1EWKA

Crystal structure of metabotropic glutamate receptor subtype 1 complexed with glutamate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
477
structure length
448
Chain Sequence
RSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
publication title Structural basis of glutamate recognition by a dimeric metabotropic glutamate receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 159
structure length 448
sequence length 477
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewkA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewkA01
2FVYA 3LUCA 3A10A 2B4AA 3JS5A 2P9HA 3H5IA 5BR1A 3OLXA 1D4ZA 4XASA 1MB3A 2MYTA 1JL3A 1JLKA 1LJUA 2CHEA 4OLBA 3KYJB 4HNQA 4XARA 1L5ZA 4KK4A 1FSPA 3HUUA 2P4UA 3L6UA 1APBA 1USKA 1LJLA 3KCNA 4Q6WA 2FQWA 3ILHA 4O1HA 4ZJPA 3RQIA 2FLWA 1I3CA 5C5EA 1TJYA 3H1FA 4PE5B 1MB0A 3OLYA 4RV5A 3TMYA 1QPZA 4FE7A 4MS1B 4N03A 3Q7SA 4JP1A 3RH0A 1QQAA 1Z25A 4W5RA 3QELA 2L19A 3F7NA 3LUJA 5CNJA 3I09A 3RVOA 3A0RB 1JBEA 1JDNA 1SD5A 3MF4A 1T34A 4N0PA 3LOPA 4RXUA 1VRVA 3BRQA 1QQBA 1KRXA 3L49A 3O1HB 5ED4A 5FBHA 4TMYA 3ILYA 4Q6BA 2PUGA 3MIZA 1KRWA 3G1WA 7ABPA 3SQNA 4ETNA 5TQ0B 2FEKA 2MSLA 4WWHA 2QU7A 4GPAA 2FMKA 3TO5A 3JPYA 2BGGA 4RXTA 8ABPA 5FWYB 4JASB 4YWHA 1BA2A 1GCAA 2FQXA 4OG2A 4LRQA 5IC5A 4MS4B 4KFCA 3LUDA 3TB6A 4EUKA 3JVIA 3T38A 1QMPA 3H5WA 4MLDA 3H5VA 3TX6A 1FFSA 3LMKA 4MRMB 4ZMSA 1JWLA 2QV0A 1RPJA 2XDYA 1MAVA 1P2FA 4RKQA 4YRZA 3CS3A 1D5WA 5TPZD 2E4ZA 4WXMA 3CHYA 1R8JA 2FEWB 2LUOA 1NXOA 3NBMA 3CTPA 4G0PA 3CZ5A 4RK5A 1QO0A 3H5TA 4OATA 3OQOA 3C97A 3JY6A 2LPMA 4MR8B 3ROFA 2TMYA 1Z2EA 1QKKA 1DRJA 3O2SB 5IBQA 3DGFC 4PEVA 4WZZA 3SAJA 2NUBA 4D6XA 5KC8A 2PKXA 4E7PA 2FMIA 4EVQA 3T8YA 2PLNA 3C3MA 4MLCA 1CEYA 1SXGA 1NXTA 1XHFA 5B3JA 1B00A 1NXSA 2JBAB 2PUCA 2ZAYA 2ID7A 1H9CA 4MS3A 5EWJB 4MR9B 3RVNA 5BRJA 5CNKA 1NY5A 4PZ0A 3IP7A 2RJOA 5DTEA 3JTEA 1HEYA 3MM4A 1D1PA 2GX6A 4W5OA 3DLHA 2MYUA 1NXWA 1XWWA 4OTZA 4F3TA 1PUXA 4NV3A 2WMYA 4EYOA 1JYFA 2H3HA 2PL9A 4EYQA 2O20A 2HPHA 3HDVA 4Z0NA 3SM9A 4Z4FA 3HCWA 3SG0A 3C6QA 4Z4IA 5HKOA 