 3S14B 4KHPL 1VRAB 1TWGB 1T3QA 5C0XH 2LVQA 1IBXA 5IKCM 3AEFB 2NVYH 2C9WB 2JQOA 3KLRA 4UP8A 1UELA 1V5TA 2VH1A 4Y7NH 2R7FA 1WJUA 1OFFA 1CI3M 4OW0A 1X3FA 3CD6A 3R7QA 2PZUA 4YWLA 2N1WA 5AUIA 4JI1L 3CQZB 1PGBA 2WX1A 1K83B 1PDQA 2J7ZA 1KJTA 2EKEC 3KQ4A 3QB3A 2HJ1A 3LB8C 4DR4Q 4G7OC 2A69D 4XT3B 3T9LA 3ZGZA 4FDBA 2RR9A 2RBMA 1P98A 2ACZB 2D10A 5JZEB 2B39A 1FGBD 2PPBC 2L32A 5H8YE 2CU1A 4XDDA 3PO3B 3DWQA 4GN3B 3V3XA 1B44D 1XCQL 4GKKL 3Q8CA 4KV2A 5CHWA 1BCPD 2IGDA 1M8AA 4IJLA 4LFCQ 1NYRA 2VL6A 1HTPA 1UH6A 1Q86C 3A9JA 4ILWA 1VQOA 1AZQA 1E2WA 2FCQA 5CHFA 4I65A 2IX1A 3CAMA 2JZPA 5C0XI 4NJ7A 5E6PA 1E9MA 2PQAA 1Y69U 5C4XG 1VQ5A 1VQ4A 2A5HA 2QA4A 2ASQA 3Q8AA 4ZUJA 4LF6L 3ABVB 1E7UA 2KO3A 2HTME 1D5MC 2AQ1B 4LJZC 4AOFA 5EPLA 3TZUA 4HKQA 3AN1A 3Q69A 3OWEB 4HJ9A 5C44B 4A3BH 3VYRA 4LF8L 2ZTDA 2K5NA 2D0OA 5D65A 4KJNA 4MEMA 5JXVA 2OXPA 4B3TL 2A68C 1TBEA 1KABA 2ZXOA 1Y8PB 2KFKB 2V4LA 1VQ6A 4NJ6A 4RF1A 1BR9A 4KY6A 1GB4A 5C0XJ 2KJXA 2R7ZG 3GQBA 5E3FA 2SNSA 1WTRA 3TP6A 3A8IE 2CQOA 2J7QB 3CF6E 1VS0A 1LQBA 2K50A 4FHJA 1GHKA 2JXMB 2B2WC 1Y8RC 2IZVB 1F9PA 4Q2JA 3KLSX 4G7ZC 1QKZA 5M3MH 2JYOA 2F0MA 3SR6A 2HTHA 5IT9L 1J8CA 2ALYB 2JEAI 2JA5B 4KN4C 2K1FA 3A9JB 2C60A 1KD1C 3M62B 3JAMi 1B50A 1STBA 2N4FA 4R4OA 3TQYA 3GTKB 1WX7A 2WDRB 1HZAA 3DBHI 5J17A 3AV8A 3IAYA 1E1TA 3DOWA 4DXGA 1PYBA 2K03A 5ELOA 5LMUQ 2K6DB 4XX5A 4DDGD 3S1NB 2EQSA 4DKAC 2H88B 1MI2A 4FO2A 2GVAA 3RN2A 2DZIA 2VY3A 2YV5A 2CU3A 2EYLA 5FLXL 4FHKA 3Q24A 3K5LA 4KKIA 1JWAD 3PGEA 4LNNA 5KNBA 5IT9E 5A2QE 1R4QB 1Q82C 1Z9FA 1ESFA 2LRUA 1HE8A 1E2ZA 3AE9B 5IYBG 2BB5A 4LNOA 2O6VD 2R92G 4HPLB 4NP5A 3TS2A 3V6CB 1WGGA 3KYCD 5DAUA 2PZWA 4ZAIA 5C6AA 2BA1A 2B2WA 4LF7Q 3M95A 1QB5D 3UIPB 1X65A 1PA6A 4IOCA 1EFWA 3ZUNA 4A3PA 3PO2B 4R9WA 2F4IA 2Z4IA 5D2MB 4II3B 4TQ0A 4FULA 2K9XA 4ZYSA 3K0XA 4KD3A 5KYIA 2F0SA 2UWQA 3CCVA 5IYBH 2MP2B 1ZGUB 3Q3MC 2INDC 3QJZA 2OCEA 4GDKA 3EFXD 1CKNB 2MHJA 5CV5A 4UDUC 3W3AA 1VQHA 4BY7H 3SHQA 1U4MA 2LFNA 4DV4L 5EE3A 3VTVA 3PS6A 3DWGC 2IBIB 1DD2A 1BBXC 2CJNA 3MAQA 3APFA 1N36Q 3ZNID 1HTQA 2CW0D 1V1PB 2FJ2A 1JRPA 5IY0A 1V97A 3CPFA 3FPPA 4CJ1B 1PHJA 1DOYA 1BCPB 3N52A 3IHPC 4DV3L 4P16A 1EY4A 4XWWA 5GXGB 3V96A 4ZYNA 1JE4A 1U4RA 1HNXQ 4OELB 3GDEA 5IYDH 2LMCA 1C4CA 3EA6A 4JPSA 1GJXA 2UXDL 1NVID 3DHHC 3OPOA 4P6VF 2LGIA 4X3SA 1Q3LA 1YJ9A 1G2TA 2KDFB 3NTIA 4J6HA 3H8HA 1J8IA 1ET6A 3QG1A 3D6CA 4PNYA 3P2BA 3ZYYX 4P2CB 4IALA 3MXGA 1SIFA 1SE2A 1GO3E 3OHXC 4KHZA 5ELBA 3IRBA 4DV6Q 3GTPH 3AE3B 4GGQA 3PPAA 4WJOA 5DPRA 2WHIA 3IT4B 4DR1L 2L5TA 2EPBA 1IL2A 3PZDA 4AH6A 3HKZB 1J5EQ 3AU7A 4IFDJ 2B2UA 2D3BA 1Q0WB 3RMKC 3CCEA 1D1KA 1QOHA 5IP7G 3HOZB 3DVGX 2DHZA 2DZMA 1XNQL 1T0QC 4C00A 3VTWA 1GC7A 1VDVA 1C0AA 4L5QA 4E6IA 4OXPA 3P4RB 2K28A 2KVMA 2OTJA 2O6VA 3N1XC 4LUZA 1IBML 1Y8OB 3VR4A 1WCMG 1FFUA 1XPOA 1L5PA 4JI7Q 2EXZA 5LHY1 2BB6A 1LLRD 1X55A 3S15B 2YEPF 3Q3FA 1CTMA 4ZKCB 5I4DA 4A3DH 1P1AA 2L83A 2CW0C 2P5ZX 1I7HA 3KDFB 4LF6Q 3DCGA 4PS8A 4ZRPA 3H1UA 3HOXH 3RD4A 5C44H 5KEEA 1V1OA 2E2IB 3X3NA 5IGCA 1G291 1IUEA 5CV8A 1OQRA 2WYQA 4X66L 3LWUA 4DF7A 2N9PC 3UDGA 4ARIA 2IW3A 2L7RA 4UAIA 4DAYB 2KOXA 2XRQD 3M63B 1WXAA 1EY6A 4LF8Q 5CX3A 1Z2MA 5GMVA 2KAJA 1YHBA 3A1QA 1Y14B 2B29A 4YT0B 5CV4A 4A3JG 2QDLA 2GOWA 2HCCA 5ISRA 2ZM6L 5KYLA 2DAJA 1GM5A 2QW7A 1VF5C 3K7UC 4LFBL 3W5VB 4M0WA 3WWVA 3OIQA 2NPTB 1AW7A 4P71A 1EYCA 1HR0Q 5DNFA 3RZWC 1JQYD 1SIJA 2DNEA 1A5RA 3KVFB 1EEFD 2WDTB 4YSZB 1CA6A 2MO0A 2LGYA 4JI2Q 3JW0X 1E7PB 5AZHA 2LSSA 4C3JB 1Q1BA 3WOFA 2LXAA 2IGHA 1AN8A 4HSPA 4JV5L 4KK7A 3K6OA 2HDEA 3KWVA 4MSQB 2AUKA 1VQBA 3TBIB 1VCIA 