1EWCA

Crystal structure of zn2+ loaded staphylococcal enterotoxin h
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
b'DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLGGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN H
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 73
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ewcA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ewcA02
3EA6A 3R8BA 1PRTD 4RGTA 3V05A 1RF2D 2IPKD 2RDGA 3BZDB 1TY0A 4RGNA 1SE3A 1V1PB 1B44D 4ZYSA 1RDPD 1LT6D 2CHBD 5ELDA 2TSSA 1GOZA 1S5ED 1STEA 1KTKA 2Z8LA 1S5BD 4RHSA 4RHRA 2O2LD 1I4PA 1HXYD 4RGMA 1BCPF 4UDUC 1EEID 1HQRD 5I4DA 1BXTA 1DJRD 1L0XB 1PRTC 1FD7D 1TS4A 4BWGB 1LTAD 1BCPB 4O1NA 1CQVA 1PTOH 1PTOC 1RCVD 2AQ2B 1YN4A 4TSSA 4RGOS 1LTID 1LO5D 1PZID 1SJED 1S5CD 1TY2A 2QEJC 3SEBA 1D5XC 1D5MC 1PTOD 3O13A 1UUPA 1KLGD 1LTBD 1PZKD 1I4HA 1RD9D 2IJ0A 2SEBD 1FGBD 2NTSA 1YN3A 1ESFA 1HTLD 2XN9C 2QILA 1YN5A 5FKAC 3BVMA 4DXGA 1LT5D 5D3DA 1ET9A 1I4GA 3R2IA 4Z9CB 1LTSD 1F77A 1LT3D 3GP7A 1B1ZA 2WV6D 1KLUD 1SE4A 1TS2A 1EU3A 2ICIA 1DYQA 1JR0D 1LTTD 5ELFA 1UNSA 1PRTF 1M4VA 3R2TA 1EU4A 4C56C 1CHPD 1PTOF 4L6TB 2XRSD 2RDHA 5FK9C 1D6EC 1EFID 1I4XA 3MFGA 3BVZA 1LTGD 1LTRD 3KLSX 1EWCA 4RCOA 1PRTB 1XTCD 3TSSA 3MC0B 1HA5A 1S5DD 4OHJA 4NZLB 1LLRD 5D3IB 1BCPD 1JQYD 1I4QA 1V1PA 3DWPA 4RH6A 2NTTA 1FNWA 2J4XA 1S5FD 1I4RA 1CT1D 3EFXD 1SEBD 2AQ1B 5TSSA 1JWSD 1TS5A 1MD2D 3DWQA 1T5XD 1V1OA 2R61A 1JCKB 1PZJD 1SXTA 3OWEB 2AQ3B 1SBBB 4RFBA 1QILA 1SJHD 1CK1A 2XNAC 5ELEA 1JWUD 2G9HD 1AN8A 1SE2A 5ELBA 1BCPC 4L63B 3URYA 1FNVA 4K6LA 3W2DA 1PTOB 1CHQD 1G8ZD 1ENFA 2XRQD 1TS3A 5ELCA 3BYTB 4DXFA 1AW7A 1JWMD 1L0YB 3BVGA 1ET6A 1PYWD 3DWAA 1D5ZC 1FNUA 3BYYB 3CHBD 1LT4D 1XXGA 1EEFD
chains in the Genus database with same CATH superfamily
1XLOA 2Z4HA 2LFIA 2BKRB 1V8QA 3FKIH 5D94A 4FXCA 2J42A 1TKWB 4AJWA 3H91A 3M3YB 2WP9B 4HPLB 3KF8B 4C2MB 4PG3A 1WTXA 4LMQD 3Q3NC 1B44D 3D8GA 1IGCA 4GU2A 2CU1A 4RKBA 4DR7Q 3M3JA 1EIFA 1MJDA 1JICA 3KF6A 4K7WA 4DR4Q 3ZVVA 4LUOA 3LXFA 1PH1A 1MJEA 1YNND 1OQYA 2ZNVC 4DV2L 1TQOA 1I50H 1VQPA 1F1HA 4FJVB 1EL0A 2G4DB 1DJRD 3ZNID 4MGYE 3GE3C 1TS4A 1J8IA 3KJOA 2K6QA 2EXZA 5FR3A 3N3KB 2JUOA 1HNXL 2C7MB 4RGOS 4X62Q 1TY2A 3BDCA 1B70B 1S40A 1PGBA 2YEPB 1D5XC 3KUDB 4DHZB 3SR1A 2R3ZA 4GN3B 1LYLA 2B8FA 1JMCA 3KVFB 1VQ9A 5J17A 3GS2A 1FGBD 1YX5B 2MO0A 3VRBB 2XBBC 2ASQA 3E56A 4P71A 2Q8IB 5GADC 4A3KH 2JX5A 3TUOA 1T9HA 4KN4C 4B9WA 5EPJA 2CHXA 5G2NA 1I4GA 1Q8IA 3JYUA 1L2NA 4KI0A 4A3JG 1CM9A 1SE4A 4EQOA 4BY1H 3NRZA 2LGDA 3RFZB 3D4RA 3ER0A 5L95C 5KHOA 1JORA 1D3ZA 1XMOL 3U8ZA 3U50C 1EY5A 2CHWA 4C1NI 4JI8Q 2NN6H 2CQAA 2LRUA 2M1MA 3S9WA 4BA1I 5IYCG 4K7SA 5I2XA 2CS4A 5BYQA 3CRKC 4WJQA 2UU9Q 3EROA 3I56A 1XF5L 2JF5A 2NVUI 3Q69A 3HOVH 5D3IB 3PO3G 3J81j 1YJWA 2DZKA 1E8YA 3DBRI 3QG1A 3IAM1 1RWSA 5KGUA 2E2JB 4GDKA 1NI2A 3PS6A 4P73A 2FNJB 1ZKOA 1VQLA 4DV5Q 2A6EC 1Y1WH 2X6LA 2Y3AA 4EQNA 3AE2B 2B63B 1HRJA 1CZPA 3ONAB 3ZQ4A 1F9RA 5ELOA 2AWTA 4RKLA 3RZFA 1V9JA 2NBUA 4UP9A 2LWPA 3S16B 4DV7L 4CDEC 4A3FG 4X66L 3T1HQ 4JI4L 1RTOA 3N52A 2KX3A 1HZBA 3Q8FA 4PS7A 3VVWB 1MG4A 2K01A 3HM6X 2K5PA 1PH8A 1HNXQ 3S15B 1PLFA 2E2DC 2F4VL 2A5HA 1MPEA 2N9PC 1EIHA 2NMQA 2XRQD 1X55A 3KJPA 1AZQA 1L4DB 2E2HB 4DXFA 4OW0A 3GTJB 3FKYA 1TWGB 3KQ4A 2DX5B 3A54A 2F0SA 4WJNA 4YL8A 1B50A 1SMXA 1X1MA 1TR5A 2HCIA 3TZDA 5IGCA 1GJZA 2PQAA 2B2YA 2M4NA 3ENEA 2BA1A 5GQOA 2NPTA 3G48A 2J0TD 5EBCA 4G50A 3VQIA 3UGBB 1AEXA 3V61A 2L1BA 4ASWC 3AMZA 1X65A 1QZHA 2C5CA 3EFCA 2LUEA 1A63A 1K0RA 4YHHQ 1TKYA 3A56A 2O2VB 3D32A 1RTNA 4RGMA 2Z6BA 2NUCA 1H9KA 4UDUC 4X3TA 3I4NH 4HCSA 1E10A 2WAQE 3LNNA 5C4JB 2KXJA 2OCEA 3DHQA 1Y8OB 1K52A 1EM7A 1GUSA 1JJGA 3GB1A 4EX5A 4OIKA 4O1NA 4HEA1 5G55A 4GNXB 4YTMB 4MACA 3VTVA 3SDLC 4ULLA 3CCUA 5AUIA 1QOGA 2NBFA 3AYHB 2WDTB 3R66C 1E2VA 1I4HA 2QDFA 3ML8A 1MKHA 4WORA 5IYBH 3KK7A 2JA6G 1AYFA 1YIWA 4ZYNA 3S1MB 2EOTA 4PNYA 5L37A 2BS4B 4A3GH 3M95A 3TCAA 4P1CC 4M8NA 3K6OA 3HOZB 2VZKB 3OTOQ 3TS0A 1ET9A 1FR3A 3FVQA 3MEFA 4DFAA 2D10A 3VAWA 3PO2G 1U4PA 3MVVA 4DV7Q 4GXBA 1TXYA 4JI4Q 2OOBB 2X8XX 3AI5A 3M62B 4A93B 1CKNA 3NWSA 2AHOB 2KD0A 4LNIA 2B2UC 1TZ1A 3FILB 3DHGC 4NQLB 1LTTD 2WACA 3TN2A 4MTNA 1M94A 4U673 4A3IH 4II3B 2N7JA 1EU4A 1KF6B 2GLSA 1SLJA 2ZW0A 3KYCD 3HOWG 4DN4M 4JI3L 3JAMc 4GIVA 2NVTH 1QQRA 1J7AA 1LTRD 2I5HA 2K1BA 3UIPB 1V2YA 1X3FA 3GQBA 1KH0A 2CJNA 1IBKQ 4DUYQ 2QDBA 4AYBE 2J0JA 3PLUA 1JQYD 1VD2A 4K8JA 3BU2A 2B3AA 4KGRA 5FO7B 4OO1H 3P63A 2LVQA 4QAYA 2WYQA 4C4VB 3C46A 1DGSA 4Q2JA 3CPWA 1YJIA 1CUKA 1WCMG 2B2UA 1VQ6A 2PZWA 1F2LA 4B3ML 3HOUH 3T51B 1FPYA 2D5GA 2F3VA 1DXMA 2RCNA 3OIPA 3CQZB 3SVMA 1TIFA 2N4FA 3I57A 1R9TH 1WGRA 3CPFA 2IO3B 1E8XA 4ZUIA 1PQSA 2NZOA 4MJSB 5CHWA 4YWGG 2W3RA 2N7EA 3WOFA 3K58A 3EHVA 3B08A 4DV3L 3S17H 2UXDL 4USAA 1JRPA 1T6BX 1GUGA 1EUJA 3H6NA 3L0OA 3AE9B 3OIQA 1HNWL 1YJ1A 3VRAB 4YWKA 4XQNA 4CBVA 1YI2A 3S24A 1B3AA 2VL6A 5IOIA 1XNRQ 3WIMA 1QKZA 3BK2A 3BYTB 1PH5A 2WDQB 2IO2B 1ET6A 2EXDA 3M4QA 1I7HA 1E2WA 1JROA 5BMGA 1GPXA 4EVOA 1AWDA 1GC7A 2BT6A 2F0WA 2VS1A 3NHEB 3LWEA 5C4XB 3IKJA 1C78A 