1EWCA

Crystal structure of zn2+ loaded staphylococcal enterotoxin h
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLGGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN H
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 73
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ewcA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ewcA02
1EWCA 2XN9C 4RGTA 4K6LA 1CQVA 2SEBD 4RGOS 1SJED 3R2IA 2QILA 5ELFA 1TS3A 1BCPB 3O13A 1SE3A 5ELEA 1ESFA 1M4VA 1KTKA 1RF2D 1BCPF 3TSSA 2WV6D 2NTTA 4Z9CB 1G8ZD 1TS5A 2G9HD 2QEJC 1ET9A 1CT1D 1D5XC 1HTLD 1RCVD 1SJHD 1FNWA 1RD9D 1ET6A 4RHSA 1TY0A 1YN4A 2O2LD 1EEFD 1PRTB 2AQ1B 2RDHA 1DJRD 1TS2A 1PTOC 2XNAC 1D5ZC 4C56C 1S5FD 2AQ3B 1SE2A 1BCPC 5I4DA 2R61A 1FNUA 1V1PA 1YN3A 1D6EC 3BVGA 1I4HA 1F77A 4ZYSA 1PRTD 1JWMD 1S5DD 1QILA 1LT3D 1FD7D 2IJ0A 2CHBD 1JWSD 1PZJD 3V05A 3CHBD 1I4QA 1L0YB 1CK1A 1EEID 1LTRD 3URYA 1CHPD 1SEBD 1PYWD 2RDGA 3BZDB 3MC0B 4RHRA 1HA5A 1LT4D 4NZLB 1LTAD 1GOZA 4L63B 2ICIA 1TY2A 4RGNA 1S5BD 2Z8LA 1I4XA 1LO5D 3OWEB 4BWGB 5TSSA 1KLGD 1PTOH 3BVZA 1PRTF 1TS4A 1LTSD 2TSSA 3DWQA 5FKAC 1LT5D 1SXTA 3BYYB 1B44D 3R2TA 3BYTB 4RCOA 5D3IB 1RDPD 1S5ED 1JCKB 4RFBA 1S5CD 1V1OA 1ENFA 1V1PB 2AQ2B 4RH6A 5D3DA 5ELBA 4TSSA 1EU3A 1XXGA 1FGBD 3DWPA 1PRTC 3BVMA 1UNSA 1AN8A 1JQYD 1I4RA 1MD2D 1T5XD 1SBBB 1KLUD 5FK9C 1L0XB 2NTSA 1DYQA 4L6TB 3SEBA 1CHQD 1HXYD 1PTOB 1FNVA 1EFID 1LTBD 4OHJA 3R8BA 1JR0D 1PZKD 4DXGA 1HQRD 1PTOF 4RGMA 1AW7A 3EA6A 1BXTA 1LLRD 2J4XA 3GP7A 1STEA 4UDUC 2XRSD 1SE4A 2IPKD 1PTOD 1D5MC 1UUPA 1PZID 5ELDA 1BCPD 1YN5A 5ELCA 4O1NA 1I4GA 1I4PA 1B1ZA 1LT6D 2XRQD 3W2DA 3KLSX 3MFGA 1EU4A 3EFXD 1JWUD 3DWAA 1LTTD 1XTCD 1LTID 1LTGD 4DXFA
chains in the Genus database with same CATH superfamily
1EWCA 4K6LA 3EROA 1J19A 1L4ZB 4LCDE 5AFWA 5TR5A 3QHTA 1TBEA 1KRTA 2KANA 3M95A 4ZRJA 2E76C 5D7GA 1I35A 3NQIA 3T4AC 3UE1A 2FUHB 4MIUA 2IGGA 1WTWA 4FHKA 3TMPB 2EZVA 4LF7L 4KVGB 5KYLA 3BY4B 2HDLA 4G50A 1HTLD 1SROA 1IZ6A 1CKMA 2QDLA 2L4NA 4FJZA 2F0PA 3G6JB 1UEBA 4W9CA 3G7LA 1B4OA 1L2FA 2LGYA 3ITPA 5CBEE 1MJDA 3KUDB 3RR5A 3E56A 3TCAA 3S1MB 3AMZA 3NBHA 2WNMA 4NAWA 4IPCA 2L0TA 2FMMA 5KEEA 1F77A 3LWEA 3FKIG 5IGCA 3WALA 2BDNA 3HS0C 4CDFC 4JPBW 4DAVA 4XZ4A 1EUVB 3CHBD 4DV3L 4MH0E 1VF7A 3AH7A 1QZEA 2NWGA 4UAIA 4LLGM 4DAMA 2R92B 1MGSA 3DM3A 5A35A 2K5VA 3JAML 3CMEA 3TEXA 2OCEA 4C3HB 2J42A 2LXJA 1S5BD 3EUB2 2PYKA 3FKIH 2JYOA 3OW7A 1LUZA 3RMHA 5LMNW 1FXTB 1V9JA 3ZUNA 1OTCA 1IBXA 1QUQA 2HQEA 1R4MI 1EWIA 1JRUA 2ZXOA 4K8JA 2E2HH 1C3TA 2GBRA 2HCCA 1LT5D 1T5EA 2KOLA 1PH8A 5KHQA 2INPE 4IO9A 1BBXC 4GB9A 2ZNVB 4EVOA 2OTJA 2MBEA 4JI1L 4ASWC 1XX8A 4KGTA 4BOZB 1UE6A 3A8IE 5CV9A 1BNZA 1N36Q 4HROA 2VUMH 5AZHA 4X64L 4US8A 2WLBA 1JQYD 1XNRQ 2Z0DB 4HDOA 1P3QU 1K0RA 4AH6A 2PE6B 1CFMA 1VDVA 1X32A 1YVCA 3S2HB 3I3TB 4EQPA 1DYQA 4HN7A 2BOSA 1WM2A 4KIKB 3UDIA 3DEOA 3K6OA 2F0JA 1GC6A 1SMXA 2L15A 4YHHQ 4I6NB 4MTKA 3MFYA 1VR9A 1HA6A 5D94A 1IKLA 3EA6A 5JHAA 2YU9B 1DOXA 4XQJA 3AFPA 1VRAB 1VQMA 1A3UA 3HRDD 3RZDH 2WYQA 2EYLA 3T3NA 2EELA 3TDQA 3HOXH 3BG3A 3GTOB 3BWUD 5C3WA 2E2IB 4A3MB 2FE8A 3MHBA 4G4KA 2R2OA 4AOFA 3U2SC 3VTVA 3PV1A 2H1EA 5IT9c 4IFDG 4TRDA 3GS2A 4A3MG 1WXMA 4E3CA 5GADC 5EBCA 1C77A 1STYA 4U673 4DXAB 2KHSA 2RVLA 5IP9G 5LMUL 3STBD 1ASZA 1U4AA 2HD3A 1M4VA 2MBBB 2NYZD 4MNOA 1SYCA 4IFDH 4HEA1 2G9HD 4MZ9A 1J6QA 2KUMA 2K5DA 4LK1C 3HOUB 4LFAL 4ZDVA 4S0RA 3D6CA 1IBKQ 5T1IA 1EQVA 2QDBA 5IP9H 2D5DA 2EMSA 2O2LD 5LL6S 2UUBL 3VA7A 1CSQA 1ZKHA 5HFYA 1BT0A 2RDHA 1CI3M 2CVRA 4HJAA 2J0MA 3TMEA 2A69D 4X66Q 2JEAI 1S5FD 3QX1A 2RKSA 4NKLA 4RMFA 1X3PA 3KJOA 2K5QA 5ELNA 1DZ1A 1Y56A 3FILB 1XNQL 4YIJA 1V9PA 1RTNA 4AYBG 5FR3A 1Y8OB 2HDEA 2MP2B 4DNRB 3DBRI 2N4FA 4JWSC 1VQKA 4LDTB 2B3GA 1NBWA 3S2DH 1SNCA 2O6VD 4LUVA 1KD1C 1AP0A 4Q2JA 2K4KA 2VH2A 4R9WA 3J7A5 5IGBA 1LTRD 3Q0AA 1SGHA 1E7VA 4UHVA 1YJ1A 4JI0Q 2BS2B 3U50C 2VZKD 2HIXA 5CV8A 2BF8B 2A6HC 4Q5VA 2XVSA 1VQDA 4JI4Q 2DHZA 2WU5B 4RGNA 1PLFA 4KJNA 4YWLA 1X3EA 3W5UB 1JB7A 4KSLC 2UUCQ 3U4EG 3ECIA 4LJPB 3LYYA 4TKOB 4ZUIA 3VR6A 4A3DH 1A15A 1B44D 2IT1A 3F1ZA 4KN7C 4OIKA 4P73A 5GAGC 1CZPA 2Z0EB 3E6ZX 1ONLA 3KDFA 1TWGB 1OXSC 4LNNA 3GZNI 3LX0A 4HTHA 3HEJA 4DN4M 5IGGA 2JSOA 1QWYA 2EYHA 1WJ6A 2LUEA 2G1EA 4M00A 1PFMA 2K1BA 2F0GA 5DEHA 1ZW7A 3FPUB 2OOBB 5ISRA 4ZHOA 4K7WA 3MTSA 4AWJA 1JW9D 2CWPA 1SBBB 3M9BA 1WGHA 5JPMC 3GTJB 1AARA 3K58A 4KY7A 5FOBB 1WVLA 2Y5BB 2PZUA 4ODGA 3UI3A 2X69A 1A8VA 1I6VC 3D8GA 3SK4A 2PTLA 2L5TA 3AE5B 1P7FA 3K9PB 3HOYH 3RD4A 1J5EQ 1AW7A 3S14H 1BXTA 1HFGA 1WCMG 3VR9B 3A9KA 4NB3A 3H9DA 2ICEC 4BBSG 4KHPL 1WYWB 2MHVA 5IT9L 3VYTA 2PKOA 3CRKC 4QMGA 4HCNB 1VZ8A 3RI7C 3GDEA 4G7ZC 2A4ZA 3G6EA 2B76B 2WU2B 5G3LF 5KNBA 1NR2A 3G71A 3HKZE 2KVZA 4YTPB 3JW0X 2EMTA 2KDMA 1I6HB 1F9QA 2VZAA 1SSNA 1WFYA 3EFXD 4K2KA 4OO1G 2PJHA 2Q5WD 3BK2A 1WCMH 3S15B 1MHWC 4CDCC 4DV7L 1VCBA 2OHFA 2JQOA 4BBSH 1K28A 3DWGC 3R7QA 2FCSA 4QJFA 4EUTA 2WB1B 1TWCH 2KECA 3OMCA 4NXNQ 1JICA 2B2TC 2UXBQ 3P75A 4DR1L 3I63C 3A5ZB 2E2JH 1GG3A 3RT3B 2KLCA 3S17B 4OO1H 2NVTB 4PZ8A 2MJDA 4XX5A 4GS3A 1JOQA 2I38A 1S4ZA 1EYAA 2BA1A 1BDOA 