1EWCA

Crystal structure of zn2+ loaded staphylococcal enterotoxin h
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLGGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN H
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 73
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ewcA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ewcA02
1TS5A 1V1PB 1D5MC 1B1ZA 1PYWD 1I4QA 1I4HA 1G8ZD 4RGNA 1JCKB 1PZKD 4RGOS 1S5DD 1LT5D 1S5CD 2AQ2B 5I4DA 1YN5A 1LTTD 1S5BD 2NTSA 3DWPA 1CHPD 4RCOA 1D6EC 1S5FD 1TS2A 2RDHA 1JWMD 4RHSA 1HXYD 1PTOC 1PTOF 1PRTD 1LLRD 1SXTA 2XN9C 4Z9CB 1CK1A 2NTTA 1KLGD 1FNUA 3R2TA 1AN8A 3BYYB 3DWQA 1LO5D 4RH6A 1LTID 1SE4A 1FGBD 1V1PA 1BXTA 1I4PA 1LT3D 1UNSA 2CHBD 1T5XD 1UUPA 2SEBD 3BVZA 3MFGA 4RGMA 5FKAC 1YN3A 5ELCA 1EU3A 1EEFD 1L0XB 1I4GA 3MC0B 4C56C 5TSSA 1I4XA 3W2DA 1JWSD 1RD9D 1L0YB 3R2IA 3DWAA 1HQRD 1F77A 1XXGA 1CHQD 5ELEA 4NZLB 3EFXD 1B44D 5ELBA 1SBBB 3BVGA 2J4XA 4BWGB 2IJ0A 1TS4A 2ICIA 1JR0D 1XTCD 2WV6D 5D3IB 1PRTF 1PZID 1TY2A 1S5ED 2AQ1B 1PTOB 1BCPC 1BCPF 3O13A 1V1OA 5FK9C 4L63B 1YN4A 1SEBD 1PTOH 1D5ZC 2TSSA 1CT1D 4TSSA 2XNAC 1AW7A 1FNWA 4RFBA 3BYTB 1M4VA 1RDPD 1DJRD 1GOZA 1PZJD 2AQ3B 1ET6A 4O1NA 2Z8LA 1LTRD 1STEA 3TSSA 1ET9A 1DYQA 1FNVA 1HTLD 1EWCA 4RHRA 5D3DA 1ESFA 3BVMA 4L6TB 2RDGA 1HA5A 1KLUD 4UDUC 1PTOD 3URYA 1ENFA 2IPKD 5ELDA 1PRTC 1LTSD 2QEJC 3EA6A 1RCVD 3GP7A 4ZYSA 3R8BA 1BCPB 4RGTA 3OWEB 1LT6D 3KLSX 1SJED 2O2LD 3BZDB 1I4RA 1FD7D 4K6LA 3CHBD 1RF2D 1D5XC 1LTGD 4DXFA 2XRSD 1SE2A 1TS3A 5ELFA 2R61A 2XRQD 3V05A 1JQYD 1LTAD 1KTKA 1CQVA 1SE3A 1TY0A 1MD2D 4DXGA 2QILA 1EEID 1QILA 4OHJA 3SEBA 1EFID 2G9HD 1LT4D 1BCPD 1SJHD 1JWUD 1PRTB 1EU4A 1LTBD
chains in the Genus database with same CATH superfamily
1SLJA 3FILB 1YIJA 1DONA 4KGSA 2B63H 1OTCA 4FF4A 5LHY1 4X3KA 1K83B 2OOBB 2QC8A 2RQXA 3NTKA 1GNUA 5AEKB 5AFWA 5IGBA 2CVRA 1ZUD2 1E6EB 1SIJA 4JVZA 5AUIA 1AWDA 1JRPA 3NOBA 4LFCQ 2FUG1 4A3EB 3T3OA 1K0RA 3CAMA 2KK8A 5EAYA 3I90A 3F2BA 2VS1A 3AEGB 2R7FA 1I50H 4DGZA 1AP0A 4NXNL 5E6OA 3UIPB 5HY6A 4KTAA 1UH6A 3BVZA 1K8GA 3E3XA 5HHDG 4XWWA 2CU3A 2F4VL 4ANXA 1TWHH 2K7VA 4PZ8A 3EHVA 3WWVA 2RPVA 4N6EB 2E75C 1RYJA 2EYPA 1SYEA 5TSSA 2C60A 2RGFA 1IW7D 1L0YB 3GTMB 3D4DA 2LUEA 5IYCH 1HQRD 4BKSD 4B9XA 5I9PA 3CCJA 4K81A 2L0TA 1HTOA 2NPTB 4HN7A 2LI5A 1C76A 3QIAA 3PF4A 5JJIA 3DLLA 2LMCA 1EIHA 1BBWA 4EE2A 4OVZA 1WXVA 4LAAA 2WXLA 1JWAD 2JA7G 3M4YA 1KIXA 4JI6Q 2V3PA 2F0NA 1XO3A 2KWCA 5M5YB 4KGRA 1HE8A 3PQIA 3A8IE 2NBUA 4JYAL 4US8A 1AW7A 3J80c 2AQ3B 2WS3B 2L11A 2WXNA 1STEA 4UPAA 3DHQA 1ISNA 5LL6X 1OQYA 1E1OA 5CHFA 2YTYA 3V6EB 3LXFA 3BVMA 1CTMA 1BR9A 2JEAI 3OW2A 2W3SA 2A74C 1XF5L 2CFMA 3QHTA 1D1IA 1ZKOA 1JRUA 1O7YA 5M3FH 4KZCA 4ZRQA 3AFQA 5ELDA 4FO2A 3V62A 3PIOA 4RF1A 3RMKC 3GP7A 1FO4A 4NB3A 1V43A 4CHKA 1TTNA 2ZPNA 3L0OA 1Z9FA 4A3KH 3H7SA 4CYEA 3AU7A 1NE3A 4K1RB 1LT6D 1SYCA 3D4WA 1SJED 3KLSX 4EQ5A 4HJ7A 3N6RA 5C6AA 2OT2A 3OLMD 2L32A 1SROA 2B2YC 3PLUA 3DDCB 4FN2A 1P16A 4JBKA 4O2DA 4DK1A 2DZJA 4KKIA 1D1KA 1N36L 4WJQA 1A2TA 1QUQB 4GDKA 5KHOA 1C48A 2EMTA 1EY5A 4Y52H 4AJWA 1ILQA 3DVNU 4NJ7A 1DXMA 2I5LX 4KDLB 2UWQA 1UAPA 3I70A 1CQVA 2WP8J 1N62A 3I4NH 3RLNA 3S1MH 4DV2L 3MHBA 5FLXL 2NN6G 2EYJA 3GB1A 1SJHD 5FJ8H 1O7ZA 1YJJA 4L5QA 4QGUA 1OQQA 5KRUA 3JVZX 1AYFA 1QT9A 4L1BA 4CO7A 4EZLA 1QNKA 1BT0A 5DAUA 1EWYC 1F2LA 3ND8A 2BB5A 2OJRA 2PNHA 4DR6Q 1D5MC 4M1UB 3WAOA 4C7ZA 4H13C 2ZM6L 1Q90A 2LRWA 4W9FA 2HQLA 2W54A 2L15A 3FKIB 1PUTA 3CSFA 3W5VB 2KCNA 3HOVB 5CHWA 4LK1C 1ACCA 1J7AA 3ECIA 4RKLA 4X66L 4ARCA 1PTOC 1EYCA 1PTOF 1Y1VG 2MJ8A 1LLRD 1SXTA 2Z1CA 1Q82C 2DJFC 1JALA 1YMHE 3AE5B 4DA2A 4A3DH 4QAYA 5H92C 4X62L 2PTLA 2LRUA 1WRIA 2M4NA 2NVYB 1R4PB 1E2VA 1FCLA 4XXEA 1EQVA 4CDDC 2XEWA 1UUPA 3GV6A 1C3TA 1PH4A 1ZEQX 3EVQA 5IGGA 4WFN3 2K5PA 2H4OA 2L55A 2Y3AA 3NHHA 2C7HA 3A1QB 1ZP0B 2PI2E 3DBLB 1YVCA 2EIFA 1SBBB 4EQNA 4AJYB 1X3EA 2XBBC 4XZ4A 1CKNB 1GJZA 2YEPF 3KUPA 4KLKA 3HOUG 2PCFB 4JI7Q 3NENA 4J3OD 1EYDA 4FXGC 2JA5G 1WH3A 4C7YA 1RM6C 1NI3A 2EYLA 1GG3A 3M9BA 2ZNVB 4A20A 1JB3A 3PUVA 4LF5Q 1J8IA 1STYA 1HZAA 2SAKA 4DK5A 3EFCA 1FFUA 5C1ZA 1TR5A 1MJDA 3OMGA 2HHHQ 5DM73 1WX8A 1PTOD 2WX1A 5EE0A 4J8QA 1C9FA 2M00A 4LFAQ 2N9KA 1U4LA 3QWNA 3S1RB 3GTMH 2I46A 3W1SA 1PRTC 2JZ3B 1ESRA 4YY3Q 4DR1Q 1ZGUB 2JJQA 2K5WA 1WXAA 1E90A 1K3RA 3DQVA 3TMEA 1L1OA 2ZT9C 2UXCQ 4AUQC 3ABVB 3AE4B 4ID6A 1S3SG 3HKZE 3CCLA 1B8AA 4IM0A 3RYTA 5C3EG 2ON8A 2JSOA 3K58A 4EVOA 2RDFA 4KN7C 5IY0A 2CJNA 4C3JG 4GKJL 2MH7A 4PZ6A 2ASQA 2K04A 2D5GA 4HRSA 3V6CB 1KTKA 1RTOA 3PO3G 4HTHA 4MACA 4ZYNA 1EUVB 5D65A 1FXTB 2MJEA 4KZ0A 4PYUA 1P98A 1MG8A 4ZQ3A 1A8VA 1DGSA 3JW0X 1EFID 3HGBA 1QLBB 2NMQA 1E1TA 1Q7YC 1C8CA 4LFBL 1VQFA 2AL6A 4HPLB 3J81E 3EFUA 4KKTA 4EUTA 2BE5C 2Z4HA 1WXQA 3A56A 3TCAA 5L83A 1Q5WB 3RN5A 1IBXB 1LM8B 2PQAB 1E8ZA 1J8CA 1PYWD 4GDLA 1CKMA 4FP5D 2F0EA 4KY6A 5EKLA 2JUOA 1KRTA 5C4XB 2N9XA 4LMQD 4DUZQ 1GO3E 2GB1A 1I94Q 2N1VA 4B0MA 2A1AA 5LXIB 3DWPA 4MSMB 1X56A 4RCOA 1S5FD 1TU2B 3KOJA 1IKMA 2V3NA 5GADC 2ZXPA 3GTOH 2N7DA 1VQ5A 4YT0B 2KFKA 1PRTD 3E0EA 3SR1A 2GBMA 4IM3A 3I4OA 4MH8A 