2SAKA 4YXDB 1A3VA 1EOTA 1JOQA 4FXGC 4NPNA 1F2MA 4RMAA 5C1ZA 2IPKD 1IBMQ 3BZDB 4IUUA 3GTKB 4RGNA 2IX0A 1EF1A 2ZM6L 1X3PA 3TMPB 4ZYSA 4BY7B 2KTRA 3AE5B 3AE8B 5IA7A 2JP1A 1JOOA 4DGZA 2PCFB 1EQRA 5ELDA 3ZKJC 1HTQA 1PDQA 3C19A 1STEA 4IUTA 5KYLA 1AZPA 5M5YH 5CORA 2OJWA 3N30A 3KOJA 2HTHA 1X9NA 4US9A 1DOXA 2QCPX 3M4PA 4H7BA 5FO8B 1MHHE 2MH7A 1LM0A 3HKZB 1J0GA 2ZPNA 3AQQA 4TQUS 4BBRG 4FBJB 4ZHOA 1FIQA 3KDFA 4WFN3 4TQ1A 5BN4A 3RPFC 2NYZD 5DEHA 3V96A 2KMCA 2R7ZG 3A74A 2WKDA 1TWCB 2VY3A 5FLMG 1ISNA 1IW7C 1P16A 4H2AA 2F0KA 1JMLA 1O80A 5IP7H 2UUAL 3M4OB 1XD3B 2HD5B 3T3OA 3RZOB 2EYFA 5IT9c 4A4IA 3B0AA 2BGFA 1HJPA 5CV8A 4Y7NH 3OLMD 4DV1L 4QB4A 1P9DU 2JA7B 3WANA 3K7UC 2PNHA 2QILA 4JI1Q 2WXKA 3F8TA 1I94L 2JSVX 1YQ4B 1GKHA 1VQFA 4RCNA 1BT0A 2MP2A 2ICEC 3TQYA 2WFWA 4DV3Q 1PH3A 2UXDQ 4CDCC 1UWXA 1WX8A 2DAFA 1C4AA 1V5OA 1JC7A 4PS8A 3VYSA 4R4CA 4IUMB 5C44B 4KY5A 1OEYA 2F4IA 1S4ZA 2K03A 5CC4A 3N32A 3NVWA 3T3NA 2L12A 2LUMA 4CJ0B 1UNSA 4MNOA 1V9PA 2EJFC 4LWCA 1OGWA 2PEAA 2YU9H 1Q81C 2ZVNA 4AQ7A 4LNFA 5M5WB 4LJOB 3A9JB 2QJLA 2KEDA 1SIFA 1KAWA 1J19A 2WNMA 3IFWB 5G5GA 3NS1A 2WB1E 4RNAA 4IDIA 4DV0L 2A68D 4C1NK 2IO1B 5M9OA 4BKTA 4X3KA 4RH6A 4OONA 2PI2E 2R7DA 4NKLA 3UQAA 5AUKA 4IM2A 2ZM6Q 2K5QA 4M00A 3KWLA 1JRUA 5J2RA 3G6JB 4C3HB 2YV5A 1STBA 2IX3A 1GUNA 2X69A 2L11A 3T1YL 2BWES 1EO6A 5E6OA 4RG1A 3DVGY 2HCCA 4LFBL 3EJIA 1CKOA 2BDOA 1X3GA 4HMJA 2ZJDA 3T53B 4NQKE 5E6PA 2HHHL 1V49A 1SE2A 1KDCA 2R92B 4PT5A 1DOLA 4A9AA 3N6RA 3HG9A 2I07B 4AP4C 1TS3A 2JA8H 1W6JA 3PCOB 4MEMA 3PZ7A 1JWMD 3PUWA 1BR9A 1L0YB 1FXTB 1P0RA 3VDYA 2YEPF 5AZHA 2WX0A 3ZJUA 2UXBQ 1NSNS 5IYCH 4CO7A 4K3CA 1HHVA 2NVYB 2L5TA 2MUYA 4OZCA 1VQOA 4IG7B 3DM1A 1EEFD 2JA5B 1WXSA 1ICFB 4DHZE 5IGDA 4ARCA 4K2LA 1FM0D 4DPGA 1K28A 2KA7A 2RDGA 3A5UA 1J5EL 4JGHB 4ZRJA 2KNBA 2N49A 5D2MB 1IYFA 2E6XA 1SN8A 3ICEA 1S1QB 2CHBD 2CWPA 1EUVB 4DV4L 4KGTA 5D14A 4E6IA 2L83A 1QB5D 2HIXA 2F0EA 4HIKA 2A6HC 4Y52H 4LFAL 2ZW1A 3CMAA 5J22A 1DOKA 3IBEA 1BCPF 5JH5C 3QA8A 4IPGA 5IP4D 2B2TC 1CI3M 2A19A 1TGZB 4A3MB 1BXTA 1T0QC 4F7ZA 3LGJA 5KEEA 4XQJA 5IAAC 3RUIB 4LK1C 1FMAD 1P8LA 4K5WA 1CQVA 4HSVA 1G51A 4A3KG 2EYJA 1CMXB 4B3SL 3WOEA 4MM3B 3Q3JA 4EFOA 5FO9B 4X3SA 3VYTA 2K32A 3ERQA 2PZUA 5CV7A 4UPAA 4JPBW 1TWAH 4IALA 2QHOA 3Q8CA 1VCIA 4X57B 2JN4A 3E0JA 4BY1G 1C0AA 4L2YA 1YNNC 2IY5B 4G0NB 3T1YQ 5H1SE 4DUZL 4IOAA 2EYHA 1XLQA 3U52E 3NPPA 2N9KA 3M4YA 2F1MA 3HOYB 4LFBQ 4DAYA 1F2RC 1VQDA 2TMPA 1STAA 5EDSA 4A93G 3KYDD 1NR4A 3QR8A 3AEFB 4IOIE 3TJPA 1F0ZA 1G6JA 1H9MA 3G7LA 4IFDH 3VA7A 4W9GA 4JWUC 2K5VA 5KHQA 2ZTCA 3RZWC 2ZNVB 3NZSA 3NSWA 1VJKA 3HZXA 5KIXA 4L5RC 4GB9A 4JL9A 3MA2B 5FJ8H 1QOBA 2AX5A 4M8MA 1QG7A 4NXNL 5M5XB 4P7IA 1SYEA 1AFPA 1Q86C 1C77A 1C4PA 4WQOB 1TWHH 4IOCA 1A2UA 2BDNA 5C3EB 2QDLA 4EQ5A 1Y1WG 3L3OC 2DNFA 5KNDA 3H7PB 5EAYA 2UUCL 4OELB 3FDTA 1HNZL 1C4QA 1J5EQ 3T4AC 3F2DA 3K5OA 3ZIMA 4O42A 5M3MB 1SEBD 4FNFA 2R6GA 1OO9B 5IOCA 2K75A 3UDFA 2ZJQA 2VNUD 3V60A 2LMCA 2W55A 3UDGA 1LFDA 1SYCA 1PDXA 4LFAQ 1R4QB 3W5OA 4WAFA 1FFVA 3UE0A 4C3IB 5J39A 3PO2H 5EQ0A 1I42A 2Y5BB 5GROA 4YWLA 4B9KA 4GLVB 2M0XA 2L1AA 2BS3B 4OWXB 1MJCA 2LS01 4XE0A 3R3OA 4A3CH 2DZIA 2FCQA 4K5VA 2L0TA 4JI0Q 1AARA 3E0EA 1R4MB 1ENFA 2EVBA 1NDDA 1MIUA 4K5XA 1PH9A 1LGRA 3BVGA 2MGSA 3HOWH 2GBNA 4EOYA 4HVBA 1L2FA 2LSSA 4XWWA 2K05A 1KHIA 3L08A 4PZ6A 3VUWA 3NZ3A 3J7AV 2HDMA 5IKCM 3GTQB 2QSDA 4POFA 2N3SA 2W3SA 5G3LF 2EZVA 4I6LB 1IUEA 4LFCL 3RN2A 2LJIA 4GOPB 4W9DA 3JVZX 3I4NG 4JW0A 4JI5L 1TU2B 3J80i 1WCMH 1CQFA 5LMUQ 5EKLA 2EYPA 4WJ3M 2VW9A 3MHZA 3SK4A 4IW0A 3PMFA 4RHRA 1VCBA 4JBJA 2A74C 1HXYD 2UXCL 2K9XA 4AYBB 2OHFA 1X6OA 3U7DA 3WAMA 2FJ2A 4BKGA 3U4VA 2B76B 1U9RA 1L0XB 2KMMA 5IYBG 4J8QA 3VH4B 4EKUA 4LF5L 2MHJA 1HZAA 2WXGA 4A3GG 2G5DA 4YWMA 3J81i 4L1BA 2SNMA 4DK6C 4ZLTF 2LZ6A 5C4ZA 1D5MC 1IW7D 2NZHA 1YVCA 5E6NA 1UUPA 1KRTA 1YX6B 2V4DA 1FJGL 1MVKA 4R4QA 1L0WA 4K8IA 4LF4Q 3R7RA 3RZDB 3L17A 3DBHB 4MGIE 1QVFA 4JI2L 1LACA 4C2MH 4A3IG 4IUVA 1GB4A 1BKBA 1QOFA 1T0SC 4LUVA 1TT2A 2KHWB 1K8RB 5C44G 2F0VA 3D4WA 4KD4A 3PTFC 2KCNA 2NVQB 3QB3A 3F2BA 2BWFA 4I6PA 1JR0D 3I4OA 2DJFC 5I6WA 4NJ6A 4FF1A 1FCCC 2KVRA 4CKBA 3ZUNA 5BMHA 4DV6L 4OWWB 1CA6A 4OO1G 1WE7A 1A5RA 4N9TA 3Q23A 4I6NB 4BBRH 5CTRC 1D8LA 1EFID 1N9WA 2EYOA 2QEXA 1N5XA 2FAZA 4I7ZC 1HZ5A 4Q0FA 4P74A 3VR3A 4B9XA 5EJWA 2MJ3A 4BVUC 3H0GB 1Z47A 1HFNA 1BCPD 3P4RB 1NI3A 4BKSD 3NJTA 2R2OA 1NAPA 1ICWA 2ENBA 5TSSA 3U2SC 4JK1C 1R4MI 4ZDVA 2DENB 3P4QB 4FA6A 4DR7L 1G291 3OWFA 3PF4A 3S14B 1VRAB 1ZXHA 2FUHB 4C7ZA 4F1SA 1FVIA 3BJUA 4DR4L 3Q8AA 2A69C 1MHXA 1P98A 4KKUA 4HWIB 4P6VF 1JQ4A 1JWUD 1KQSA 3GTOH 2V0GA 1UWVA 5DPRA 2VUMB 5M3FB 2E75C 3MAQA 3NP8A 4KJNA 2MHVA 3DBSA 3A8JE 2JZPA 1GM5A 2KCTA 5IYDH 5K36G 4NAWB 4ZRIA 2A5UA 3HKZE 3Q3MC 3UDXA 4X62L 1N33Q 3SD5A 1W3SA 4DA2A 2KWCA 1WZ3A 2XEWA 3ZJTA 3A0JA 2VQFL 5DPWA 1XPRA 4II2B 1IXRA 3JAME 4JI2Q 3NBHA 4C3JB 2LVOA 1F2YA 4FULA 1KRSA 2MO1A 2E2JH 1QT9A 1QWYA 1K83B 2GBMA 1EY7A 3HRZC 4B3TQ 2N0SB 1DOIA 1LT6D 2HD3A 2PLPA 4R8NA 5DAUA 2EELA 3Q3OC 3PIP3 3QWNA 1Y1VB 1C8CA 3ZO5B 2IX1A 1XCTL 4R4OA 3ND8A 4DV6Q 5I9OA 