4KD4A 4M1UB 1E22A 4IUTA 4BBRG 2MJEA 2REXA 1RODA 3KF6A 4FBJB 3TP6A 2PPHA 5KHOA 3U58A 4B3RL 2L7RA 4WFN3 3SFEB 3OHXC 2CQOA 1EFWA 4JI3Q 4DGZA 4FYDA 2EJMA 5IY0A 3RUZA 1WR6E 2D07B 3HUIA 4YT0B 3BZKA 4P16A 1DJRD 4GKKL 2BYEA 2V3PA 3TREA 1A2TA 4NP5A 3J80c 1Q5WB 3HOVG 2FINB 2DZKA 1B9NA 2M0AA 3X0WA 5T1GA 2Q8IB 2DNCA 1NCVA 3RNEC 2AYOB 2KXJA 3T1HQ 2ZPNA 2K5WA 4DAYB 2NUCA 3HG9A 2C7NB 3DQVA 4XDDA 2A1AA 3HOVH 3CIRB 4AQYQ 1KDAA 4W9LA 2IO3B 1V97A 3OW2A 2JE6I 4GLXA 5G5HA 3DEPA 5HY6A 1XMOL 1IPGA 4KZ0A 1G6JA 4PS8A 1VQ9A 1TWAB 2VQFL 2KTRA 4G57A 1TU2B 4A3JB 2K5PA 5BYSA 1KM7A 1C76A 2DNFA 4TQUS 3CCVA 2NVXB 1IXRA 3JSVA 1FCLA 5FKAC 2H5XA 3Q69A 2I1KA 1WXQA 2MX2A 3SVMA 4FJYA 4BY7B 4DV1L 1K8GA 2F52A 1GB4A 2YTVA 2Z6KC 1HNXQ 4B3TQ 4M8MA 4W9JA 1FXAA 3ND9A 4A75A 4AP4C 2KENA 5EBDA 1WFQA 3RLOA 1XPRA 3H7PB 2IO1B 1Q90A 1V1OA 3M4QA 4U68A 4GXBA 2K28A 4EZJA 5JOBA 4XYOA 1RFKA 3QWNA 3BVMA 1EF1A 3AEEB 1A63A 2WQYB 1IW7D 2MFIA 4HR7B 1WR1A 2E8GA 4DR4L 1VQIA 4GKJQ 1E8ZA 4A3GH 4L2YA 3DM1A 2L55A 3PHXB 3FEWX 2K04A 1TQOA 3HFZB 1FEHA 4CBVA 1N33Q 4GDLB 4NXML 4HCPB 1R4QB 5M3MH 3KOJA 3H0GH 3H94A 4CKBA 3J7YW 4KHVA 2O2VA 1CZWA 4PS7A 1IBXB 2JYEA 1Z5SB 1V80A 2KBNA 2BTEA 1B8AA 2FCQA 2ZEQA 5IP7G 2HQLA 3QJYA 1Q46A 5JEAG 1NYRA 4NJ7A 1PH2A 4ARCA 4XYCA 3GE3C 2C5CA 4Y7NB 1MI0A 4HSPA 1KAAA 3RNGC 1NMFA 2M4NA 2NVQH 4J6IA 5LMNQ 1YNND 2KFKB 2MLBA 1EY9A 2KCMA 4L5QA 3W1SA 2WXLA 2PLPA 2K6AA 2K0PA 4HMIA 4PMCA 2K5NA 5IP7H 4DR6L 5JEAH 3I4MB 2L00B 3PT2B 2EYFA 1SF0A 3I4OA 2KQ7A 4OL7A 1C9OA 3ER0A 2AWNA 4PMWA 4OGQC 5J39A 4LF9Q 3GTQH 1ESFA 1Q1EA 4R8NA 2F3IA 3KVFB 3MHSD 3NRZA 3OLMD 3Q8EA 4WJPA 1I94Q 3DBLB 5AEKB 1UGJA 1EY6A 2EYJA 4OVUA 4Z9CB 2PQEA 3NZUA 4HJGE 4LTUA 4URKA 4DR7Q 1ENAA 1UWXA 1EO6A 3Q2AC 1DCZA 3J80L 2K05A 3RLNA 3E9HA 2K01A 4YWKA 1D3ZA 1E1OA 5M5XH 2L11A 1TY0A 1YJJA 4P1BC 4A3KG 2B8FA 3ULLA 2JZPA 2LZ6A 1FJGQ 2N9EB 5E6PA 1TS2A 2KOXA 1PTOC 4DR2Q 4GMVA 5DLQE 3IAYA 1DOKA 3NZ3A 2ZXRA 4ZRPA 2YTXA 2NBFA 1U9RA 4X6AH 3U7DA 5EKIA 3CSTA 1LM8B 1SMYC 5IT9E 3VR8B 4M0WA 4V0BA 2F0EA 3IFTA 3EVQA 4YCWA 1B2TA 1MHXA 1E10A 5IKCM 1CK1A 3CC7A 1TR5A 4JG2A 3QJZA 2ASBA 2IGDA 5IYDG 3PO2B 3A5UA 2CR5A 3OJ3A 4RM9A 2GMIC 3AULA 1KHIA 1WJJA 2ICIA 4K7SA 1YIJA 1MG8A 2R7ZG 4DNIA 2KYWA 3PZ7A 1TT2A 1X54A 1YJNA 2LXCA 2N9PC 3AE7B 3L16A 5C23A 3ZO5B 1XPOA 4M8AA 3Q8BA 4KKTA 4LF4Q 1WX9A 3NVZA 2BPSA 4K3CA 3UGBB 1N60A 1JC7A 3GV6A 1YNXA 4PV1C 1AZPA 4HKZE 3RPFC 1CMXB 3TEZA 4JBWA 2MHJA 1VF5C 4A3BG 3J7AF 3H3VC 2JX5A 2RBMA 2AWTA 2R7ZH 4N58A 4KGRA 4B0EA 3CCRA 2UXDQ 4R3DA 1L7YA 1Q0WB 3SGIA 3N20C 1R9TH 2G4SA 2DX5B 4CGYB 1Z7TA 4E6IA 4A3OA 1UNSA 2KWUB 3RNFC 1UD7A 3B2FA 4JYAQ 1ILPA 1KL9A 1I4RA 1WJNA 3NUHB 5FK9C 1B50A 1GO3E 4ABNA 3HVDA 2QKIC 1KABA 3Q8FA 3CCMA 3S24A 1PTOB 3PGZA 2MQJA 1EWYC 2F0DA 1WTQA 1QVGA 4WJ4A 1QQRA 2JSVX 4B0MA 3ZJUA 3L10B 4KKIA 3SXHA 3C0RB 5CC4A 3AMUA 2PIAA 2RDBC 4IALA 3JC66 1N6ZA 3Q8CA 2H88B 4MDKE 2I0QA 1SSOA 3UINB 1BBWA 2RCNA 5JJLA 4C2MB 2JXTA 1O7ZA 1I4GA 1VQAA 2LY7A 2R3ZA 1HE8A 3IVFA 1LFDA 2CHXA 1DXMA 4A55A 2AKWB 3MFGA 1EIFA 4DUZL 3AU4A 5M5WH 1QKZA 4KMUC 2CH4W 2XIWA 5C0XG 3NS1A 4YSZB 3Q6BA 5IP4D 1E8YA 3W3AA 3AE8B 2PMZE 4DXFA 3GTPB 1K3RA 3SE0A 1ZEQX 3M63B 4FULA 3ZYYX 3HOZH 1TS3A 4DUYQ 2I5HA 1SE3A 3HK0A 4KI0A 5LL6X 3HOWG 1QZHA 2V3SA 3MXUA 4DV5Q 4ALPA 1UWMA 1G8ZD 1BBUA 1HUNA 3AE3B 3FILA 3ZGZA 1T3QA 4IWPA 1GM5A 4C3IH 2KJ6A 3MC9A 3V61A 2MP2A 3BINA 1BMLC 2CWAA 5L37A 2Q8TA 2E5LL 2JA8G 3QK0A 2TMPA 3D4RA 3GV3A 3S1QB 4C7YA 1PMRA 1Z9FA 2JJQA 4PG3A 1TYGB 5GROA 2NB0A 2VB2X 2V1YA 2V4IB 2Y3AA 1WD1A 4XE0A 2JXMB 1MG4A 1HNWL 4FF3A 2L12A 1FNUA 3I2ZA 4DF7A 5M5YH 2JVCA 2IL8A 3AEBB 3I4NG 3KUPA 1JWMD 2QW7A 3A1QA 1QILA 4XQQA 1RKNA 1WTRA 1FD7D 4L5SA 4BA2I 4QCLA 1EY7A 2N9LA 3RZFA 3DLLA 1HR0L 2DZMA 1B7YB 4B3ML 3RCZA 3TZUA 2YVCA 4RF1A 1C9FA 3PLUA 4PYUA 1GUNA 3L0WB 3VA5A 2WIIB 1WYDA 1F2YA 4V190 5DPRA 2NMQA 2RHQB 3ZNGC 1I5FA 3R93A 1WI5A 2WDTB 3ZRCA 3OWEB 5F2DA 1ZDVA 4K8IA 4IN3A 4WJWA 2LJIA 3LJ3A 3VTUA 4ZQ3A 2NBWB 1E2VA 1JRPA 3MZ5A 2R93B 1TZOA 3VHTC 3Q24A 3R2TA 4LF8L 5IWAL 3Q3JA 3W5VB 1P9DU 1XPUA 1YZ6A 3PPAA 1H4RA 2NVUI 3J80E 3HP3A 1AWDA 1JCKB 3RULA 4RFBA 5I9PA 3KUZA 4ZUJA 1YQBA 3QIJA 3L17A 1JB3A 1U4LA 3R3OA 2F0IA 5ELBA 1Y8RC 2KZRA 4YTNB 2LSSA 3A55A 2LMCB 1T0YA 3M7GA 3V2TA 3RFZB 3WCQA 2YV5A 3HM6X 1L1OC 2Y5PA 2WWZA 3KYCD 3PO3H 3L9AX 1Q1OA 1N34L 1U4MA 2EY6A 5EGTA 4BA1I 4CHTB 3S1NB 1VZ6A 1EZ8A 2A74C 3W1GA 4GIVA 1HZCA 2VQEL 4DV0L 1FFUA 3V6CB 3EIVA 1M1KC 1F52A 1MFWA 1E7ZA 4DR3Q 1JR0D 1VQHA 3VRAB 4OW0A 5EKKA 2MSED 3VUWA 1STEA 3OIPA 2NBVB 2O5JC 3KWVA 4J15A 4QF4A 3T1YL 1YNJC 4RNAA 1N32L 2RSUA 3FRPB 3N30A 4A3PA 1YN5A 2EYMA 2Y0SG 4JE3B 4KX6B 2IHEA 4C3JB 3AE2B 4IWQA 2FCMA 1TZ1A 3ML8A 3GOEA 2BE5C 2Q2HA 2MCNB 4B6WA 3PCOB 4YSXB 1SRUA 4BFRA 4QQBX 4JI7L 4LAAA 3AE1B 3ZNID 4YCVA 1XTDA 2F0WA 5C5MA 1X56A 3GTLB 3IRBA 4DV6Q 1XMQQ 1SNPA 1JORA 1P7EA 2KX0A 2FIFA 3HKZG 2NVYH 2D3CA 1VMCA 2EIFA 4JI5Q 2BBCA 3MHZA 1TWHB 2Z6BA 2WV6D 3AYHB 3IKJA 1GUSA 2B2UA 3CQZH 1OGWA 2XK5B 2PMVA 3AXCA 2WXRA 1R4NB 2L1AA 1A2UA 2D3BA 1D5XC 3PZ8A 2HUGA 1I50B 3SK6A 4GDKB 4KDLB 1D4BA 2KX3A 3SK8A 