4ME5A 4PZ7A 3NRZA 2ENBA 1B53A 4DU9A 1SE4A 3TDQA 1E7PB 2CHBD 4B3SL 5JVH3 4PQXA 4BY1H 3X3MA 1BMLC 4OW0A 4F7ZA 1X3FA 1M1KC 1NBWA 2R7DA 5IN7A 2M0XA 3P7JA 5K36H 2N8NA 3K0XA 2KAJA 2MWSB 4X65L 3NWTA 3WIMA 4W9HA 4G0NB 1UGMA 4P74A 3I57A 4TKOB 3DWAA 4C4VA 1MIUA 3T13A 2ZXRA 1MJEA 2IY0B 3JAMi 2L52A 1L4ZB 3H9DA 4AYBE 1HRJA 3ERSX 1L5PA 1VJKA 1U4PA 4JI4L 4QB4A 1RL2A 4DV1L 3VYRA 5CV6A 1WD1A 3GTKB 4IUPA 3RCZA 2MBOA 2KD0A 5C44B 2K05A 5LMUQ 2BE5D 2K01A 1F9RA 2J7QB 1KD1C 4C2MH 3HOVH 2DYOA 2UU9L 3KUZA 3TJPA 3H3VI 1HR0W 4K0KQ 5FK9C 3P1HA 3HRDD 5IP7H 4KJNA 1SE8A 1IBML 3F2CA 3IAM1 2IT1A 4M00A 1WY8A 5CV9A 1Q12A 2LVQA 4TSSA 2C7NB 4GB9A 3U4EG 2GBKA 1SSOA 3FPPA 4ODGA 2KTRA 4HJ9A 1R9TH 2B2WC 3G7LA 5EKKA 1V2YA 2KVZA 1V8CA 1QCBD 2BA0A 4Q5VA 5BN5A 2NVXH 5IYCG 3J81i 3SFEB 2WU2B 2F0QA 2RCFA 4BY7G 1B3QA 4DDGD 2WB1E 3JYUA 3ZJUA 3ZTCA 5EQ0A 4P2CB 3IVFA 4A3BB 2CH4A 5KNCA 3PO2G 1NVID 3STBC 2D62A 1P9DU 3UQAA 4ZYSA 4IDIA 3DBSA 1WX9A 2CCZA 3VFKA 2V4LA 2IGDA 2O2LD 1CI3M 4DAVA 4ALPA 3S1QB 2KA7A 1MPEA 2N88A 1Y69U 2KBNA 2F0MA 3D6WA 2KQSA 1EQRA 1WCMH 3VAWA 1TS3A 2KDFB 1HA6A 4FLHA 1EIFA 3RZOH 1XMOQ 1PH5A 4MT5A 1FYCA 2VQEL 1KF6B 1N61A 3Q22A 4I6NB 1HR0L 5BYQA 2O6VD 3UF8A 2AEHA 1ZXTA 3HP3A 4J6HA 4W9IA 4G50A 2V3SA 1VQIA 2AWNA 4DK6C 1TKEA 4ITKA 4WWOA 4WWNA 4IJLA 4HJ8A 4B9KA 1EY8A 1NCVA 2JYEA 2LVPA 3I91A 3N1XC 2JA9A 3VUXA 4DV7L 1VF5C 4EX5A 3SK4A 1G8ZD 2KZRA 1JOOA 4OIJA 2L5TA 3TREA 5C5MA 3FEWX 4KIKA 1KHIA 5LMNL 4GOPB 1DM0B 1T3QA 3CKIB 4A3GH 4RMAA 1CZPA 1FD6A 3CPFA 3AE7B 3S2HB 4M0WA 4CKBA 3STBD 4DAMA 4Y7NB 3MXNA 1PFSA 4YWGG 3E6ZX 4HSVA 3HOWB 2F0TA 1WZ0A 2R2OA 4XX5A 1JMCA 4OZBA 5JPMC 5EE9A 2EKIA 3CW2C 4A3JH 2E2DC 3F8TA 5FO9B 2ZW1A 2PIAA 1T5XD 1K51A 4RGMA 1YJ1A 4DV4L 5JJLA 2MUYA 3AFPA 2IY5B 4BAXA 3ZXVA 1EF1A 3Q0AA 4BBRB 3TP5A 2WQYB 1HFGA 3X3NA 3BZKA 3W2DA 1X3PA 1F52A 1RKNA 4NNJB 2H88B 3KDFA 5KNDA 3HOXH 1V5OA 2OEDA 4A3LH 1U0LA 2CQAA 1K8RB 1MSHA 2NCNA 3ZUNA 2J52A 5FO8B 4FJYA 1TWGB 3I3TB 4JI0L 2PZUA 2BS2B 3WAPA 2F0OA 1F9SA 3EN2A 5CYUA 2LXJA 1Z6HA 1ASZA 2X69A 4DAYB 5JVG3 1P8LA 3O13A 2I38A 4LUOA 3PLVA 5IP9H 4HCNB 4JIOU 2KYWA 3ICEA 4BXXH 3EUB2 1PGXA 1PTOH 2BW2A 2NS5A 3UINB 1SF0A 1PVOA 1MVKA 4OO1H 3MP9A 1M4VA 5CBEE 4YCWA 2QJLA 2LGIA 1KNEA 4EQPA 1STGA 1HCZA 1IGCA 1SFOB 2J53A 1VQ9A 1P7EA 3TEWA 2KNBA 3PZ7A 1UE6A 1Y1WH 2LZ6A 1YITA 4DAPA 1E0BA 4P73A 1H95A 3L54A 4HJKA 2F0DA 2LS01 3RD4A 1XCQL 4NAMA 3RNCC 5JJZA 1WI0A 2D5DA 3MAQA 1WJ6A 2F0SA 4DHJD 1DOYA 4I7AA 1CMXB 2HJ1A 4PG3A 2ZVNA 3H09A 4A3EG 2XWBB 1QOAA 3CF6E 5C44H 2YU9B 2O2VA 2RD0A 2RSNA 5I9OA 2BKRB 2A4ZA 4OZAA 3NE5B 2QF7A 3Q6SA 4USAA 3NQIA 5EPLA 3OTOL 2VY3A 2N78A 3HIZA 4FF3A 2LJ5A 5FR6A 1NJIC 2IYDB 3NY5A 1SE3A 5BYRA 1D2BA 1WMHA 2HTME 4OVUA 2JEBI 2X6LA 3IRBA 4C1NI 1EO6A 3DBLI 4HROA 4HDQA 3QG1A 1E0ZA 3MXPA 1EWHA 2KCTA 1G2TA 3IKJA 4IUUA 2B63B 2EJGC 1WMHB 3DHIC 3PUZA 4JPSA 2IBIB 3KWVA 1T6BX 3MXUA 1YOVB 3KF8B 3TP6A 3AQQA 4IZ8A 1BDOA 3TS2A 2INCC 3J9CA 2XTIA 1UBIA 1I4HA 2J42A 3GTLH 1MHHE 2EXZA 2EOTA 1QE6A 1L0WA 3CF5A 1LFDA 1I50B 1RRBA 1GJXA 3FDTA 4CHTB 1PV4A 3S1NH 3F2UA 2WAQE 4NDXA 4UHVA 2B29A 1QKZA 2HE7A 3FC4A 2BGFA 4BKTA 2N9PC 1UWXA 4A93G 1TWHB 1VQMA 3PIPA 4B6WA 1AN8A 1EYAA 4JOIC 2QSDA 1GUOA 4ZUIA 4HIKA 2SEBD 3I56A 5CV8A 3HKSA 2B8FA 2EZVA 1ONLA 4DHJB 4B9WA 3DM3A 4N9TA 2I07B 1SIFA 1ASYA 2LGXA 3WOFA 1WOCA 4WH4A 2RBMA 4WJWA 5C3WA 4DV0Q 3DBRI 1LV9A 1UE7A 3GV3A 1WVLA 1W3SA 2W3RA 2UUBL 4LF6L 2NVUI 4NZLB 5CX3A 3EFXD 2WYQA 1GD7A 5IO9A 1BKBA 1W6KA 4GNXA 4IUNA 1Q1BA 3CMEA 3A33B 4LTUA 3ZVVA 2QCZA 2JU6X 2WKDA 1JR0D 3KYDD 2JRHA 3ONSA 3OOCA 4HDOA 4JV5Q 1B4OA 2AQ1B 3AI5A 4KHPQ 4A3FH 2KOXA 4R4TA 3PZ8A 3NZUA 3CU7A 4K5WA 1RJTA 3U9SA 2BF8B 5CR3A 1EY7A 4IPCA 2I0QA 3B0AA 2OCEA 2QIEB 3RLFA 3S2HH 4XQQA 2M19A 3U30A 3ERQA 2PE6B 2VXWA 1FNWA 3C1EA 3TN2A 3GE8C 3PGZA 5EKIA 4PMCA 1NYQA 2WHIA 5IODA 1FFVA 4JI8L 1YNXA 3VXWA 5M3FB 2VQFQ 3AULA 3NG0A 1DYQA 5BR8Q 1EWCA 1SNQA 1UEBA 3QWZB 1IBKL 1O80A 4URKA 3LB8C 4JC0A 3B2FA 1KLUD 3SK5A 4UDUC 2EJFC 4A3KB 1KAWA 3NBHB 1JROA 2WXRA 2SOBA 2VB2X 2BH2A 3OWFA 4W9LA 4L23A 4B3TL 3H15A 4AQ7A 3QR8A 4NAWA 3EA6A 2WDQB 1KOTA 3OAWA 3FKIG 1VQ4A 3HOVG 3DWGC 5BMIA 2Z9HA 2LY7A 2ZPYA 1NSNS 4HLEA 4P72A 3MZ5A 4WWPA 1IBLQ 4A75A 1I4RA 4OO1I 5E4XA 2O4XA 1XMQQ 2BYEA 4V0BA 4PMBA 2MQHA 4DXFA 2K6AA 5A2QL 3I4NB 1XYIA 4N8X1 3S24A 4KY5A 3ZYYX 3JAMc 3S1MB 3TEYA 1WTHA 2DUDA 2JN4A 1S1QB 3RNEC 4P1BC 3ZNHB 3ND9A 4ZK9B 4QIWE 5JHAA 1A70A 3RZDH 2FCNA 1H8CA 3VH3B 4F8MA 3P4RB 3PO0A 3WANA 1QILA 3BU2A 4OHJA 4L5TA 4F88A 2K52A 4XC2A 3M4OB 1VQJA 4KD3A 2IZVB 4J6IA 1JWUD 1BOSA 3VR2A 2JYTA 4MSQB 2E3TA 4PS3A 1NENB 2KWUB 2WXMA 4C1NK 2EJMA 1J9OA 2J0TD 5M5XH 1JJ2A 3HOZH 2YLMA 3PRPB 4FHJA 4HXDA 3CRKC 4FHKA 2FXQA 2EYHA 1RTNA 1V1PB 1O78A 3KF6B 1V97A 1AH9A 2LXKA 4DKAC 1I4QA 4B3RQ 5GAHC 1TIFA 2NZOA 2NUCA 1OXSC 3PGEA 3VQIA 2E5LQ 5D6JB 2HT1A 4WRDA 3EC8A 3KJPA 2AQ2B 3GS2A 3PRMB 1HQMC 5C2TB 4A3DB 2L4NA 4FYDA 3HK0A 4LF5L 1ZE3D 3AE9B 2YU9H 2IY1B 1QVFA 3B2GA 3QA8A 1B50A 2MHJA 3EBEA 3BG3A 2M8SA 1VRAB 1CK1A 4IPGA 3G71A 1DZ1A 3NS1A 2DY7A 1STHA 4RH6A 2H89B 4LDTD 4LFAL 1LTID 2LGDA 5JEAH 