1WVLA 2UUBQ 2E5LL 2KDEB 3QAQA 1STNA 3S16H 1EEID 1P3QU 4MGKE 5EE0A 3NQTA 1STGA 3IT4B 4GLXA 2A6HD 4DNTB 4JI8L 1K51A 2WXOA 3X3MA 4QJFA 1C76A 4HPPA 4BWGB 3S15H 1I6VC 3SK8A 2G4SA 2FIDA 3HIZA 1EF5A 4TSSA 4HIDA 2N8NA 1BF4A 1S5CD 2E2HH 4NPSA 2ALYB 2AWNA 4KTAA 3GTJH 1TWGH 1JT8A 1HE8A 1N63A 3ALBA 3KW5B 3X3NA 5GMVA 3J7AF 1PZKD 3PUYA 3ZLZA 4ODGA 5JJLA 1GUTA 1HTLD 4JIOU 4PV1C 1Q46A 3MJ5A 4DV5L 2KZRA 4NAMA 2WX1A 1HA6A 4ZRZA 5D3DA 3RNCC 5JVG3 3I2ZA 5C0XJ 3L10B 3S2HB 1V1QA 3PREA 3ETRA 3UDIA 3T1HL 3WWVA 1S72A 1WR1A 3PRPB 1J7BA 2KOLA 5G3LD 1H4RA 2G1EA 2K0PA 3H9DA 1K9MC 2X38A 1GG3A 2QC8A 2KHSA 5C4JH 4PMBA 4C56C 3PRZA 3ULPA 1Z7TA 1NBFC 1PA6A 5BO4B 1ZXIA 3KLSX 4RCOA 2VQFQ 3TSSA 1RLFA 2MRPA 2MWSB 4B3RQ 1IL8A 4L5TA 3VR2A 1KC8C 2L0FA 1Z9FA 2K14A 2EMTA 1EZ8A 2BB6A 2MNAA 4FN2A 5E4WC 1UBQA 4KN7C 2WAQG 4F88A 1RAXA 2C5LC 2L00B 2YLMA 2AQ1B 2OJRA 1GUOA 2RSOA 3S1MH 1CFMA 4P2CB 5LL6S 3PIPA 3VTUA 5IT9E 1WM2A 4EZKA 3HOZH 5BN3A 4YHHL 4PS3A 3L9AX 3TMEA 2Z1CA 5GAEC 2E5LQ 1I6HB 2PE9A 2WHIA 1VQBA 3JW0X 1EYAA 2KWUB 2F0TA 2JA8G 2D11A 4A93H 2NVXH 1WTQA 4DNRB 3PRMB 2A68C 4HPMB 1SB3C 3A8KE 5ELBA 1QZGA 3V6CB 3K5LA 3E5SA 3URYA 2CFMA 2PJHA 4QUCA 2E2IB 3TIXA 2SDFA 1PTOB 1CHQD 1JOKA 3JAML 3ZRCA 2MQHA 3S1NB 2LGYA 3MC9A 3AEEB 2PYKA 4IPDA 5CBAE 1CSQA 3E6ZX 3PZ8A 5HHDG 2V1YA 2EE1A 3N20C 4XYQA 1TVXA 3J9CA 2KFKB 4IPHA 1SE9A 4LNNA 4NB3A 5JAVA 2XK5A 1XT9B 3IVFA 1F9PA 3L7ZC 4LDTD 4JWSC 2KKCA 2B2YC 2QW7A 4O2DA 2IWHA 1F52A 4TRDA 5IODA 3OTOL 3JSVA 4FHJA 4KGSA 1V5TA 3H7SA 3M63B 4KJOA 1MSGA 3CQZH 1RL2A 5AZGA 3IXSA 3P7JA 2RPQA 3WA0A 3K5MA 3AB9A 2VB2X 3SHLA 3TEHB 2FMCA 4AYBG 3U7ZA 5IWAL 4FHKA 4BXXH 3NVZA 1W6KA 2E8GA 5BN5A 3UINB 4XTCS 4B0MA 5CV9A 4G7OC 1Q8KA 2FUG1 1SYFA 2REXA 3DWGC 5LXIB 3UQBA 1ASYA 5JEAG 3AE1B 1TIID 3GV6A 4IJLA 2ZJRA 2PVGC 4PZ8A 1K53A 2N9LA 4IJHA 1B53A 4KHVA 1M1KC 1WRDB 1U0LA 1IBKL 3U9SA 4DUYL 2M2LA 3E9SA 1KJTA 5CGKA 1FEHA 3O13A 1QVCA 2KQSA 3SK6A 2KHJA 1IBXB 3WAPA 1LTBD 3A5ZB 4A20A 1GVPA 1RD9D 1VQCA 2O6VA 2RGFA 2GA4B 1V43A 2JK8A 3DEPA 5C4XH 2V4IB 2JRIB 3ULJA 4WH4A 4IFDG 1UEBA 2F3IA 5T1GA 2RQXA 4H0LC 4DAPA 3AULA 3Q8EA 1S3OA 3A7AB 5EKKA 4DXGA 4EGVA 4K6DA 4TV3A 3K7AH 3B2GA 4BY7H 3R2IA 1BMLC 2KBNA 1EIGA 4GDLA 5FJ8G 4W9JA 1R4NB 3A1QB 1MHWC 5EE9A 4LJZC 1JJ2A 3SFEB 1A3TA 4HJ8A 4X6AH 3AV8A 2KENA 1LV9A 1DOYA 3K5NA 4QQBX 1HEZE 3CSFA 3T13A 1XNRL 1CHPD 1VQ5A 2BA0A 2JEAI 1B9RA 3D6WA 5LMNW 3PHWB 2RSUA 4KSLC 2I38A 1VQHA 4G11A 2BS2B 3TEXA 4DR2L 2N78A 3H0GG 2V4LA 2JQOA 2L0CA 3MC0B 2BQQA 4JVZA 3RNGC 4OHJA 3GTLH 2LXJA 5IT9L 2FXQA 1GC6A 3BZKA 2GBRA 3RZOH 2V3NA 2LD9A 2ZT9C 1CT1D 2WQYB 1IBML 1XTDA 2HDLA 3W1YA 1TS5A 3DWQA 1Y56A 2Y0SG 3TS2A 3MXNB 4G3XB 5FR6A 4DU9A 1W2BA 2PW5A 1QVGA 4ZHPA 1EY8A 5IWAQ 4A3CG 1SBBB 2WXIA 1UE5A 1ZE3D 2OQ0A 3J7ZC 1OXXK 4TMAB 3W5UB 1K73C 1V81A 4WWPA 2A69D 5C44H 1K3RA 4MTKA 3GDEA 3APDA 4QF4A 3AEBB 3I4MB 2NB0A 1NCVA 4NY0A 4YCVA 3GTPB 3D0FA 1G8ZD 3FPPA 3ONSA 2KT7A 2R2QA 1AW7A 2DLBA 2HJ1A 1ZYRD 2BE5D 3AB5A 4W9EA 1SROA 1SE8A 5IGBA 3PQIA 1BUIC 2N1VA 2V3PA 1SNCA 4XT1B 3ITPA 2YVCA 1VQAA 4KDIC 2KN5A 4KV2A 4R3DA 4MELA 3H3VH 5CV4A 4KHPL 3VUYA 3X0WA 3AE6B 3HOVB 1TWFB 4JI1L 4QMGA 3K0YA 3MXUA 5ELNA 1SNMA 3CCJA 4A3LH 3DCGA 1V1PB 2J0KA 1STYA 1WOCA 1B4OA 1BBWA 3DLLA 5KYIA 5KRUA 1HZ9A 2ZTEA 3TDQA 2WB1G 4HCNB 4RHSA 3ZXVA 2K52A 2DYMA 5DM73 1G91A 3T16A 3HS0C 3CW2C 5BR8L 1L1OA 1SYDA 3CCLA 3OW7A 1Q12A 5CV5A 1Q7YC 4ILWA 2CKHB 2LXKA 2RR9A 1BNZA 1VQKA 4G57A 2LEKA 2WIIB 5C23A 4DR2Q 2KEEA 1CKMA 1LTAD 3O65B 4ME3A 3V3XA 2AQ2B 3D4DA 2INCC 3Q6BA 3BWUD 5LLIA 2H5XA 5K36H 1K8MA 4HJAA 1L4ZB 2KX0A 1R4NI 4DXAB 2FHTA 3CD6A 1YHAA 5JOBA 5HY6A 2ZXPA 4CDFC 4DHJD 1KLGD 5F2DA 2NVYH 2C9OA 3W3AA 4JCVE 1QOAA 3V2TA 1EFWA 4CHKA 1RHPA 1E3PA 1IP9A 2F0LA 1YNJC 3HOXB 2VH1A 3VFKA 1A62A 4YIJA 2C7NB 4AJYB 2K6AA 2EPBA 4M8AA 3MEHA 4GGQA 2XIWA 1F77A 4P75A 1X3EA 1LT3D 4R4IA 1WFYA 4MHEA 2MBHA 1WMHB 4JBMA 2AUKA 2Z0EB 2Z6KC 1ENAA 1RODA 4PYZA 4AUQC 4EEWA 5ELFA 3NG0A 2KN4A 2QGQA 1RRBA 2K8CA 4I7AA 1PRTF 1M4VA 4TKOB 1C48A 1HZCA 3OG5A 3CRLC 2B29A 4A3MH 1PGXA 2UU7A 4IO9A 4WWMA 3EGRA 2UXBL 5A2QE 2H89B 1O7ZA 3RR5A 5E3FA 4KHPQ 1F2RI 4MSMB 3RN9C 3FHWA 1QUQB 3KF8A 4HAEA 4JBKA 4LLGM 4PYUA 3BG3A 2RPVA 1I4RA 4TKNA 1H9SB 3RCZA 2A73B 1H8CA 1N6ZA 4K2KA 2Z6KA 1WXVA 2K5DA 1MD2D 1XPUA 2KJXA 2BTEA 4LF7Q 3Q22A 1JJCB 4F7XA 2NN6I 1BOSA 2EYMA 3NELA 1D1IA 1Y8PB 2PE6B 3MWYW 1M90C 5IYDG 1ZW7A 5BR8Q 2M19A 1VF7A 3PF5A 1TZOA 2Q2TA 3HUIA 1BO0A 3KUCB 2C60A 3U58A 2PVOD 4HRSA 4DF7A 2M17A 3ABVB 3EBEA 4XT3B 1Y8NB 1H9JA 2BCOA 4JX1C 4LCDE 2PMZB 4BAXA 4HJ5A 1OQRA 1IHZA 4BFRA 4IUQA 1BCPC 4L63B 1KFYB 1SF0A 1VZ7A 5C0XI 3DVGX 1CTMA 4MH0E 5CYUA 4L23A 3PUZA 3HK0A 3IAS1 4IM3A 4AWJA 5CMDA 1DGJA 3AEVA 3AM9A 1PFMA 5M5XH 1D5ZC 1Y14B 3BYYB 4HROA 2RDBC 2RHQB 2HJ8A 2WGSA 3SE0A 3TZUA 5C3EH 2RF4A 1PV4A 1E90A 2OEOA 2I1KA 2L05A 2ONQA 3ECIA 2AEHA 3QIJA 4M02A 2B63G 1SNOA 1YQ3B 4OWTB 3CWIA 2BYEA 1KDBA 2R93B 1GUAB 4ZRQA 3VH3B 4WWOA 4J3OD 2LHDA 2NCNA 4HXDA 2K33A 4RM9A 3HOUB 2LRWA 3QHTA 5JXVA 1R9TB 4N9F4 4XYOA 3RLOA 5DCNA 4BBSB 5I2YA 1TBEA 3P4PB 2O6VD 4C3IH 4KIKB 2WKCA 1MGSA 2CHZA 3E9IA 