4A3CH 4DHJD 1EQRA 4JK1C 4HIOA 2UU7A 3P4SB 1KC8C 1XLNA 3ZDMC 3V6EB 4OELB 4GNXB 3KF8B 1Q8IA 2GVBA 3VDZA 3V96A 4ICVA 1BQQT 3GO5A 4A20A 4DAYA 3I4LA 2A19A 4L5RC 2KNBA 2RSOA 3N3KB 4K5XA 4ZCKA 2IDYA 1K9MC 4BVUC 2C7HA 1YN3A 3A54A 1A5RA 3BIID 4A3IB 4EE2A 1PRTD 1SIFA 1E0ZA 1GHJA 4JX1C 1LT3D 3AEAB 4FHJA 3IHPC 3ZDTA 1K8OA 5BMGA 2CHBD 2IY1B 4LF7Q 2JPHA 2N3SA 4GN5A 1R4PB 2PO4A 1CHPD 2HD5B 3L4PA 3P42A 1TKWB 3M4YA 4RHRA 4DR5Q 1HA5A 1LT4D 1QNKA 3AB9A 1GPXA 1HZ9A 4BKTA 5GMVA 2DZJA 1NSNS 1JWBD 2E2DC 2OWOA 2EKIA 1NVID 1PVOA 1WOCA 3SR1A 3W1BA 1NMGA 2WKDA 1GNUA 1T9HA 2B2TA 1ML0D 1YD8U 2RGFA 5H92C 3ZLZA 3SHQA 4II3B 1BO0A 3H7PA 2CFMA 3OMGA 5HURA 3V3XA 1SXTA 1Y8NB 3VUYA 1KFYB 1A70A 1TGZB 2BB5A 2EJGC 1SR3A 4DV3Q 3NSWA 4OEMB 1K83B 5IGEA 3DPDA 4K6DA 1K8RB 4ANVA 5IOCA 1D2BA 4P75A 4G3XB 4M01A 4ZRKA 3TS0A 1ENFA 1EYDA 1Q3LA 2VRRB 4GDLA 4H44C 1EF5A 3RNCC 3PIPA 4IUVA 3PQIA 4APVA 4I7ZC 2L52A 1MD2D 3K5LA 1T5XD 3KJPA 2R92G 1KLUD 3WOFA 3S1MH 2K22A 1L0XB 1IYUA 4M0WB 2QC8A 1EQQA 2JZZA 1GUOA 4C3HG 3OJ4B 4BBNF 3TP8A 5DNFA 2DNEA 1HZ6A 4ARIA 4QL5A 1F0ZA 1SB3C 1WTHA 1YOVB 2K8BA 5C4XB 2LEKA 4IFDI 2UXCL 1RJTA 1Q10A 2M00A 1KJTA 1CQFA 2MO1A 4LFBL 4JI1Q 2IPKD 1MJCA 4DU9A 2KFKA 1E24A 5ELDA 4UY8C 5G5GA 1UE5A 4X64Q 2VB3X 1U0LA 3B2GA 4FLHA 1WTOA 1I4PA 4XDCA 2KWDA 4OONA 1J7BA 4FXDA 2K1FA 2VUMB 1MJEA 5FLXc 3C1FA 3DWAA 1AYFA 4EX5A 3L54A 2F4IA 4GGQA 4CKCA 1LTGD 3QQ8B 5J2RA 2SEBD 3CW2C 1WXSA 1NNXA 2BA0A 3F2BA 2BWFA 4C00A 3O13A 5FO9B 3ULPA 1WTVA 2LHEA 1PDXA 3IFWB 3VVWB 1BCPF 5IODA 3RN5A 3KYDD 1CM9A 1TJEA 3DOWA 1WTXA 2YLMA 2LVPA 2BKRB 2F0OA 3RZDB 1C7YA 5GXGB 3K5NA 3HOXB 3S2HH 5EKLA 3TEHB 2IY5B 3NK9A 2KMCA 1XNRL 4NPSA 5C2TB 2AQ1B 1IL2A 2C7MB 1PFBA 1FIQA 3L08A 1IUEA 3PIP3 3APDA 1WY8A 4IJLA 1GAQB 2KO3A 2B63B 1NI3A 2R61A 5LMUQ 4IQZA 2B2WC 2YU9H 1BKBA 4YHHL 4MJSB 1WIAA 2E75C 3VDYA 3M85A 1R4MB 2ZVOA 3TP7A 3LGJA 2J0KA 2LGDA 2NBUA 1A6XA 4CQNA 1L0YB 2MNAA 2E2IH 3RMKC 4JV5L 3CRLC 2WX0A 1I42A 4LFAQ 1EYCA 1PYWD 4A3MH 4IW0A 2ALYB 1CUKA 2L1BA 4D2KA 3H8HA 2DGYA 2B39A 4JBMA 1M90C 3Q3NC 3FAHA 2UUBQ 1SYDA 2J7QB 1QOGA 1AE2A 1SNMA 2KVMA 2JA5B 2W82A 2Z8LA 3HOUG 3KLSA 3S1RB 3ZKJC 2DLBA 3AECB 5AUKA 1RRBA 1V8QA 1GC7A 2BS3B 4DWFA 1XNQQ 2UUAL 1T6BX 5LNK1 1LTSD 2IHFA 3DWQA 3NELA 2D5GA 3R66C 1XLPA 2F0TA 5DPWA 1BF4A 4MACA 1H8CA 2WKCA 2DY8A 2F0KA 3EFCA 5LXHA 3PS6A 2KDFB 3KUCB 1S5ED 4R8IA 2ES2A 3HOUH 2H4OA 4X65L 1YJIA 2K8HA 2KACA 5E4WC 2MW5A 4FF1A 5K36G 4MT5A 3SDLC 4ITKA 1FGBD 2D62A 3QIAA 2FXQA 1L0WA 1K73C 1WM3A 2HJ8A 3A1QB 3AEFB 2AUKA 4A6QA 4BOSC 2QMTA 3VAWA 2DYOA 5BR8L 1V5TA 4JL9A 3VH3B 1JJ2A 4TV3A 4X66L 2WS3B 3ABVB 1E0BA 4YTMB 3M3YB 5BN5A 4IKGA 3UQAA 5K36H 1IBML 2IX1A 4OO1I 1HQRD 2DN8A 1VQ7A 4A3DB 2N88A 1O7YA 4JI2L 1HFNA 2F4VL 5FLXL 5BO4B 1PYBA 1S1QB 1EQTA 3SFDB 4I65A 4MELA 2V9HA 1F9PA 4BBNC 1RL2A 1FMAD 2ZT9C 4A3EB 4JWUC 4PT5A 2ZJQA 3C19A 2MUYA 5E4XA 2INCC 3R7RA 3WANA 3L0OA 2D2QA 1G6ZA 1XXGA 1EY4A 1YQ4B 2L9HA 1W3SA 4LF6L 2XN9C 1KRSA 4RGTA 4RGOS 4HJ8A 1EY5A 2ATWA 4LNKA 1YQ3B 1Q82C 2AHOB 1TWGH 1VQEA 1IL8A 4L5TA 1Y69U 3NE5B 1Z47A 2MBOA 2FBWB 5ELEA 5J22A 3AEDB 1WJ4A 5M3FB 4N9PA 2PMZB 3HOYB 2BYFA 4MN3A 2DBYA 4WWMA 1HR0W 4KHPQ 5JVH3 3OTOL 3AI5A 1VQGA 2DJFC 4FP5D 3S14B 2PVGC 4A76A 1F2MA 1G291 2D0OA 5EPKA 3NVVA 3RZWC 3JAME 3DBRB 3ZXRA 2VY3A 1J7AA 3CCQA 1A3VA 2NPTB 2JYTA 3CC2A 2YEPF 1QOBA 3A7AB 3C1EA 3TBLD 4IC7B 4DV7Q 4ZRQA 3WIMA 3OIQA 1WE6A 4KY5A 1DOYA 1GUTA 2FMCA 1BCPC 5C44B 1WWTA 3E5SA 5DPTA 4JVZA 5HKHA 2IX0A 4X62Q 4DR1Q 5GAEC 1U5KA 1Y14B 5C44G 1J5EL 3DUZA 2ZPYA 1F2RI 4P71A 3MJ5A 1JWSD 1O80A 1PZJD 2WB1G 3I73A 1IKMA 1F2RC 4REZA 1STHA 2ZZPB 3J9CA 1D1KA 3MP9A 2RHSB 4B3RQ 4JI8Q 3Q6SA 4YY3L 1I6HH 2M0XA 4C4VB 3NWSA 1GOZA 2RDFA 3CMAA 3S15H 1GUGA 1TY2A 4C1NI 3GZNB 4O0AA 4GKKQ 4JI6L 3DHQA 2OT2A 4FO2A 1C4AA 2M2LA 3IL8A 5JZEB 5J1ZA 1OEYJ 3KW5B 1TS4A 3RNAC 2F3WA 3DDCB 2D10A 2L32A 1TIFA 4JOIA 4BBRH 2A68D 1K50A 1LGRA 2M17A 1E90A 2NVTH 2UXBL 2LMCA 2NN6G 4RCOA 4TUUA 2ZW0A 3GTGB 4HJKA 2PNRC 3U8ZA 2LHDA 2BQQA 3IAM1 1XCTL 3E9IA 2WXIA 2F0LA 3MXNB 5JAVA 2LVOA 1QB5D 3QG1A 3QA8A 5KIXA 1XMOQ 3H6MA 2ZVNA 4WJNA 3HKSA 3DWPA 4JQWC 3AE9B 2SNMA 2PE9A 3BU2A 2NN6H 3VTWA 3WAMA 2M19A 4WH4A 4DV4L 2RR9A 4W9FA 3TUOA 1PA6A 2RF4A 4KZCA 2OQ0A 2B2VA 4N8X1 1EOVA 5HHDG 1LTBD 4DV1Q 1PZKD 4A3JG 4OX9L 2GRIA 1C79A 4LK0M 2JA7B 1XLOA 2MP1A 3GD7A 3S16B 3T13A 1SE8A 4P2CB 3AU7A 1E2WA 4BY7G 2K33A 2HHHL 1UUPA 4I6LB 2ZCBA 1FXIA 3P1MA 4LNIA 1R7SA 2CS4A 3IFDA 4EQOA 3Q3MC 4A3JH 1W6KA 3D0FA 3EN2A 1N5WA 1X55A 2JQRB 1A62A 3OWFA 5BN3A 4XQNA 2NVXH 1ZYRC 2IZVB 5EQ0A 5JXVA 5AJ3Q 1A3TA 2X38A 3AFQA 3EC8A 4WAFA 4LFCL 2CJOA 2ACZB 3I56A 1ISNA 4BY7H 2XK5A 4N9F4 1Y1VB 4NXMQ 3J7AV 4A3GB 4A93B 1Z6HA 4PZ6A 4YXDB 3ALBA 2QCPX 1N63A 4GDKA 5ELFA 3W1YA 1GVPA 3K5MA 5JJIA 2GBMA 5CV7A 3H0GB 3VR5A 4GNXA 4K0KL 3KF8A 4P72A 4A3LG 4N8FA 3BK1A 3KQ4A 4XC2A 5I2YA 3EBEA 2QEJC 1CT1D 4MEMA 4ANWA 1IBLL 3E9SA 3KWLA 2RD0A 2JF5A 4IOIE 3G48A 1KF6B 2KMAA 2K52A 4TQ0A 4ZAIA 4XGAB 3CCSA 1I7HA 2NVQB 4O42A 1D5ZC 4A3LH 4E71A 1NAPA 1H9MA 4DR6Q 1UH6A 4ACFA 4YWGG 4RG1A 1QZGA 4KK7A 1N33L 3LB8C 1PFSA 3FVQA 3NUCA 