3Q8AA 1EY0A 4RCNA 3V60A 1KH0A 4GLAC 2ZXOA 1CZGA 4DR1L 1UELA 2QDFA 3Q3JA 4GLVB 4HMJA 4RG1A 2JXTA 3OIQA 1C9OA 4HIDA 2BKFA 3H6MA 4DR4L 3B08A 1H9JA 2KHSA 1Y14B 3A9JA 1TWAH 2HJ8A 3TEXA 1GC6A 4RNAA 4RA8A 5FLXE 1XPRA 3S16B 3E9IA 1FGUA 4GSWA 5E6NA 4YIJA 4W9KA 3CQZH 3ZDMC 3A9JB 4YHHQ 1E9MA 1HNWQ 1BCPC 4ZRPA 1BCPF 1YNTE 2L00B 4NPNA 1VQGA 1EQTA 4L5SA 4DNTB 3DMUA 3D32A 2DY8A 4DQOC 2AUKA 2TSSA 2C5CA 2KFJA 4DBGA 3Q14C 4ZOHC 1IL8A 1VQPA 4K2KA 1ZPSA 2F0LA 2NPTA 3QJYA 3U50C 1WE6A 2VL6A 4OELB 3L2PA 2LEKA 2XSCA 2RR9A 1HTLD 4KMUC 5EPJA 2JPHA 4DWFA 3AYHB 2Z0EB 4A3LG 5IOCA 1ESFA 4L6TB 4F7XA 1JJGA 2JZPA 2N1WA 3AH7A 2AWOA 2L76A 3DBHB 4A9AA 1FVIA 4B3ML 2IPKD 2ATWA 5C4XG 1WTVA 2BTEA 4H7BA 3D31A 3HUIA 2ZTEA 2FE8A 1YHQA 4R8NA 2HQEA 3T1YL 2KN4A 1S72A 1HJPA 3I73A 4MM3B 1QWYA 1HZCA 2JXMB 4XYQA 3I4LA 4NJ6A 4KHVA 3SR6A 1TZOA 3ZLZA 3P20A 1AFPA 3RNGC 4W9CA 1X65A 4ANWA 1WTRA 2KJ6A 2B39A 2H1EA 1ICWA 5E7NA 2DX5B 3A54A 3CCRA 2MFIA 4YTMB 3M3YH 2LJIA 4A3OA 4IG7B 2QILA 3NUHB 4N8FA 4ANVA 1BCPD 4X64Q 3C46A 4HIOA 1YIWA 1IGDA 2KJXA 5T1GA 5CHVC 1QB5D 2Y5BB 3KBGA 2UUAL 1XLOA 4E71A 5FLMH 2ZJQA 5BYSA 1FJGQ 2WINB 1VQ6A 3VDZA 1KDBA 5IYBH 1XLPA 1YD8U 1QUQA 1Y8PB 5IGFA 2LWPA 2YVCA 2UUCL 2Q2HA 1ZDXA 2HDLA 2M17A 4HEDA 4LWCA 1XD3B 2XWJB 4K0KL 1KJTA 3GTOB 2KTFA 1IP9A 1JQ4A 4ZAIA 1PZKD 1WTPA 1LT5D 1LYLA 1MI2A 1B9NA 1F2YA 1T5EA 1HNZL 3MWYW 1XLNA 1YN5A 2KQ4X 5EDSA 1V81A 3IFDA 2GBNA 2RHQB 4REZA 2Q2UA 4B0EA 1JWMD 3OSOA 1MJCA 4K5VA 4P75A 5FO7B 2E2IH 3AMUA 1N5WA 3RD2A 4BY1B 2B2UA 3SE0A 1XNQL 4DV3Q 1E24A 4K6DA 4UP7A 4H2AA 3D8GA 5J2RA 2DAJA 3W1SC 4X3UA 3J7ZC 3AEEB 3NTHA 3FP9A 2OTLA 2KJRA 2VH1A 2FNJB 4N9PA 1QVGA 2PEAA 3R93A 3ULPA 4HCPB 1BXTA 1TKYA 3W9CB 2INDC 1L1OC 2JXXA 4FJZA 3AEBB 5FKAC 5ELCA 1ILPA 4ANUA 2K0PA 2PLPA 2C7MB 3U9OA 3M4OH 4A3BG 2M0AA 3FHWA 4MGYE 1V5TA 2L1AA 1ZYRC 1J19A 2V4IB 1RD9D 3CP0A 2A69C 4NW2A 2XVSA 4CJ0B 3RNAC 1PH2A 1R4MI 5ELEA 2JA6H 3WA0A 4QUFA 2Z4IA 4C2MB 1NR4A 2PE9A 5C3JB 1TS4A 2MGSA 2WXKA 2WV6D 4TUUA 3A55A 3B6YA 2Y0SB 4H0LC 2GBRA 1S5ED 3ENEA 1B9RA 4DR3Q 3NS8A 2ZTCA 2QMTA 4J1MA 1E3PA 1VQ8A 1UZXB 2VW9A 4MNOA 1R9TB 2MLBA 3U8ZA 1NDDA 3R7RA 1HEZE 5J18A 1F2RC 3JSVB 2NVXB 1SNMA 3I55A 1IZ6A 4I65A 2IO3B 2OF1A 1I6VC 3ZNID 5FR3A 3CD6A 3BZCA 3A1QA 3U4VA 4R4IA 1STBA 1GOZA 5G2NA 1VLBA 3G6JB 1CKNA 3K8AA 3VA7A 2JA8H 1ET9A 3P42A 4LF8L 3I4MH 5LXHA 1XJVA 4PNYA 3W1YA 4GN1A 1OEYJ 4DR7L 1WF9A 4KK7A 3URYA 3M4QA 4H44C 1XWEA 3GTQH 4EQOA 2R92H 3CCVA 2DENB 1WCMB 4L8JA 4YCUA 3MJWA 3OWEB 4R8IA 3ML8A 1TXYA 3S16H 1BO0A 2IWHA 3GTPB 3RZOB 1XTDA 2RSOA 4K6LA 4KKSA 3T51B 3CPWA 1MI0A 1G6PA 1XCTL 1ZYRD 3HOYB 2EY6A 3L9AX 5M9OA 3HOWG 4XT1B 2EYOA 4MZ9A 4A6QA 2A69D 5IP4D 5F2DA 1OQRA 2C9OA 3SK6A 1R4NB 4A90A 3PF5A 3H7PB 1JQYD 3ONAB 4ZRKA 2OTJA 5H8YE 4BA2I 4QQBX 1TKGA 3HVZA 5IYDH 3A5UA 4GKKL 2BWFA 5C23A 4BBRG 2RSUA 3ZRFA 3UDXA 2IX3A 3J7AF 4AQYQ 3AMZA 5HI1A 3PUYA 1WIAA 3K80C 2L3ZA 2LUMA 4ZRIA 1A3VA 4DNIA 1L6VA 2B2YA 1VDVA 2Y5PA 1HTQA 3DBRB 4AH6A 2Z59B 4G7OC 2PVOD 4WJOA 3FVQA 1PGAA 2O5IC 2CH4W 1E2ZA 4ZKCB 5C0XH 4DV5Q 4LF9L 4A3GB 3A4SC 1NBFC 3G6EA 1S5CD 4OX9L 1GC7A 2UXBQ 2A68C 4CQNA 4M01A 2B76B 2EMSA 2DLBA 5HFYA 1Z2MA 1JOQA 4GN4B 2RDHA 3W5OA 4A3JB 3MTSA 3C2PA 1DOKA 2K50A 3GTGH 3DPDA 2PO4A 2XN9C 1PYSB 4Z9CB 1SE9A 2DZKA 3SFDB 4DHZE 1FNUA 3RZFA 1D7QA 3DWQA 2LXCA 1IBXA 2PQAA 4C3IB 2XGTA 4NKLA 1QQRA 3DVGY 2K14A 2MO0A 3W1BA 3HOXB 4JE3B 3APFA 3AU5A 3S14H 3J7A5 3PUXA 3N1YC 5M5WH 1F9PA 2F0WA 1JWSD 1F1HA 5J22A 4BKGA 4X3TA 3NVWA 1XXGA 1CHQD 4ABNA 5I2XA 2JYOA 1IUEA 2LHDA 3H6NA 3CCSA 1JICA 2F52A 5D14A 4POFA 1QF6A 3H0GB 4NXNQ 2TMPA 4R4OA 2K75A 1WRDB 1WGRA 1ZDVA 3Q23A 2DWQA 2A5HA 3CC4A 2BQQA 1PTOB 4DK0A 1YZ6A 5LLIA 3A0JA 2L05A 2LXAA 3KLSA 3ZTDA 2JK8A 2K32A 1V1OA 1C4AA 1VZ8A 4P6VF 4F8CB 3GDEA 4LNIA 4XYCA 1GUTA 1D5ZC 2EVBA 4MHEA 2K8HA 3KLWA 2KDBA 1SNOA 1TWCB 5DLQE 1SYGA 2IGGA 4KVGB 1D4BA 5I6YA 2D10A 2B63G 1PZJD 4K14A 1Y1WB 3ZKJC 2Z8LA 3TSSA 2A68D 4G7HC 2IX0A 2JA7B 2KWDA 3QAQA 5TR5A 1GHJA 1PDXA 5IT9c 4S3SA 2K9XA 1E2WA 1KQSA 1SMXA 2YEPB 1JE4A 2FCSA 1VMCA 4JYAQ 4ASWC 1MGSA 1NNXA 2K1BA 1JWBD 2A6HC 2EXDA 1K8OA 1RAXA 1J5EL 4IQZA 2R7ZB 4YL8A 1E8YA 2EYMA 2LFIA 1GAQB 1X32A 3A9KB 1LTGD 1DGJA 3VUYA 5MPOA 3V96A 4M8MA 1IHZA 1SNDA 2DNFA 5CV5A 2CHWA 1YX6B 2K03A 3SXHA 4IFDH 3Q2AC 4HJGE 4FA6A 3I5JC 3VHTC 5M3MB 1TWFH 1X6OA 2GVAA 2E2JB 1JMLA 2L0CA 1X9NA 4EFOA 1MHXA 4RF0A 1MD2D 5I6WA 3Q24A 4JBMA 2G9HD 4A3CH 4C3HH 3AE1B 2LFNA 1PRTB 5DEHA 2FUHB 1PYBA 5LMNW 1Z47A 1N36Q 3K7UC 1IYUA 5JJKA 4KJOA 2KDIA 1HFNA 3GTLB 5EBDA 1WGHA 3NHEB 2H5XA 1Y8OB 1C4CA 4E3CA 1SDFA 4H02A 3VR3A 1JCKB 4RGOS 4DV2Q 3S1NB 1L0VB 2N9LA 1YJNA 3GTPH 5IGEA 5KHQA 5CV4A 1BNZA 1D6EC 2MA9B 3W1GA 3HOYH 1OTRB 1KM7A 4LNOA 3PSIA 4FXDA 2SNMA 2DHZA 2KWVB 2PMZE 1GUWA 5CMDA 4LF7Q 2MJDA 4YTPB 1KLGD 3J80E 5M3FG 1HNXL 1KABA 1L2NA 2C35B 5EBCA 2D3AA 2Y5CA 2A6HD 2EE1A 4YXDB 2ZM6Q 1OXUA 2NVTH 1FGBD 3DBHI 3AEAB 4A3KG 3C0RB 3NZ3A 3R3MA 4DNRB 4M8NA 1CZWA 1EU3A 1QOGA 1VQAA 3LNNA 3U2SC 5C0XI 1RWSA 3NK9A 4A3MH 1OEYA 3PPAA 3RNUA 3ZRCA 1WGDA 4GOPA 4U673 1D8LA 3BWUD 3AU4A 2DJGC 1IBLL 1P7FA 4OVVA 1XPUA 