2MX2A 1HQRD 2EYLA 4J6IA 5G5HA 1SDFA 1SFOH 3S17B 1E0ZA 3RUZA 3CXCA 1QJOA 4A3EB 1KIXA 1DONA 3Q2AC 2D3BA 2ZVOA 3NY5A 1J6QA 4NW2A 4QIWB 3I72A 4TQ0A 3I5JC 3CF6E 1RCVD 3HKSA 4XQQA 4X3UA 5IE8A 2K8HA 3U4EG 3HGBA 2QEJC 1FXIA 4V0BA 4A55A 2HDEA 3DXJC 1QCBD 1XMQQ 3EECA 3C2PA 1S3SG 3VR9B 1E0BA 4CQNA 1Q1EA 2C35B 3H6MA 5JPNC 4DR3Q 2RHSB 4LTUA 3SXHA 1HR0W 2JXTA 1RFAA 2KANA 3MTSA 2DY8A 3GTQH 5GAGC 5EBDA 1L0VB 1ESFA 1WXAA 2XN9C 1I5FA 2BKFA 4HTHA 3D6CA 1A70A 1N60A 3MHSD 3Q8BA 2K22A 3Q14C 4M0WB 3AFQA 4J1MA 2OF1A 2PPBC 3DHHC 2K25A 1IYUA 3AEDB 3HP3A 3AFPA 4Z9CB 1LTSD 1SSOA 5DNFA 3RD4A 4ANWA 1PFDA 4ZK9B 3DVNV 1OTCA 1BVSA 3SDZA 3AU5A 3QWZB 2WS3B 4HEDA 2L52A 5A2QL 4J15A 2Z0DB 3WCQA 2DY7A 2N55A 3TP5A 3J7YW 1UZXB 2LI5A 4AH6A 3DPDA 1K3BC 1MFWA 2K39A 1BDOA 3KF6B 2K04A 4OXPA 4JI0L 1WSPA 4WJ4A 4N58A 1PTOF 1A3UA 3TP7A 2XTIA 2DZJA 1B9NA 3GZNB 5BMIA 1IKLA 1B2TA 2Q8RE 2Z0SA 5JEAH 1V97A 4JV5Q 2GI9A 4A8XC 4GNXC 4DDGD 3HOZG 3UF8A 4MDKE 2E3TA 2NTTA 4GN4B 1EQVA 4JC0A 1OXTA 1QLBB 2JYEA 2PW7A 1DCZA 5E1FA 1Q82C 1GUWA 2O2VA 1KNAA 3BINA 5TR5A 3RZDH 5LMUL 5EPLA 3PUVA 1CA5A 1PH2A 1EY6A 3M85A 2OQKA 2B2WC 3LJ3A 3QK0A 4MGZE 4WAAA 1MI0A 3GTGB 3R7QA 2N1WA 2K50A 5LNK1 1CK1A 5JJIA 3NUHB 1C9OA 3QX1A 4ACFA 2ATWA 2H88B 1RIPA 4GNXA 2NVQH 3I4MG 4GKJL 1V86A 4JI6Q 3A33B 3HHMA 4OO1I 1C9FA 1NTGA 4HR7B 1WYGA 4K6LA 1V6EA 2VQEQ 3SGIA 1TKGA 2INNE 2YU9B 2DAJA 1ONLA 1YZ6A 1TYGB 4UP8A 1PFSA 2D0PA 1RJTA 3IFTA 2KO3A 3CF5A 3H0GH 1ZOYB 3IT6B 2I2YA 1Y69U 2B2WA 2ZXOA 4LF4L 1PRTD 3V6EB 3Q6SA 4WJOA 4WJPA 1VQNA 4BXXG 1SGHA 2JT4B 2EQSA 4IPCA 4GLAC 1F9QA 2EY6A 1G6ZA 3FILA 3PO0A 5IY0A 3KBGA 1FL0A 1GD7A 4GDKB 1Z5SB 3SR6A 3S14H 3RMKC 2I5LX 5C3WA 3CCRA 2OWOA 2O2LD 1I4PA 5LL6X 3G71A 3NE5B 1VMCA 3QO2A 2C7HA 2LGXA 4KZCA 3T9LA 4U68A 4RF1A 2VUMH 4JOIC 1IL2A 4A3JB 2K3UA 3AE7B 3M9BA 4IUNA 2WXRA 3MC8A 3S2AA 1OXUA 5C4XG 2KWVB 1BBUA 4C4VA 1H9RA 3BIID 2V3SA 2Q2IA 3QC8B 3NHHA 2WXHA 1PUTA 4HLEA 4BY7G 3MP9A 4A3BB 4MJSA 1JWBD 1A15A 3Q24A 1XCQL 4C3JH 5LMNL 3HOXG 3IFDA 3KFUA 5D6JB 3PO3B 2PKOA 5NUCA 1LT5D 1QOHA 1ZXTA 3HKZG 1VF5C 2L9HA 3AU7A 4I65A 1K83H 5I9PA 4JOIA 4X64L 3K59A 2KK8A 2NPTB 2AYOB 4C7YA 1YNJD 4DK1A 1EQQA 3PUXA 4LK0M 2B2VC 1KLUD 2CWAA 3NUCA 1FGUA 4OGQC 4GKJQ 2OTJA 2XWBB 1WTOA 1Y1VH 1AH9A 4XWTA 1HQMC 1OTRB 4XGAB 1PFNA 4YSZB 2A4ZA 3FPUB 4KHZA 2RA4A 1WJ4A 3CU7A 4LNKA 2RSNA 4P72A 1N33L 2RDHA 2QCZA 1X56A 3S1RB 3AEAB 4JQWC 5BYSA 3BVZA 4A3FB 2A1AA 2JA7G 1K8OA 1VZ6A 4ZUJA 1XTCD 2GVAA 1WM3A 4FP5D 2ZTDA 4AOFA 1S5DD 3S1QB 1Q1OA 2J0MA 2MEKA 1I4QA 3M3YH 3RNUA 3RULA 3EUB2 3U9OA 1XO3A 2B2VA 1E2ZA 2C9WB 3MTNB 1LABA 4E3CA 1DD2A 2M9VA 4B3TL 2KVMA 5HI1A 1P1AA 2CH4A 5HURA 4HCPB 1O7LA 2F0IA 4K1RB 4DNIA 1JCKB 3W1SC 4M01A 1SXTA 2MSED 1QILA 2UUBL 2XNAC 3L4PA 3S2HH 2D3GA 3ZDMC 3NWTA 1WD0A 4IN3A 5HFYA 4ARIA 2BOSA 3STBC 2BBCA 1YD8U 1CKNB 1J8CA 3ZRFA 1RYJA 1OXSC 3EVQA 4F87A 5FLXc 3BS1A 2FCSA 3QOLA 5ELCA 1CJEA 1UBIA 4A3LG 4K3BA 4EE2A 1G2SA 2ZXRA 2QIEB 3DWAA 3C3LA 4C3HG 5JVH3 1A6XA 1JB7A 4MH8A 2MBBB 3ZJVA 2PMVA 2Q5WD 5IO9A 3W1SA 4ICVA 3H3VC 5LMNQ 4A3OA 4YCUA 1Z6HA 4ZAIA 3V05A 3KLWA 2XSCA 1D4BA 3K81C 1B7YB 1II3A 4X64Q 4LF8Q 3CAMA 3EC8A 1E7PB 4OVUA 3GD7A 1KXLA 3RMHA 1RKNA 3A7LA 2CR5A 1RDPD 5E6JA 1ILPA 1C4CA 1EIYB 3OW2A 1VDVA 1CZWA 2R92G 2ZZPB 2JA6B 1S5ED 1SAPA 2OT2A 1OXVA 4W9KA 4BBSG 2YYZA 2VH2A 2L32A 3A9JA 1ZYRC 2BE5C 1SNQA 2KYWA 3QARA 1XNQQ 2BVCA 4LF9L 5I4DA 4A3EG 3PO2B 3DBLB 1TJEA 3LYYA 3I55A 3G4SA 2J7ZA 1LUZA 2VXWA 2JA5G 2GMIC 1UGJA 1UAPA 2E2IH 1F9SA 1PTOH 3R93A 5CHVC 2PTLA 3TP6A 3S1NH 4B3RL 2ID0A 1KL9A 3QJYA 4W9CA 2WP8J 2F03A 1EY0A 5EE1A 5C3JB 3B2FA 3HOWB 1YNXA 2KQ7A 4X65Q 1I3QB 3V62A 3AN1A 2B63H 2MJ8A 2BF8B 4WRDA 2UWQA 3VXWA 3FC4A 2BYTA 2K5WA 1OFFA 4A3MG 3H09A 3GP7A 3CMEA 1B1ZA 4CHTB 3CCVA 1WGYA 2Z59B 1TS2A 2I5MX 1XYIA 3M7NA 1G6PA 1IYVA 1ROEA 3OJ3A 4BZAA 2MW5A 1ESRA 1YJJA 2KTRB 2ICIA 1NYQA 3RT3B 2W54A 3VYRA 3K9OB 1FRRA 3H1UA 3UI3A 2BPSA 3VR8B 4OVZA 4Q5VA 2A8VA 1G2TA 3PSEB 4HDQA 4NDXA 2PMZE 4HIMA 2G3QB 1NR2A 3I91A 2W9NA 1MSHA 2D3CA 2MBOA 5HKHA 1QF6A 2N88A 4XDXA 3I3CA 3KDFB 1SIJA 4C80A 3J80c 3RYTA 3F1ZA 4YY3L 3D3RA 1YHBA 2YTXA 3HOYG 4FO2A 1VS0A 2RMMA 1VQ4A 1IBLQ 2KMAA 4UY8C 1VLBA 2D3AA 2LKVA 4ANXA 2Z9HA 2WU2B 3ZNZB 4JPSA 2VRRB 4ALPA 3K0XA 1HUNA 3PPAA 1B9MA 1SNDA 2O5IC 1WTRA 2Q8TA 1WR6E 5JZEB 1SJHD 2KC2A 2XVSA 3ULLA 4DR6Q 3P1HA 2VZKD 4KSKC 1KOTA 4LF9Q 1N36L 2MP2B 1N34Q 1SMYC 1SRUA 2ZCBA 1KABA 4UHVA 3J81c 1LM8B 2W82A 1MI2A 2XGTA 1SSNA 2Q2UA 4GZYC 2INDC 5C3EG 2MP1A 1ZUD2 4AQYQ 4MM3A 3AMUA 1GHKA 3W2DA 1ZDXA 3BZCA 1PH6A 5T1IA 1E7ZA 4HCEA 3ZYYX 1VQMA 4DAVA 1O78A 1EYGA 2LGIA 5M3MG 3I8ZA 4N6EB 4BBRB 4ICUA 5AFWA 4KLKA 5J18A 1U4RA 1HCZA 4ITKA 4QIWE 1AE3A 4YSYB 3W1GA 4BA2I 2R7ZB 2IW3A 1JW9D 2L76A 4RGTA 3JAMi 1PGAA 5CR3A 3DBLI 1WFQA 4YSXB 4LAAA 1WTVA 1T0RC 4V190 3WALA 5C6AA 4R4TA 4C3IG 3I63C 4XDDA 1TY0A 1SE3A 4LUZA 2CKZB 3OHXC 3N1XC 2D0OA 5COYA 1STHA 4OVVA 2F0PA 4US8A 2EDGA 4HMIA 4CGYB 1GOZA 2VB3X 1T5EA 2K8BA 2YTVA 2Z4IA 4B6WA 2EY1A 1HR0L 4URKA 3H94A 1VQ7A 2DUDA 2R7FA 3CC7A 3E3XA 3CCSA 3LDZE 5IN7A 1QNUA 3GTOB 2BW2A 3ZDTA 2ON8A 3NOBA 1N32L 3H7PA 