1WR1A 2KXJA 3VR9B 4K5XA 2IHEA 3NTHA 3F2DA 2KHSA 4IFDH 3OW7A 2F0QA 5IGEA 4EQ5A 5L83A 4ME5A 3BDLA 4AJWA 4GNXA 4M00A 2BE5C 2Q2IA 4BBSG 3H0GG 4JW0A 4OWXB 4M1UB 1F2MA 2KX3A 3R66C 5LL6S 4DK6C 2D2CC 4ABNA 3CCQA 3EC8A 4EQOA 1C9FA 1RJTA 2D11A 3ERSX 2R93H 5DCNA 3VR2A 2Y0SB 2K5WA 2Z6KC 1PGXA 3KF8A 2WXNA 2J4XA 1XTCD 2TMPA 2B63G 2F4VL 1IGCA 3C19A 1D2BA 2PKOA 4N6EB 2M1MA 1GAQB 2QCPX 4NZLB 3CRLC 4HXDA 4BA1I 1STGA 4I6LB 1WTHA 1FRRA 2Q2TA 1SF0A 1JWMD 1JOQA 2PEAA 4LF7L 2KWUB 2JVCA 2NZ1D 5GADC 4M8MA 4A3GB 2RSOA 3HKSA 1TIID 3AMUA 5C4XB 2FBWB 5A35A 1XO3A 3RNAC 4CKBA 2R93G 2WXHA 3HOUG 2GBKA 4KN7C 4QY7A 4W9GA 4A8XC 2XGTA 3TMEA 5EE9A 1WJ4A 4EKUA 4BZAA 1KLGD 2DZKA 1KRSA 5C3EG 4C3IH 2C7NB 2FXQA 3NXWA 4X65L 2KWCA 4YHHQ 3D4RA 4CKEA 3L7ZC 1EYGA 1VZ6A 1LTAD 3K9OB 2AKWB 4H02A 4B9XA 4KDLB 4PQXA 3F2BA 1JJ2A 4WQMA 3E9HA 3FKIG 3GV6A 2B2VC 2AL6A 4FJVB 5BYRA 1EWCA 3CHBD 3GB1A 4FN2A 1VMCA 4W9HA 2F0LA 1WI0A 3OMGA 4FF2A 4ME3A 4NXNL 2K7VA 3UGBB 1WMHA 3PLVA 1J9OA 3AEVA 1U5KA 1WTVA 4DV3Q 1I6HH 1V2YA 5E7NA 2N9KA 1HNXL 5FJ8G 3VUYA 2C5CA 3TIXA 4RGMA 3W1SA 2KLCA 2GB1A 2WXGA 1NUCA 1X3GA 4FF3A 1P16A 3AE5B 4YTPB 4A93H 3GTMB 4JC0A 1OGWA 2F52A 1FVIA 2WGSA 2K5PA 3L08A 3HOZH 1CZGA 2F3WA 4MZ9A 2NVUI 4DR1Q 1VQ7A 1OXTA 1BKBA 2LASA 3F1ZA 1JWSD 3T8MA 5IA7A 3CCUA 3ZXRA 1L0XB 2XSCA 2G4SA 2D3CA 4OL7A 3RN9C 4LF9Q 4EQPA 1F2RI 3AEGB 3GO5A 4M8NA 1QOGA 1WCMH 2FFKB 2D07B 2J53A 1U9RA 1AWDA 1U4LA 4IPHA 3AM9A 3P42A 3UQAA 4A3EG 1IBMQ 2JXXA 3PQIA 3GTLB 3HOXB 1HNZQ 3OJ3A 4PZ6A 3J80c 5JH5C 4GDKB 3AE2B 3PHWB 4L8JA 2WX0A 2EJFC 4FNFA 3ENEA 4DV7Q 3NENA 3PIOA 1Y1WG 3C2PA 1EF1A 1YJIA 2VZKB 4X66Q 4A3FB 2C5LC 3J80L 3KF6A 2E5LL 2L55A 3S17H 1VQGA 4NAWA 5J3BA 4P7IA 3P1MA 3KYHC 3BWUD 3U9SA 4N9TA 1R4MB 2O2VB 3S1MH 1NBFC 3FKIB 5HHDG 2QMTA 4ACFA 4P1CC 1TWGH 3J7ZC 2D62A 2BKRB 3U8ZA 2X38A 3Q8BA 1FPYA 1HCZA 4FVMA 1LTLA 5C3XA 5M3MG 1HR0L 3ICEA 4X62L 1UD7A 3E5SA 2QF7A 1PH4A 2UXBL 2IO2B 2F0PA 1VD2A 4JQWC 1GJZA 4A3CH 4IWPA 2BKFA 1K83H 4ZOHC 1WJNA 3M4PA 3GTJB 1V49A 2LVOA 1AZPA 3I4NG 1T5XD 1HRJA 4DU9A 3VR8B 1EOVA 5CV7A 1WH3A 1C77A 2FCSA 2MHVA 4WQOB 3ZXVA 2Z6BA 5C0XG 3A4SC 2PYKA 4HMJA 1HQRD 1JWUD 4V0BA 1JCKB 2BH8A 4DUZQ 2G4DB 2KDMA 1FCCC 3TMPB 3NVVA 3CMMB 2UUBQ 4KMUC 2CKHB 1GUOA 3GTQH 4IURA 2O2LD 4IKGA 3D3RA 1IYJB 5EQ0A 3CCJA 4DR7Q 5KRUA 4H0LC 3WALA 3NY5A 4MH0E 2C7MB 3BZKA 1XMQL 2KK8A 1LV9A 4XZ4A 1LM0A 4X3KA 2BBCA 4WJWA 5IP9G 4OX9Q 5DPSA 1L2NA 1ZUD2 3ZJYC 4QUCA 5BN3A 2FMMA 2JA8G 3KW5B 1PTOF 3M4YA 2F4VQ 4MTNA 3ZRCA 4G7HC 4AUQC 3NOBA 3NG0A 3CF5A 2D9UA 5BMHA 3P4SB 4GXBA 2E2HB 4C3HH 3PTFC 2IT1A 4DAYA 1FEHA 4NNJB 2WLBA 4IM3A 3U30A 3J9CA 3APCA 4S0RA 3I9V1 3BZCA 4HIMA 5EAYA 1JC7A 2OOBB 1WM2A 5I2YA 3A1QB 3NZ3A 4DAMA 4YWKA 2KUMA 4W9DA 3K8AA 4FBJB 3W2DA 3MA2B 1YJJA 2BWES 3DBLI 4C3IB 2LJ5A 3ETRA 4KY7A 3H09A 4F88A 1ZOYB 3DVNV 4PG3A 4MJSB 1YJNA 2NPTA 4RGNA 4HCPB 4OVVA 3VRAB 1SMYD 3MJ5A 4DGZA 3A56A 3KJPA 2IY1B 4MH8A 1SJED 2F0KA 1O80A 2V3SA 4ZRZA 4JWSC 4K8JA 4GDLB 2NZOA 3G7LA 2KD0A 1WFQA 2N78A 3LX0A 4IUTA 4B9KA 2AQ2B 1QJOA 2OQ0A 4JLCA 1VQKA 3BZDB 2JA5H 1E8WA 2RSUA 1PTOD 4OO1G 3SXHA 2NVXB 4JYAQ 3V05A 4BY7G 3IT6B 3VA5A 2BCOA 1YD8U 1QVCA 3NS1A 3NZUA 2KQ3A 5E4WC 3ULPA 1IBLL 4B3SL 1KLUD 2EDGA 1LTBD 5G55A 1A15A 4C4VB 3A4RA 2KJ6A 2R7DA 4IC7B 4A93B 5IYCH 1BCPC 4XGAB 2KTRB 1QUQB 1YX6B 4CO7A 1VZ7A 1SJHD 4EVOA 5IT9c 5IWAQ 5M3FG 1PVOA 4RM9A 2K05A 4TVAB 3I3CA 3KF8B 3PUXA 5IP7H 1SN8A 3CCSA 1UE7A 4C2MB 2XK5A 1HZCA 1VQCA 3S1QB 5DEHA 1I4QA 1NMGA 1S72A 1AEXA 1D7QA 5IP4D 1SMXA 3KUZA 4MELA 1NNXA 4US8A 2IHFA 2JP1A 2KEDA 3UE1A 2YU9H 4JOIC 1WTXA 2X6LA 