3S9WA 1WM3A 4A3FB 2N55A 3R3OA 1TZ1A 3DM1A 2XK5B 3QQ8B 1VQEA 4L2YA 1QVCA 3AEDB 2PW9A 1VCIA 1A62A 2G9DA 1GUNA 4IUQA 2PYKA 4DR2L 3I4NG 1NAPA 3L0WB 2GLSA 4A55A 3UDIA 4FBJB 2N7EA 1X1MA 5FJ8G 3D3RA 4FNFA 3A8JE 2GBJA 2PW5A 3QCAA 1YN4A 3GZNB 2E2HB 1VQ7A 3QO2A 2HTHA 3C3LA 4WURA 4V190 4MGZE 1LACA 1K52A 1N9WA 4JI1Q 5LNK1 1G2SA 1JB7A 2K33A 1IL2A 2N7JA 3D4RA 2REXA 5G5HA 1DJRD 3HKZB 1F2MA 4C3IH 3ML9A 4HPMB 2KO3A 1CM9A 1B9MA 1FNVA 4WJ4A 3CSTA 3ZNGC 4B3RL 4IPDA 1VQHA 2EY2A 1AE3A 2EPBA 2K6QA 3VR6A 4K3BA 2E5LL 3HHMA 1ZOYB 1NUCA 4MIUA 2NB0A 4DAYA 2ID0A 4JI3L 4DV6Q 1WTQA 1V9JA 1WM2A 1YX5B 3QK0A 2KHIA 2QEJC 3UI2A 2N9EB 2KN5A 2O6VB 1RCVD 4HKZE 4GLXA 2A6EC 2AYOB 4A3DG 3K9PB 4NJCA 3H0GH 3VH4B 5DPWA 2JSVX 1WX7A 4II2B 3APCA 1WWTA 2B2WA 1KC8C 1FM0D 1KFYB 1SB3C 1RF2D 3Q3OC 1WTWA 4K8IA 4YCVA 1XNRL 4G57A 3RZDB 1VQBA 1TT5B 1CA5A 3F1ZA 1B7YB 3VR4A 3KH0A 1M94A 3NVVA 1WXMA 3V05A 3FAHA 2VUMB 1LTAD 4G4KA 1TWCH 3J7YW 3A5ZB 3OJ3A 1A2UA 2KQ3A 3KYCD 2MPMA 3T4AC 4XT3B 4GNXC 2BDOA 3HOZB 5M5XB 1WGKA 1EEID 1E5WA 2BBCA 2N3SA 3M85A 4IW0A 2JA7H 1PGBA 4K7UA 5BN3A 2C5LC 3K81C 1Q86C 4TV3A 3J80L 4OGQC 4LFCL 3OYYA 1V6EA 2QKIC 1TIID 4GKJQ 1I6HH 1N32Q 2KXJA 5I2YA 2V1CC 5HURA 1TS5A 5IGCA 4YHHL 1E8WA 1HNWL 3UIOB 3EROA 1R4MB 5BMHA 3RZWC 1FRDA 3KYHC 3QC8B 2L9HA 1PMRA 1X3QA 2K5HA 1M90C 4IFDI 2R7ZH 3PSEB 4LFBQ 4XGAB 2KT7A 4W9EA 3S2DH 1FXAA 1Q0WB 3LGJA 3CXCA 4MGKE 2X8XX 4PYZA 2RDBC 3J7AV 2JT4B 1TJEA 4I6LB 2I1JA 3PCOB 2WX0A 2R6GA 1FR3A 2G3QB 2GMIC 4PT5A 3BDOA 4B95A 4AYBB 1SYBA 3PV0A 2ASBA 1RLFA 1WZ3A 1HZ9A 2A6ED 3E56A 4BZAA 1VZ7A 3SK8A 4CKCA 5M3MH 1PHJA 2E2JH 3KF8A 3HFZB 3IT6B 2FINB 3K5MA 4K5XA 3T56B 2UU7A 2CW0C 5C0XJ 1WGGA 1VF7A 1EEFD 3TBIB 1KNAA 1L0XB 5A2QE 3IBEA 1TWAB 5C5LA 1WJJA 4JI6L 1IYJB 4R3DA 5C0XG 3ZDTA 1I35A 3H94A 4MDKE 1BUVT 3TEHB 4LJOB 1WYWB 4ZLTF 1NMFA 2J7ZA 2A5UA 2WDRB 3CQZB 2MP1A 3BDCA 5ELBA 1KRSA 3PTFC 1E8XA 3TBLD 3TS0A 3LDZE 5JH5C 1I42A 2R2QA 3SDLC 2OHFA 2D0OA 2NN6H 3QB3A 2A8VA 1R4NI 2D2CC 4MTNA 5AJ3Q 3N3KB 2WB1B 1WR6E 1AZQA 3A4RA 2WXFA 3HG9A 3GQBA 4GLSC 3AV8A 2B3GA 1N33Q 4K7SA 3H91A 4CJ2C 2YTXA 1T0QC 5EGTA 5HG2A 5BN4A 2E74C 1TT2A 3UGBB 1GB1A 1RDPD 4JGHB 1FJGL 1C79A 1UE1A 3K5LA 3IFWB 1LTRD 3HM3A 1JOKA 1TYGB 4RHRA 3ZXRA 4TQUS 1SNCA 3IXSA 4DDID 2HCCA 2FIFA 3VDYA 2UU9Q 3H3VC 4ULLA 1Y1VH 4BFRA 4W9GA 1E10A 2KKCA 2SDFA 4FVMA 1IBMQ 3WOEA 1IYVA 1ENFA 2Z6KA 3O65B 3TEZA 2GI9A 1SR3A 3QOJA 3CCUA 5KEEA 2ZJRA 1U5KA 3R8BA 4KI0A 4RGTA 3ULLA 2CW0D 4QMGA 2NR2A 4G3XB 3S2AA 4BY1G 4UAIA 4NQLB 1Q10A 3CC2A 3M3YB 2AUJD 2XRSD 5K36G 4JI2Q 2E2HH 1NEKB 2FCQA 2CU1A 2JVCA 3NBHA 3JC66 2NBWB 1S3OA 4OONA 4DR6L 5JAVA 2BPSA 1WFQA 1XT9B 3ZIMA 2F3WA 3S15H 4G11A 1PH8A 2K5QA 3NBIA 3PZDA 1NTGA 3L16A 3D0FA 1GKHA 4YWMA 2AKWB 1H4RA 5C4ZA 4HAEA 2JA5H 2WXOA 3APDA 1EU4A 2JWZA 5GAGC 3UI3A 1JE5A 2IGHA 1DCZA 5IP7G 3G4SA 4AP4C 2Y0SG 4UP8A 2C9WB 1B1ZA 1QZGA 3L10B 3X23A 2FAZA 1HR0Q 1V86A 4IFDJ 4GZYC 1WJUA 3DEPA 3E9HA 2E2IB 3IG3A 1YBYA 5IWAQ 4FJVB 3GD7A 2BYFA 3RMHA 4GGQA 2Q8TA 3ZGZA 3AEVA 5HKHA 1MG4A 3RNFC 2VZKD 3NP8A 3PRZA 3CIRB 4QY7A 4ZUJA 2J0JA 1KDAA 2VUMH 2G4SA 4DV7Q 3N52A 5CGKA 2LD9A 1JJCB 1BBUA 1V1PA 2LKVA 2QDBA 3KF6A 4HWIB 1UNSA 4QUCA 2MNAA 2K6DB 2KHWB 5CTRC 1WR1A 2HD5B 2EY5A 1HUNA 5C3EH 4JI7L 5DPTA 2KC1A 3T8MA 2JA6B 1EFWA 3UQBA 1I4GA 1YNNC 4RM9A 2W9NA 1CSPA 1UE5A 1N34Q 5E6JA 2ZCBA 3J81c 1WCMG 2BB6A 4KSLC 4LJPB 3MFYA 1F77A 2E76C 2LSSA 3PO3H 4NXMQ 4LUVA 1FEHA 2K5VA 4GIVA 4WIPA 1Q46A 5E4WC 2DBYA 3HOYG 5C3XA 4LNQA 2QHOA 2D07B 5D3IB 1PZID 2I1KA 3DHGC 4LJZC 1VQCA 2HHHL 2GVBA 3OIPA 5CBAE 4RAUC 4PV1C 1SEBD 2VNUD 2B2TA 5NUCA 2JA8B 3Q8BA 1CT1D 4OIKA 4YY3L 3I4MB 2JRIB 3OJ4B 3IHPC 2HIVA 2JY6A 3MC8A 4K7WA 1P3QU 4JI0Q 4EZJA 2UXCL 3GO5A 4POGA 1OGWA 4PMWA 1TBEA 2B2VA 4R1JA 3GTQB 2O5JC 4AIMA 2KC2A 4BA1I 2R92B 3DEOA 2R93B 4IOCA 2F0UA 1R7SA 3PV1A 4A3GG 4JK1C 5IE8A 4X3SA 5IIFA 2UXBL 3VYTA 3NTIA 2M2LA 1C4PA 1VZ6A 1FRRA 2DYBA 2B2UC 2J0KA 2IX1A 4MGIE 3SU8X 1TKWB 2KHJA 3FKYA 4WWMA 1UBQA 4ARIA 2MBBB 4A4IA 4A3JG 2L0FA 1WXSA 3VUWA 1YNND 2MP2A 1O7LA 3RN2A 5A35A 1HPCA 2BCOA 2FMMA 5IT9L 3M3JA 1Z5SB 2NYZD 5BMGA 1A3UA 4GS3A 4MJSA 1FMAD 4IOAA 1E7VA 2HDEA 4KSKC 1C1YB 4HR7B 3VR5A 3L3OC 2XRQD 4C3IG 1A6XA 2MP2B 2V9HA 4Q2JA 2ICEC 4II3B 4W9JA 2MBQA 3HOXG 1Y56A 3Q3MC 4DN4M 4BBSB 4MJSB 4Q0FA 4AS1A 1EOVA 1EF5A 2L83A 1NR2A 2K5NA 5ELNA 4DUZL 2IO0B 3ULJA 3F2DA 1I94L 1VCBA 2MBEA 2PKOA 4MM3A 4DUYQ 4HCSA 4A3PA 2WAQB 5DPRA 4E74A 1BVSA 3LYYA 1ICFB 1CKOA 1H9RA 3H0GG 1Q81C 3OTOQ 1LTBD 2WGSA 3TL5A 4AWJA 2NBFA 5IP9G 2F0IA 4IM2A 4BXXG 4XYOA 3HS0C 3LX0A 4GU2A 4LDTB 3VVWB 3VR9B 3TIXA 2K8BA 2WU5B 1F9JA 2KANA 4AOFA 2PMVA 3GZNI 4KN4C 4OO1G 3I9V1 3HZXA 4WJ3M 4TKNA 3GTGB 4DK3C 2ZVOA 3C19A 4GXBA 4JI5Q 4DFAA 3SGIA 2BA1A 3K59A 2F3IA 3M4PA 4BY7H 2XIWA 3L08A 3PMFA 3Q8CA 1HXYD 3PO2H 3AEFB 4HEA1 1Y1WG 4UP9A 2NTTA 3Q3NC 3V2TA 4PS8A 3IL8A 2Q5WD 2WXPA 4XWTA 3PUWA 3EECA 2LMCB 3S14B 3PREA 3U7ZA 5M5WB 2WXJA 3RUIB 4LUZA 4E6IA 2ZZPB 2ZNVC 2D11A 1G291 3L13A 2JWUA 1YHBA 2M9VA 5LMUL 4HMIA 2M1MA 4C56C 2J0MA 4RM8A 3RT3B 1B3AA 5C44G 4FF1A 3AECB 3N1ZC 4A93B 1XLQA 1WFYA 3D6CA 