4L8JA 3I4MH 1BCPB 4HDOA 4XXEA 3RNBC 1GHJA 3FEWX 2IHFA 4YY3Q 3GTPH 1YN4A 3S2DB 3I73A 2KJ6A 3ZJYC 2J53A 1EWHA 2H1EA 1U4AA 1EZ6A 2O5JC 2CVRA 4P1BC 4A3BG 2F0UA 2KFJA 1EY9A 2MJEA 1YJ9A 2DGYA 3DQVA 3GTMB 2KHIA 1IZ6A 1ILQA 3I7FA 1JB3A 1TWFH 4GOCA 2WLBA 2HE7A 3PV0A 4N8FA 1Z2MA 5FKAC 4NNJB 4GOPC 3U4ZA 2CU3A 2HIVA 5C0XH 3PV1A 4PK1A 3L13A 2ZEQA 3N9YC 1N36Q 3B1LX 1NJIC 1NEKB 4KDLB 3CCEA 5DPSA 2WV6D 2KQ3A 3NTIA 3KH0A 3TBIB 3AEGB 2JWUA 3QJZA 3SHQA 2F0MA 1L7YA 2KDMA 2MA9B 1DYQA 3ZGZA 4A3DB 2JRHA 4DV2Q 4EZLA 2PO4A 4N9PA 1WE6A 3QQ8B 2HTME 3VTWA 2MPMA 3VR5A 4PMCA 4DR5L 2XRSD 3PSIA 1FFUA 1NYRA 1LTGD 1P7EA 1IPGA 1DZ1A 3K8AA 2OXPA 1Q5WB 1QE6A 4GOPA 2KDBA 3TEYA 3Q0AA 4HJ9A 3A4SC 4TVAB 3GTKH 3FKIB 2KDFB 1WTPA 2NWGA 1ENCA 3I3TB 4NJCA 4WWNA 1CZGA 3BDLA 1YQBA 4GLSC 1JWSD 3OSOA 4LF6L 2JZZA 3FAHA 3KBXA 1WRIA 4UAIA 2JY6A 1WY8A 1T5XD 4FF3A 4BBNC 3PGEA 3HOXH 1Q0WB 1IYJB 4DKAC 5MPOA 1HR0Q 2HQLA 2AQ3B 4HIOA 4K14A 4W9LA 3TEWA 2JJQA 1XQQA 3DWMA 2IHEA 3BY4B 4P16A 2G9HD 1I50B 2L15A 4DAYB 1N32Q 4A90A 1AN8A 4J6HA 4WJWA 1U4LA 1TWCH 3DEOA 3MZ5A 1FNVA 2JPHA 2KJHB 1XMOQ 3MHBA 4JLCA 3DOWA 4MSQB 3M4OH 5T8IA 4ABNA 2L4NA 3STBD 1WX9A 4FADA 1DM0B 2JVCA 1U5KA 4ME5A 2IGGA 4HK2A 4IC7B 4B0EA 1WZ0A 1AP0A 1WJUA 2JA7H 2V1CC 3WDNA 1XLNA 2WWZA 1VQEA 4UP7A 1XXGA 2WXMA 3F2UA 1NNXA 3NQIA 1KLVA 2LXAA 2KECA 4A3KB 4HKQA 3HVZA 3VUXA 2DYBA 2X6GA 3CP0A 1Q90A 1EWIA 4YCWA 2VUMG 5M3FG 1WTWA 2LGSA 3SU8X 4KMUC 1Q10A 4BY1B 1XJVA 3H8HA 2L8JA 4HSPA 1HTPA 1YNTE 4N59A 1PMRA 2DYOA 2GOWA 1FRDA 2LMCB 1VQIA 4XDCA 1NY4A 1D1KA 5M5WH 3RLFA 4DR5Q 4X66Q 1HH2P 2PQEA 4MZ9A 4OL7A 2RDFA 2Y5CA 3IG3A 1L1OC 2N7DA 2NVXB 1FO4A 1PRTC 1DOMA 2IGDA 4B95A 1QNKA 2F0QA 2F4VQ 2K5NA 3ERSX 4C3JG 3G6EA 4IZ8A 4G7ZC 2M56B 3ZNHB 3AECB 3IAYA 2KUMA 1EQTA 4BBNF 3A9KB 3AE3B 3C1EA 4LF6Q 2SEBD 2NTSA 4C3HH 1YN3A 1K0SA 3KUPA 3OAWA 4FYDA 3DM3A 4IM0A 1BQQT 1Y1VG 2GN5A 2F0NA 3D31A 2QKIC 4LF7L 4FJYA 1HUMA 3OPOA 1Y1WB 4XX5A 3W5VB 1GB1A 4QL5A 3CC4A 2PPHA 2KCMA 4YTNB 1Q3LA 4IQZA 1E8WA 2WU5B 2R93H 3TBLD 1UE1A 3UI2A 1L6VA 3CKIB 2JE6I 4MIUA 1C79A 3NTHA 5C3XA 1GO3E 1B8AA 2UYZB 4GS3A 4NAWA 2R92H 1EYDA 4BBSH 1WH3A 1E7VA 3CSTA 3CCMA 4IWPA 1I35A 4ZRKA 2LHEA 2MJDA 4XIGS 4KY7A 3ZNGC 2JQRB 1B3QA 3P42A 2ZPYA 4L6TB 2CW0C 3MFYA 3VR6A 4A3EH 2F0JA 4IUPA 2I46A 4QUFA 4POGA 2KTFA 2DNCA 2NBWB 2G45B 2JA5H 4XC2A 4LDTB 4RF0A 1HA5A 2NZ1D 4DK5A 3ND9A 5E4XA 2MLBA 2KC1A 4CJ2C 1XWEA 1WD1A 2ACZB 2J4XA 1S5FD 1WXMA 2LY7A 1T3QA 1WWTA 2GB1A 4C00A 5CX3A 4DWFA 5D7GA 1UE7A 3VR4A 4N8X1 4DR1L 2GVBA 2RD0A 4CJ1B 4CKCA 2IY0B 3WAOA 1XX8A 2DJGC 4DK3C 5AJ3L 2ZJPA 1JWAD 2KOXA 2FINB 4HJKA 1YJNA 2L55A 2PI2A 4NMZA 3E9HA 4RFBA 5IP9H 1KM7A 1WTHA 3QOJA 3AU4A 1LTLA 4A6QA 3K7AB 2LVPA 3FMCA 3I4NB 1E1OA 1N8RC 3RLNA 1PYSB 4LNQA 3NXWA 4L5QA 2FCMA 2DN8A 4CKEA 3ZTDA 1SMYD 2EKEC 1OQQA 2FBWB 3P20A 4FDBA 1PHJA 2OTLA 4JI3Q 1K8AC 1PYWD 4OEMB 1XMQL 2DHZA 3PT2B 5IGGA 3ML9A 1FNUA 4O0AA 2M8SA 5L83A 5J1ZA 2Y0SE 4DR3L 1BBXC 1EWYC 2IBIB 3TEZA 1PVOA 3GTLB 4A3GB 2EY5A 3HOYH 2F0HA 2JXMB 4KKJA 2QMTA 3NZUA 4A3PA 4B3MQ 1VZ8A 1NBWA 3PZDA 2CCZA 4K81A 2GBJA 2H4OA 4D2KA 2TSSA 1JALA 4HKZE 2Q2HA 2Z8LA 3I70A 3GTGH 3K9PB 4ZRPA 3R3MA 4RMFA 2B8GA 4A3IB 4GKKL 2FFKB 5GAHC 4BS9A 1HNWQ 2ZCCA 2PNRC 1WGGA 2D9UA 3UE1A 4JG2A 1MBYA 1U4MA 1TT5B 4WQMA 4B08A 2NS5A 2NVTB 2AUJD 5E7NA 5EGTA 3M7GA 1YEZA 1NVID 1PTOC 4JV5L 3DVNU 2WXQA 5K5PA 4F8MA 1A2TA 1LTID 3RNAC 1SJED 3T8MA 2K28A 5J3BA 1ZDVA 2FIFA 2M0AA 5M3MH 2EKIA 3RNFC 2L7RA 2D62A 3HRDD 5FLXE 4DR1Q 2WXFA 4R9WA 3APFA 1Q1BA 2DBYA 5C2TB 3KLSA 4PMWA 5AJ3Q 2L3ZA 5JEAJ 1N5WA 3C8YA 4H02A 2KCCA 5FOBB 1E8ZA 2LJ5A 2V9HA 4OX9L 4NJ7A 4R1JA 1YIJA 1UH6A 2KLGA 2IO0B 4RA8A 3F2CA 2B39A 5ISRA 5DM63 3NBHB 2KDIA 4JI7L 4ZKCB 3EIVA 1ASZA 1VMPA 1L6UA 2I0QA 4A3DG 3Q3FA 1A8VA 4JI6L 1PXUA 4IFDJ 1L5PA 2AMCB 2A6ED 1PH4A 1E1TA 2JA9A 3KUZA 4XZ4A 3R2TA 2O4XA 3OOCA 1C3TA 2VQEL 4A3JH 3PGZA 5IGFA 2KFKA 1D6EC 4BKSA 4ZCKA 4MT5A 3BDOA 4ZOHC 1XPOA 3ZXRA 1EWCA 2XWJB 2D5DA 3P2BA 4GSWA 4NZLB 3JC66 2UUAQ 3FKIG 3NK9A 4KKIA 4NP5A 4PQXA 1KD1C 2JYTA 4F8CB 1NMGA 5CBEE 2JYOA 4JE3B 3MJWA 4A3BH 2G9DA 1V80A 4DV1Q 2IL8A 1F2ZA 1EYCA 1FCLA 5JJKA 1M8AA 4RM8A 3I90A 2CH4W 1K8GA 2VZAA 3EN2A 1I94Q 2KWDA 3PO3H 1V1OA 2R61A 5IIFA 5M5YB 3OMCA 2CQOA 4RAUC 1ML0D 2NBVB 4BOZB 4GKKQ 1CSPA 4DK0A 4LNOA 5EE3A 1ZP0B 1E22A 4ZQ3A 1YMHE 4PZ7A 4CDDC 2AKWB 2F0GA 1PYBA 4ANUA 1LQBA 3PVLA 5DPTA 4FJZA 5HG2A 5EKIA 1T0YA 3TP8A 1ZKHA 2MQJA 4IKGA 3U30A 1IBXA 4DHJB 3P1MA 3RN5A 3S1RH 2BYVE 3A8IE 2IYDB 4A3FH 1WIAA 3CHBD 4MN3A 1D2BA 3AE4B 4DAMA 4Y7NB 1LT4D 4DV0Q 1UEAB 4AIMA 3S1QH 3CC2A 3PLVA 3R8BA 1WF9A 3K57A 4CYEA 1JE4A 4OX9Q 2KJRA 2HT1A 3CCQA 3MXPA 3A1QA 4ID6A 3UIOB 4KV6A 3J80E 4JI7Q 4TUUA 4W9IA 1ZEQX 2D2QA 1HTOA 2WDRB 5KNCA 4S3SA 2ES2A 1UE6A 1TTNA 2B2TA 4XYCA 2QF7A 4YTPB 2EMSA 3VA5A 3W1BA 2NN6G 3H3VI 3EQLC 2PZTA 2HHHQ 5C4HA 1C7YA 4OZAA 2RCFA 4A75A 4FLHA 1VQJA 2JEBI 4L5SA 5FLXL 2AWOA 1HFGA 3SFDB 2EIFA 2K7VA 5KNBA 3A55A 1O7YA 3HOVG 2K1FA 3B9JA 2IT1A 1LO5D 1PZID 3J81E 3SEBA 1YOVB 4GN1A 1E24A 2IDYA 3OMGA 5C0XG 3DUZA 2IY1B 5JJZA 3MXNA 1Y8RC 1E6EB 5GXGB 3EFUA 3IRBA 1PFBA 