1O78A 4ZYSA 3J81j 4II2B 5FLXE 4R4IA 3AEGB 2N1WA 1WI0A 3I4MG 1NBFC 4Y7NH 3QB3A 1FD6A 4LDTD 3CPWA 2CQAA 1TWFB 1GJXA 5C1ZA 3HGBA 2N9KA 3PUYA 5MPOA 2WXQA 5LMNL 4BWGB 4WWPA 5IE8A 3U7ZA 1FGUA 3I4MH 1ICFB 1KLGD 3NVYA 3K5OA 2MH7A 4GLAC 1PGAA 4USAA 4ID6A 2ZCCA 4LWCA 4B9KA 1A0IA 4HK2A 2WACA 1KQSA 3AM9A 3BYYB 2ZJRA 1WGDA 4EQNA 1PFDA 5E6OA 1DM0B 1NE3A 1OQQA 1FPYA 1RWSA 1U4RA 3QOLA 4JCVE 1X1MA 2F0MA 4A3KH 3DVNV 2I5MX 1CJEA 5KGUA 2JEBI 3I7FA 2KQ3A 2CH4A 5C4ZA 2WP9B 4K1RB 4IM3A 1ZXIA 4AJYB 2JWZA 2V4LA 2LKVA 5EE9A 1VMPA 1MIUA 4ZK9B 2LRUA 4YWMA 2M9VA 1B53A 1HH2P 5FJ8G 5GAHC 2B8GA 2BGFA 1P0RA 1J8IA 1MSHA 5T8IA 1OQRA 1V49A 3PO2G 4WWOA 3GTKH 4OVZA 2OF1A 4PMBA 4DR2L 1Y1WB 1STAA 4G0NB 5DM63 1PH5A 3ZNZB 1KOTA 1RM6C 2HCIA 3PSIA 4OIJA 3U30A 4ZHPA 1FNVA 1EFID 3T53B 5IYDH 4DXGA 4A3FB 3H3VI 3K59A 1RIPA 5FJ8H 1LLRD 1TIID 2J4XA 2KK8A 2KT7A 2PW9A 2JUOA 4ZRZA 2IW3A 1V5OA 4HCSA 4YL8A 3D4WA 5CBAE 4F87A 1I3QH 1WXVA 4NAWB 2ZM6L 3T9LA 2WXJA 4X57B 4PZ7A 2BCOA 4W9DA 5JHBA 1B1ZA 1LT6D 1UZXB 1R9TB 4JGHB 5DAUA 3VYSA 5A2QL 1L4DB 1E5WA 1VQ6A 4E74A 4ZLTF 4J3OD 2CU3A 5C4JH 4A3BH 2ZTCA 3CSFA 1PV4A 3PUVA 4OZCA 4R4QA 1YHAA 3KBGA 3PRPB 3ZIMA 1CQVA 4IUNA 3RN2A 5LXIB 4LW1A 2K75A 2PQAA 1J0GA 1BR9A 1V6EA 2Z4HA 1VZ7A 1BOSA 1Q7YC 3U9OA 4GN1A 1WZ3A 4IOAA 3B0AA 4DK1A 3TSSA 2XBBC 3J7ZC 4BY1B 1TS5A 3Q23A 1WE7A 1D7QA 3P1HA 1M94A 3IT6B 2WDVB 4K14A 1ZUD2 2KFJA 1VS0A 3ICEA 4I6PA 5LLIA 4L23A 5IO9A 1FNWA 1LYLA 1ET6A 4H0LC 1ACCA 4MJSA 4DV2L 1K0SA 4IUMB 1B70B 4ZRIA 3EGRA 3VFKA 2OEDA 3L3OC 4B95A 5M5WB 1QOFA 2Z9HA 1D1IA 2KMMA 4DA2A 4LUZA 4KSKC 3I57A 1ROEA 3NPPA 4GOCA 5JVG3 5FO7B 4HDQA 3H91A 4LUOA 2CKZB 3VUXA 5C3EB 5KNDA 3RNUA 3RZOB 1P8LA 4KY6A 3HOZB 1AH9A 2BW2A 1B9RA 4W9IA 3P20A 3V05A 4C2MH 2O5IC 2FAZA 1I4QA 5C0XH 3URYA 3N1YC 4AQ7A 3PUXA 3K57A 1JJGA 4A9AA 2HTME 4RKLA 3P4PB 2K6DB 1Q8KA 3STBC 2E5LQ 1XF5L 2AMCB 4KKSA 3UDFA 2DWQA 3NTIA 2SAKA 2Z1CA 3GTMH 1JE4A 4DHZB 2EKEC 1LO5D 4RMAA 1TVXA 1L2NA 5BMIA 2XWBB 3HOWH 3QC8B 2GA4B 4HXDA 3K8AA 4TMAB 3SR6A 1H9JA 2ZTDA 2VH1A 2LJ5A 4BKSD 1NR4A 1DGSA 5M5YB 2IO0B 2KD0A 5AZFA 3IAS1 1HR0Q 2QGQA 1WJUA 2CHWA 4B3MQ 4EOYA 2A69C 2JA8H 1IP9A 1P98A 1D8LA 1YJWA 2HT1A 1WSPA 3K7UC 3RYTA 2HJ1A 4RM8A 2L8JA 3S1QH 4FJVB 4BZAA 4G7OC 2NS5A 5CORA 2V0GA 3I4NH 3NOBA 1HZAA 1GD7A 2B2WA 1BUIC 1ZP0B 2N7EA 4DK5A 4XT3B 2HE7A 4HSVA 4IUQA 3ZXVA 4FN2A 1T0RC 2JP1A 4YCUA 4IFDJ 4H02A 2IX3A 4LF8Q 5IWAQ 1SFOB 1SIJA 2DAFA 4LJOB 4UPAA 1GHKA 3PUZA 3MTNB 3ULJA 4UDUC 3DCGA 4RF0A 2SOBA 1HNZL 2R93G 1E8XA 4F8CB 1DOIA 3N9YC 4LNFA 2HIVA 1N62A 1X65A 2UU9Q 4OWWB 1HZBA 1SE9A 1Z2MA 2CKHB 2LGXA 4H2AA 1XYIA 1AEXA 4DNTB 1RAXA 4WRDA 3DWMA 4KV2A 2KCNA 1H9SB 3Q14C 1IHZA 1NY4A 1EU4A 2GOWA 2KHWB 1SYGA 1QVFA 4WURA 4EZLA 5I2XA 2EYPA 2BDOA 1N34Q 1E9MA 2R93H 3UIPB 3NEMA 3DHHC 1LTID 3I55A 4LF5L 2ZW1A 4DV0Q 3IT4B 2F0NA 4A90A 1SJED 4UP7A 3R2IA 2ZTEA 3Q22A 3K7AB 2UYZB 4KLKA 2IWHA 3CMMB 2MWSB 4IM0A 1CKOA 2B29A 4IJHA 2KCCA 2M56B 2I07B 2NPTA 3T1YQ 2BB6A 1KNEA 3PV0A 3X23A 1MBYA 1OFFA 2G45B 4MM3B 2DJGC 1ET9A 1J9OA 2PZWA 1RCVD 3H09A 4B3SL 1NDDA 4J8QA 2UWQA 4NQLB 3TN2A 2KCTA 2L83A 1AFPA 4R1JA 3HIZA 2Z0SA 4JI7Q 1OQYA 1UBIA 2LVQA 4C3JG 2O6VB 4C56C 2F0QA 2KC1A 1QLBB 1VLBA 2Y5CA 2Q2UA 2DUDA 1V1PA 5HI1A 1QJOA 1PH7A 2VZKB 3BZCA 4C4VA 3DBSA 2M8SA 4F1SA 4NQKE 3APFA 2F03A 2IJ0A 1E7UA 4CYEA 3N32A 3TRZA 5EJWA 4C3JH 4X3TA 4NPNA 5BN4A 2AL6A 4OZBA 1PH1A 4MH8A 2A6ED 3CQZB 3MC0B 2JXXA 3C2PA 2WXKA 3AE6B 1SNQA 1HTPA 2EOTA 3PRMB 1CTMA 3TQYA 3BS1A 3KH0A 4K7UA 2I46A 4DQOC 1FL0A 1J8CA 2W3RA 3J81c 4PQXA 3IG3A 5JH5C 3P4RB 3A4RA 1FRRA 3TZDA 3GTLH 2WAQB 4IPGA 1EL0A 3KLWA 1L1OB 1TKYA 3BVZA 1Q12A 4TQ1A 3MXNA 1E7PB 2JA6B 5H8YE 1XMQL 1KDBA 3TIXA 1QOHA 3A74A 2Q2TA 2Z4IA 3T51B 4CKEA 4XDXA 2MJ3A 2N7JA 1T0SC 2LRWA 2LUMA 4A3IG 5BYRA 1VDZA 4BKSA 1G91A 2A68C 4J6HA 4KN4C 4S3SA 2JRHA 5E6JA 5D3DA 4XIGS 2HTHA 1YBYA 3X3MA 1XQQA 4KHZA 3ZJVA 3NBIA 3PHWB 3OAWA 2CW0D 4CJ0B 2PVOD 5G3LD 4F88A 3M4OH 1C1YB 3PREA 5J17A 4NJCA 2H89B 1HZ5A 2X8XX 3J81i 4A3IH 1EIGA 1WXAA 3ZJTA 3D6WA 2OJRA 3SU8X 3SEBA 1G6PA 3WWVA 1UAPA 4XYQA 5L95C 5IN7A 1X3FA 2LXKA 3A7LA 1E3PA 4W9HA 2ZNVC 4B08A 1CZGA 1W2BA 1YJ9A 4F7XA 1F9SA 4IUPA 1WX8A 1F2ZA 5BMHA 2K25A 3D31A 4EGVA 1K53A 4WWNA 1PTOD 1D5MC 4HIKA 3BDLA 4R4OA 1XJVA 3S2AA 4MGKE 4WIPA 2MBQA 5D14A 2J0JA 4DR5L 3BDOA 3DHIC 1XEEA 1VD2A 3ETRA 3ERQA 2D9UA 1SMYD 4W9KA 3NJTA 4BAXA 5FR6A 4GSWA 3ZTCA 3L7ZC 1PQSA 3HRZC 1PFNA 2MJ8A 3FKIB 4QUCA 3N6RA 1KH0A 2WP8J 1PXUA 1X3QA 2V4DA 2D3GA 2KJXA 2QILA 3B6YA 2KWCA 1K83H 2UXCQ 2E2HB 4HJ5A 3DMUA 3FC4A 3SD5A 2YTYA 1IW7C 5C3JB 2QJLA 4LFBQ 1KTKA 3RLFA 5EE0A 1VQLA 3KYHC 3AB5A 2OEOA 2R92H 4WQOB 1YEZA 4EQ5A 3TJPA 5C4XG 1PUTA 2FHTA 3D32A 4C3HH 4US9A 1P1AA 4TKNA 3PSEB 2AEHA 2NR2A 2V3NA 2WHIA 5E6NA 5EDSA 5L83A 4IOCA 1Q86C 3JVZX 4OZAA 3D3RA 4GU2A 1AZQA 1QVCA 3A9JB 2AQ3B 4ULLA 1SE2A 2KEDA 4KTAA 1WGKA 5C4XH 2VUMG 2D2CC 4NW2A 5I4DA 2O4XA 2Q8RE 2Z6KA 2JK8A 4HEDA 4DK3C 3CCUA 1C0AA 2N1VA 1JROA 3QOJA 2KN4A 2LFIA 1STBA 3MXGA 1S5DD 2F0VA 2QSDA 1ZOYB 4G7HC 1YNNC 1G51A 3V60A 1ENCA 1VJKA 2RQXA 4HMJA 3MA2B 4NMZA 2ZJPA 4C1NK 2KQ4X 