2UUCL 1HA5A 5CBAE 4DQOC 5AJ3Q 2WNMA 1V43A 4LWCA 1K52A 1MSHA 4EX5A 3ONSA 3BINA 5LLIA 1PH1A 3PF5A 5CBEE 2D0PA 1QZHA 1PRTD 5E6JA 5EE0A 4C1NI 4OONA 3E3XA 3Q23A 3IAM1 2I2YA 1TS5A 4UHVA 3L16A 5G2NA 5JAVA 5BMIA 3K5OA 5JPNC 4C3IG 5J22A 2INPE 4LK0M 2JRIB 3K7AH 5JJLA 1VQNA 2PW5A 1N33Q 2N3SA 3AI5A 2MEKA 1U0LA 1JJGA 3KLWA 2F3VA 4BVUC 1NDDA 4N8FA 4A3GG 2FIFA 1NYQA 1S1QB 1H95A 1DXMA 1QNKA 3VRBB 4U68A 5JVH3 1X3EA 2J0TD 5M5YH 3H7PB 3DBRB 1I4HA 2NCNA 3U52E 2K25A 3E56A 4WJQA 1IZ6A 3EJIA 1Q10A 4KSKC 1V1QA 1HZ9A 4B3MQ 4M8AA 1RTNA 3PRMB 4LF4Q 3I4MB 1BUVT 4YCWA 4W9LA 2Z1CA 1UBQA 2EYMA 1FFVA 1V86A 3SEBA 1N61A 4A3JH 5DLQE 3AYHB 3A9KB 1WM3A 2K5DA 2UXCL 2XRSD 1IW7C 2GA4B 1CHPD 4HJ5A 3SD5A 4GN5A 5IP9H 1B9MA 4IM0A 3QWZB 3CP0A 4LFAL 2F0FA 4PMCA 3PO3G 5HY6A 4BBRB 3GTQB 2GI9A 5M3FB 3UF8A 3AFQA 3V60A 1A2TA 3K81C 5CC4A 3RPFC 1F2YA 1DZ1A 1ZKHA 4NY0A 4DUZL 3GTGH 2GBJA 3IAS1 1ROEA 3BYYB 4WURA 1U4PA 2RHSB 3H7SA 3B6YA 1PV4A 3ER0A 4K6DA 2LD9A 3A7LA 1LFDA 1DGSA 2A6HC 5C1ZA 2I38A 1WXMA 4DK1A 4RA8A 4JI8L 1B9NA 4JI4L 4FF4A 3ZQ4A 2QGQA 2OT2A 4AWJA 5D3IB 3DPDA 2B2YC 1EFID 2PZTA 1WZ3A 2ZCCA 4JWUC 1I3QB 2OQKA 3F8TA 2KMAA 2WXKA 4HROA 2KCNA 5C23A 3LGJA 2BOSA 4C3HB 4DN4M 3CMAA 3MVVA 1HNWL 1K50A 3MEHA 5FLMG 3Q22A 4HCSA 2XN9C 1UE1A 2KWVB 4JI5Q 2J52A 1M94A 5IYDG 2ATWA 2A68D 1QOAA 1AE2A 1JROA 1FGUA 1J6QA 1KHIA 1GUWA 2R7ZB 5HURA 2A19A 3GTOB 4B3RL 4UY8C 1Z47A 1NMFA 2JYTA 2MP2A 2LI5A 3NS8A 3N3KB 1CKNA 1EWIA 3AQQA 2KA7A 1RFAA 1OQQA 2NUCA 4B0EA 1GG3A 2ZJPA 2K1BA 2YTVA 2VW9A 3HFZB 5T1GA 1PH3A 1QOBA 3RZFA 4OWWB 3R2TA 3Q6SA 2CFMA 3MEFA 4C3JH 3VYTA 1SFOB 2MX2A 1L4DB 1Q81C 4A3KH 1JOKA 3X3MA 3QQ8B 1VJKA 1EY8A 2Z0SA 3JSVB 2B2YA 3NWSA 2QHOA 2A6HD 2LJIA 2NN6G 2SAKA 4JYAL 3N30A 1QNUA 4IZ8A 4CDDC 2DX5B 3RLOA 3OYYA 4P75A 1H9MA 2IPKD 2EYHA 1TWHH 1WE7A 4R8IA 4EUTA 2EY6A 4KIKB 5LNK1 2FINB 3QX1A 4DR4L 2YTXA 3OOCA 2XTIA 4Y7NB 1I94Q 3AE8B 3MP9A 3ULJA 5F2DA 1VLBA 1KAWA 2IDYA 2I5HA 2AHOB 2QEXA 3I4NB 4NQKE 4KDIC 3TP8A 3S1QH 3D4DA 2IO0B 1SMYC 4WWPA 2BYEA 5HI1A 2K52A 3ZDMC 1ENAA 2YU9B 3PHXB 3G6JB 3JAMc 3BG3A 2EMSA 2A6ED 2VQFL 2HJ8A 4K5VA 4YCVA 1UEAB 4AJYB 2NB0A 1ZYRC 2KJHB 2L0TA 4J3OD 3WAOA 1WD1A 1FNWA 2RCNA 4CJ0B 5AEKB 1Y1VB 4C3HG 3SK6A 3L54A 5EE1A 2G9HD 4BS9A 3P7JA 1RM6C 1FMAD 2SEBD 3CCLA 3SGIA 5EPKA 4NJCA 4ZLTF 1VQEA 3HOWB 2MJDA 4J6IA 2HIVA 4ZHOA 4P1BC 3H91A 1KNEA 4B9WA 1TT2A 1T5EA 4R3DA 2JA8B 3GE8C 2PNRC 3K7AB 4ZCKA 4FXDA 1L6UA 3JSVA 5KGUA 1LTID 2FE8A 2CR5A 1WE6A 4B3TQ 1JB7A 2LZ6A 1C4PA 2W82A 2NZHA 3WDNA 2H4OA 3PIO3 3DM1A 5HG2A 3P63A 2WXOA 4DNIA 1WVLA 3ZNHB 4ZRIA 1YNJD 3S14H 3VDZA 1TQOA 4L5TA 1L0WA 5LMNW 1C8CA 1LACA 3DBLB 1IP9A 2NVYB 3DVGY 1D5ZC 2KLGA 1K8MA 2HT1A 1RTOA 1J19A 2INNE 3RYTA 4IW0A 4E74A 1N8RC 1LT3D 1GHJA 3VXWA 3WANA 5J2RA 3U4ZA 2D3GA 1MGSA 4H13C 3FHWA 3NUCA 1S3OA 4B3ML 1N5WA 2K75A 4OVZA 2JA6G 2KFKA 5E1FA 1CUKA 3NJTA 1F2LA 1L7YA 1AYFA 1PUTA 3TBLD 2WXQA 5JVG3 1C1YB 1XLOA 4WJ4A 3PUZA 4X3TA 1TKYA 2LUEA 1EWHA 3KDFA 3E0EA 5ELCA 5GAHC 2HDLA 4TKNA 5C4HA 3NEMA 2JA7G 4OVUA 4KY5A 5H1SE 3PZ8A 4CKCA 5IGGA 1XX8A 3CC2A 1YVCA 1PDXA 3K58A 3OAWA 4RG1A 1WTWA 3LDZE 2JJQA 1KRHA 2RDHA 1EZ8A 1X3PA 4A4IA 2BWFA 5CTRC 3ZLZA 3WOEA 1HUMA 1SYGA 1IKLA 2EE1A 2PI2E 3BVGA 4OEMB 2JWUA 2MSED 2RPVA 1WCMB 2WDQB 3N9YC 3DHGC 1SYEA 1D1IA 1LO5D 5DM73 1EQVA 4MTKA 4JI8Q 3Q14C 4ODGA 5JOBA 4ZUIA 3H3VI 1D8LA 1V6EA 4HJAA 2MBEA 3HOWG 1TKEA 1EWYC 5IGBA 1IBKL 1TS2A 3E9SA 2E2DC 1IBXB 4LMQD 3SDZA 4IUVA 2RDBC 4C7YA 4MSMB 4WH4A 1DOIA 4ZQ3A 1MPEA 1I4RA 3RR5A 1RHPA 1EY7A 4HEA1 1B1ZA 2CHBD 4XC2A 2EXDA 3ULLA 1U4AA 4JI5L 3PO2H 2WXJA 4BFRA 2BW2A 