3LX0A 1XEEA 2M00A 3PIO3 3NENA 2MFIA 2KVZA 1YN5A 2WXJA 3H15A 4ANVA 2N9EB 2RBMA 1E7UA 2DWQA 3N1YC 2KAJA 1P7FA 2XK5B 2WAQB 1V8CA 3RI7C 4DV4Q 3JSVB 5M3FH 2JA6H 3C0RB 1O7IA 2RKSA 1EU3A 4G7HC 2JZ3B 3CMMB 1VDZA 2GRIA 2F0FA 3DMUA 3HFZB 3MXGA 2F3WA 3I9V1 4REZA 2JWZA 2F52A 3RNEC 4K7UA 5AEKB 1OEYJ 3B6YA 5I6YA 4KZ0A 3NVVA 4DDID 5FK9C 1SFOB 1I4XA 2JA8B 1WYWB 3MFGA 1PH7A 1JE5A 4R8IA 5H92C 1N61A 2OEDA 1EOVA 1FXAA 2CW0D 2LXCA 2SNSA 4H13C 4FVMA 2F0OA 1LLRD 2MBEA 4B3SQ 1NENB 3A9KA 2EJGC 1V1PA 2F0DA 2PQAB 3APCA 1ACCA 2YTYA 3EFXD 4LF8L 3DHIC 4JBWA 1E5WA 1I3QH 2EY2A 1J9OA 1AE2A 3IHPC 3RD2A 4DUZQ 4QGUA 2KLCA 2O6VB 1X3QA 1H95A 1LXDA 3HM3A 3AH7A 4IURA 4FF4A 2WDVB 2E74C 1EY4A 5JPMC 4K0KL 3ZW3A 4H44C 4EZJA 1UWMA 1XNQL 4IWQA 3X23A 2QA4A 1WJJA 1F9JA 3GZNI 5C5LA 1TKEA 2PIAA 5LHY1 1ZPSA 2J52A 4GDLB 4WURA 2E76C 3T56B 3VYUA 1WI0A 1XLPA 2GBKA 2MCNB 1SNPA 5LXHA 4EUTA 1R4PB 2AL3A 4APVA 4BOSC 4NXNQ 3NTKA 1E9MA 3J80L 2FE8A 1HPCA 5HGTA 2K4KA 5HGQA 5EPKA 4KVGB 4G4KA 1WGHA 2BYFA 1TWAB 4W9HA 4X65L 3DDCB 1KDAA 3PIOA 3EA6A 4GN5A 2UUCQ 1HNZQ 3BK1A 2I1JA 2N9XA 1WGDA 1RF2D 2SOBA 1WMHA 1GXDC 4W9FA 4FXDA 5D65A 2WINB 3L16A 3NEMA 2JXXA 1WX7A 4M1UB 2EJMA 1WXQA 2JSOA 1MG8A 2WXLA 3LB8C 1YITA 1KTKA 1S5BD 1WYDA 2K5HA 3CIRB 5BYRA 1KRHA 3P4SB 4FXKC 5C5MA 4S0RA 5JHBA 4NXML 3J81L 4KX6B 3P75A 2J7QB 3L0WB 3GO5A 2IZVB 2CJOA 2BH8A 4HJ7A 3KYHC 1SYGA 1QUQA 1RM6C 5AZFA 1FD7D 1D7QA 3L2PA 4A76A 4KD3A 3AXCA 2RVLA 1H9SA 1TWHB 1VQGA 1KAAA 2ASBA 4S17A 3GV3A 1WJNA 4WIPA 3GE8C 2P5ZX 1NE3A 2BB5A 1YBYA 1UF0A 2FCNA 1PTOD 1NUCA 2R93G 1J7CA 4KKSA 2D2CC 3GOEA 3KWVA 1IBLL 3HOUG 2IJ0A 1C1YB 2WXPA 2R7ZH 3FP9A 2BH2A 3TRZA 2NR2A 1N62A 4JYAL 5FLMH 4KKTA 2JU6X 4FF2A 2IGHA 4OZBA 1VQ8A 2KACA 1I6HH 4HJGE 4LFCQ 3BVMA 3FRPB 5A35A 2LASA 3K80C 4EQPA 4JI5Q 4K0KQ 4GMVA 1QZEA 4DR6L 3QCAA 4E74A 3NBIA 2MBQA 1N34L 1KNEA 1R7SA 3HVDA 2KQ4X 2Y0SB 2UXCQ 4QCLA 4AQYL 1WJ6A 1GAQB 3HEJA 5DLQE 3J7A5 1HZ6A 3OJ4B 2AL6A 1UELA 2LFNA 2DZMA 1SYBA 5CV6A 3OYYA 3SK5A 3TREA 1GJXA 1WGKA 3L54A 3W9CB 1L1OB 1GNUA 4YT0B 1PRTB 4LF5Q 2Y5PA 4DQOC 1UGMA 3IL8A 1FYCA 1UD7A 3S2DH 2HQEA 3NVYA 2K6DB 3DWPA 2B3GA 3ZTCA 1X54A 1FNWA 4KK7A 5IGEA 5IP9G 3VDZA 3TL5A 1FJGQ 4E71A 3A4RA 3GTMH 1WCMB 1SR3A 4KIKA 2HUGA 2WXNA 1VR9A 2D07B 1PZJD 3OWEB 4NXMQ 2PW9A 1IKMA 5ELEA 4QY7A 4KY6A 5JHAA 3QIAA 4RWSC 3N1ZC 4OIJA 1X32A 1NMFA 1YHQA 1IGDA 3DBRB 3PHXB 3VHTC 4A3DH 4LJPB 2WB1B 3KLRA 1WI5A 3NS8A 1FD6A 2INPE 5IP7G 4LW1A 3Q8DA 1A0IA 1BUVT 1ZGUB 2FMMA 3LWUA 3C1FA 4AS1A 4IFDI 1K50A 4ZKBB 2DNEA 3DBHI 4DBGA 3I4LA 4HN7A 4IWOA 4M0WA 5CHFA 4JYAQ 1RFKA 5H8YE 2UU9L
chains in the Genus database with same CATH topology
1XLOA 2Z4HA 2LFIA 1V8QA 4FXCA 2J42A 1TKWB 3H91A 3M3YB 2WP9B 4C2MB 1WTXA 4LMQD 1B44D 3D8GA 1IGCA 4RKBA 1JICA 3LXFA 1YNND 1TQOA 1EL0A 1DJRD 1TS4A 1J8IA 5FR3A 2EXZA 4RGOS 1TY2A 3BDCA 1PGBA 2YEPB 1D5XC 3SR1A 2R3ZA 2B8FA 3GS2A 1FGBD 3VRBB 3E56A 2Q8IB 2JX5A 3TUOA 4KN4C 4B9WA 5EPJA 1I4GA 1Q8IA 4KI0A 1CM9A 1SE4A 4EQOA 3NRZA 3RFZB 3D4RA 1JORA 1EY5A 4C1NI 2NN6H 2CQAA 3S9WA 4BA1I 5I2XA 5BYQA 3CRKC 3EROA 1XF5L 3Q69A 5D3IB 3IAM1 3QG1A 1RWSA 5KGUA 2E2JB 1ZKOA 2Y3AA 2A6EC 2X6LA 4EQNA 3AE2B 2B63B 1HRJA 1CZPA 3ONAB 3ZQ4A 1F9RA 4RKLA 3S16B 3Q8FA 1RTOA 3N52A 2K01A 2K5PA 3S15B 1PLFA 2E2DC 2A5HA 1MPEA 1EIHA 2NMQA 2XRQD 1AZQA 1L4DB 2E2HB 4DXFA 4OW0A 3GTJB 1TWGB 3KQ4A 3A54A 2F0SA 1B50A 1TR5A 2HCIA 3TZDA 5IGCA 2B2YA 2BA1A 5EBCA 2J0TD 3VQIA 1AEXA 2L1BA 3AMZA 2C5CA 1TKYA 3A56A 1RTNA 4RGMA 2NUCA 1H9KA 4UDUC 4X3TA 4HCSA 1E10A 3LNNA 5C4JB 3DHQA 1Y8OB 1K52A 1EM7A 1GUSA 3GB1A 4OIKA 4O1NA 4HEA1 4YTMB 4MACA 4ULLA 5AUIA 1QOGA 2NBFA 1E2VA 1I4HA 4WORA 3KK7A 1AYFA 3S1MB 2EOTA 4PNYA 2BS4B 3K6OA 3HOZB 2VZKB 1ET9A 1FR3A 3FVQA 4DFAA 1U4PA 3MVVA 4A93B 3NWSA 2B2UC 3FILB 1LTTD 2WACA 3TN2A 4U673 2N7JA 1EU4A 1KF6B 2ZW0A 4DN4M 1QQRA 1J7AA 1LTRD 2K1BA 3GQBA 1KH0A 2CJNA 2QDBA 1JQYD 4K8JA 4KGRA 5FO7B 4OO1H 3P63A 3C46A 4Q2JA 1YJIA 2B2UA 3AEAB 2PZWA 1F2LA 2D5GA 3T51B 3P4PB 2F3VA 1DXMA 3SVMA 3OIPA 3CQZB 3I57A 3NVZA 4YWGG 4ZUIA 2W3RA 3WOFA 3K58A 4USAA 1JRPA 1T6BX 1GUGA 3AE9B 3OIQA 3VRAB 4XQNA 4CBVA 1B3AA 1QKZA 3BK2A 3BYTB 2WDQB 1ET6A 1I7HA 1E2WA 1JROA 5BMGA 1GPXA 4EVOA 1AWDA 2BT6A 2F0WA 3LWEA 5C4XB 3IKJA 1C78A 2SAKA 4YXDB 1A3VA 1EOTA 1JOQA 4FXGC 1F2MA 2IPKD 3BZDB 4IUUA 3GTKB 4RGNA 2IX0A 1X3PA 4ZYSA 4BY7B 3AE5B 3AE8B 2JP1A 1JOOA 4DGZA 2PCFB 5ELDA 1PDQA 1STEA 4IUTA 5KYLA 1AZPA 1DOXA 5CORA 4US9A 2QCPX 4H7BA 5FO8B 1MHHE 2MH7A 3HKZB 4TQUS 4ZHOA 1FIQA 4WFN3 4TQ1A 5BN4A 3RPFC 2NYZD 5DEHA 3V96A 2WKDA 1TWCB 1IW7C 4H2AA 2F0KA 1JMLA 1O80A 3M4OB 3T3OA 3RZOB 2EYFA 5CV8A 4QB4A 2JA7B 2QILA 2WXKA 2JSVX 1YQ4B 4RCNA 2ICEC 1UWXA 1C4AA 1JC7A 3VYSA 5C44B 4KY5A 2F4IA 1S4ZA 2K03A 5CC4A 3NVWA 3T3NA 2L12A 2LUMA 4CJ0B 1UNSA 2EJFC 4AQ7A 5M5WB 2QJLA 2KEDA 2WNMA 5G5GA 3NS1A 4RNAA 4IDIA 2A68D 4C1NK 5M9OA 4X3KA 4RH6A 4NKLA 5AUKA 2K5QA 3KWLA 3G6JB 4C3HB 1STBA 2IX3A 1GUNA 2X69A 2L11A 2HCCA 3EJIA 2BDOA 4HMJA 3T53B 1SE2A 1KDCA 2R92B 4PT5A 1DOLA 4A9AA 3N6RA 3HG9A 2I07B 1TS3A 1W6JA 3PZ7A 1JWMD 1L0YB 1BR9A 3PUWA 3ZJUA 2YEPF 1NSNS 1HHVA 2NVYB 2L5TA 2MUYA 