3GWGA 4RK0A 3M9WA 3BILA 3NNDA 4H3HB 3VNAA 1VPWA 1SRRA 3O75A 3OLVA 5HSGA 5JS1A 2JRLA 2YHBA 3UK0A 4YO7A 5TPWA 4G0QA 6ABPA 2VUIB 3KYIB 3H6HA 1USGA 4RY9A 3RVMA 1Y1LA 3O2QB 1JX6A 2OQRA 3GBVA 3QLUC 3S99A 2GWRA 4EVRA 1F51E 3P9YA 2PUDA 2PE5A 1EWVA 4QICA 3FFWA 4MS1A 4P98A 1FFWA 3N53A 1S8NA 3EGCA 2E4UA 2ID9A 3QX8A 1TMYA 1NATA 3QEKA 4KRFA 1TM2A 1ZVVA 1JF8A 4IRXA 1K68A 1JFVA 9ABPA 1DCKA 4EGSA 4YR7A 4G0YA 1ZDMA 1JDPA 4XLTA 5JNSA 4W5QA 2R47A 4D74A 1CHNA 3HK2A 3KTOA 2NT4A 1JHZA 1MIHA 1Z15A 5IEJA 1BDHA 4NCAA 4MQEB 1ZH4A 4E7OA 4RK6A 5C5CA 2M1ZA 2E4WA 5KC9A 2GBPA 3OO1A 1ISSA 5T3YA 1DP4A 1ZN2A 3EDCA 3QLVC 1DC8A 4KQ9A 4W5TA 4MQFA 3NNSA 1AB5A 1YMVA 3CG0A 1Z2DA 3IPCA 1TVMA 4MS4A 1DJMA 3D02A 1NTRA 2FW0A 3OQMA 5ABPA 4F12A 4S04A 2HSGA 4FE4A 4LE0A 1DRKA 1CYEA 1DC7A 2AYZA 4HYEA 4MRMA 4QYWA 5DKFA 1E6MA 1NXVA 2PL1A 4IILA 4KVFA 1M2EA 2NZVG 1YS7A 4YP9A 1USIA 2FEPA 3H6GA 3OM1A 1ZHHA 3HS3A 4MPTA 2X7XA 1PEAA 1RXEA 4EVSA 4LX8A 2A9OA 3CG4A 4RZSA 4FB4A 3DZDA 4XFKA 3LFTA 3LTEA 2QR3A 3HEBA 3GA5A 3Q7RA 4KK3A 3RVQA 3KSMA 3IP6A 2LP4Y 3IP9A 2F8TA 3H5LA 1QP7A 1QO0D 5CNMA 1YIOA 2MSWA 5DGCA 3Q7TA 1M5TA 2QSJA 2E4XA 5CHYA 3FDFA 3O2JA 3OLZA 5D2CA 5IEBA 2F8SA 2LIVA 1A2OA 2JBAA 1U04A 5KI6A 1JFTA 3A0UA 2VYCA 2N9UA 2WB4A 3KHTA 5FBKA 3RVSA 1PNTA 4KPYA 4WUTA 3HO1A 4RK4A 2RDMA 2IYNA 3OMXA 3LKBA 4Z9BA 1YVUA 2WRZA 3QELB 4H3KB 2FKAA 4ETMA 4IGAA 1SXIA 4Q7EA 1D1QA 3QEMB 1DBWA 3KKEA 4MAAA 5IX8A 3EQZA 2LBPA 5TQ2B 3M9XA 1W25A 2J48A 1LK0A 3EQ2A 5T7BA 4MR7B 4YLEA 2IDMA 4RK7A 3D8UA 2FTKE 1EAYA 1YTUA 4P1ZA 2HQBA 3C3WA 1URPA 4QYMA 1P6QA 3VNBA 4JAVC 4KREA 4MYRA 1PEYA 4G97A 5EWLB 1ABFA 3DLBA 1Z12A 5GQSA 1C4WA 1PNRA 1TLFA 3MMNA 1U2QA 1DG9A 4LE2A 3GT7A 1FQWA 1YS6A 3LUGA 3RVKA 1EWTA 4G0XA 1Z18A 2MYPA 1JH9A 4YGXB 2PUFA 3NHMA 2NT3A 3I42A 2FLKA 4RWEA 2CHFA 4Z4HA 6CHYA 3QLTA 1KMIY 2IPMA 4O1IA 1LBIA 2L2QA 2QXYA 2DRIA 1RNLA 1ZESA 3O21A 2IPAB 4RKRA 3HDGA 3RVPA 3CNBA 3B2NA 1ABEA 2VUHB 3LUHA 1VLZA 4UHJA 2A9QA 3HV2A 4ZYLA 5KQGA 4KNYA 3M6MD 1PHRA 3FMVA 1NXXA 1QNLA 4RS3A 3K4HA 4JB2A 1BAPA 3F73A 4G0ZA 4O5AA 4Z99A 4G0MA 4LDAA 