1EU4A 1RDPD 3HS0C 2KCTA 2V1CC 4ANXA 2BH2A 2EKIA 3H3VC 3PCOB 1L1OB 3U58A 1QVFA 3VHTC 4W9KA 1PZJD 2DZJA 1VQMA 4HK2A 1IYUA 1SROA 1XCTL 2MLBA 3U4EG 2B3GA 4CBVA 1VQLA 3EFCA 1N36L 3ND8A 3A9KA 4RCOA 3Q0AA 4A3KB 3UDIA 3NBHA 3GTKH 1YZ6A 5ELEA 4C3JG 1HZ5A 1WX9A 3QHTA 3UIOB 2RGFA 1B8AA 3CXCA 2NN6H 2M00A 1NI2A 3RNUA 4BXXG 4A3MB 2UXDQ 3RNGC 2N8NA 1E10A 4GN1A 1KAAA 3I72A 5EKKA 2N88A 3T1HL 1KQSA 4KGSA 2JA5G 4ZHPA 3H0GB 3ERQA 4RHRA 2IWHA 4A3LG 1RAXA 1K0SA 4DV6L 2MCNB 1K9MC 1XEEA 3ZNGC 4TRDA 1ASZA 1I94L 2Q5WD 1UGJA 4DV1L 3L3OC 5EBDA 4JCVE 2LEKA 1IKMA 2KBNA 3FPUB 2ON8A 2G3QB 1X6OA 4G11A 1VQIA 3DLLA 1YJWA 4BBRG 1XNQQ 2AWTA 3SU8X 3S9WA 1LABA 3NP8A 2VH2A 3ZJVA 5IODA 5AZFA 4FJZA 2LHEA 3S16B 2QSDA 1MG4A 4LTUA 1SSOA 2HDMA 5JEAJ 3NVWA 2WAQE 3AXCA 1EQTA 3NQIA 1BT0A 3A33B 2F0VA 3PO0A 2XWJB 5BMGA 4KJOA 3Q3NC 1X54A 3F2CA 3EBEA 1P7EA 2Z9HA 2JA8H 4BY7B 1B53A 2F0JA 2WB1B 1KL9A 3MXNA 1WYDA 2F0IA 4LUVA 3I56A 4MGYE 3VH3B 2XVSA 1A62A 3AB9A 1VDZA 4DR3Q 1J0GA 1N5XA 3T3NA 1NCVA 2A73B 3RNFC 1MD2D 3CCMA 3M7GA 1YIWA 2K32A 2RKSA 2JA6H 1YEZA 1HQMC 4G4KA 1T0RC 2D5DA 3DEPA 4NXML 4W9JA 3IBEA 2RMMA 3H6MA 3ECIA 3N1ZC 4BKTA 4KX6B 2ZM6Q 1ILQA 4IN3A 1AFPA 1Q7YC 2MP1A 1A63A 3TSSA 1K8GA 4L1BA 2NVXH 4KKUA 1TTNA 2GVBA 3SE0A 1WX8A 5JJIA 3NHEB 4C7ZA 2PVGC 1ENFA 3MFYA 2ID0A 1S5ED 3UI2A 2AWNA 3RZDH 4WJ3M 1JALA 2DY7A 3A5UA 1R4NB 4A3MG 4IFDG 1J7BA 3GTPB 4WJPA 4ANUA 1V9JA 4NKLA 3EECA 2IL8A 2Z0DB 1K8OA 2N7JA 3KH0A 3KUCB 3L13A 4HDQA 4HPMB 4ICUA 3U7DA 2JF5A 3L2PA 5EDSA 3I4LA 2ZTCA 4LNKA 1HR0W 2M17A 3HG9A 2OTLA 3TL5A 3S2DB 4BKGA 1IHZA 2SOBA 2BT6A 4TMAB 3PUVA 1SE4A 3RZOH 3G4SA 3PF4A 1WFYA 2WV6D 2FMCA 4GZYC 2I5MX 1HFGA 3SK5A 5LMNL 1AH9A 2CHZA 3QOJA 2CH4W 1OTCA 2DNFA 1BOSA 4XDXA 1F1HA 1PQSA 2CHWA 1CA5A 1MBYA 1WRIA 1W3SA 1YIJA 5KNDA 4DNTB 3K9PB 3O13A 5IAAC 4JBMA 3D31A 2E2IH 4DR2L 2WFWA 3HOXG 4ANWA 1B9RA 2KDIA 4NQLB 4E71A 3IVFA 1LTGD 4WWMA 2K3UA 4KLKA 1SXTA 4DK3C 1QZEA 2LGSA 1JRUA 3T53B 4N9F4 4A55A 3CPWA 2NN6I 2WINB 3I73A 2MJ8A 4FXKC 1IBKQ 1HXYD 3WAMA 2I1JA 4A3FG 2KN5A 1LUZA 1CM9A 2A69C 2I0QA 3A55A 4GU2A 5C44G 2EYOA 2MFIA 1DJRD 2MRPA 3AEAB 4EGVA 2K0PA 5JJZA 3NELA 1C76A 3GV3A 2ONQA 2PJHA 3PRPB 3ZRFA 1TY0A 1TZ1A 1PRTF 3VR3A 5C4XH 1WOCA 2AWOA 4RWSC 2KDEB 4MJSA 4YHHL 3I91A 1A3VA 5J39A 4R4QA 4DR6Q 1SDFA 5BYQA 4M01A 1IYVA 2C35B 4DUYL 2BPSA 2I46A 2KCMA 2BS2B 2SNMA 4A3JB 1SNMA 4AYBB 1X1MA 4WORA 1HPCA 4WFN3 3OTOQ 2MA9B 4K7WA 2UU9Q 1SNQA 2R92B 1EIHA 1TKWB 2NVTH 2VUMB 1DOMA 3RNCC 2GRIA 4K2LA 1PZKD 3J7YW 1Q12A 4I6NB 3MC8A 3TEYA 4BBRH 1SGHA 5I9OA 3KJOA 1LXDA 4A3IG 2HE7A 2W3SA 1XQQA 2IY0B 3VQIA 4LCDE 3OJ4B 5M5XH 3NBIA 1G6PA 1I6HB 2B76B 3AEBB 1L2FA 4W9CA 2BYTA 4ARCA 1BNZA 1L0YB 1RKNA 3LWEA 4N8X1 1E6EB 3APDA 3GTMH 5FO7B 3L0OA 2OEOA 3ZJTA 2DNCA 2B8FA 1PFBA 5JJKA 2MBQA 2N7EA 1I3QH 2JZZA 1S3SG 3W5UB 5C4JH 4LF9L 3D32A 5BN4A 3VYUA 3BDOA 3J81c 1R9TH 1VR9A 4GDLA 3QK0A 4F1SA 4DK0A 1GKHA 2B2UC 1W6KA 1UEBA 2HCIA 3HOUH 4K2KA 5L37A 1AARA 2Q2HA 2EZVA 1HNZL 3C0RB 1PRTC 3M4OH 3CSTA 3VR6A 3L10B 3MHSD 1FXIA 3RD2A 2PMZE 2DENB 3TEZA 2L3ZA 4CGYB 3OLMD 3T13A 1WJJA 4K14A 5IIFA 4DV0L 4EZJA 5CGKA 5FK9C 2M0XA 2RSNA 3GS2A 1UWXA 4DPGA 1PYSB 4CJ2C 1WF9A 2KNBA 1RCVD 2MW5A 2F0WA 4J1MA 1V8CA 2RQXA 2E5LQ 2KT7A 2L05A 4L23A 4ZRKA 4JI3Q 1I42A 2EY2A 1X9NA 1XMOQ 4YCUA 3I63C 2NYZD 4YL8A 3HKZG 2F03A 1L4ZB 3IFWB 1PH9A 1SFOH 4OZCA 3D0FA 3PT2B 4RF0A 4LNFA 1GUAB 1F0ZA 1H9KA 2K6QA 4IO9A 3GD7A 5C3EB 2LY7A 4YY3L 1I4GA 1X56A 2IX3A 4DV2L 2MBHA 2PMZB 3J81E 1C9OA 3P1HA 2OEDA 1JICA 3JC66 1BF4A 4GOPB 4MACA 3FKIH 3MJWA 5JEAG 4RKLA 2CQAA 3HM3A 1QF6A 4KGTA 