5AZGA 5G2NA 1H9KA 3J81L 1SNDA 4RKBA 1TXYA 3KBXA 1SEBD 4N6EB 1QE6A 1UBQA 3HVZA 1X3GA 2PQAB 1HTOA 1VQBA 4K3BA 1N36L 1UE1A 3ZQ4A 3CKIB 4H13C 3E0JA 4JLCA 2KQSA 2VL6A 4OWXB 2AL3A 2W9NA 3HOXG 3WAOA 3U52E 4A8XC 4ZKBB 3A8KE 5CYUA 1SYEA 2WXFA 4QB4A 3AV8A 4J1MA 2K14A 3UIOB 3F2DA 2K8CA 4OWTB 2GBJA 4FF2A 1VQ8A 1GUAB 2LXAA 1T0QC 2F1MA 3K80C 3NVWA 1E8WA 4YSYB 3BYTB 4WJOA 5KYIA 2B63G 1RDPD 2N7DA 1AE3A 5CGKA 1NYQA 5CMDA 4JV5Q 2LD9A 3NZSA 2N8NA 5G55A 3GTOH 4CO7A 2K39A 4FDBA 4DHZE 1N5XA 3NY5A 2AQ2B 2KHJA 2KDEB 3FDTA 3K81C 5JEAJ 2K6QA 1C8CA 2E3TA 1AN8A 2R6GA 1YIWA 2PNHA 3VXWA 1JMCA 3AEVA 1JOKA 2B63H 1TTNA 4JW0A 2UUAQ 3F2CA 3DVNU 1H9RA 3I9V1 1PH6A 3C3LA 1YMHE 2N49A 3T56B 2JA5G 2WXPA 2GLSA 1ASYA 2K9XA 2WXNA 1EWHA 1ZE3D 5D2MB 2PPBC 1BUVT 4GLSC 2L0FA 3Q8DA 1CKNB 3NTKA 1V43A 4IPDA 4WAAA 4X65Q 2XRSD 1STNA 2E74C 4K2LA 3S2DB 1IYFA 3Q3OC 3PMFA 2J0TD 5CHWA 4ME3A 4KDIC 5K5PA 2BWES 4QAYA 3SDZA 1VQPA 4K5VA 2JA5H 2BH8A 5FO8B 3S1RH 1G2TA 4MSQB 4HPPA 1ZDXA 4M02A 1MKHA 1IBKL 5BR8Q 1VQCA 1JWUD 4QY7A 4TVAB 4AYBB 1KXLA 1WGYA 2JY6A 3PGEA 5CX3A 2F3VA 2CJNA 5E1FA 1XTCD 4MHEA 5HG2A 2B2YC 1KIXA 2WDRB 4B9XA 2F0FA 3I3CA 2MA9B 1IBMQ 3KFUA 1PYSB 1HUMA 4CDEC 2L3ZA 1M8AA 3MWYW 3WDNA 1E6EB 4JI2Q 4GOPC 2F4VQ 2C9OA 2KDBA 5CHVC 4XWTA 2KTFA 2MQHA 2NTTA 1VQFA 1PGBA 1UF0A 1WF9A 1II3A 3NP8A 4A3DG 4PS3A 3CAMA 2KJRA 1QF6A 1W6JA 4JI0L 1V1QA 4QIWE 1J7CA 2M1MA 3CU7A 3AQQA 4JI4L 1JQ4A 4RHSA 3F2UA 3OSOA 1EEFD 3U4ZA 2RSNA 1LQBA 3M3YH 4POFA 1SN8A 4LF6Q 5EE3A 3CPFA 2NZHA 1FM0D 3HHMA 1OXVA 3T8MA 4A3EG 3VYUA 2D11A 2UUCL 4R4TA 3CCEA 1YX5B 3NWTA 5ELOA 2KWVB 2DZIA 1I4HA 1OEYA 2F0UA 4HKQA 1CSPA 4ME5A 3MVVA 2VNUD 1OXTA 2ASQA 3OTOQ 3CF5A 2AX5A 3A4SC 2I5LX 2GBNA 2FUG1 2EXZA 2QDFA 4EKUA 4JC0A 5DCNA 4A3EH 1UWVA 5M3FG 2LGIA 4R4CA 3HOYG 4HIDA 4O2DA 3PRZA 2NN6I 1BVSA 4IURA 3ZRFA 2B2UC 3MEHA 2RCFA 4IZ8A 1UEAB 3UDXA 4FXGC 3GTJH 3NG0A 4C7ZA 2LFNA 4PNYA 1L0VB 4HCEA 1I4XA 4ILWA 3C46A 2BH2A 3A56A 3CXCA 2X6LA 1HPCA 1OO9B 1YNJD 2GB1A 1EOTA 2Y0SE 1PRTF 2R2QA 1WCMB 5M3FH 2QEXA 1YNTE 4BBSB 2BVCA 1RYJA 4RWSC 1SYBA 2IBIB 2BE5D 5D3IB 3VYRA 5KRUA 2BKFA 3PVLA 4HWIB 2KAJA 1TWCB 3N1XC 3I90A 4GOPB 2E2JB 2D0PA 4RA8A 4YY3Q 2A5UA 1S3SG 2D3AA 3QAQA 5J3BA 4M8NA 1V1PB 4IPHA 4RH6A 1FVIA 3M7NA 1RFAA 4TSSA 3BJUA 1JMLA 2GN5A 2WAQE 1YITA 2MRPA 4NDXA 3H15A 4JI6Q 1SLJA 1UELA 2EQSA 3A8JE 2QHOA 3HM3A 1GXDC 5C44H 4PYZA 2W54A 3L2PA 2C35B 1UE7A 2PW7A 2NCNA 2RPVA 3DBHI 3CC4A 3H1UA 2LASA 1WGRA 5C0XJ 2NTSA 3K0XA 1JJCB 1IGCA 1EZ6A 1WRDB 4DFAA 3KK7A 1YHBA 5NUCA 4ZOHC 4ANUA 2K03A 3R8BA 1MSGA 4X62L 1EYGA 4KGSA 4AUQC 1PTOF 4RGMA 4XT1B 3J81E 3S17H 2WDQB 1QCBD 4NXNL 3X3NA 1H9SA 4BBRB 1WGGA 4A4IA 3PTFC 1ZKOA 1L5PA 1WMHB 2E6XA 4FXKC 1FRDA 1V86A 1E1TA 4IWOA 2L76A 3E0EA 5EPLA 3PUWA 5ELCA 5C6AA 2KC2A 3IXSA 4JI8L 3EFUA 4QUFA 3W2DA 3HOVB 4PK1A 1V2YA 1B9MA 2VQFQ 4DV4Q 3NENA 1RTOA 4JI3L 3CWIA 1HEZE 1K8MA 1HCZA 3GE8C 3Q8AA 4HJ7A 2WXGA 4FNFA 1RLFA 4MM3A 3KLRA 4DPGA 5IGDA 4OX9Q 3GTGH 2RA4A 3JYUA 2R7FA 5D65A 1XO3A 1NTGA 3FKYA 1BCPB 3P4QB 3LWUA 4L8JA 1N8RC 4NY0A 2GVAA 4L1BA 2NZOA 1ESRA 2EPBA 3DVGY 2HHHQ 4S17A 3T1HL 1VQJA 2JRIB 2O6VA 3M3JA 1EIHA 2JA7G 2B3AA 3V62A 4AQYL 3VR2A 4JIOU 1TWAH 2YYZA 3NQTA 5LHY1 2KEEA 4ICUA 2IY0B 3PO0A 4CHKA 2KN5A 1U4PA 2EY1A 5HGTA 1PHJA 3EJIA 4DR4Q 5M9OA 4LFCQ 1PH3A 4GLVB 1F9JA 3DBLI 3VR4A 3J80i 4G11A 2A73B 2XTIA 1DOMA 2G5DA 2JA7H 1V81A 2L05A 4KJOA 3ONSA 3S16H 5BYQA 4F8MA 3RN9C 3DBHB 2QF7A 5EE1A 4WORA 1QOAA 3UF8A 3K0YA 1K3BC 1Y1VG 4BS9A 4A3GG 4K0KQ 4A93G 5M3MB 1EM7A 5KNCA 4FA6A 1F2LA 4B3TL 1HNXL 5CR3A 2PCFB 2BYVE 1O7IA 4KKJA 1HRJA 3NBHB 1L1OA 2RDGA 5M3MG 4RAUC 1IBLQ 2EY2A 1ZXTA 3H0GG 1QT9A 1C78A 2LI5A 2LGSA 3CF6E 3FPPA 2JZ3B 3H7SA 1B3QA 3G4SA 1JWAD 1PGXA 2ONQA 1Q81C 1LM0A 3PZDA 3ML9A 1WZ0A 3MXPA 3TEYA 4MGYE 1Y1VH 3O65B 4A93H 1V8CA 3NS8A 2A8VA 5AJ3L 4UP8A 3CCLA 4GKJL 3NTHA 2A6EC 2KLGA 2DYBA 5D6JB 2TSSA 3I8ZA 3I70A 4JBKA 2FCNA 3TBIB 3T16A 1Q1BA 1VQ4A 1FO4A 5JJKA 5E3FA 1QUQB 1NEKB 4N59A 2WINB 4N9TA 3GTQB 2PW5A 3I72A 3W9CB 3MEFA 4B9WA 4HRSA 3ERSX 3RUIB 3ZVVA 1WH3A 3DHGC 2RPQA 4AJWA 1EU3A 1STGA 1ICWA 2F0HA 1PRTC 2EY5A 4HVBA 3E3XA 3QO2A 3AE4B 1SYFA 3S9WA 1IYJB 5COYA 1VQNA 2DY7A 2K3UA 1DONA 1FCCC 5M5XB 3OPOA 2INDC 1NUCA 2MEKA 3P63A 4ANXA 1QNUA 1CHQD 1XLQA 1OTRB 4Q0FA 2EXDA 3PF4A 1CA5A 1N9WA 2CW0C 2X6GA 5CTRC 2VS1A 4OXPA 4LF9L 4XTCS 4IG7B 2JU6X 3L13A 3RD2A 1SE4A 1FR3A 1HTQA 1I94L 1TWFH 2IGHA 3EQLC 1WRIA 1CA6A 2MGSA 4A3KB 1VCIA 4IDIA 1ILQA 4DR7L 2LS01 1FFVA 2PEAA 3AN1A 4NAMA 2XRQD 4MGZE 1B3AA 3B1LX 1OXXK 3KLSX 3UDGA 3EHVA 1FYCA 2DENB 4MSMB 2JA9A 4CJ1B 3N52A 1FJGL 3GB1A 2XSCA 3CP0A 5AUIA 5I6YA 2WXHA 3ZJYC 1EY0A 2ON8A 3GTKB 3FMCA 2G4DB 2BT6A 2N9XA 2KKCA 2XWJB 2QA4A 3CD6A 2I1JA 3VH4B 1Y1WG 1PH4A 4FADA 4DDID 5C0XI 3DXJC 4LNOA 1RF2D 4DHJB 1LACA 5I6WA 2L0CA 2K5HA 4POGA 3HZXA 3VR3A 2ZM6Q 4A3FG 3PO2H 3WOEA 3A9JA 3VRBB 2F0SA 2PI2E 2QIEB 4AYBE 2R7ZB 1TKEA 2FNJB 2KJHB 1JOOA 1I3QB 1VQOA 2YEPB 2W55A 2BYTA 4CJ2C 2LWPA 2CCZA 1Y1WH 1YN4A 1P16A 3NHEB 2JWUA 2PZTA 1PRTB 3NHHA 5FLMG 1L6UA 3C8YA 4BXXG 1PDQA 3K9OB 2SDFA 1EUJA 4X3UA 2INNE 5C4JB 4A3FH 4A3BB 