3LWEA 5DPSA 4BKSA 3V3XA 2R7ZG 5CORA 1H9MA 4LLGM 1GUSA 1GB4A 5D2MB 1B70B 4BWGB 3T1HQ 2IJ0A 3ER0A 4WORA 2KENA 1N60A 4LK0M 5KYIA 2B3AA 4R4QA 2F0KA 2KLCA 2OEOA 3R66C 5J1ZA 3S17B 2KACA 3K5NA 1T0YA 1DD2A 5M3MG 3T3NA 3J81j 5J3BA 1K8AC 2UUBQ 5GAEC 4LF6Q 3CCMA 4TQ0A 4MEMA 1EY9A 3ALBA 1GUGA 4DR5Q 3NELA 2CHZA 5AZHA 3M7NA 1OXVA 2LVOA 3WCQA 3CRLC 1SNPA 2MSED 2RA4A 4ZHOA 2BOSA 1EIGA 2PVGC 4GDKB 1N63A 3PIO3 2RDGA 1YJ9A 2CR5A 4CJ1B 1MFWA 3BINA 4IWPA 4HJAA 2PPHA 4QIWB 2DN8A 2ZJPA 1XMOL 5JHBA 5EE1A 5D7GA 3JSVA 1WYGA 3CMMB 3MA2B 4JI8Q 1BCPB 1QG7A 4LF7L 2IL8A 4ZKBB 2HCIA 1YHAA 3TUOA 4IN3A 1IBKQ 1IPGA 3N9YC 2RVLA 3E0JA 3K0YA 2LGYA 3KFUA 1TWFB 2MRPA 1K28A 2RMMA 5E3FA 2F0VA 2L12A 1QZHA 2ONQA 5ELFA 4B3TQ 1I7HA 4BS9A 1G91A 5IA7A 1Q1EA 2F3VA 2RPQA 2EY1A 3KW5B 1ML0D 2RKSA 4C3HB 4LF4Q 2KECA 4UY8C 2DZIA 1LQBA 3K7AH 3RR5A 2JX5A 3LJ3A 3NSWA 3ZQ4A 1TY0A 3AE2B 1EWIA 1J7CA 5KGUA 3CC7A 2KEDA 3BK1A 2Q8IB 2KCMA 1A15A 4A3FG 1HZ6A 4A3IB 5E6PA 2R93H 4ICVA 3H3VH 2OQ0A 2AX5A 2WLBA 2VH2A 3HRZC 1K9MC 2FBWB 3PHXB 3CCQA 1JC7A 3ZJTA 4OL7A 1V9PA 2CWAA 4QF4A 1QOHA 1I3QB 4QJFA 3SDZA 4X6AH 2BS4B 3H7PA 1EOTA 1OXXK 1VQNA 1YQ3B 4CBVA 1WD0A 4HIMA 1VR9A 3KUCB 4XTCS 2I2YA 1A5RA 4JI1L 1A3TA 1PLFA 5KNBA 1ZKHA 4U68A 1F2ZA 2KOLA 2ZEQA 3E9SA 3RN9C 1TS2A 1X55A 2UXDQ 1UF0A 2CKZB 4OWWB 1K83H 1SGHA 2NVTB 4JL9A 4RHSA 1D3ZA 5HGTA 3W3AA 2CS4A 3HKZG 2G45B 1HUMA 4JWUC 1QZEA 3T16A 4EZKA 2AL3A 5EPKA 2BWES 3T53B 4A3MB 1J6QA 3VTVA 4BBSH 5KIXA 1LT3D 4DV6L 4A3EH 3BK2A 3KK7A 2IDYA 2HDMA 3QIJA 5GQOA 2K39A 2KEEA 3CWIA 3GE3C 1I4XA 1RIPA 2KJHB 3VRBB 1CFMA 4RMFA 3VTWA 1MBYA 3TQYA 3ZNZB 1U9RA 1BUIC 1SMYC 4CDEC 2AMCB 1P1AA 3GTJB 5J17A 4HKQA 3RPFC 2W55A 1PRTF 2PPBC 1TY2A 1LGRA 2A19A 4DF7A 3JAME 2VUMG 5AZGA 2KMAA 1WI5A 4L63B 4DR4Q 4KKUA 4MN3A 3HOZG 2MJ3A 3QARA 1L1OB 1YEZA 1XEEA 1C77A 3BYTB 3EJIA 5C4HA 1BQQT 1X54A 3UDFA 3MJ5A 1QJOA 2FJ2A 1L2FA 4IURA 4O1NA 1N32L 1UWMA 2PJHA 5M5YH 1N6ZA 2KX0A 1RFAA 5L95C 1EIYB 4HK2A 2VB3X 4CKEA 3IT4B 2L1BA 1DOMA 1IYFA 2ZCCA 1P0RA 3M95A 3RI7C 1YQ4B 3OG5A 4A93H 3IFTA 3L7ZC 3PVLA 4HPPA 3QJZA 4TRDA 2JQOA 2MO1A 2F4VQ 1LTSD 3IAS1 4XDDA 2WP9B 3EQLC 5JEAJ 4C00A 3A8KE 2Z0SA 1PH7A 1BBXC 1PH1A 3SD5A 3ZO5B 2B8GA 5JEAG 1K73C 4CDFC 1FD7D 1E7ZA 1PXUA 2V4DA 4GN5A 3NWSA 4AYBG 3S17H 2LGSA 4I6PA 3P4PB 4KHZA 3TMPB 1GUAB 3U7DA 2IW3A 2R61A 2BDNA 4GOPC 4B3MQ 4GDLB 1SMYD 4JX1C 1GPXA 1ZXIA 3T1YQ 1EYGA 2FMCA 1VS0A 1WYDA 1I5FA 1IXRA 2MCNB 1VQLA 1C4QA 4IKGA 3OW7A 1FXIA 5JZEB 2CWPA 5FOBB 1I6HB 1ZW7A 1LT4D 3G48A 2FCMA 2GA4B 4ZCKA 2OWOA 4X57B 3AB9A 2KFKB 4YSYB 1PFNA 3SVMA 4YWKA 3A9KA 4LNFA 1SYDA 4EGVA 1V8QA 5AJ3L 3WALA 3I8ZA 2I5MX 3S2DB 1ZXHA 5K5PA 2WB1G 1N33L 2HUGA 3DCGA 3VTUA 1L6UA 3ZJVA 3SHQA 2JQRB 1GXDC 1LTTD 4ILWA 1C7YA 3AE6B 5GMVA 1CHPD 1WSPA 4WAAA 3Q8DA 3NXWA 2E8GA 4JBWA 2ES2A 2UUAQ 4WAFA 3P4SB 3C1FA 2JZZA 4C4VB 4DV0L 1W6JA 1LABA 2ZTDA 1UEAB 3FKIH 1PQSA 2DNCA 2UUCQ 2KMMA 4FULA 5GXGB 3R2TA 1EM7A 3BYYB 2WXGA 4OWTB 1WTOA 1CUKA 3JAML 3DVGX 3OHXC 3I72A 2KVMA 4WJPA 1HNZQ 3AE8B 4BOSC 1YN3A 2W82A 2WWZA 1V49A 4JV5L 5G55A 4KHPL 1YQBA 3EIVA 1PA6A 2D0PA 4MELA 2EYFA 3RNBC 1II3A 2NVYH 4A3IH 2MQJA 1GM5A 1SAPA 4I7ZC 1OXTA 1FPYA 2PI2A 2HD3A 1XNQQ 2KTRB 3DVNV 2MEKA 1S40A 1B44D 1YNJC 1N5XA 3W5UB 4ACFA 1C0AA 3DUZA 4XQNA 3Q8FA 4EEWA 1I3QH 4ZRJA 2ICIA 4JI2L 3DHHC 4XDCA 5ELOA 4M8AA 2AHOB 5LL6S 2VQFL 5BR8L 2KX3A 3KUDB 4FADA 5BO4B 3VA5A 2F0PA 1BF4A 3J81L 1WGYA 5H1SE 3ZJYC 5D94A 1S4ZA 3BY4B 4N9F4 1TQOA 2PZTA 2YV5A 1IKLA 3M7GA 5JOBA 5FLMG 1CQFA 3RLOA 2Q2TA 1ENAA 2WDTB 4IUTA 2BH8A 2OXPA 4A8XC 4XIGS 5AZFA 5C4JB 2RCNA 4D2KA 5IYBG 1KAAA 3M62B 4JG2A 4RFBA 3H1UA 3N20C 2WXHA 4YSXB 1PFDA 1Y1VB 1G6JA 1YJWA 2XK5A 4X66Q 1Q3LA 2IHFA 1H9KA 4J15A 4N59A 5IOIA 4NQKE 2F0GA 5DNFA 1XMQL 1STNA 3CMAA 4JBJA 1VQKA 2V0GA 4X62Q 3R7QA 3HVDA 2CJOA 5IWAL 2EELA 2EKEC 2PZWA 2DGYA 3OMCA 4HCEA 1PH9A 3KJOA 4KKJA 1CSQA 3P4QB 5AUKA 2E6XA 3DWMA 3FRPB 4LNKA 1MSGA 2PNRC 4KDIC 3GTJH 3S1RH 4NP5A 1WJ4A 2GN5A 2MX2A 2JP1A 4LF8Q 2K5DA 3CHBD 4WQOB 2FFKB 5FLXc 4YTNB 1WTXA 4OZCA 3NVZA 3TRZA 3S15B 4DR7Q 1YJIA 3A74A 3I2ZA 1VMPA 4OWXB 3HOUB 4MH0E 3IAYA 2KVRA 3HEJA 1YNJD 4WJNA 1STAA 3LWUA 4GOCA 1G6ZA 4JQWC 2DYMA 1T0SC 1N34L 3MTNB 1SN8A 2JA6G 3KWLA 4DXAB 4CGYB 2JA5B 1F9QA 2O6VA 4KIKB 2D3BA 2BYTA 4IOIE 2F0FA 1ENCA 1OFFA 1A63A 4FF2A 4NXML 2WKCA 4RKBA 2JE6I 4YWLA 1ROEA 4IJHA 3MHSD 1LXDA 1OO9B 4M0WB 2QA4A 4A76A 2QDLA 1JT8A 1AARA 1KRHA 3MXNB 3A7AB 3TZDA 1JW9D 3NJTA 2K4KA 3ZW3A 4LCDE 4DHZB 4HVBA 3UDGA 2NBVB 1KDCA 2MBHA 3U58A 3L4PA 1CA6A 4XDXA 1K8MA 5T8IA 4HJ5A 4IO9A 4GKKQ 3GOEA 2OJWA 3K9OB 3N30A 2QW7A 2RF4A 3H8HA 1EY6A 3K57A 4G7ZC 2N0SB 4P16A 2NVQB 4PS7A 2YTVA 3J80i 2KCCA 3CCEA 2JA8G 1U4AA 1EZ6A 2F0HA 3P63A 1HZBA 4GMVA 4TVAB 3BIID 3KDFB 3I4MG 5C4XH 1FCCC 3VYUA 3N32A 1F0ZA 5C3EB 1HTPA 2Z6KC 5E1FA 3C8YA 3I7FA 2LHEA 4YSZB 4DPGA 1LM0A 3I63C 4LF9Q 4KX6B 4C3JB 1Q8KA 2R92G 3MFGA 2R93G 1YI2A 2KMCA 4OX9Q 2KDEB 3K6OA 2G4DB 4M02A 3PO3B 1AE2A 1FL0A 4P1CC 2ACZB 4PK1A 1PDQA 4S0RA 2GOWA 3T9LA 4BBNC 1M8AA 4BBNF 3R2IA 1SRUA 1HZ5A 1EZ8A 2Z0DB 3TP8A 3NEMA 1EQQA 2ZW0A 4JLCA 2F0JA 4KGTA 4HSPA 