4X62Q 2CCZA 3ZTDA 4V190 4R4IA 2BF8B 4AQ7A 2QILA 4LLGM 4IWOA 2WAQB 2DY8A 3B2FA 3S2DH 1ENCA 1K3RA 4A76A 2FCNA 2KDBA 3KLSA 5I2XA 2L0FA 1PFSA 1WYWB 1ZXIA 1STYA 1FIQA 3HOVB 2EVBA 5C4ZA 4A90A 4DHZB 3GTJH 2F0NA 4IQZA 3CCRA 3HEJA 3IKJA 1FD6A 2KENA 2HQEA 3HOYH 2VB3X 3A74A 1JMCA 1TZOA 2R61A 4KGRA 3V6EB 2MQHA 1UF0A 2EOTA 1IPGA 1V8QA 3HGBA 3PRZA 1STNA 4KKSA 4NAMA 1TGZB 4DR7L 4HJ8A 1TWFB 3IFDA 2VXWA 1EY5A 4A3BG 1G8ZD 1XMQQ 2R2OA 3TP5A 2KYWA 1YMHE 2K5QA 3IFTA 4HIKA 2V1YA 2ZW1A 1MJDA 2G9DA 4XT1B 2G5DA 4HCEA 1WJ6A 4OZAA 5T8IA 3RUIB 2AL3A 4NMZA 1I50B 1QOFA 3NK9A 4DR2Q 3SK8A 4A3FH 3EROA 1T0SC 2FIDA 2F0TA 2I5LX 3S17B 2NBWB 2XWBB 4IOIE 2XIWA 2BYFA 4GLSC 4OWTB 3QWNA 3B0AA 4W9FA 3SHLA 2J42A 3ZIMA 4W9EA 4A3DG 3STBD 4RH6A 1D4BA 4HJKA 1ZDXA 4F8MA 3AB5A 4GLXA 2CJOA 1ML0D 1K3BC 1TS4A 1B7YB 1C78A 5DM63 1Q8KA 2KHJA 3KUPA 1STHA 3DUZA 3ZW3A 2BE5D 2VS1A 2V3NA 4MT5A 3W1YA 1SYFA 4LJOB 1E24A 3RNEC 2LMCB 1GUGA 4MGZE 4C80A 2WIIB 1PFDA 4OO1H 3C46A 2GLSA 1N6ZA 3BY4B 5GROA 2JT4B 4GLAC 4KZ0A 2XNAC 4DR6L 3HP3A 4LDTB 1MKHA 1WGRA 1MG8A 3DHQA 2ICIA 1GD7A 3QIAA 3CMEA 3M9BA 3TJPA 2KECA 1O7IA 4TSSA 2E75C 1FJGL 5FO9B 1IW7D 1PTOH 3FEWX 1LM8B 4ICVA 4K1RB 4B3SQ 2UU9L 4RHSA 1C79A 3FRPB 4DAVA 5CORA 3ML9A 1YN4A 4J15A 3H15A 3CWIA 1PH2A 4JL9A 3Q3JA 1RLFA 1FNUA 3R3OA 1QZGA 5JHBA 1KDCA 4LAAA 1OEYJ 1QCBD 4DAPA 1FR3A 1PGAA 1A6XA 1SYCA 4YSXB 4GKJL 4K7SA 5CYUA 2E3TA 1DM0B 2RF4A 5ELFA 1B70B 2PO4A 4DR5L 3B1LX 3I3TB 2NMQA 1TT5B 3MXUA 2JYEA 1CK1A 2JU6X 4DFAA 3S1RB 3WA0A 2DUDA 4BOZB 4URKA 2E2HH 2Y0SG 2L00B 2UUCQ 3KWLA 2F0DA 1F9RA 2K22A 3W5OA 5AJ3L 5I6YA 2BQQA 1WTQA 1TWAB 2BDOA 2ZXPA
chains in the Genus database with same CATH topology
4FYDA 1CQVA 4YXDB 1Q8IA 2C9OA 1LTSD 3AE1B 1HZ6A 1SBBB 4XQQA 2W54A 1WYGA 4HAEA 5EPJA 2JXTA 2L1BA 1Z6HA 4MN3A 1Q1EA 3J7AF 4MM3B 2BDNA 1DYQA 2VB2X 2QIEB 4IFDI 2IGGA 3OIPA 3K0YA 1YNTE 3TEWA 2DN8A 2WXMA 2BA0A 3J7AV 4HSVA 2Y5PA 4XWTA 2AUJD 1KTKA 4TQ1A 2QKIC 3NQTA 4N59A 4OGQC 3ONAB 2EY5A 3PUWA 2B8GA 2L1AA 1NR4A 1HA6A 4RNAA 2KMMA 3P75A 4DXFA 2DYOA 4A3EB 2E74C 1BDOA 3BIID 4HMIA 2DLBA 3HOYB 4OIJA 1A70A 2Z8LA 2KQ4X 1KNAA 2JSVX 1YNNC 2L52A 2M0AA 2MJEA 1B2TA 3K57A 4U673 4O42A 3M3YB 1WGKA 3RFZB 3AEDB 1YQ3B 1PLFA 1TWCB 2LKVA 1F77A 1FXAA 1QT9A 1AP0A 5CV9A 1LT5D 2BS3B 3TEXA 4XTCS 2MPMA 5IGDA 3T51B 1VMPA 5ELDA 4YTNB 2DBYA 3SFEB 2EY1A 1OXXK 2PW9A 1DOLA 5EKIA 1R7SA 4PMWA 1O7LA 4QB4A 3BS1A 3QO2A 3LXFA 1Y1WB 1B3AA 1OXSC 2AX5A 4I7ZC 3MXPA 1EYDA 5K36G 2F0GA 1SYDA 2SDFA 5EGTA 3JAML 2F0EA 1BQQT 3J80E 2TSSA 5EJWA 1CQFA 2RDFA 2Q8IB 3K59A 1RWSA 1RYJA 4NDXA 5M3MB 4IUPA 1RODA 3OWFA 3QJYA 3A7AB 1EZ6A 1NEKB 3C1EA 5D3DA 1TU2B 4XYOA 2EYJA 3FILB 4L6TB 2M19A 1ZKOA 4KKTA 2B63B 1SEBD 1WTPA 1TR5A 2QDBA 4QUFA 2R6GA 2EJMA 1ZXTA 5COYA 2M56B 3D4WA 1QLBB 1GUNA 5AUKA 3AE7B 4C56C 1TKGA 4FXGC 2PTLA 3MZ5A 4QCLA 2VZKD 3KBXA 3FMCA 3IL8A 4DA2A 2RVLA 1O7ZA 2N9LA 2NWGA 1JOOA 1XYIA 3KBGA 4NAWB 1O7YA 2MUYA 1N62A 1C4QA 4A3IB 2QEJC 2WXFA 5C5MA 2DYMA 3R93A 1GB1A 5FKAC 3NRZA 3R8BA 4JBWA 4RGTA 1XWEA 3B9JA 4Q5VA 4XDCA 3CU7A 1BMLC 4X3UA 5A2QL 4NW2A 3SFDB 3C1FA 1YN3A 3SVMA 1TWHB 3I70A 3NUHB 3SK4A 4QF4A 1BUIC 2LS01 4RCNA 2AQ3B 1DOKA 2Y3AA 5C5LA 3RUZA 1TS3A 3CKIB 1QWYA 1S5FD 3U2SC 1Z7TA 4RFBA 3TUOA 1SNCA 2F0OA 4ZK9B 1NENB 5C4JB 1X32A 4KI0A 1PXUA 1VF7A 4XQNA 5IGFA 3PUYA 1TVXA 3L4PA 3DWMA 2WP8J 1OXVA 2B2VA 5E4XA 1MVKA 4IUNA 3NVZA 4JE3B 1FCLA 3A54A 5G5GA 4YSYB 4N58A 5G3LD 3K5MA 1NR2A 2B2TA 3NTKA 4DNRB 2PCFB 5BN5A 2O5JC 4Z9CB 5C2TB 2K33A 2EYPA 2V4DA 3J81L 4EE2A 4AS1A 3T4AC 4US9A 1TJEA 1XXGA 3FDTA 1WWTA 1KH0A 4QIWB 4KV6A 