4OZCA 3DM1A 1EEFD 2JA5B 5IGDA 4ARCA 4K2LA 1FM0D 2KA7A 2RDGA 2E6XA 2CHBD 4KGTA 5D14A 4E6IA 2L83A 1QB5D 2F0EA 2A6HC 2ZW1A 5J22A 1DOKA 1BCPF 2B2TC 1CI3M 4A3MB 1BXTA 5KEEA 4XQJA 4LK1C 1FMAD 4K5WA 1CQVA 4HSVA 2EYJA 3WOEA 4MM3B 5FO9B 4X3SA 3VYTA 2K32A 3ERQA 2PZUA 5CV7A 4IALA 3Q8CA 1VCIA 3E0JA 4L2YA 1YNNC 3U52E 2EYHA 1XLQA 3NPPA 2N9KA 3M4YA 2F1MA 3HOYB 4DAYA 1F2RC 2TMPA 1STAA 1NR4A 1F0ZA 3AEFB 4IOIE 1H9MA 3G7LA 4IFDH 3VA7A 4JWUC 3NSWA 1VJKA 3HZXA 5KIXA 3MA2B 1QOBA 2AX5A 1QG7A 5M5XB 1SYEA 1AFPA 1C77A 1C4PA 1A2UA 2BDNA 5C3EB 3L3OC 5KNDA 3FDTA 1C4QA 3T4AC 3K5OA 4O42A 5M3MB 1SEBD 4FNFA 2R6GA 1OO9B 5IOCA 2VNUD 2LMCA 2W55A 1PDXA 1SYCA 1R4QB 4WAFA 1FFVA 4C3IB 5J39A 5EQ0A 2L1AA 2BS3B 2LS01 4XE0A 3R3OA 4K5VA 1ENFA 2EVBA 4K5XA 3BVGA 2MGSA 4XWWA 2K05A 3NZ3A 3J7AV 2HDMA 3GTQB 2QSDA 2W3SA 5G3LF 2EZVA 1IUEA 2LJIA 1TU2B 1CQFA 5EKLA 2EYPA 3MHZA 3SK4A 3PMFA 4RHRA 2A74C 1HXYD 2K9XA 4AYBB 2OHFA 2FJ2A 2B76B 1U9RA 1L0XB 2KMMA 4J8QA 2WXGA 4L1BA 2SNMA 4ZLTF 5C4ZA 1D5MC 1IW7D 1UUPA 2V4DA 1MVKA 4K8IA 3RZDB 1LACA 4IUVA 1GB4A 1QOFA 1TT2A 2F0VA 3D4WA 4KD4A 2KCNA 2NVQB 3QB3A 1JR0D 5I6WA 4FF1A 1FCCC 4CKBA 5BMHA 1CA6A 4OO1G 4N9TA 3Q23A 1EFID 2EYOA 1N5XA 4I7ZC 1HZ5A 4Q0FA 4B9XA 3VR3A 5EJWA 2MJ3A 3H0GB 1Z47A 1HFNA 1BCPD 3P4RB 1NI3A 1NAPA 1ICWA 2ENBA 5TSSA 3U2SC 4JK1C 3P4QB 1G291 3OWFA 3S14B 1VRAB 1ZXHA 4C7ZA 3Q8AA 2A69C 1MHXA 4KKUA 4P6VF 1JQ4A 1JWUD 2V0GA 2VUMB 5M3FB 2E75C 3MAQA 3NP8A 4KJNA 2MHVA 3A8JE 2JZPA 5K36G 4NAWB 4DA2A 3ZJTA 3JAME 4C3JB 3NBHA 1F2YA 1QT9A 1QWYA 1K83B 1EY7A 3HRZC 2N0SB 1DOIA 1LT6D 2PLPA 4R8NA 5DAUA 2EELA 3PIP3 3QWNA 1Y1VB 1C8CA 2IX1A 1XCTL 3ND8A 1WVLA 5I9OA 5EE0A 1STNA 1EEID 3NQTA 1STGA 3IT4B 2A6HD 4DNTB 1K51A 2WXOA 3X3MA 1C76A 4BWGB 1I6VC 3SK8A 4TSSA 1BF4A 1S5CD 2AWNA 4KTAA 1N63A 3X3NA 3J7AF 1PZKD 3PUYA 4ODGA 1GUTA 1HTLD 4PV1C 3MJ5A 4NAMA 1HA6A 4ZRZA 5D3DA 5JVG3 5C0XJ 3S2HB 3ETRA 1J7BA 2KOLA 5G3LD 2G1EA 2K0PA 2X38A 2KHSA 4PMBA 4C56C 1Z7TA 1ZXIA 3KLSX 4RCOA 3TSSA 1IL8A 3VR2A 1EZ8A 2BB6A 5E4WC 4KN7C 4F88A 2AQ1B 1GUOA 2RSOA 1CFMA 4P2CB 5LL6S 5IT9E 5BN3A 3L9AX 3TMEA 2Z1CA 1I6HB 1EYAA 2F0TA 1WTQA 4DNRB 2A68C 1SB3C 3A8KE 5ELBA 3K5LA 3E5SA 3URYA 4QUCA 2E2IB 2SDFA 1PTOB 1CHQD 1JOKA 3JAML 3S1NB 3AEEB 2PYKA 5CBAE 3PZ8A 3E6ZX 5HHDG 2EE1A 4XYQA 1TVXA 3J9CA 5JAVA 1F9PA 3L7ZC 4JWSC 2B2YC 2IWHA 4KGSA 4TRDA 5IODA 4KJOA 1MSGA 3IXSA 3P7JA 3K5MA 3AB9A 2VB2X 3SHLA 3U7ZA 2FMCA 1W6KA 5BN5A 4XTCS 4B0MA 5CV9A 4G7OC 2FUG1 1SYFA 3DWGC 5JEAG 3AE1B 1TIID 3GV6A 2PVGC 2WXJA 2N9LA 1K53A 4KHVA 1B53A 3U9SA 2M2LA 3E9SA 5CGKA 1FEHA 3O13A 3SK6A 1IBXB 1LTBD 1RD9D 2GA4B 1V43A 3DEPA 2V4IB 4WH4A 4IFDG 5T1GA 2RQXA 4H0LC 4DAPA 3Q8EA 3A7AB 5EKKA 4DXGA 4EGVA 4K6DA 3B2GA 3R2IA 1BMLC 1EIGA 5EE9A 3SFEB 4LJZC 1A3TA 3AV8A 1LV9A 1DOYA 3K5NA 1HEZE 3T13A 1CHPD 1B9RA 2BA0A 2JEAI 3D6WA 3TEXA 2I38A 2BS2B 2L0CA 3MC0B 4OHJA 5IT9L 2V3NA 2ZT9C 1CT1D 2WQYB 2HDLA 1TS5A 3DWQA 1Y56A 4DU9A 2PW5A 4ZHPA 1EY8A 1SBBB 2WXIA 1ZE3D 1OXXK 4TMAB 3W5UB 2A69D 4QF4A 3AEBB 3I4MB 2NB0A 1NCVA 3GTPB 1G8ZD 3FPPA 1AW7A 2DLBA 1ZYRD 2BE5D 3AB5A 2V3PA 5IGBA 4YSYB 1BUIC 1SNCA 4XT1B 3ITPA 4R3DA 5CV4A 3AE6B 3HOVB 1TWFB 4QMGA 3K0YA 3MXUA 1SNMA 1V1PB 1STYA 1B4OA 5KYIA 5KRUA 3TDQA 4RHSA 2DYMA 5DM73 1G91A 3T16A 3HS0C 1SYDA 3OW7A 1Q12A 5CV5A 4ILWA 1BNZA 4G57A 2LEKA 2WIIB 2KEEA 1LTAD 3V3XA 2AQ2B 3D4DA 3BWUD 5K36H 1K8MA 1L4ZB 2FHTA 5JOBA 2ZXPA 1KLGD 5F2DA 2C9OA 3W3AA 1QOAA 3V2TA 1RHPA 2F0LA 1YNJC 3HOXB 4YIJA 2K6AA 2EPBA 4M8AA 3MEHA 2XIWA 1F77A 1LT3D 4MHEA 2AUKA 1ENAA 1RODA 5ELFA 2KN4A 1PRTF 1M4VA 4TKOB 1C48A 3CRLC 1PGXA 4WWMA 3EGRA 5A2QE 2H89B 1O7ZA 5E3FA 1F2RI 3KF8A 4HAEA 4LLGM 3BG3A 2RPVA 1I4RA 1H9SB 2A73B 4K2KA 2K5DA 1MD2D 2KJXA 2BTEA 3Q22A 4F7XA 2NN6I 1BOSA 2EYMA 1D1IA 1Y8PB 3MWYW 2M19A 1VF7A 1TZOA 3HUIA 1BO0A 2PVOD 4HRSA 4DF7A 3ABVB 4XT3B 1Y8NB 1H9JA 2BCOA 4JX1C 2PMZB 1OQRA 1IHZA 4IUQA 1BCPC 4L63B 1KFYB 1SF0A 1VZ7A 5C0XI 1CTMA 5CYUA 4L23A 3PUZA 3IAS1 5CMDA 1DGJA 3AM9A 1PFMA 1D5ZC 3BYYB 4HROA 3SE0A 3TZUA 2ONQA 2OEOA 1SNOA 1YQ3B 3CWIA 1KDBA 2R93B 4ZRQA 4J3OD 2LHDA 2K33A 3HOUB 5JXVA 1R9TB 4XYOA 4BBSB 5I2YA 2WKCA 1MGSA 5G5HA 1HQRD 2EYLA 1SDFA 3S17B 1E0ZA 3RUZA 1DONA 1QJOA 4A3EB 4NW2A 4QIWB 3I72A 4TQ0A 3U4EG 1RCVD 4XQQA 4X3UA 3HGBA 2QEJC 1FXIA 4V0BA 4A55A 2HDEA 3DXJC 1QCBD 3C2PA 3VR9B 4CQNA 1E0BA 1Q1EA 3H6MA 5JPNC 4LTUA 3SXHA 2JXTA 3MTSA 2DY8A 1L0VB 5EBDA 1ESFA 2XN9C 5H92C 4HTHA 3D6CA 1A70A 1N60A 3Q8BA 2K22A 4J1MA 2OF1A 2PPBC 3AEDB 1IYUA 3HP3A 4Z9CB 1LTSD 1SSOA 3RD4A 5DNFA 1PFDA 4ZK9B 3SDZA 2WS3B 4HEDA 2L52A 5A2QL 3WCQA 2DY7A 2N55A 3TP5A 3J7YW 1BDOA 2K04A 4N58A 1WSPA 1PTOF 1A3UA 3TP7A 5BMIA 1B9NA 1IKLA 1B2TA 2Q8RE 5JEAH 1V97A 2GI9A 4A8XC 2E3TA 2NTTA 1EQVA 1OXTA 1QLBB 2JYEA 2PW7A 1DCZA 5E1FA 1GUWA 1KNAA 5EPLA 3PUVA 1CA5A 1EY6A 3M85A 2B2WC 1MI0A 3GTGB 5LNK1 1CK1A 3NUHB 2H88B 1C9FA 4OO1I 4HR7B 1WYGA 4K6LA 2INNE 1TKGA 2YU9B 1ONLA 1TYGB 1RJTA 3IFTA 1ZOYB 3IT6B 2I2YA 1Y69U 2B2WA 2ZXOA 1PRTD 3Q6SA 1F9QA 2EY6A 1G6ZA 3FILA 3PO0A 3KBGA 4GDKB 3SR6A 5C3WA 2O2LD 1I4PA 5LL6X 3NE5B 1VMCA 3QO2A 4U68A 4RF1A 4A3JB 2K3UA 3AE7B 4IUNA 2WXRA 1OXUA 