3Q9SA 4Z4GA 5IUKC 5DLEA 3HVRA 3N6VA 1E6LA 1L5YA 1JFSA 1OXKB 3HXMA 5B3JC 1DCFA 3NHZA 3JVDA 2GKGA 1BDJA 1AB6A 1DBQA 3I45A 1YK0A 1U2PA 5E3JA 1EHCA 3LUKA 3O74A 2QW1A 1E2BA 1A04A 3N0RA 1Z16A 4MGEA 4S05A 3O1IC 2QVCA 3FGZA 5TE9A 5KWSA 1ISRA 1VKRA 2Q5CA 2W42A 5JNWA 2PAFA 2JK1A 1BVHA 3CFYA 5PNTA 3F6CA 2JVKA 4QPJC 5TQ0A 3ROTA 5JNRA 2IPNA 4M88A 5HM6A 2IKSA 2IPLA 5FWYA 1K66A 2NZUG 3MYYA 1ZH2A 2A9RA 2RJNA 4RXMA 2OENG 5FWXB 3EJWA 1OXBB 1ZITA 3H1GA 4W5NA 1YMUA 4PICA 3FFTA 4KMRA 3CKMA 4LDZA 4RY0A 4KQCA 3R0JA 2FXIA 3KJXA 2L18A 2FSPA 3GYBA 4L85A 1U0SY 4F06A 5TPWB 5KQLA 2MSKA 1GCGA 3KLNA 5EWMB 3E61A 2JB9A 3JPWA 1DZ3A 1Z17A 4N0QA 5BRAA 3IP5A 4NQRA 2FMHA 3NNNA 1IIBA 3N75A 2HQRA 1EFAA 4NCBA 3KG2A 4B09A 1GUBA 2KYRA 3O1JC 1P8AA 4MR8A 2PUAA 3GL9A 3MQ4A 1MVOA 4IF4A 1E6KA 1ZAYA 4YV7A 5JNTA 4DADA 3IPAA 5JNVA 3QX9A 1J56A 3QEMA 2H0AA 2PUBA 3E3MA 3T95A 5TQ2A 3OMWA 4Z4CA 4MR7A 3N0WA 3URMA 3GRCA 3F6PA 3KS9A 5F64A 2FN9A 2MYNA 4G86A 3H5OA 3H1EA 3HSYA 2AYXA 4RU1A 5EWJA 4N76A 4MR9A 1ZGGA 5IUNC 4LE1A 3LUAA 3GV0A 1YK1A 2V0NA 5JNUA 4OLAA 4G0OA 5EWLA 3HZHA 5IULC 4WT7A 4RK1A 5I4CA 4IMIB 4MQFB 3QK7A 3G85A 3CU5A 5IUJC 4CBVA 1M5UA 2CWDA 2M98A 3RVJA 2CD7A 2FN8A 2R4QA 3C3KA 4JOQA 4UHKA 2WY2D 3T6KA 3Q15C 4LZLA 4KV7A 4Y9TA 1ZGZA 4DQDA 5JS2A 3BBLA 3N8IA 1FFGA 2FQYA 4GNRA 4NICA 2QVGA 2WJAA 5KQPA 1KGSA 3EODA 3A3KA 3UKJA 3W9SA 3H75A 3DGEC 3SY8A 1GLGA 3OLWA 3SNKA 1DBPA 3CRNA 3HJFA 2ZWMA 4ZMRA 1ZY2A 1Z13A 2VK2A 1A0OA 3OM0A 1DCMA 2A9PA 1EWKA 1D2AA 1SXHA 1UDRA 3EAFA 3EULA 4Z9AA 3QLUA 1U8TA 2JCGA 4ML3A 1W9HA 1Z26A 2WJWA 2WWVD 3RVLA 2E4VA 5GOTA 3TD9A 4YCSA 5DCLA 3UUGA 2PJUA 2I6FA 5TPZA 3CZCA 3KLOA 4IMJB 3OO0A 5CNIA 4EYGA 3BREA 2JVJA 3FFXA 4KZKA 3N0XA 2HJ9A 2R48A 3DBIA 3Q41A 4HNRA 4L4UA 2R25B 1BDIA 3HUTA 2FMFA 1LBHA 1RXIA 2YHAA 3HM9A 4YS6A 4N41A 3I5AA 2JVIA 5KQMA 3IDOA 2QZJA 2HQOA 1C0EA 3MA0A 4RDCA 4EYKA 1GUDA 1WETA 5TQJA 4F8JA 4EY3A 1RZRD 4N47A 4ZPJA 1P6UA 4MQEA 4RY8A 4OBBA 3RVRA 3OQNA 1JYEA 1QP0A 4TN5A 3QLVA 4TLMB 2PUEA 4RSMA 4JB0A 5FWXA 3GBPA 5BQ3A 4F11A 2IOYA 4WXEA 4TLLB 4H60A 4D6YA 2PMCA 3BRSA 1F4VA 2GI4A 4XXHA 4Z4EA 4DN6A 3CLKA 5HQJA 1QP4A 4ETIA 2E4YA 4MS3B 4HNSA 1RZRA 2B1JA 3LKVA 3LUFA 5EWMA 4JA2A 2RGYA 4PYRA 1NXPA 1XHEA 1M2FA 4XAQA 3K9CA 2L17A