4K5WA 2WU2B 4H2AA 3OSOA 1STAA 2PVOD 4KD4A 2X6GA 3E0JA 2IX0A 3JAME 3P20A 1I4XA 2WDVB 5G3LF 1H9RA 4ID6A 5C3WA 3VA7A 1CZPA 1OXUA 3T56B 2WXIA 3L9AX 1SNDA 1FYCA 2H89B 2OHFA 2DWQA 4XQJA 4WIPA 1QF6A 4ARIA 1GOZA 2YYZA 3RLFA 4A3DB 1F9QA 2PW7A 1SNPA 3GP7A 5I6WA 1N60A 5FO8B 1FD7D 1UNSA 1XLPA 4HJGE 5CMDA 2R93B 4PT5A 2H1EA 4KKJA 3DEOA 4MHEA 4L2YA 4B0MA 1GXDC 3MHBA 4OZBA 1UWMA 4XIGS 2EELA 1YQ4B 4K6LA 1BXTA 4MIUA 1LT6D 3AE6B 2YEPB 3TDQA 4G57A 4JX1C 5K5PA 2NBFA 4A6QA 1NSNS 1DOXA 1G6ZA 4ZRQA 2F0UA 5TSSA 1KF6B 1EOTA 2M9VA 3N6RA 4FP5D 1OO9B 4IDIA 3C3LA 3MWYW 4H7BA 1T6BX 1RD9D 2ICEC 3CRKC 3B2GA 2JE6I 1Q90A 3M85A 3V2TA 4TQUS 4BWGB 2F0HA 2Q8RE 4H44C 1EY0A 1G2SA 3NE5B 2VNUD 3FC4A 3FILA 1N63A 4RGOS 1FNVA 1XLNA 1ICWA 1GUTA 4ZKBB 2WP9B 4J8QA 2V3PA 1HTLD 5KIXA 3OMCA 3DWPA 3I57A 2FHTA 1UAPA 4BY1B 4REZA 3F2UA 3NWTA 4KTAA 2FUG1 3KK7A 3EUB2 2B2TC 1F9SA 5KNCA 3NHHA 2ZT9C 1K53A 1NI3A 2W3RA 5M5WB 4WAFA 3HZXA 1F2RC 4IUUA 2OF1A 1JW9D 2X69A 2KWDA 4TKOB 2JX5A 1ZXHA 3PZ7A 5JEAH 3LYYA 2KACA 3AECB 4RAUC 2JA6B 1W6JA 4YTMB 2A6EC 2N55A 1V1PA 1L6VA 1JMLA 3NSWA 1MI0A 1ACCA 4PV1C 3IXSA 4PMBA 5K36H 1ILPA 1D6EC 4A9AA 3AH7A 2WKDA 3RZDB 1JWBD 1SB3C 1ZE3D 3HRZC 1TYGB 1K51A 1ZDVA 5T1IA 1ZYRD 3PMFA 1HHVA 2PMVA 3UI3A 2WXLA 1P7FA 4R8NA 4HTHA 3RZOB 1E0ZA 5FR3A 1Y8NB 2KEEA 1O78A 3WCQA 1JQ4A 1QILA 5BYSA 1A3UA 4BBSB 4F7XA 1SNOA 5M5XB 3T16A 1QG7A 1WD0A 3BK1A 4HKZE 2W55A 1QQRA 5CR3A 1H9SB 1EEID 3S2HB 3MFGA 1DGJA 4HRSA 4N9PA 3URYA 1SSNA 1KDAA 4KHVA 1J7CA 3I8ZA 2LUMA 5D14A 1I4PA 5FOBB 2JEBI 1CJEA 3HOUB 4Q0FA 2NTTA 4RKBA 4EQNA 4FF1A 1LTTD 2WXRA 3HUIA 1BCPF 1DONA 2G1EA 3DWAA 5CV6A 3DXJC 1VZ8A 3Q8EA 3MC0B 3BVMA 2NVTB 2PIAA 2D5GA 2MJ3A 3A8JE 1ESRA 3EGRA 3DMUA 5J1ZA 5HFYA 4FXCA 1D5XC 5NUCA 1IGDA 1GUSA 2K01A 4O1NA 1TY2A 1YNND 1L0VB 2BS4B 5EBCA 3ND9A 1C4AA 2WU5B 2V0GA 1YNJC 4YWGG 1ONLA 2NTSA 4XYQA 2L0CA 1EM7A 3TZDA 1HFNA 4S3SA 3HVDA 2WACA 1R9TB 3ITPA 3H94A 1S5CD 3PV0A 2N0SB 3BK2A 2Z4HA 3BYTB 4WRDA 3M4OB 2WKCA 5G5HA 1QE6A 1S4ZA 2MGSA 4CQNA 1ZP0B 4ULLA 2L4NA 5I9PA 1FRDA 2K04A 2K6AA 2Q8TA 2PQEA 1ZPSA 5D7GA 1EIGA 1XLQA 1E0BA 1FO4A 1EL0A 1CT1D 3FVQA 2ZW0A 1IL8A 4JK1C 4C1NK 1H9JA 4D2KA 5MPOA 1E2VA 3PIP3 2O5IC 3AMZA 2Y5CA 1S5BD 4B08A 3TP7A 1KDBA 3CIRB 1M4VA 4K8IA 4L63B 1G91A 2E6XA 1A3TA 2L12A 4HR7B 2LHDA 3MTSA 2E2JB 4BA2I 2R3ZA 4XXEA 1PTOB 1B4OA 3HVZA 1J7AA 5C3JB 3AE4B 2L11A 2IJ0A 3GTGB 4F87A 3TN2A 4OO1I 2JSOA 3EVQA 2KCCA 3M7NA 3NPPA 4LK1C 1MHXA 3C8YA 1X3QA 1CFMA 2L9HA 2ZXRA 3U9OA 2F1MA 3Q8FA 4USAA 4A3BB 2JA7B 2ENBA 3W9CB 3SR1A 4CHTB 5M5YB 2WQYB 1R4PB 1KFYB 3P4QB 1II3A 4HEDA 1PMRA 2EJGC 3BVZA 3VYSA 4XE0A 2KOLA 2HUGA 1WXQA 5AFWA 1JR0D 1PRTB 3P4PB 1S5DD 1WSPA 4HN7A 2A74C 1PTOC 5IOCA 1MSGA 1Y56A 1ZEQX 1SAPA 2V4IB 3A8KE 3NVYA 5FLXE 1JORA 1STEA 2I07B 2RDGA 3VR5A 2O4XA 1SYBA 3EQLC 1DCZA 4OIKA 1HEZE 1LT4D 1RF2D 3K5NA 3LNNA 5EKLA 1PFNA 1GPXA 3ZJUA 3BDCA 1SE3A 1CHQD 1MHHE 1BO0A 1ET9A 3MHZA 1EU3A 1F2ZA 3FAHA 1JB3A 2M2LA 4ITKA 2QJLA 1EY9A 1A2UA 1RFKA 4QMGA 5JPMC 4IUQA 2WS3B 1CZWA 1H9SA 2EYFA 4OHJA 1PYWD 3I90A 4YIJA 3T3OA 5M9OA 2PLPA 2KN4A 1XF5L 2E76C 5H92C 2CVRA 3QOLA 5HGTA 3D6WA 1PZID 3D8GA 1YN5A 3HRDD 3R2IA 2MH7A 3RMHA 1I6VC 2WXPA 1EYAA 1UUPA 1WTOA 5LL6X 1NAPA 2RA4A 1C48A 3E6ZX 2LFIA 1HUNA 2BTEA 2NVQB 1LTRD 3S1MB 3AEEB 1PFMA 2JQRB 1FM0D 3S14B 1VRAB 1IBXA 1TWGB 1T3QA 5C0XH 3AEFB 3KLRA 1OFFA 1CI3M 4OW0A 2PZUA 5AUIA 3CQZB 1PGBA 1K83B 1PDQA 2J7ZA 3KQ4A 3QB3A 3LB8C 4G7OC 2A69D 4XT3B 3ZGZA 2RBMA 2ACZB 2B39A 1FGBD 2PPBC 2L32A 5H8YE 4XDDA 3PO3B 3DWQA 3V3XA 1B44D 1XCQL 3Q8CA 1BCPD 2IGDA 1M8AA 1NYRA 1HTPA 4ILWA 