1F9RA 3AU5A 3RNBC 4XXEA 4LF4L 1D6EC 3BVGA 3MJWA 2A6HD 2KHIA 3F8TA 4ZKCB 1EIYB 1WD0A 4AS1A 5IAAC 1XD3B 3WA0A 5FLMH 5JJZA 5IYCG 4BXXH 1L6VA 4KIKA 2UXDL 4HPLB 4UP9A 1LV9A 4WQMA 3BZDB 5H1SE 1JALA 1K52A 4HJ9A 4DV2Q 4BY1G 3LNNA 5CV4A 2Q2IA 4DUZQ 2EDGA 4JYAL 3FHWA 4DKAC 1PTOH 3NXWA 2J53A 2N78A 3A0JA 4JBJA 5IYCH 4EEWA 1ZPSA 1XWEA 5DM73 1XT9B 3Q3FA 3ZW3A 5EPJA 3MC8A 2WXOA 2EJFC 1K51A 3OYYA 2EVBA 3TS2A 3UQBA 4NJ6A 4BY1H 3ONAB 2MO0A 3D4DA 3BDCA 3M4PA 2OJWA 3I91A 2XGTA 5C3EG 2HDMA 1X9NA 3TL5A 2N55A 3HOZG 4MTNA 1C4QA 1SAPA 3EECA 1GB1A 2C60A 3KDFB 2EE1A 1HQMC 1LTLA 4FXCA 1ZXHA 2FFKB 1X6OA 1CKNA 4FVMA 4C3IB 4FF4A 3GTPH 3A33B 3PLVA 1KDCA 2KA7A 3GTMB 2G9DA 1HNWQ 2BS4B 5C3EH 4C3IG 1HXYD 3RZOH 3HOWB 1WTPA 2JT4B 3WAPA 3B08A 4P6VF 1MPEA 4QGUA 4RCNA 4DUYL 1MHHE 3GP7A 2PI2A 4JOIC 3H3VH 3MAQA 4W9GA 2SNSA 3ND8A 2K7VA 4DV5L 2EYOA 3P7JA 4BKGA 1BCPD 2JA8B 1YHQA 2WFWA 3QCAA 4GZYC 3PIOA 2QCZA 4NNJB 3VQIA 4I7AA 1S72A 3IBEA 5IGFA 1ZGUB 5I9OA 3A9KB 1SDFA 4HPMB 2WB1E 2ZXPA 5CV6A 1LTTD 4IUUA 3I4NB 3P2BA 3H6NA 5C3XA 1NJIC 3OOCA 4X3KA 4CDDC 2DAJA 4GN4B 1IGDA 2KDIA 2MPMA 4KKUA 5CHFA 2ZJDA 1XCQL 3SHLA 2B2VC 1HNZQ 4K5WA 1Y8PB 2IYDB 4ZYNA 1RHPA 1NENB 4HAEA 2C9WB 1KRHA 3QARA 5IA7A 1DD2A 1MVKA 1SNOA 3UE0A 4WJQA 1SJHD 1JT8A 5E7NA 3SK5A 1H95A 5DPSA 4EFOA 4KV6A 5JPNC 1UGMA 2GBKA 1RD9D 4LJZC 5IIFA 1S40A 1K8AC 4P1CC 3TEWA 4LF5Q 2KVRA 1GKHA 1G2SA 1KAWA 2XNAC 1SFOH 1NI2A 4QIWB 3ENEA 2VXWA 3PO3B 4F7ZA 4DAPA 5J18A 1OXUA 3KF6B 2WGSA 2VQEQ 4JPSA 1N61A 4K81A 2OTLA 1R4NI 2J7ZA 2OXPA 2FJ2A 3PO3G 2W3SA 4DDGD 3PF5A 1C4CA 3GQBA 2Z59B 3APCA 3CCJA 2CU1A 4EZKA 4C80A 2J52A 4KD3A 4XWWA 1N32Q 1EEID 1LABA 2UU9L 3LXFA 4MGIE 1WYGA 1E2ZA 4B3SQ 1MI2A 4GNXC 1IYVA 1JE5A 2N0SB 4NZLB 4DBGA 2AWOA 1LTAD 2B2YA 4L63B 2GI9A 2DYMA 3QR8A 4X3SA 1KNAA 3S1NH 4WJ3M 5TSSA 3PIO3 1LXDA 1O7LA 2R7DA 3DVGX 3K7AH 4DK6C 3N1ZC 4GOPA 1YX6B 3T3OA 3JAMc 2A5HA 1PH9A 4LNQA 1HHVA 2XEWA 1QG7A 3W1SC 3ZTDA 4DR3L 3U9SA 4Y52H 1GUWA 2KTRB 5C4HA 4GN3B 2Y0SB 2AUJD 3W5OA 1GJZA 3M62B 1ZYRD 2NVYB 5GQOA 3LDZE 2I2YA 1KLVA 5IYBG 1YI2A 4LMQD 1WX7A 1C48A 3JSVB 1S5CD 1TT5B 3TP5A 5A2QE 5CV5A 3QWZB 1TKGA 2CHZA 4HIMA 1F1HA 1C4PA 2FIDA 2C5LC 4W9EA 3I5JC 2JN4A 3UI2A 1WMHA 3HKZB 5IYBH 4L6TB 3B9JA 3OG5A 4AIMA 4DK0A 4H7BA 4A3CG 5IOIA 4OHJA 2G3QB 2MBHA 1TWHH 2WAQG 3JAMi 2VW9A 4DV6L 1EY8A 2ENBA 2ID0A 4JI5L 2JA6G 4HLEA 5HGQA 3U4VA 1I50H 1PZID 1DGJA 3R3MA 2K32A 2IO2B 1S3OA 4O1NA 4IM2A 3ZNHB 2O2VB 2NZ1D 2P5ZX 2K50A 2WX1A 1VQ5A 4P7IA 1HJPA 2WXMA 5C5LA 4OVVA 5EAYA 3FP9A 2V1CC 2JA6H 4P74A 1DOLA 2RMMA 3M4OB 2OQKA
chains in the Genus database with same CATH topology
1EWCA 4K6LA 3EROA 1L4ZB 5AFWA 2E76C 5D7GA 3NQIA 3T4AC 4MIUA 2IGGA 1WTWA 2EZVA 5KYLA 2HDLA 1HTLD 2L4NA 2F0PA 3G6JB 3G7LA 1B4OA 3ITPA 5CBEE 3E56A 3S1MB 3AMZA 3NBHA 2WNMA 2FMMA 5KEEA 1F77A 3LWEA 5IGCA 2BDNA 3HS0C 4DAVA 3CHBD 1VF7A 3AH7A 2NWGA 4UAIA 4LLGM 2R92B 1MGSA 5A35A 3JAML 3TEXA 4C3HB 2J42A 3EUB2 1S5BD 2PYKA 2JYOA 3OW7A 3RMHA 1IBXA 2HQEA 2ZXOA 4K8JA 2HCCA 1LT5D 1T5EA 2KOLA 2INPE 1BBXC 4EVOA 1XX8A 4KGTA 3A8IE 5CV9A 1BNZA 4HROA 4US8A 2WLBA 1JQYD 1CFMA 1VDVA 1X32A 3S2HB 4EQPA 1DYQA 4HN7A 2BOSA 3DEOA 3K6OA 2F0JA 1VR9A 3MFYA 1HA6A 1IKLA 3EA6A 2YU9B 1DOXA 4XQJA 1VRAB 1A3UA 3HRDD 2EYLA 3T3NA 2EELA 3TDQA 3BG3A 3GTOB 3BWUD 5C3WA 2E2IB 4A3MB 2FE8A 3MHBA 4G4KA 3U2SC 2H1EA 4IFDG 4TRDA 3GS2A 5EBCA 1C77A 1STYA 4U673 2KHSA 2RVLA 1M4VA 2NYZD 4IFDH 1SYCA 4HEA1 2G9HD 2KUMA 2K5DA 4LK1C 3HOUB 3D6CA 5T1IA 1EQVA 2QDBA 2D5DA 2O2LD 5LL6S 3VA7A 5HFYA 2RDHA 1CI3M 2CVRA 3TMEA 2A69D 2JEAI 1S5FD 2RKSA 4NKLA 1DZ1A 1X3PA 3FILB 2K5QA 5FR3A 1Y56A 4YIJA 1RTNA 1Y8OB 2HDEA 4DNRB 4JWSC 1SNCA 4Q2JA 1AP0A 4R9WA 5IGBA 1LTRD 3Q0AA 2VZKD 4A55A 2BS2B 5CV8A 2A6HC 4Q5VA 2XVSA 2WU5B 4RGNA 1PLFA 4KJNA 3W5UB 3U4EG 3LYYA 4TKOB 4ZUIA 3VR6A 1A15A 1B44D 2IT1A 4KN7C 4OIKA 1CZPA 3E6ZX 1ONLA 1TWGB 1OXSC 3LX0A 4HTHA 3HEJA 4DN4M 5IGGA 2JSOA 1QWYA 2EYHA 2G1EA 1PFMA 2K1BA 2F0GA 5DEHA 3FPUB 5ISRA 4ZHOA 3MTSA 1JW9D 1SBBB 5JPMC 3GTJB 3K58A 4KY7A 5FOBB 1WVLA 2PZUA 4ODGA 3UI3A 2X69A 1I6VC 3D8GA 3SK4A 2PTLA 2L5TA 3AE5B 1P7FA 3RD4A 1AW7A 1BXTA 1HFGA 3VR9B 2ICEC 2MHVA 5IT9L 3VYTA 2PKOA 3CRKC 4QMGA 1VZ8A 4G7ZC 2B76B 2WU2B 5G3LF 5KNBA 1NR2A 4YTPB 2KDMA 1I6HB 1F9QA 1SSNA 3EFXD 4K2KA 4OO1G 3BK2A 2Q5WD 3S15B 2OHFA 3DWGC 2WB1B 2KECA 3OMCA 1JICA 2B2TC 3P75A 2MJDA 3S17B 4OO1H 2NVTB 1JOQA 2I38A 3PZ8A 1S4ZA 1EYAA 2BA1A 1BDOA 4KD4A 4M1UB 4IUTA 2MJEA 1RODA 3TP6A 4WFN3 3SFEB 3OHXC 4FYDA 4DGZA 3HUIA 2EJMA 3RUZA 4YT0B 4P16A 1DJRD 2V3PA 1A2TA 4NP5A 2FINB 1B9NA 2M0AA 5T1GA 2Q8IB 2DNCA 1NCVA 2K5WA 2NUCA 3HG9A 4XDDA 3CIRB 1KDAA 1V97A 2JE6I 5G5HA 3DEPA 1TWAB 4G57A 1TU2B 4A3JB 2K5PA 5BYSA 1C76A 4TQUS 2NVXB 1FCLA 5FKAC 3Q69A 1WXQA 3SVMA 4BY7B 1GB4A 1FXAA 3ND9A 5EBDA 1Q90A 1V1OA 4U68A 2K28A 5JOBA 4XYOA 1RFKA 3QWNA 3BVMA 3AEEB 2WQYB 1IW7D 4HR7B 4L2YA 3DM1A 2L55A 3FEWX 2K04A 1TQOA 1FEHA 4CBVA 4GDLB 1R4QB 3H94A 4CKBA 3J7YW 4KHVA 1CZWA 1IBXB 2JYEA 2BTEA 5JEAG 3QJYA 1NYRA 4ARCA 2C5CA 4Y7NB 1MI0A 4HSPA 1KAAA 1YNND 1EY9A 3W1SA 2WXLA 2PLPA 2K6AA 2K0PA 4HMIA 4PMCA 5JEAH 3I4MB 