3BVGA 3A7LA 1K50A 2J4XA 2K25A 5IYDG 1UD7A 4BOZB 3UE0A 1V80A 3Q3FA 2WACA 2GRIA 1LTLA 4P71A 1WE7A 1UGJA 2NZHA 2D3CA 2M56B 3ETRA 3L17A 1J0GA 1K3BC 1C78A 1VQDA 2V1YA 4BBSG 3NQTA 5CV7A 3BDLA 3GTKH 1H9SA 2D9UA 2EQSA 2PQEA 5CC4A 4DUYL 2CHXA 2INNE 5ISRA 1TGZB 3MEHA 2XNAC 5COYA 4C80A 2WAQG 2EDGA 1H9SB 2WXQA 1PFBA 2R3ZA 5HGQA 3QOLA 2O2VB 4W9DA 4JCVE 5D3DA 3WAMA 4MTKA 2NZ1D 1B2TA 4RWSC 3AB5A 3KLRA 2LASA 4FXCA 2IHEA 5G3LF 4B3SQ 4JI5L 1XQQA 1EY4A 2K1FA 4X65Q 2IO2B 5EE3A 2BS3B 3WDNA 4S17A 1UWVA 1K53A 2P5ZX 1QNUA 4A3BH 4NPSA 1J7BA 1RODA 3BZDB 4KY7A 2FHTA 3P75A 4X64L 2K22A 5T1IA 2QCPX 1SE2A 3BJUA 4JI4Q 3Q8EA 1L7YA 4DV1Q 3S1QH 1K0SA 3U4ZA 5C4JH 4JPBW 1NYRA 4IC7B 2K8CA 2CQOA 2D3GA 3ITPA 3Q6BA 5IAAC 4F1SA 1J5EQ 4R4CA 3NPPA 2Z6BA 4QCLA 1Y8NB 3SHLA 1NMGA 2MW5A 2KQ7A 2PMZB 1QOBA 3TP7A 3T1HL 2AWTA 1NI2A 4NMZA 1PH3A 3MVVA 4ICUA 3VYSA 2BT6A 1U4RA 3NVYA 4TMAB 1DOIA 1JORA 3P2BA 3AE3B 4DV3L 3U52E 2B2TC 1L4DB 4IWOA 4WQMA 1U4MA 4BY7B 1GHKA 4US9A 4RGNA 4F87A 3PO2B 1S5DD 5I4DA 3B1LX 2RHSB 5L37A 1AEXA 1S5BD 2NTSA 3FPUB 4DR5L 3PIP3 4XQJA 1Y8RC 2B2VC 2A73B 4ZDVA 3P1MA 4O42A 5G3LD 2QEXA 3BS1A 1V1QA 4APVA 4O0AA 3HOUH 1FIQA 4GNXB 2L8JA 4LW1A 3VRAB 4IUMB 1EUJA 2Q8RE 5JPNC 1LO5D 3MXGA 3Q69A 1PFMA 2I5HA 1I4PA 2N4FA 2HIXA 5J39A 3DOWA 4Y7NH 3RFZB 2FIDA 1G51A 1O7IA 4K3CA 3HOWH 3X0WA 5G5GA 5EJWA 1HHVA 2DAFA 1MKHA 5IT9E 2VRRB 4KV6A 4DR3L 3MC0B 3M63B 2VQEQ 2YYZA 4ME3A 2NWGA 2K28A 1Q8IA 4GN3B 4CDCC 1EL0A 1VQOA 2KDMA 3V61A 1HNXQ 1F2RI 1Q1OA 2N49A 4OXPA 4R9WA 1W2BA 1HH2P 1SYFA 1T9HA 1KL9A 4BBRH 2WNMA 4IFDG 3EGRA 1LUZA 5IGDA 2UYZB 1XTCD 2DNEA 4IALA 3UE1A 2Q2IA 4FDBA 4L5RC 4IWQA 2INPE 1QOFA 1KLVA 1E7UA 2NVQH 1NY4A 4LF4L 3DXJC 1RFKA 1SSNA 2WXIA 4A3CG 4OEMB 4C3HG 1TWGH 4B08A 4BVUC 2G5DA 2OQKA 3HM6X 4NAWB 3RUZA 1T0RC 1VD2A 2PW7A 2WFWA 3AN1A 2VZAA 1RHPA 4QL5A 2ALYB 4K2LA 2WDVB 5LMNQ 2K3UA 4ZRZA 4IPHA 3KVFB 4LNNA 4A3IG 4C3JH 1ET6A 4DR2Q 4NY0A 5JXVA 2X6GA 1E22A 1DOLA 5GROA 3MC9A 1MHWC 4ZHPA 5DCNA 2Y0SE 1HA5A 1KXLA 3K5OA 4IUVA 3RULA 4P7IA 4TQ1A 1WJNA 3I3CA 3AM9A 1SFOH 4DV4Q 2X38A 4EOYA 4JOIA 2DZMA 2UXDL 2IO1B 3MHZA 2WIIB 1XPOA 3MEFA 5DM63 4EKUA 1TVXA 5KYLA 4JW0A 4N58A 3KQ4A 4AQYL 3AXCA 4JWSC 2ZJDA 2L7RA 3VR8B 3KBXA 3PHWB 1D5XC 2F4IA 3K7AB 1DOXA 3QX1A 1GVPA 3NZSA 4A3MG 1XX8A 1IW7C 4JI3Q 4XE0A 1CJEA 1N8RC 2BVCA 4KD4A 2F1MA 1PH6A 2D2QA 2SNSA 2CKHB 4DV5L 2NN6I 2G1EA 2JF5A 4DXGA 2KUMA 1VDZA 2BYVE 3SEBA 1AZPA 4K8JA 5IKCM 2MHVA 3PS6A 2QGQA 4KV2A 1Z7TA 3TZUA 2F03A 2KLGA 3FILA 3OPOA 2VZKB 3B9JA 1A0IA 1R4QB 3FMCA 1XNRQ 4FXKC 3PT2B 1X3GA 3NUCA 3E5SA
chains in the Genus database with same CATH topology
3FILB 1DONA 4KGSA 4FF4A 5LHY1 4X3KA 1K83B 2RQXA 3NTKA 5AFWA 5IGBA 2CVRA 1ZUD2 1E6EB 1SIJA 5AUIA 1AWDA 1JRPA 2FUG1 4A3EB 3T3OA 3I90A 3AEGB 4DGZA 1AP0A 4KTAA 3BVZA 5HHDG 4XWWA 2CU3A 2K7VA 2RPVA 4N6EB 2E75C 1RYJA 2EYPA 1SYEA 5TSSA 1IW7D 1L0YB 3GTMB 3D4DA 1HQRD 4B9XA 5I9PA 4HN7A 1C76A 3QIAA 2LMCA 1EIHA 4EE2A 4OVZA 4LAAA 2WXLA 1JWAD 3M4YA 2V3PA 2F0NA 1XO3A 4KGRA 5M5YB 3A8IE 4US8A 1AW7A 2AQ3B 2WS3B 2L11A 2WXNA 1STEA 3DHQA 5LL6X 3LXFA 3BVMA 1CTMA 1BR9A 2JEAI 2W3SA 2A74C 1XF5L 1D1IA 1ZKOA 1O7YA 4ZRQA 5ELDA 4FO2A 4RF1A 3GP7A 1FO4A 1V43A 3AU7A 1LT6D 1SYCA 3D4WA 1SJED 3KLSX 3N6RA 5C6AA 2OT2A 2L32A 2B2YC 4DK1A 4KKIA 1D1KA 1A2TA 1C48A 1EY5A 1ILQA 1DXMA 1UAPA 3I70A 1CQVA 2WP8J 1N62A 3MHBA 5FLXL 2NN6G 2EYJA 3GB1A 1SJHD 1O7ZA 1YJJA 1OQQA 5KRUA 4L1BA 1AYFA 1QT9A 1QNKA 1EWYC 5DAUA 1F2LA 3ND8A 2BB5A 1D5MC 4M1UB 4C7ZA 4H13C 1Q90A 2W54A 3FKIB 1PUTA 3W5VB 2KCNA 3HOVB 4LK1C 1ACCA 1J7AA 4RKLA 4ARCA 1PTOC 1EYCA 1PTOF 2Z1CA 2MJ8A 1LLRD 1SXTA 1YMHE 1JALA 3AE5B 4DA2A 5H92C 2PTLA 1WRIA 2NVYB 1R4PB 1E2VA 1FCLA 4XXEA 1EQVA 1UUPA 3GV6A 1ZEQX 3EVQA 5IGGA 4WFN3 2K5PA 2H4OA 2L55A 2Y3AA 3NHHA 1ZP0B 1SBBB 4EQNA 2YEPF 3KUPA 2PCFB 4J3OD 1EYDA 4FXGC 4C7YA 1RM6C 1NI3A 2EYLA 1JB3A 3PUVA 1J8IA 1STYA 2SAKA 1FFUA 1TR5A 3OMGA 5DM73 1PTOD 5EE0A 4J8QA 1C9FA 2M00A 2N9KA 1U4LA 3QWNA 3S1RB 2I46A 3W1SA 1PRTC 1ESRA 2K5WA 3TMEA 2ZT9C 3ABVB 3AE4B 4ID6A 2ON8A 2JSOA 3K58A 4EVOA 2RDFA 4KN7C 2CJNA 4C3JG 2MH7A 2K04A 2D5GA 4HRSA 1KTKA 1RTOA 4HTHA 4MACA 5D65A 2MJEA 4ZQ3A 1EFID 3HGBA 1QLBB 2NMQA 1C8CA 3J81E 4KKTA 2BE5C 2Z4HA 1WXQA 3A56A 1IBXB 1PYWD 4FP5D 2F0EA 4KY6A 5EKLA 5C4XB 4LMQD 2GB1A 4B0MA 3DWPA 4RCOA 1S5FD 1TU2B 1IKMA 2V3NA 2ZXPA 4YT0B 1PRTD 3SR1A 4MH8A 4ME5A 3NRZA 2ENBA 4DU9A 1B53A 1SE4A 3TDQA 1E7PB 2CHBD 4OW0A 5JVH3 4PQXA 1BMLC 3X3MA 3P7JA 5K36H 2KAJA 3NWTA 3I57A 4TKOB 3DWAA 3T13A 2ZXRA 2L52A 1L4ZB 1HRJA 1L5PA 1VJKA 1U4PA 4QB4A 1WD1A 3VYRA 5CV6A 3GTKB 4IUPA 5C44B 2K05A 2BE5D 2K01A 1F9RA 2DYOA 3HRDD 5FK9C 3P1HA 4KJNA 3IAM1 2IT1A 5CV9A 1Q12A 4TSSA 3U4EG 1SSOA 3FPPA 4ODGA 2B2WC 3G7LA 5EKKA 1V8CA 1QCBD 2BA0A 4Q5VA 5BN5A 3SFEB 2WU2B 2F0QA 3ZJUA 5EQ0A 4P2CB 4A3BB 5KNCA 1NVID 2D62A 4ZYSA 4IDIA 2IGDA 2O2LD 1CI3M 4DAVA 3S1QB 1MPEA 2KA7A 2N88A 1Y69U 3D6WA 2F0MA 1TS3A 1HA6A 4MT5A 1FYCA 1KF6B 1N61A 3Q22A 5BYQA 1ZXTA 3HP3A 4J6HA 2AWNA 1TKEA 4ITKA 1EY8A 1NCVA 2JYEA 3I91A 1VF5C 3SK4A 1G8ZD 1JOOA 4OIJA 2L5TA 5C5MA 3FEWX 1DM0B 1T3QA 3CKIB 1CZPA 1FD6A 