1AZQA 1E2WA 4I65A 2IX1A 2JZPA 5C0XI 1E9MA 1Y69U 2A5HA 3Q8AA 4ZUJA 3ABVB 2HTME 1D5MC 2AQ1B 4LJZC 5EPLA 3TZUA 4HKQA 3AN1A 3Q69A 3OWEB 5C44B 3VYRA 5D65A 4KJNA 5JXVA 2OXPA 2A68C 1KABA 2ZXOA 1Y8PB 4RF1A 1BR9A 4KY6A 1GB4A 5C0XJ 2KJXA 3GQBA 5E3FA 2SNSA 1WTRA 3TP6A 3A8IE 1GHKA 2JXMB 2B2WC 4Q2JA 1F9PA 3KLSX 4G7ZC 1QKZA 2JYOA 2F0MA 3SR6A 5IT9L 2JEAI 2JA5B 4KN4C 1B50A 1STBA 3GTKB 2WDRB 3AV8A 3IAYA 4DXGA 2K03A 3S1NB 2H88B 1MI2A 4FO2A 2CU3A 2EYLA 5FLXL 3Q24A 3K5LA 4KKIA 1JWAD 5KNBA 5IT9E 5A2QE 1R4QB 1ESFA 1E2ZA 3AE9B 2BB5A 4NP5A 5DAUA 2PZWA 4ZAIA 5C6AA 2BA1A 2B2WA 1QB5D 3PO2B 4R9WA 2F4IA 2Z4IA 4TQ0A 2K9XA 4ZYSA 4KD3A 5KYIA 2F0SA 3EFXD 5CV5A 4UDUC 3W3AA 1U4MA 2LFNA 5EE3A 3DWGC 1DD2A 1BBXC 2CJNA 3MAQA 2CW0D 1V1PB 2FJ2A 1JRPA 1V97A 4CJ1B 3FPPA 1DOYA 1BCPB 3N52A 4P16A 4XWWA 1EY4A 5GXGB 3V96A 1JE4A 1U4RA 2LMCA 4JPSA 1C4CA 3EA6A 1GJXA 1NVID 3OPOA 4P6VF 2LGIA 4X3SA 1Q3LA 1G2TA 3NTIA 4J6HA 3H8HA 1J8IA 1ET6A 3QG1A 3D6CA 4PNYA 3ZYYX 4P2CB 4IALA 3MXGA 1SE2A 3OHXC 4KHZA 5ELBA 3AE3B 3IT4B 2L5TA 2EPBA 3HKZB 3AU7A 4IFDJ 2B2UA 1D1KA 1QOHA 3HOZB 1VDVA 4E6IA 3P4RB 2K28A 2KVMA 1Y8OB 3VR4A 1FFUA 1L5PA 2EXZA 5LHY1 2BB6A 1LLRD 3S15B 2YEPF 5I4DA 1CTMA 4ZKCB 2L83A 2CW0C 1I7HA 4ZRPA 3RD4A 2WXKA 5KEEA 1V1OA 2E2IB 3X3NA 5IGCA 1G291 1IUEA 5CV8A 1OQRA 4DF7A 3LWUA 2IW3A 4UAIA 2XRQD 1EY6A 2KAJA 4YT0B 5CV4A 2HCCA 5ISRA 5KYLA 1VF5C 3W5VB 4M0WA 3OIQA 1AW7A 1EYCA 5DNFA 1JQYD 1SIJA 2DNEA 1EEFD 4YSZB 1CA6A 1E7PB 4C3JB 1Q1BA 3WOFA 2IGHA 1AN8A 4HSPA 4KK7A 3K6OA 2HDEA 3KWVA 2AUKA 3TBIB 1VCIA 3VR9B 4K5XA 3NTHA 4IFDH 2KHSA 3OW7A 2F0QA 5IGEA 4ME5A 3BDLA 2BE5C 4M1UB 1F2MA 5LL6S 2D2CC 4ABNA 1C9FA 4EQOA 1RJTA 3VR2A 2Y0SB 2K5WA 1PGXA 2WXNA 3KF8A 2J4XA 1XTCD 2TMPA 1IGCA 1D2BA 2PKOA 4N6EB 1GAQB 2QCPX 4NZLB 3CRLC 4BA1I 1STGA 1FRRA 1SF0A 1JWMD 1JOQA 2NZ1D 4A3GB 2RSOA 3AMUA 1TIID 5C4XB 2FBWB 5A35A 1XO3A 4CKBA 2WXHA 4A8XC 4KN7C 3TMEA 5EE9A 1KLGD 3NXWA 3D4RA 4CKEA 3L7ZC 1VZ6A 1LTAD 4B9XA 4PQXA 4WQMA 3GV6A 5BYRA 2B2VC 1EWCA 3CHBD 3GB1A 1VMCA 2F0LA 3OMGA 4FF2A 2K7VA 1J9OA 1WTVA 2N9KA 2C5CA 4RGMA 3W1SA 2GB1A 2WXGA 1NUCA 3AE5B 4FF3A 4YTPB 3GTMB 2K5PA 1CZGA 2F3WA 1OXTA 1JWSD 1L0XB 2XSCA 4OL7A 4EQPA 1F2RI 3AEGB 3GO5A 1QOGA 2J53A 2FFKB 1U9RA 1AWDA 1U4LA 3AM9A 3P42A 3GTLB 3HOXB 4GDKB 3AE2B 4L8JA 2EJFC 4FNFA 3C2PA 1YJIA 2VZKB 4A3FB 3J80L 2L55A 3P1MA 3BWUD 3U9SA 4N9TA 3FKIB 5HHDG 2QMTA 2D62A 2X38A 3Q8BA 1HCZA 4FVMA 5C3XA 3E5SA 2QF7A 2F0PA 4ZOHC 3GTJB 1AZPA 1T5XD 1HRJA 4DU9A 3VR8B 5CV7A 1C77A 2MHVA 5C0XG 2PYKA 4HMJA 1HQRD 1JWUD 4V0BA 1JCKB 2KDMA 1FCCC 3NVVA 4KMUC 1GUOA 4IURA 2O2LD 4IKGA 3D3RA 5EQ0A 5KRUA 4H0LC 1LV9A 4X3KA 2BBCA 4WJWA 1ZUD2 4QUCA 5BN3A 2FMMA 1PTOF 3M4YA 4G7HC 2D9UA 5BMHA 3P4SB 2E2HB 2IT1A 4DAYA 1FEHA 2WLBA 3J9CA 3I9V1 1JC7A 5I2YA 3NZ3A 2KUMA 3W2DA 3MA2B 1YJJA 4C3IB 3ETRA 4KY7A 3H09A 4F88A 1ZOYB 4RGNA 3VRAB 1SMYD 3MJ5A 4DGZA 3A56A 4MH8A 1SJED 2F0KA 1O80A 4ZRZA 4JWSC 4K8JA 4GDLB 3G7LA 3LX0A 4IUTA 2AQ2B 1QJOA 3BZDB 1PTOD 4OO1G 3SXHA 2NVXB 3V05A 3IT6B 3VA5A 2BCOA 3NS1A 2KQ3A 5E4WC 1KLUD 2EDGA 1LTBD 1A15A 4A93B 1BCPC 1VZ7A 1SJHD 4EVOA 2K05A 3I3CA 3PUXA 4C2MB 3S1QB 5DEHA 1I4QA 1AEXA 4US8A 2JP1A 2KEDA 1WTXA 2X6LA 1HA5A 5CBAE 4DQOC 2WNMA 1V43A 1K52A 1MSHA 5CBEE 1PRTD 5E6JA 5EE0A 4C1NI 3Q23A 2I2YA 1TS5A 5JAVA 5BMIA 3K5OA 5JPNC 4C3IG 5J22A 2INPE 4LK0M 2PW5A 2MEKA 2F3VA 1NYQA 1DXMA 1QNKA 3VRBB 4U68A 5JVH3 2J0TD 1I4HA 3U52E 3E56A 3EJIA 1Q10A 1RTNA 4M8AA 3I4MB 1BUVT 2Z1CA 2EYMA 1FFVA 3SEBA 1N61A 2K5DA 2XRSD 1IW7C 2GA4B 1CHPD 1B9MA 2F0FA 4PMCA 4BBRB 3GTQB 2GI9A 5M3FB 1A2TA 3RPFC 5CC4A 1F2YA 1DZ1A 