2EYFA 1SF0A 4OL7A 2AWNA 4PMWA 4OGQC 5J39A 1ESFA 1Q1EA 4R8NA 3NRZA 3Q8EA 1UGJA 1EY6A 2EYJA 4Z9CB 2PQEA 4HJGE 4LTUA 1ENAA 1UWXA 1DCZA 3J80L 2K05A 2K01A 2L11A 1TY0A 1YJJA 2B8FA 2JZPA 1TS2A 1PTOC 3IAYA 1DOKA 3NZ3A 2ZXRA 4ZRPA 2NBFA 1U9RA 5EKIA 1SMYC 5IT9E 3VR8B 4M0WA 4V0BA 2F0EA 3IFTA 3EVQA 1B2TA 1MHXA 1E10A 1CK1A 1TR5A 2IGDA 3PO2B 2ICIA 3PZ7A 1TT2A 3AE7B 4M8AA 3Q8BA 4KKTA 3NVZA 1N60A 1JC7A 3GV6A 4PV1C 1AZPA 4HKZE 3RPFC 3TEZA 4JBWA 1VF5C 3J7AF 3H3VC 2JX5A 2RBMA 4B0EA 4N58A 4KGRA 4R3DA 4CGYB 1Z7TA 4E6IA 1UNSA 3B2FA 1ILPA 1I4RA 3NUHB 5FK9C 1B50A 4ABNA 3HVDA 2QKIC 1KABA 3Q8FA 1PTOB 1EWYC 2F0DA 1WTQA 1QQRA 2JSVX 4B0MA 3ZJUA 4KKIA 3SXHA 5CC4A 3AMUA 2PIAA 4IALA 3Q8CA 2H88B 1SSOA 4C2MB 2JXTA 1O7ZA 1I4GA 2LY7A 2R3ZA 1DXMA 3MFGA 3NS1A 1QKZA 4KMUC 2XIWA 5C0XG 4YSZB 3W3AA 3AE8B 3GTPB 4DXFA 3SE0A 1ZEQX 3ZYYX 1TS3A 1SE3A 4KI0A 5LL6X 3MXUA 1UWMA 1G8ZD 1HUNA 3AE3B 3FILA 3ZGZA 1T3QA 1BMLC 2Q8TA 2TMPA 3D4RA 3GV3A 3S1QB 4C7YA 1PMRA 2V4IB 2Y3AA 1TYGB 2NB0A 2VB2X 4XE0A 1WD1A 2JXMB 4FF3A 2L12A 1FNUA 4DF7A 2IL8A 3AEBB 3KUPA 1JWMD 1QILA 4XQQA 1RKNA 1WTRA 1FD7D 4QCLA 4BA2I 2N9LA 1EY7A 3TZUA 4RF1A 1C9FA 1GUNA 3VA5A 2WIIB 1F2YA 4V190 2NMQA 3R93A 3OWEB 5F2DA 1ZDVA 4K8IA 4IN3A 4WJWA 2LJIA 4ZQ3A 1E2VA 1JRPA 3MZ5A 2R93B 1TZOA 3Q24A 3R2TA 3W5VB 3J80E 3HP3A 1AWDA 1JCKB 4RFBA 5I9PA 4ZUJA 1JB3A 1U4LA 3R3OA 2F0IA 5ELBA 4YTNB 3A55A 2LMCB 3M7GA 3V2TA 3RFZB 3WCQA 2Y5PA 3L9AX 1U4MA 2EY6A 5EGTA 4BA1I 4CHTB 3S1NB 1VZ6A 1EZ8A 2A74C 1FFUA 1JR0D 3VRAB 4OW0A 5EKKA 1STEA 3OIPA 3KWVA 2O5JC 4QF4A 1YNJC 4RNAA 3FRPB 1YN5A 2EYMA 4JE3B 4KX6B 3AE2B 4C3JB 2BE5C 4YSXB 4LAAA 3AE1B 2F0WA 5C5MA 3GTLB 1JORA 1SNPA 1P7EA 1VMCA 2BBCA 3MHZA 1TWHB 2WV6D 3IKJA 1GUSA 2B2UA 2PMVA 2WXRA 2L1AA 1A2UA 1D5XC 2HUGA 1I50B 3SK6A 4GDKB 1D4BA 3SK8A 4JK1C 3P4SB 1XLNA 1Q8IA 3V96A 1BQQT 3GO5A 4DAYA 3I4LA 2RSOA 4K5XA 2IDYA 1YN3A 3A54A 3BIID 4A3IB 4EE2A 1PRTD 1E0ZA 1GHJA 4JX1C 1LT3D 3AEAB 1K8OA 5BMGA 2CHBD 1R4PB 2PO4A 1CHPD 3L4PA 3P42A 1TKWB 3M4YA 4RHRA 1HA5A 1LT4D 1QNKA 3AB9A 1GPXA 1NSNS 1JWBD 2E2DC 2EKIA 1NVID 3SR1A 2WKDA 2B2TA 1ML0D 5H92C 1BO0A 3OMGA 5HURA 3V3XA 1SXTA 1Y8NB 1KFYB 1A70A 2BB5A 2EJGC 3NSWA 1K83B 5IGEA 4K6DA 5IOCA 1D2BA 1ENFA 1EYDA 1Q3LA 4H44C 4IUVA 4I7ZC 2L52A 1MD2D 3K5LA 1T5XD 1KLUD 3WOFA 2K22A 1L0XB 1IYUA 1GUOA 4C3HG 3TP8A 5DNFA 2DNEA 1HZ6A 4ARIA 1F0ZA 1SB3C 2LEKA 5C4XB 4IFDI 1Q10A 1RJTA 2M00A 1CQFA 2IPKD 4DU9A 5ELDA 5G5GA 2VB3X 3B2GA 1WTOA 1I4PA 4XDCA 2KWDA 1J7BA 4FXDA 2VUMB 3C1FA 3DWAA 1AYFA 2F4IA 4CKCA 1LTGD 2SEBD 2BA0A 3O13A 5FO9B 1WTVA 2LHEA 1PDXA 1BCPF 5IODA 1CM9A 1TJEA 1WTXA 2F0OA 3RZDB 5GXGB 3K5NA 3HOXB 5EKLA 3NK9A 5C2TB 2AQ1B 1PFBA 1FIQA 1IUEA 3PIP3 1GAQB 2B63B 1NI3A 2R61A 4IQZA 2B2WC 2E75C 3M85A 3TP7A 1A6XA 4CQNA 1L0YB 3CRLC 1EYCA 1PYWD 2L1BA 4D2KA 3H8HA 2B39A 3FAHA 1SYDA 1QOGA 1SNMA 2KVMA 2W82A 2JA5B 2Z8LA 3KLSA 3S1RB 2DLBA 3AECB 5AUKA 2BS3B 1V8QA 1T6BX 5LNK1 1LTSD 3DWQA 2D5GA 1XLPA 2F0TA 1BF4A 4MACA 2WKCA 2DY8A 2F0KA 1S5ED 4R8IA 2H4OA 1YJIA 2KACA 5E4WC 4FF1A 5K36G 4MT5A 4ITKA 1FGBD 2D62A 3QIAA 4A6QA 3AEFB 2AUKA 2QMTA 2DYOA 2WS3B 3ABVB 1E0BA 4YTMB 3M3YB 5BN5A 4IKGA 5K36H 2IX1A 4OO1I 1HQRD 2DN8A 4A3DB 2N88A 1O7YA 1HFNA 5FLXL 1EQTA 3SFDB 4I65A 1F9PA 1FMAD 2ZT9C 4A3EB 4JWUC 4PT5A 2MUYA 5E4XA 1G6ZA 1XXGA 1EY4A 1YQ4B 2L9HA 2XN9C 4RGTA 4RGOS 1EY5A 1YQ3B 1IL8A 1Y69U 3NE5B 1Z47A 2FBWB 5ELEA 5J22A 3AEDB 5M3FB 4N9PA 2PMZB 3HOYB 2DBYA 4MN3A 4WWMA 5JVH3 2PVGC 4FP5D 3S14B 1F2MA 1G291 5EPKA 3NVVA 3JAME 1J7AA 1A3VA 2JYTA 2YEPF 1QOBA 3A7AB 3C1EA 4ZRQA 3OIQA 4KY5A 1DOYA 1GUTA 2FMCA 1BCPC 5C44B 1WWTA 3E5SA 2IX0A 3DUZA 1F2RI 3MJ5A 1JWSD 1O80A 1PZJD 3I73A 1IKMA 1F2RC 4REZA 1STHA 3J9CA 1D1KA 3MP9A 3Q6SA 3NWSA 1GOZA 2RDFA 1GUGA 1TY2A 4C1NI 3DHQA 2OT2A 4FO2A 1C4AA 2M2LA 3IL8A 5J1ZA 1TS4A 2F3WA 2L32A 1K50A 2A68D 2LMCA 2NN6G 4RCOA 2ZW0A 3GTGB 2PNRC 2LHDA 3IAM1 1XCTL 2WXIA 2F0LA 5JAVA 1QB5D 3QG1A 5KIXA 3H6MA 3DWPA 3AE9B 2SNMA 2NN6H 2M19A 4WH4A 3TUOA 2B2VA 5HHDG 1LTBD 2GRIA 1PZKD 1C79A 4LK0M 2JA7B 1XLOA 2MP1A 3GD7A 3S16B 3T13A 4P2CB 3AU7A 1E2WA 2K33A 1UUPA 1FXIA 3P1MA 1R7SA 3IFDA 4EQOA 1W6KA 1N5WA 2JQRB 4XQNA 3OWFA 5BN3A 5JXVA 1ZYRC 5EQ0A 1A3TA 2X38A 4WAFA 2CJOA 2ACZB 1Y1VB 3J7AV 4A3GB 4A93B 1Z6HA 4YXDB 2QCPX 1N63A 5ELFA 3K5MA 5CV7A 3H0GB 3VR5A 3KF8A 3BK1A 3KQ4A 5I2YA 2QEJC 1CT1D 3E9SA 3KWLA 4IOIE 1KF6B 4TQ0A 4ZAIA 1I7HA 2NVQB 4O42A 1D5ZC 1NAPA 1H9MA 4YWGG 4KK7A 3LB8C 3FVQA 3NUCA 1O78A 4ZYSA 5FLXE 3AEGB 3QB3A 1FD6A 2CQAA 1TWFB 1GJXA 3HGBA 2N9KA 3PUYA 5MPOA 2WXQA 4BWGB 3U7ZA 3NVYA 1KLGD 3K5OA 2MH7A 1PGAA 4USAA 4ID6A 2WACA 3AM9A 3BYYB 4EQNA 1PFDA 1DM0B 1OQQA 1RWSA 1U4RA 3QOLA 2F0MA 1CJEA 5KGUA 2JEBI 2KQ3A 5C4ZA 2WP9B 1ZXIA 2LKVA 5EE9A 1VMPA 4ZK9B 2M9VA 1B53A 2B8GA 5T8IA 1J8IA 1MSHA 1OQRA 4OVZA 2OF1A 4PMBA 1Y1WB 1STAA 5DM63 1RM6C 2HCIA 4OIJA 4ZHPA 1FNVA 1EFID 3T53B 4DXGA 4A3FB 3K59A 1LLRD 1TIID 2J4XA 2PW9A 4ZRZA 2IW3A 4HCSA 3D4WA 5CBAE 4F87A 2WXJA 2BCOA 1B1ZA 1LT6D 1R9TB 5DAUA 3VYSA 5A2QL 1L4DB 4ZLTF 4J3OD 2CU3A 4OZCA 3PUVA 3KBGA 1CQVA 4IUNA 1BR9A 2Z4HA 1VZ7A 1BOSA 3U9OA 4DK1A 3TSSA 4BY1B 