3AE7B 3S2HB 4M0WA 4CKBA 4Y7NB 3MXNA 4YWGG 3E6ZX 4HSVA 3HOWB 2F0TA 4OZBA 5JPMC 5EE9A 2EKIA 2E2DC 5FO9B 2ZW1A 2PIAA 1T5XD 1K51A 4RGMA 2MUYA 3Q0AA 4BBRB 3TP5A 2WQYB 1HFGA 3X3NA 3W2DA 1X3PA 1RKNA 2H88B 5KNDA 2OEDA 2CQAA 1MSHA 2J52A 5FO8B 1TWGB 2PZUA 2BS2B 2F0OA 1F9SA 5CYUA 2I38A 1Z6HA 2X69A 5JVG3 3O13A 3EUB2 1PGXA 1PTOH 2BW2A 1SF0A 1MVKA 4OO1H 3MP9A 1M4VA 5CBEE 2QJLA 2LGIA 1KNEA 4EQPA 1STGA 1HCZA 1IGCA 1SFOB 2J53A 1P7EA 3TEWA 3PZ7A 4DAPA 1E0BA 2F0DA 2LS01 3RD4A 1XCQL 4NAMA 5JJZA 2D5DA 3MAQA 2F0SA 1DOYA 3H09A 2XWBB 1QOAA 2YU9B 2RSNA 5I9OA 4OZAA 3NE5B 2QF7A 3Q6SA 4USAA 3NQIA 5EPLA 4FF3A 1SE3A 5BYRA 1D2BA 2HTME 2JEBI 2X6LA 4C1NI 4HROA 3QG1A 1E0ZA 3MXPA 1EWHA 1G2TA 3IKJA 4IUUA 2B63B 2EJGC 4JPSA 3PUZA 3KWVA 1T6BX 3MXUA 3TP6A 4IZ8A 1BDOA 3J9CA 1I4HA 2J42A 1MHHE 2EXZA 2EOTA 1QE6A 1I50B 1GJXA 3FDTA 4CHTB 3F2UA 4NDXA 1QKZA 3FC4A 1UWXA 1TWHB 1AN8A 1EYAA 2QSDA 1GUOA 4ZUIA 2SEBD 5CV8A 2B8FA 2EZVA 1ONLA 4B9WA 4N9TA 2I07B 4WH4A 3WOFA 2RBMA 4WJWA 5C3WA 1LV9A 3GV3A 1WVLA 2W3RA 4NZLB 3EFXD 1W6KA 4IUNA 1Q1BA 4LTUA 2JU6X 2WKDA 1JR0D 3OOCA 1B4OA 2AQ1B 3PZ8A 3CU7A 4K5WA 1RJTA 3U9SA 5CR3A 1EY7A 2QIEB 3RLFA 4XQQA 2M19A 3ERQA 2VXWA 1FNWA 3C1EA 3TN2A 5EKIA 1NYQA 4PMCA 5IODA 1FFVA 5M3FB 1DYQA 1EWCA 1SNQA 1O80A 3LB8C 3B2FA 1KLUD 3SK5A 4UDUC 2EJFC 4A3KB 1JROA 2WXRA 2SOBA 2VB2X 3OWFA 4L23A 4AQ7A 3EA6A 2WDQB 3DWGC 5BMIA 2LY7A 1NSNS 3MZ5A 1I4RA 4OO1I 5E4XA 2O4XA 4V0BA 4PMBA 4DXFA 2K6AA 5A2QL 3I4NB 1XYIA 3S1MB 3TEYA 4KY5A 3ZYYX 3ND9A 4ZK9B 1A70A 4F8MA 3P4RB 3PO0A 1QILA 4OHJA 4F88A 3M4OB 4KD3A 1JWUD 1BOSA 3VR2A 2JYTA 2E3TA 1NENB 2WXMA 4C1NK 2EJMA 1J9OA 2J0TD 3CRKC 2EYHA 1RTNA 1V1PB 1O78A 1V97A 1I4QA 2NUCA 1OXSC 3VQIA 4WRDA 2AQ2B 3GS2A 1HQMC 5C2TB 4A3DB 2L4NA 4FYDA 1ZE3D 3AE9B 3B2GA 1B50A 3BG3A 1VRAB 1CK1A 1DZ1A 3NS1A 2DY7A 1STHA 4RH6A 2H89B 1LTID 5JEAH 3Q8AA 1EY0A 4RCNA 1KH0A 2ZXOA 1CZGA 4HMJA 2JXTA 3OIQA 3H6MA 1H9JA 2KHSA 3TEXA 4RNAA 4RA8A 5FLXE 3S16B 4YIJA 1E9MA 1BCPC 4ZRPA 1BCPF 1YNTE 1EQTA 4DNTB 3DMUA 2DY8A 4DQOC 2AUKA 2TSSA 2C5CA 4ZOHC 1IL8A 4K2KA 1ZPSA 2F0LA 3QJYA 2LEKA 2XSCA 1HTLD 4KMUC 5EPJA 5IOCA 1ESFA 4L6TB 4F7XA 2JZPA 3AH7A 2AWOA 4A9AA 2IPKD 1WTVA 2BTEA 4H7BA 3D31A 3HUIA 2FE8A 4R8NA 2HQEA 2KN4A 3I73A 4MM3B 1QWYA 2JXMB 4XYQA 3I4LA 4KHVA 3SR6A 1TZOA 3P20A 1AFPA 1WTRA 2B39A 2H1EA 1ICWA 3A54A 4YTMB 2LJIA 2QILA 3NUHB 1BCPD 3C46A 1IGDA 2KJXA 5T1GA 1QB5D 3KBGA 1XLOA 2WINB 1KDBA 1XLPA 1Y8PB 5IGFA 1ZDXA 2HDLA 4HEDA 2XWJB 1JQ4A 3GTOB 4ZAIA 1PZKD 1WTPA 1LT5D 1MI2A 1B9NA 1F2YA 1T5EA 1XLNA 3MWYW 1YN5A 2KQ4X 3IFDA 4REZA 4B0EA 1JWMD 3OSOA 4K5VA 5FO7B 3AMUA 1N5WA 4BY1B 2B2UA 3SE0A 4K6DA 4H2AA 3D8GA 4X3UA 3AEEB 3NTHA 4N9PA 3R93A 1BXTA 1TKYA 3W9CB 3AEBB 5FKAC 5ELCA 1ILPA 2K0PA 2PLPA 3U9OA 2M0AA 2L1AA 1ZYRC 2V4IB 1RD9D 2A69C 4CJ0B 4NW2A 2XVSA 5ELEA 4QUFA 2Z4IA 4C2MB 1NR4A 5C3JB 1TS4A 2MGSA 2WXKA 2WV6D 3A55A 2Y0SB 4H0LC 1B9RA 1S5ED 2QMTA 4J1MA 1R9TB 1HEZE 1F2RC 2NVXB 1SNMA 4I65A 2OF1A 1I6VC 5FR3A 1STBA 1GOZA 1VLBA 3G6JB 3VA7A 1ET9A 3P42A 4PNYA 4KK7A 3URYA 4H44C 1XWEA 4EQOA 1WCMB 4L8JA 3OWEB 4R8IA 1BO0A 2IWHA 3GTPB 3RZOB 4KKSA 3T51B 2RSOA 4K6LA 1MI0A 1XCTL 1ZYRD 3HOYB 2EY6A 3L9AX 5M9OA 4XT1B 2EYOA 4A6QA 2A69D 5F2DA 1OQRA 2C9OA 3SK6A 4A90A 1JQYD 3ONAB 5H8YE 4BA2I 1TKGA 3HVZA 2IX3A 3J7AF 3AMZA 5HI1A 3PUYA 2LUMA 1A3VA 1L6VA 2B2YA 1VDVA 2Y5PA 4G7OC 2PVOD 3FVQA 1PGAA 2O5IC 4A3GB 1E2ZA 4ZKCB 5C0XH 1S5CD 2A68C 4CQNA 2B76B 2DLBA 5HFYA 1JOQA 2RDHA 4A3JB 3MTSA 3C2PA 1DOKA 2PO4A 2XN9C 4Z9CB 3SFDB 1FNUA 3DWQA 1IBXA 4C3IB 4NKLA 1QQRA 3HOXB 4JE3B 3PUXA 1F9PA 2F0WA 1JWSD 5J22A 4X3TA 3NVWA 1XXGA 1CHQD 4ABNA 5I2XA 2JYOA 1IUEA 2LHDA 1JICA 5D14A 1QF6A 3H0GB 2TMPA 1ZDVA 3Q23A 2DWQA 2A5HA 1PTOB 4DK0A 3KLSA 2K32A 1C4AA 1V1OA 1VZ8A 4P6VF 1GUTA 1D5ZC 2EVBA 4MHEA 1SNOA 1TWCB 1SYGA 2IGGA 1D4BA 5I6YA 1PZJD 4K14A 1Y1WB 2Z8LA 3TSSA 2A68D 4G7HC 2IX0A 2JA7B 2KWDA 1GHJA 1PDXA 4S3SA 2K9XA 1E2WA 2YEPB 1JE4A 1VMCA 1MGSA 2K1BA 1JWBD 2A6HC 1K8OA 4IQZA 2R7ZB 2EYMA 2LFIA 1GAQB 1X32A 1LTGD 1DGJA 5MPOA 3V96A 1IHZA 1SNDA 5CV5A 2K03A 3SXHA 4IFDH 4HJGE 5M3MB 2E2JB 1JMLA 2L0CA 1MHXA 4RF0A 1MD2D 5I6WA 3Q24A 2G9HD 3AE1B 2LFNA 1PRTB 5DEHA 1Z47A 1IYUA 4KJOA 1HFNA 3GTLB 5EBDA 1Y8OB 1C4CA 1SDFA 3VR3A 1JCKB 4RGOS 3S1NB 1L0VB 2N9LA 5IGEA 5CV4A 1BNZA 1D6EC 4FXDA 2SNMA 1GUWA 5CMDA 2MJDA 4YTPB 1KLGD 3J80E 1KABA 5EBCA 2Y5CA 2A6HD 2EE1A 4YXDB 1OXUA 1FGBD 3AEAB 3NZ3A 4DNRB 1CZWA 1EU3A 1QOGA 3LNNA 3U2SC 5C0XI 1RWSA 3NK9A 4U673 3BWUD 1P7FA 3S9WA 4A3FB 2N55A 3R3OA 4L2YA 3DM1A 3AEDB 2PW9A 1VCIA 4IUQA 2G9DA 1GUNA 2PYKA 1NAPA 4A55A 3D3RA 4FNFA 3A8JE 2PW5A 1YN4A 2E2HB 3QO2A 4WURA 3C3LA 4V190 1LACA 1K52A 5LNK1 1G2SA 2K33A 2N7JA 3D4RA 5G5HA 1DJRD 3HKZB 1F2MA 1CM9A 1B9MA 1FNVA 2EY2A 2EPBA 3VR6A 1ZOYB 1NUCA 4MIUA 2NB0A 4DAYA 2ID0A 1WTQA 2QEJC 3UI2A 4HKZE 1RCVD 2A6EC 4NJCA 2JSVX 1WWTA 2B2WA 1FM0D 1KFYB 1SB3C 1RF2D 1WTWA 4K8IA 4G57A 3RZDB 1CA5A 3VR4A 3NVVA 3V05A 3FAHA 2VUMB 1LTAD 4G4KA 3J7YW 1A2UA 2KQ3A 2MPMA 3T4AC 4XT3B 2BDOA 3HOZB 5M5XB 1WGKA 1EEID 2BBCA 3M85A 1PGBA 5BN3A 3J80L 4OGQC 2QKIC 1TIID 5I2YA 5HURA 1TS5A 5IGCA 