3IAS1 1ROEA 3BYYB 4WURA 1U4PA 4K6DA 3A7LA 2A6HC 2I38A 4DK1A 4RA8A 3ZQ4A 1B9NA 4FF4A 2OT2A 5D3IB 2B2YC 1EFID 2PZTA 4JWUC 1I3QB 4HROA 2KCNA 2BOSA 4C3HB 4DN4M 3MVVA 1K50A 3MEHA 3Q22A 4HCSA 2XN9C 2J52A 2A68D 1QOAA 1JROA 1GUWA 2R7ZB 5HURA 3GTOB 1Z47A 2JYTA 2KA7A 1OQQA 2NUCA 4B0EA 2K1BA 5T1GA 1QOBA 3R2TA 3Q6SA 3VYTA 1SFOB 1L4DB 1JOKA 3X3MA 1VJKA 1EY8A 2B2YA 3NWSA 2A6HD 2LJIA 2NN6G 2SAKA 1QNUA 4IZ8A 1H9MA 2IPKD 2EYHA 4R8IA 2EY6A 5LNK1 2FINB 3OOCA 4Y7NB 3AE8B 3MP9A 1VLBA 5F2DA 2IDYA 3I4NB 3TP8A 3D4DA 1SMYC 5HI1A 1ENAA 2YU9B 3G6JB 3BG3A 2A6ED 4K5VA 1UEAB 2NB0A 1ZYRC 4J3OD 1WD1A 1FNWA 4CJ0B 1Y1VB 4C3HG 3SK6A 5EE1A 2G9HD 4BS9A 3P7JA 1RM6C 1FMAD 2SEBD 5EPKA 4NJCA 4ZLTF 3HOWB 2MJDA 4ZHOA 3H91A 1KNEA 4B9WA 1TT2A 1T5EA 4R3DA 2JA8B 2PNRC 3K7AB 4FXDA 1L6UA 5KGUA 1LTID 2FE8A 2W82A 1C4PA 3WDNA 2H4OA 3PIO3 3DM1A 5HG2A 3P63A 2WXOA 1WVLA 1YNJD 1TQOA 1C8CA 1LACA 2NVYB 1D5ZC 1K8MA 1RTOA 2INNE 1LT3D 1GHJA 1MGSA 4H13C 3NUCA 1N5WA 4OVZA 5E1FA 1F2LA 1AYFA 1PUTA 2WXQA 5JVG3 1XLOA 3PUZA 4X3TA 1TKYA 1EWHA 5ELCA 2HDLA 5C4HA 4KY5A 3PZ8A 4CKCA 5IGGA 1XX8A 1PDXA 3K58A 1WTWA 1KRHA 2RDHA 1EZ8A 1X3PA 3WOEA 1HUMA 1SYGA 1IKLA 2EE1A 3BVGA 2JWUA 2RPVA 2WDQB 3N9YC 1WCMB 1SYEA 1D1IA 1LO5D 5DM73 1EQVA 4ODGA 5JOBA 4ZUIA 3IAM1 1TKEA 1EWYC 5IGBA 1TS2A 3E9SA 2E2DC 1IBXB 4LMQD 3SDZA 4IUVA 4C7YA 4WH4A 1DOIA 4ZQ3A 1MPEA 1I4RA 1RHPA 1EY7A 4HEA1 1B1ZA 2CHBD 2WXJA 2BW2A 1EU4A 1RDPD 3HS0C 2EKIA 3H3VC 1PZJD 1IYUA 1XCTL 3U4EG 4CBVA 3ND8A 4RCOA 3Q0AA 4A3KB 3NBHA 5ELEA 4C3JG 1HZ5A 2NN6H 2M00A 4A3MB 1E10A 1KAAA 3I72A 5EKKA 2N88A 4KGSA 4ZHPA 3H0GB 3ERQA 4RHRA 2IWHA 1XEEA 4TRDA 2Q5WD 1UGJA 3L3OC 5EBDA 2LEKA 1IKMA 3FPUB 2ON8A 3S9WA 1LABA 3NP8A 3ZJVA 5IODA 2LHEA 3S16B 2QSDA 4LTUA 1SSOA 2HDMA 5JEAJ 3NVWA 1EQTA 3NQIA 2F0VA 3PO0A 2XWJB 5BMGA 4KJOA 1P7EA 4BY7B 1B53A 2F0JA 2WB1B 3MXNA 2F0IA 2XVSA 3AB9A 1VDZA 1N5XA 3T3NA 1NCVA 2A73B 1MD2D 3M7GA 2K32A 2RKSA 1HQMC 4G4KA 2D5DA 3DEPA 2RMMA 3H6MA 4KX6B 1ILQA 4IN3A 1AFPA 2MP1A 3TSSA 4L1BA 4KKUA 3SE0A 4C7ZA 2PVGC 1ENFA 3MFYA 2ID0A 1S5ED 3UI2A 2AWNA 1JALA 2DY7A 4IFDG 1J7BA 3GTPB 4NKLA 2IL8A 1K8OA 2N7JA 3I4LA 3HG9A 3S2DB 1IHZA 2SOBA 2BT6A 4TMAB 3PUVA 1SE4A 2WV6D 2FMCA 4GZYC 1HFGA 3SK5A 3QOJA 1BOSA 4XDXA 1CA5A 1MBYA 1WRIA 5KNDA 4DNTB 3O13A 3D31A 1B9RA 4WWMA 1LTGD 2K3UA 1SXTA 3T53B 4A55A 2NN6I 2WINB 3I73A 2MJ8A 4FXKC 1HXYD 1CM9A 2A69C 3A55A 2EYOA 1DJRD 3AEAB 4EGVA 2K0PA 5JJZA 2ONQA 1C76A 3GV3A 1TY0A 1PRTF 3VR3A 2AWOA 4RWSC 3I91A 1A3VA 5J39A 1SDFA 5BYQA 1IYVA 2I46A 2BS2B 2SNMA 4A3JB 1SNMA 4AYBB 4WORA 1HPCA 4WFN3 1SNQA 2R92B 1EIHA 1TKWB 2VUMB 1DOMA 2GRIA 4K2LA 1PZKD 3J7YW 1Q12A 3TEYA 2W3SA 5I9OA 3VQIA 3NBIA 1I6HB 2B76B 3AEBB 2BYTA 4ARCA 1BNZA 1L0YB 1RKNA 3LWEA 1E6EB 5FO7B 2OEOA 3ZJTA 2DNCA 2B8FA 1PFBA 3W5UB 5BN4A 3VYUA 3BDOA 1VR9A 4DK0A 2B2UC 1W6KA 2HCIA 4K2KA 2EZVA 1PRTC 3VR6A 1FXIA 3TEZA 4CGYB 3T13A 4K14A 5IIFA 5CGKA 5FK9C 2RSNA 3GS2A 1UWXA 4CJ2C 1RCVD 2F0WA 4J1MA 1V8CA 2RQXA 4L23A 2EY2A 2NYZD 2F03A 1L4ZB 4OZCA 4RF0A 1F0ZA 1H9KA 3GD7A 5C3EB 2LY7A 2IX3A 1I4GA 2OEDA 2PMZB 3J81E 3P1HA 1JICA 1BF4A 4MACA 5JEAG 4RKLA 2CQAA 4KGTA 4V190 4AQ7A 2QILA 4LLGM 2WAQB 2DY8A 3B2FA 3U7ZA 1ENCA 3KLSA 5I2XA 1ZXIA 1STYA 1FIQA 3HOVB 2EVBA 5C4ZA 4A90A 2F0NA 4IQZA 3HEJA 3IKJA 1FD6A 2HQEA 2VB3X 1TZOA 2R61A 4KGRA 2EOTA 1V8QA 3HGBA 1STNA 4KKSA 4NAMA 1TWFB 3IFDA 2VXWA 1EY5A 1G8ZD 3TP5A 1YMHE 2K5QA 3IFTA 2ZW1A 2G9DA 4XT1B 4HCEA 4OZAA 5T8IA 4NMZA 1I50B 1QOFA 3NK9A 3SK8A 3EROA 2F0TA 3S17B 4IOIE 2XWBB 2XIWA 4GLSC 3QWNA 3SHLA 2J42A 4RH6A 1D4BA 1ZDXA 4F8MA 3AB5A 2CJOA 1ML0D 1TS4A