1TS5A 3Q23A 3P1HA 3IT6B 2WDVB 4K14A 1ZUD2 4L23A 1FNWA 1ACCA 1ET6A 4H0LC 3EGRA 2OEDA 3L3OC 5M5WB 1QOFA 1D1IA 2KMMA 4DA2A 3I57A 1ROEA 3NPPA 5JVG3 5FO7B 3H91A 5C3EB 5KNDA 3RZOB 4KY6A 3HOZB 2BW2A 1B9RA 3P20A 3V05A 2O5IC 1I4QA 5C0XH 3URYA 4AQ7A 3PUXA 3K57A 4A9AA 2HTME 4RKLA 3P4PB 1XF5L 2SAKA 4KKSA 2DWQA 3NTIA 2Z1CA 1JE4A 1LO5D 1TVXA 5BMIA 2XWBB 2GA4B 4TMAB 3SR6A 1H9JA 1NR4A 5M5YB 3IAS1 2A69C 1WSPA 4G7OC 5CORA 2V0GA 1ZP0B 2B2WA 1BUIC 4XT3B 4HSVA 4IUQA 2JP1A 4IFDJ 2IX3A 1SFOB 1SIJA 1GHKA 3PUZA 4UDUC 4RF0A 2SOBA 1DOIA 3N9YC 1N62A 4H2AA 1XYIA 1AEXA 4DNTB 4WRDA 3DWMA 2KCNA 1H9SB 1IHZA 1EU4A 1SYGA 4WURA 5I2XA 2EYPA 2BDOA 1E9MA 1LTID 2ZW1A 3IT4B 2F0NA 4A90A 1SJED 3Q22A 3R2IA 3K7AB 2IWHA 2KCCA 2M56B 2I07B 2BB6A 1KNEA 3PV0A 1MBYA 1OFFA 4MM3B 1ET9A 1J9OA 2PZWA 1RCVD 3H09A 4J8QA 3TN2A 2L83A 1AFPA 4C3JG 4C56C 2F0QA 1QLBB 1VLBA 2Y5CA 1V1PA 5HI1A 1QJOA 2VZKB 2F03A 2IJ0A 5EJWA 4X3TA 5BN4A 4OZBA 4MH8A 2A6ED 3CQZB 3MC0B 3C2PA 2WXKA 3AE6B 1SNQA 1HTPA 2EOTA 4DQOC 1CTMA 3BS1A 2I46A 2W3RA 4PQXA 3P4RB 1FRRA 3TZDA 1EL0A 2WAQB 1TKYA 3BVZA 1Q12A 4TQ1A 3MXNA 1E7PB 2JA6B 5H8YE 1KDBA 1QOHA 2Z4IA 3T51B 4CKEA 4XDXA 2MJ3A 2N7JA 2LUMA 5BYRA 1VDZA 1G91A 2A68C 4J6HA 4KN4C 4S3SA 5E6JA 5D3DA 4XIGS 3X3MA 4KHZA 3ZJVA 3NBIA 2CW0D 4CJ0B 2PVOD 5G3LD 4F88A 4NJCA 2H89B 1HZ5A 3ZJTA 1EIGA 3D6WA 3SEBA 1UAPA 4XYQA 3A7LA 4B08A 1CZGA 4F7XA 1F9SA 4IUPA 1F2ZA 5BMHA 3D31A 4EGVA 1K53A 1PTOD 1D5MC 3BDLA 4WIPA 5D14A 3BDOA 1XEEA 3ETRA 3ERQA 2D9UA 1SMYD 3L7ZC 3HRZC 1PFNA 2MJ8A 3FKIB 4QUCA 3N6RA 1KH0A 2WP8J 1PXUA 1X3QA 2V4DA 2KJXA 2QILA 2E2HB 3DMUA 3FC4A 1IW7C 5C3JB 2QJLA 1KTKA 3RLFA 5EE0A 3AB5A 2OEOA 1PUTA 2FHTA 4US9A 2V3NA 4OZAA 3D3RA 1AZQA 2AQ3B 4ULLA 1SE2A 2KEDA 4KTAA 1WGKA 2D2CC 4NW2A 5I4DA 2O4XA 2Q8RE 1TKGA 4HEDA 1JROA 3QOJA 2KN4A 2LFIA 1STBA 3MXGA 1S5DD 2F0VA 2QSDA 1ZOYB 4G7HC 1YNNC 1ENCA 1VJKA 2RQXA 4HMJA 3MA2B 4NMZA 2KQ4X 4C1NK 1H9KA 3J81L 1SNDA 4RKBA 3KBXA 1SEBD 4N6EB 1QE6A 3HVZA 3ZQ4A 3CKIB 4H13C 3E0JA 4A8XC 3U52E 4ZKBB 3A8KE 5CYUA 1SYEA 2WXFA 4QB4A 3AV8A 4J1MA 4FF2A 3NVWA 2F1MA 4YSYB 3BYTB 5KYIA 1RDPD 5CGKA 1NYQA 5CMDA 1N5XA 2AQ2B 3FDTA 5JEAJ 1C8CA 2E3TA 1AN8A 2R6GA 1JOKA 1H9RA 3I9V1 3C3LA 1YMHE 3T56B 2WXPA 2K9XA 2WXNA 1EWHA 1ZE3D 2PPBC 1BUVT 4GLSC 3NTKA 1V43A 2XRSD 1STNA 2E74C 4K2LA 3S2DB 3PMFA 2J0TD 5K5PA 3SDZA 4K5VA 5FO8B 1G2TA 1ZDXA 1JWUD 4AYBB 2F3VA 2CJNA 5E1FA 1XTCD 4MHEA 5HG2A 2B2YC 2WDRB 4B9XA 2F0FA 3I3CA 1HUMA 1M8AA 3MWYW 3WDNA 1E6EB 2C9OA 4XWTA 1PGBA 2NTTA 1II3A 3NP8A 1QF6A 1W6JA 1J7CA 3CU7A 1JQ4A 4RHSA 3F2UA 3OSOA 1EEFD 2RSNA 5EE3A 1FM0D 1OXVA 3VYUA 3NWTA 1I4HA 4HKQA 2F0UA 4ME5A 3MVVA 2VNUD 1OXTA 2AX5A 2FUG1 2EXZA 2LGIA 2NN6I 4IURA 2B2UC 3MEHA 4IZ8A 1UEAB 4FXGC 4C7ZA 2LFNA 4PNYA 1L0VB 4HCEA 1I4XA 4ILWA 3C46A 3A56A 2X6LA 1HPCA 1OO9B 1YNJD 2GB1A 1EOTA 1PRTF 1WCMB 1YNTE 4BBSB 1RYJA 4RWSC 1SYBA 2BE5D 5D3IB 3VYRA 5KRUA 2KAJA 1TWCB 3I90A 2E2JB 4RA8A 1V1PB 4RH6A 3M7NA 4TSSA 1JMLA 4NDXA 3A8JE 1GXDC 2W54A 2RPVA 2PW7A 5C0XJ 2NTSA 1IGCA 1EZ6A 4DFAA 3KK7A 4ZOHC 5NUCA 2K03A 3R8BA 1MSGA 4KGSA 1PTOF 4RGMA 4XT1B 3J81E 2WDQB 1QCBD 3X3NA 1H9SA 4BBRB 1ZKOA 1L5PA 2E6XA 4FXKC 1FRDA 5EPLA 3PUWA 5ELCA 5C6AA 3IXSA 4QUFA 3W2DA 3HOVB 1B9MA 1RTOA 3CWIA 1HEZE 1K8MA 1HCZA 3Q8AA 2WXGA 4FNFA 3KLRA 5IGDA 2RA4A 5D65A 1XO3A 1BCPB 3P4QB 3LWUA 4L8JA 4L1BA 1ESRA 2EPBA 1EIHA 3VR2A 2YYZA 3NQTA 5LHY1 2KEEA 3PO0A 1U4PA 2EY1A 5HGTA 3EJIA 5M9OA 3VR4A 2A73B 1DOMA 5BYQA 4KJOA 4F8MA 2QF7A 5EE1A 4WORA 1QOAA 3K0YA 4BS9A 1EM7A 5M3MB 5KNCA 1F2LA 5CR3A 2PCFB 4KKJA 1HRJA 2RDGA 1QT9A 4RAUC 2EY2A 1ZXTA 4NAWB 1C78A 3FPPA 1JWAD 1PGXA 2ONQA 3MXPA 3TEYA 1V8CA 3NTHA 2A6EC 2TSSA 3I8ZA 3I70A 3TBIB 3T16A 1Q1BA 1FO4A 5E3FA 1NEKB 4N59A 2WINB 4N9TA 3GTQB 2PW5A 3I72A 3W9CB 4B9WA 4HRSA 1EU3A 1STGA 1ICWA 2F0HA 1PRTC 2EY5A 3QO2A 3AE4B 1SYFA 3S9WA 5COYA 2DY7A 2K3UA 1DONA 1FCCC 5M5XB 3OPOA 3P63A 1NUCA 2MEKA 1QNUA 1CHQD 1XLQA 4Q0FA 1CA5A 2CW0C 2X6GA 4XTCS 2JU6X 1SE4A 1FR3A 2IGHA 3EQLC 1WRIA 1CA6A 2MGSA 4A3KB 1VCIA 4IDIA 1ILQA 2LS01 1FFVA 3AN1A 4NAMA 2XRQD 1B3AA 1OXXK 3KLSX 1FYCA 4CJ1B 3N52A 3GB1A 2XSCA 5AUIA 5I6YA 2WXHA 1EY0A 2ON8A 3GTKB 3FMCA 2BT6A 2XWJB 5C0XI 3DXJC 1RF2D 1LACA 5I6WA 2L0CA 3HZXA 3VR3A 3VRBB 3WOEA 2F0SA 2QIEB 2R7ZB 1TKEA 1JOOA 1I3QB 2YEPB 2BYTA 2W55A 4CJ2C 1YN4A 2JWUA 2PZTA 1PRTB 3NHHA 1L6UA 3C8YA 1PDQA 2SDFA 4X3UA 2INNE 5C4JB 4A3BB 1F9RA 4XXEA 1D6EC 3BVGA 2A6HD 4ZKCB 1WD0A 4AS1A 5JJZA 1L6VA 4WQMA 1LV9A 3BZDB 1JALA 1K52A 3LNNA 5CV4A 2EDGA 1PTOH 3NXWA 2J53A 1ZPSA 1XWEA 5DM73 5EPJA 2WXOA 2EJFC 1K51A 2EVBA 3ONAB 3D4DA 3BDCA 3I91A 2HDMA 2N55A 1C4QA 1SAPA 1GB1A 2EE1A 1HQMC 4FXCA 1ZXHA 2FFKB 4FVMA 4C3IB 4FF4A 1KDCA 2KA7A 3GTMB 2G9DA 2BS4B 4C3IG 1HXYD 3HOWB 1WTPA 4P6VF 1MPEA 4RCNA 1MHHE 3GP7A 3MAQA 2SNSA 3ND8A 2K7VA 2EYOA 3P7JA 1BCPD 2JA8B 4GZYC 3VQIA 5IGFA 5I9OA 1SDFA 2ZXPA 5CV6A 1LTTD 4IUUA 3I4NB 5C3XA 3OOCA 4X3KA 1IGDA 2MPMA 4KKUA 1XCQL 3SHLA 2B2VC 4K5WA 1Y8PB 1RHPA 1NENB 4HAEA 1KRHA 1DD2A 1MVKA 1SNOA 1SJHD 3SK5A 4KV6A 5JPNC 1RD9D 4LJZC 5IIFA 3TEWA 1G2SA 2XNAC 4QIWB 2VXWA 3PO3B 4DAPA 1OXUA 4JPSA 1N61A 2J7ZA