1H9RA 3BIID 3NHHA 2WXHA 1PUTA 3MP9A 4A3BB 1JWBD 1A15A 3Q24A 1XCQL 3IFDA 3PO3B 2PKOA 5NUCA 1LT5D 1QOHA 1ZXTA 4I65A 1VF5C 2L9HA 3AU7A 5I9PA 3K59A 4C7YA 1YNJD 4DK1A 3PUXA 4LK0M 2B2VC 1KLUD 3NUCA 4OGQC 2XWBB 1WTOA 4XWTA 1HQMC 1PFNA 4YSZB 3FPUB 4KHZA 2RA4A 3CU7A 2RSNA 2RDHA 3S1RB 5BYSA 3BVZA 4A3FB 1K8OA 1VZ6A 4ZUJA 1XTCD 4FP5D 1S5DD 3S1QB 2MEKA 1I4QA 3EUB2 3U9OA 1XO3A 2B2VA 1E2ZA 1LABA 1DD2A 2M9VA 2KVMA 5HI1A 5HURA 1O7LA 2F0IA 1JCKB 1SXTA 1QILA 2XNAC 3L4PA 3NWTA 1WD0A 4IN3A 5HFYA 4ARIA 2BOSA 2BBCA 1RYJA 1OXSC 3EVQA 4F87A 3BS1A 3QOLA 5ELCA 1CJEA 4EE2A 1G2SA 2ZXRA 2QIEB 3DWAA 3C3LA 4C3HG 5JVH3 1A6XA 4MH8A 3ZJVA 2PMVA 2Q5WD 3W1SA 3H3VC 1Z6HA 4ZAIA 3V05A 2XSCA 1D4BA 1II3A 1E7PB 3GD7A 3RMHA 1RKNA 3A7LA 1RDPD 5E6JA 1ILPA 1C4CA 1VDVA 1CZWA 2JA6B 1S5ED 1SAPA 2OT2A 1OXVA 2YYZA 2L32A 1ZYRC 2BE5C 1SNQA 3PO2B 5I4DA 1TJEA 3LYYA 2J7ZA 2VXWA 1UGJA 1UAPA 1F9SA 1PTOH 3R93A 2PTLA 3TP6A 2ID0A 3QJYA 2WP8J 2F03A 1EY0A 5EE1A 5C3JB 3B2FA 3HOWB 1I3QB 3AN1A 2MJ8A 4WRDA 3FC4A 2BYTA 2K5WA 1OFFA 3H09A 3GP7A 1B1ZA 4CHTB 3P4SB 1TS2A 1XYIA 3M7NA 1ROEA 1IYVA 1ESRA 1YJJA 2ICIA 1NYQA 2W54A 3VYRA 1FRRA 3UI3A 3VR8B 4OVZA 4Q5VA 1G2TA 4NDXA 1NR2A 3I91A 1MSHA 1QF6A 2N88A 4XDXA 3I3CA 1SIJA 4C80A 3D3RA 4FO2A 2RMMA 1VLBA 2LKVA 2WU2B 4JPSA 1HUNA 1B9MA 1SNDA 2O5IC 1WTRA 2Q8TA 1SJHD 2XVSA 3P1HA 2VZKD 1SMYC 1KABA 2W82A 1MI2A 1SSNA 4GZYC 2MP1A 1ZUD2 3AMUA 1GHKA 3W2DA 1ZDXA 5T1IA 4HCEA 3ZYYX 4DAVA 1O78A 2LGIA 3I8ZA 4N6EB 4BBRB 5AFWA 1U4RA 1HCZA 4ITKA 4BA2I 1JW9D 2R7ZB 2IW3A 4RGTA 1PGAA 4YSXB 5CR3A 4LAAA 1WTVA 4V190 5C6AA 4C3IG 4XDDA 1TY0A 1SE3A 3OHXC 5COYA 1STHA 2F0PA 4US8A 2EDGA 4HMIA 4CGYB 1GOZA 2VB3X 1T5EA 2Z4IA 2EY1A 3H94A 1QNUA 3GTOB 2BW2A 2ON8A 4L8JA 1BCPB 4XXEA 1GHJA 3FEWX 1YN4A 3S2DB 3I73A 2J53A 1EWHA 2H1EA 1EZ6A 2O5JC 2CVRA 2F0UA 2MJEA 1EY9A 3GTMB 1ILQA 1JB3A 2WLBA 3PV0A 5FKAC 2CU3A 5C0XH 3N9YC 1NEKB 2WV6D 2KQ3A 3NTIA 3TBIB 3AEGB 2JWUA 2F0MA 2KDMA 1DYQA 3ZGZA 4A3DB 2PO4A 4N9PA 2HTME 2MPMA 3VR5A 4PMCA 2XRSD 1FFUA 1NYRA 1LTGD 1P7EA 1DZ1A 2OXPA 1QE6A 3TEYA 3Q0AA 3FKIB 1WTPA 2NWGA 1ENCA 4NJCA 1CZGA 3BDLA 4GLSC 1JWSD 3OSOA 3FAHA 3KBXA 1WRIA 4UAIA 1T5XD 4FF3A 5MPOA 2AQ3B 4K14A 3TEWA 3DWMA 4P16A 2G9HD 1I50B 4A90A 1AN8A 4J6HA 4WJWA 1U4LA 3DEOA 3MZ5A 1FNVA 5T8IA 3MHBA 4ABNA 2L4NA 1DM0B 4ME5A 2IGGA 4B0EA 1AP0A 3WDNA 1XLNA 2WXMA 1XXGA 3F2UA 3NQIA 2KECA 4A3KB 4HKQA 3HVZA 2X6GA 1Q90A 1WTWA 4KMUC 1Q10A 4BY1B 3H8HA 4HSPA 1HTPA 1YNTE 4N59A 1PMRA 2DYOA 1FRDA 2LMCB 4XDCA 1D1KA 3RLFA 2PQEA 4OL7A 2RDFA 2Y5CA 2NVXB 1FO4A 1PRTC 1DOMA 2IGDA 1QNKA 2F0QA 4C3JG 4IZ8A 4G7ZC 2M56B 3AECB 3IAYA 2KUMA 1EQTA 3AE3B 3C1EA 2SEBD 2NTSA 1YN3A 3KUPA 4FYDA 1BQQT 3D31A 2F0NA 2QKIC 3W5VB 1HUMA 3OPOA 1Y1WB 1GB1A 4YTNB 1Q3LA 4IQZA 2WU5B 3UI2A 1L6VA 3CKIB 2JE6I 4MIUA 1C79A 3NTHA 5C3XA 1EYDA 2LHEA 2MJDA 4XIGS 4KY7A 2JQRB 3P42A 4L6TB 2CW0C 3MFYA 3VR6A 2F0JA 4IUPA 2I46A 4QUFA 2DNCA 4RF0A 1HA5A 2NZ1D 3ND9A 5E4XA 4CJ2C 1XWEA 1WD1A 2ACZB 2J4XA 1S5FD 2LY7A 1T3QA 1WWTA 2GB1A 5D7GA 3VR4A 4CJ1B 4CKCA 1XX8A 1JWAD 2FINB 2L55A 4NMZA 4RFBA 4A6QA 3QOJA 3K7AB 3FMCA 3I4NB 3NXWA 2DN8A 4CKEA 1SMYD 1OQQA 2FBWB 3P20A 1PYWD 5IGGA 1FNUA 5J1ZA 1BBXC 1EWYC 3TEZA 3GTLB 4A3GB 2EY5A 2F0HA 2JXMB 4KKJA 2QMTA 1VZ8A 4D2KA 2H4OA 2TSSA 1JALA 4HKZE 3I70A 2Z8LA 4ZRPA 2B8GA 4A3IB 2FFKB 4BS9A 2PNRC 2D9UA 4WQMA 1MBYA 1U4MA 4B08A 2NVTB 2AUJD 5EGTA 3M7GA 1NVID 1PTOC 2WXQA 5K5PA 4F8MA 1A2TA 1LTID 1SJED 2K28A 1ZDVA 2M0AA 2EKIA 2D62A 3HRDD 5FLXE 2WXFA 4R9WA 1Q1BA 2DBYA 5C2TB 3KLSA 4PMWA 5JEAJ 1N5WA 3C8YA 2KCCA 5FOBB 4RA8A 2B39A 5ISRA 5DM63 4ZKCB 1VMPA 1L6UA 4IFDJ 1L5PA 1PXUA 2A6ED 3R2TA 2O4XA 3OOCA 5IGFA 1D6EC 4MT5A 3BDOA 4ZOHC 1EWCA 2XWJB 2D5DA 4NZLB 3NK9A 4KKIA 4NP5A 4PQXA 2JYTA 5CBEE 4JE3B 2JYOA 2G9DA 2IL8A 1F2ZA 1EYCA 1FCLA 1M8AA 3I90A 2KWDA 1V1OA 2R61A 5IIFA 5M5YB 3OMCA 4RAUC 1ML0D 4DK0A 5EE3A 1ZP0B 4ZQ3A 1YMHE 2F0GA 5HG2A 5EKIA 1IBXA 3TP8A 4IKGA 3P1MA 3A8IE 3CHBD 4MN3A 1D2BA 3AE4B 4Y7NB 1LT4D 1UEAB 3R8BA 3K57A 1JE4A 3MXPA 4ID6A 4KV6A 3J80E 1ZEQX 2WDRB 5KNCA 4S3SA 2B2TA 2QF7A 4YTPB 3VA5A 2NN6G 3EQLC 2PZTA 4OZAA 5C4HA 2JEBI 5FLXL 2AWOA 1HFGA 3SFDB 2K7VA 5KNBA 1O7YA 3A55A 3B9JA 2IT1A 1LO5D 1PZID 3J81E 3SEBA 2IDYA 3OMGA 5C0XG 3DUZA 5JJZA 3MXNA 1E6EB 5GXGB 1PFBA 3LX0A 1XEEA 2M00A 3PIO3 1YN5A 2RBMA 2DWQA 2KAJA 1P7FA 2WAQB 1V8CA 2RKSA 1EU3A 4G7HC 1VDZA 2GRIA 2F0FA 3DMUA 3MXGA 4REZA 2F3WA 3I9V1 5I6YA 3NVVA 5FK9C 1SFOB 1I4XA 2JA8B 3MFGA 4R8IA 1N61A 2OEDA 1FXAA 2CW0D 2SNSA 4H13C 4FVMA 2F0OA 1LLRD 1NENB 2EJGC 1V1PA 2F0DA 1ACCA 3EFXD 4JBWA 2EY2A 1J9OA 1X3QA 3AH7A 4IURA 4FF4A 2WDVB 2E74C 1EY4A 5JPMC 4H44C 1UWMA 5C5LA 1TKEA 2PIAA 5LHY1 1ZPSA 2J52A 4GDLB 4WURA 2E76C 3T56B 3VYUA 1XLPA 1SNPA 1R4PB 3NTKA 1E9MA 3J80L 2FE8A 1HPCA 5HGTA 5EPKA 4G4KA 1TWAB 1KDAA 3EA6A 3BK1A 1RF2D 2SOBA 1GXDC 4FXDA 5D65A 2WINB 4M1UB 2EJMA 1WXQA 2JSOA 2WXLA 3LB8C 1KTKA 1S5BD 5BYRA 3CIRB 1KRHA 4FXKC 5C5MA 3J81L 4KX6B 3P75A 3GO5A 2CJOA 1SYGA 1RM6C 1FD7D 4KD3A 2RVLA 1H9SA 1TWHB 4WIPA 1KAAA 3GV3A 2BB5A 3KWVA 1PTOD 1NUCA 1J7CA 4KKSA 2D2CC 2WXPA 2IJ0A 1N62A 2JU6X 4KKTA 4FF2A 2IGHA 4OZBA