3EROA 5BMHA 1FRDA 2L9HA 1PMRA 1X3QA 4IFDI 1FXAA 3J7AV 1TJEA 2R6GA 1FR3A 4PT5A 3BDOA 4AYBB 1SYBA 3PV0A 2A6ED 3E56A 1VZ7A 3SK8A 4CKCA 3KF8A 3IT6B 2FINB 3K5MA 4K5XA 3T56B 2CW0C 5C0XJ 1VF7A 1EEFD 3TBIB 1KNAA 1L0XB 5A2QE 1TWAB 5C5LA 4R3DA 5C0XG 3H94A 1BUVT 4ZLTF 2J7ZA 2WDRB 3CQZB 2MP1A 3BDCA 5ELBA 2OHFA 2NN6H 3QB3A 2D2CC 2WB1B 1AZQA 2WXFA 3HG9A 3GQBA 4GLSC 3AV8A 3H91A 4CJ2C 5EGTA 5HG2A 5BN4A 2E74C 1TT2A 1GB1A 1RDPD 1C79A 3K5LA 1LTRD 1JOKA 1TYGB 4RHRA 4TQUS 1SNCA 3IXSA 2HCCA 3H3VC 4ULLA 1E10A 2SDFA 4FVMA 3WOEA 1IYVA 1ENFA 3TEZA 2GI9A 3QOJA 5KEEA 3R8BA 4KI0A 4RGTA 2CW0D 4QMGA 4UAIA 1Q10A 3M3YB 2AUJD 2XRSD 5K36G 1NEKB 3NBHA 5JAVA 2F3WA 2K5QA 3NBIA 5C4ZA 4HAEA 2WXOA 1EU4A 3UI3A 2IGHA 1DCZA 1B1ZA 4IFDJ 4GZYC 3DEPA 2E2IB 3GD7A 3RMHA 2Q8TA 3ZGZA 2VZKD 3NP8A 3CIRB 4ZUJA 1KDAA 3N52A 5CGKA 2LKVA 1V1PA 2QDBA 1UNSA 4QUCA 2EY5A 1HUNA 2JA6B 1I4GA 1YNNC 5E6JA 2BB6A 3MFYA 1F77A 2E76C 1FEHA 4WIPA 5E4WC 2DBYA 5C3XA 5D3IB 1PZID 4LJZC 3OIPA 5CBAE 4RAUC 4PV1C 1SEBD 2VNUD 2B2TA 5NUCA 2JA8B 3Q8BA 1CT1D 4OIKA 3I4MB 3GO5A 4PMWA 2B2VA 3GTQB 2O5JC 4BA1I 2R92B 3DEOA 2R93B 1R7SA 2F0UA 4JK1C 4X3SA 5IIFA 3VYTA 3NTIA 2M2LA 1C4PA 1VZ6A 1FRRA 2B2UC 2IX1A 1TKWB 4WWMA 4ARIA 1YNND 1O7LA 5A35A 1HPCA 2BCOA 2FMMA 5IT9L 2NYZD 5BMGA 1A3UA 1FMAD 2HDEA 4HR7B 3VR5A 3L3OC 2XRQD 4C3IG 1A6XA 4Q2JA 2ICEC 1Y56A 4DN4M 4BBSB 4Q0FA 2L83A 1NR2A 2PKOA 4HCSA 2WAQB 3LYYA 1H9RA 1LTBD 2NBFA 2F0IA 3VR9B 4AS1A 4XYOA 3HS0C 3LX0A 2WU5B 2PMVA 4KN4C 4OO1G 3I9V1 3HZXA 3GTGB 4DFAA 2BA1A 3K59A 2XIWA 3PMFA 3Q8CA 1HXYD 3AEFB 4HEA1 2NTTA 3V2TA 3IL8A 2Q5WD 2WXPA 4XWTA 3PUWA 2LMCB 3S14B 3U7ZA 5M5WB 2WXJA 4E6IA 1G291 2JWUA 2M9VA 4HMIA 4C56C 1B3AA 4FF1A 3AECB 4A93B 1XLQA 3D6CA 3LWEA 3V3XA 5CORA 1H9MA 4LLGM 1GUSA 1GB4A 4BWGB 2IJ0A 4WORA 1N60A 4LK0M 5KYIA 2F0KA 2OEOA 5J1ZA 3S17B 2KACA 3K5NA 1DD2A 3T3NA 4TQ0A 1EY9A 1GUGA 3M7NA 1OXVA 3WCQA 3CRLC 1SNPA 2RA4A 4ZHOA 2BOSA 1EIGA 2PVGC 4GDKB 1N63A 3PIO3 2RDGA 4CJ1B 4QIWB 2DN8A 5EE1A 5D7GA 1WYGA 3MA2B 1BCPB 1QG7A 2IL8A 4ZKBB 2HCIA 3TUOA 4IN3A 3N9YC 2RVLA 3E0JA 3K0YA 1TWFB 2RMMA 5E3FA 2F0VA 2L12A 2ONQA 5ELFA 1I7HA 4BS9A 1G91A 1Q1EA 2F3VA 2EY1A 1ML0D 2RKSA 4C3HB 2KECA 2JX5A 3NSWA 3ZQ4A 1TY0A 3AE2B 1J7CA 5KGUA 3BK1A 2KEDA 2Q8IB 1A15A 1HZ6A 4A3IB 2AX5A 2WLBA 3HRZC 2FBWB 1JC7A 3ZJTA 4OL7A 4QF4A 1QOHA 1I3QB 2BS4B 3SDZA 1EOTA 1OXXK 1YQ3B 4CBVA 1WD0A 1VR9A 2I2YA 4XTCS 5KNBA 1A3TA 1PLFA 3E9SA 4U68A 1F2ZA 2KOLA 1TS2A 2NVTB 4RHSA 5HGTA 3W3AA 1HUMA 4JWUC 3T16A 5EPKA 3T53B 4A3MB 5KIXA 1LT3D 3BK2A 3KK7A 2IDYA 2HDMA 2KEEA 3CWIA 1I4XA 3VRBB 1CFMA 1MBYA 1U9RA 1BUIC 1SMYC 4HKQA 3GTJB 3RPFC 2W55A 1PRTF 2PPBC 1TY2A 4DF7A 3JAME 4L63B 4KKUA 4MN3A 2MJ3A 1XEEA 1C77A 3BYTB 3EJIA 5C4HA 1BQQT 3MJ5A 1QJOA 2FJ2A 4IURA 4O1NA 1UWMA 2VB3X 4CKEA 3IT4B 2L1BA 1DOMA 1YQ4B 3IFTA 3L7ZC 4TRDA 1LTSD 3IAS1 4XDDA 2WP9B 3EQLC 5JEAJ 3A8KE 1BBXC 2B8GA 5JEAG 1FD7D 2V4DA 1PXUA 3NWSA 3P4PB 4KHZA 2IW3A 2R61A 2BDNA 4GDLB 1SMYD 4JX1C 1GPXA 1ZXIA 2FMCA 1C4QA 4IKGA 3OW7A 1FXIA 5FOBB 1I6HB 1LT4D 2GA4B 3AB9A 4YSYB 1PFNA 3SVMA 1SYDA 4EGVA 1V8QA 3I8ZA 3S2DB 1ZXHA 5K5PA 2HUGA 1L6UA 3ZJVA 2JQRB 1GXDC 1LTTD 4ILWA 3AE6B 1CHPD 1WSPA 3NXWA 4WAFA 4JBWA 3P4SB 3C1FA 1W6JA 1LABA 1UEAB 2KMMA 2DNCA 5GXGB 3R2TA 1EM7A 3BYYB 2WXGA 1WTOA 3JAML 3OHXC 3I72A 2KVMA 3AE8B 1YN3A 2W82A 2EYFA 1II3A 1SAPA 4I7ZC 1OXTA 2MEKA 1B44D 1YNJC 1N5XA 3W5UB 3DUZA 4XQNA 3Q8FA 2ICIA 4XDCA 4M8AA 5LL6S 3VA5A 2F0PA 1BF4A 3J81L 1S4ZA 1TQOA 2PZTA 3M7GA 1IKLA 5JOBA 1CQFA 1ENAA 4IUTA 2OXPA 4A8XC 4D2KA 4XIGS 5BYSA 5C4JB 1KAAA 4RFBA 2WXHA 4YSXB 1PFDA 1Y1VB 1Q3LA 1H9KA 4N59A 2F0GA 5DNFA 1STNA 2V0GA 3HVDA 2CJOA 2EELA 2PZWA 3OMCA 4KKJA 4HCEA 3P4QB 5AUKA 2E6XA 3DWMA 3FRPB 1MSGA 2PNRC 4NP5A 2JP1A 2K5DA 3CHBD 2FFKB 4YTNB 1WTXA 4OZCA 3NVZA 3S15B 1YJIA 1VMPA 3HOUB 3IAYA 3HEJA 1YNJD 1STAA 3LWUA 1G6ZA 2DYMA 3KWLA 4CGYB 2JA5B 1F9QA 2BYTA 4IOIE 2F0FA 1ENCA 1OFFA 4FF2A 2WKCA 4RKBA 2JE6I 1ROEA 1OO9B 1KRHA 1JW9D 3A7AB 3TZDA 1KDCA 3L4PA 1CA6A 4XDXA 1K8MA 5T8IA 3H8HA 1EY6A 3K57A 4G7ZC 2N0SB 4P16A 2NVQB 2KCCA 1EZ6A 2F0HA 3P63A 3BIID 1FCCC 3VYUA 1F0ZA 5C3EB 1HTPA 3C8YA 5E1FA 2LHEA 4YSZB 4KX6B 4C3JB 3MFGA 3K6OA 3PO3B 2ACZB 1PDQA 1M8AA 3R2IA 1HZ5A 1EZ8A 3TP8A 2ZW0A 2F0JA 4KGTA 4HSPA 3BVGA 3A7LA 1K50A 2J4XA 2WACA 2GRIA 1UGJA 2M56B 3ETRA 1C78A 3NQTA 5CV7A 3BDLA 1H9SA 2D9UA 2PQEA 5CC4A 2INNE 5ISRA 3MEHA 2XNAC 5COYA 4C80A 2EDGA 1H9SB 2WXQA 1PFBA 2R3ZA 3QOLA 5D3DA 2NZ1D 1B2TA 4RWSC 3AB5A 3KLRA 4FXCA 5G3LF 1EY4A 5EE3A 2BS3B 3WDNA 1K53A 1QNUA 1J7BA 1RODA 3BZDB 4KY7A 2FHTA 3P75A 2K22A 5T1IA 2QCPX 1SE2A 3Q8EA 1NYRA 3ITPA 3NPPA 4QCLA 1Y8NB 3SHLA 2PMZB 1QOBA 3TP7A 4NMZA 4TMAB 3MVVA 3VYSA 2BT6A 1U4RA 3NVYA 1DOIA 1JORA 3AE3B 3U52E 2B2TC 1L4DB 4WQMA 1U4MA 4BY7B 1GHKA 4US9A 4RGNA 4F87A 3PO2B 1S5DD 5I4DA 1AEXA 1S5BD 2NTSA 3FPUB 3PIP3 4XQJA 2B2VC 2A73B 3P1MA 4O42A 5G3LD 3BS1A 1FIQA 3VRAB 2Q8RE 5JPNC 1LO5D 3MXGA 3Q69A 1PFMA 1I4PA 5J39A 3RFZB 5G5GA 5EJWA 1HHVA 5IT9E 4KV6A 3MC0B 2YYZA 2NWGA 2K28A 1Q8IA 1EL0A 2KDMA 1F2RI 4R9WA 1SYFA 2WNMA 4IFDG 3EGRA 5IGDA 1XTCD 2DNEA 4IALA 2INPE 1QOFA 1RFKA