chains in the Genus database with same CATH superfamily
1E98A 1Q17A 1DAGA 1DZIA 1FDIA 5A3JA 2I2FA 1WDWB 5CK5A 3RHTA 3UGJA 5IMSA 3GMSA 1X1SA 2GYYA 5TMEA 4C29A 2VOEA 3JD0A 3U61B 4DW8A 4QDZA 4QASA 2QMYA 3DVAA 4IGEA 4CETA 1LSSA 3CBQA 3KDPA 3MJVA 1SUWA 2J7PD 3BSFA 2I3GA 2H17A 3GLKA 1UZLA 1QPBA 4R4JA 1PWHA 2WVHA 2IYLD 3FF4A 5ENDA 3BXZA 4B6RA 2XB8A 2AX4A 3DE3X 3L8FA 5CT6A 2A5FA 5CK4A 1CS0B 2N0SA 1I94B 2H54A 3KQLA 1H85A 4GKBA 4Q9DA 1JKJB 1T2VA 2B8EA 2Z5LA 1LBEA 4RFSB 3H8WA 2C95A 3H17A 3ESAA 1TJYA 4O25A 3VI4B 2FUCA 2JC3A 3BF7A 2GZRA 2JJ1A 1O9BA 1QTQA 3PUIA 4Y1EA 3Q7SA 4V0NA 2CJYA 3CX3A 4PX2A 1PGOA 1OCEA 3FN4A 4TV9A 5AVSA 1T0JB 4W8HA 4BNDB 3UMVA 3EVEA 1UBTS 5ECGC 1DQSA 5CBPB 5M2QA 2OL4A 4DIOA 4OIFA 5ICSA 1VL6A 2J09A 1Y4UA 3FKQA 3DMFA 1IHDA 3LUPA 1OIVA 1UM9B 2O3QA 2YVKA 3ETLA 3LC0A 4CLOA 4DVJA 1XPJA 2GXQA 3ZX4A 2DB3A 3VBCA 3A4TA 3L8YA 5DSTA 2ESRA 4FGJA 5D87A 1T5BA 5IAEA 2OM2A 3SHOA 1LLFA 1TVCA 1FFCA 2ZS7A 2WZBA 1XIVA 3GVIA 1N5KA 3FCYA 3DO6A 4OM7A 5AM5A 3RJZA 3UCXA 4NLLA 3TB6A 5E7MA 3BAFA 2FSUA 2IYYA 4D3YA 1UXIA 1Y1PA 4LGYA 3GZNB 5DYNA 3S68A 4D45A 4X62B 2TYSB 2A57A 4E70A 4MH0R 3CLRD 5F9HA 3I6IA 3SXJA 4NE9A 5C32A 1EM8B 4HUTA 2QN6A 5HYVA 3J80A 2OCDA 3D1JA 1KSHA 3HLTA 1CEEA 1NAIA 3KV3O 3KELA 1L2TA 1R8JA 3BWCA 2NUPA 2DBRA 3DR5A 4H0NA 1SUEA 4I1SA 1NMZA 2VDLB 4LMPA 4ASUA 2JIBA 1MO6A 2YCLA 5IJ0B 2GD2A 3F4KA 1E5QA 3DLAA 3T06B 4EUNA 6ADHA 1C0KA 2RGUA 2TMYA 1FDTA 1XU4A 1PJ3A 2O07A 4JJ6A 1N2BA 1M3SA 3H0KA 4FFWA 4D6XA 4GI5A 2OO5A 4ZTUB 5U1PA 4JGGA 1RAHA 2Z6UA 3HB7A 3DDZX 2QI9F 2Y99A 1KARA 1RHJA 1WV0A 2Z95A 2DHDA 1C9EA 2J4FA 4KITB 1RP7A 2G08A 5IKEA 2OSBA 1KVQA 2R8RA 1OGIA 3PUHA 4DSZA 1ENZA 2Y67A 3DBLA 2ZRJA 2HD4A 4K9LA 2IOFK 1Q16A 4ZJZA 3PT9A 4M1WA 3OX4A 1NYQA 3AHJA 4DQXA 2JLXA 2X2PA 2RBGA 2IKQA 1ISPA 4GFDA 5CXXA 3P4YA 4CM5A 4YV2A 5K3DA 1A3CA 3H6KA 2JAHA 4TSRA 4TRJA 3KD2A 4GUAA 3SG0A 3TGLA 4N5IX 3DE5X 3R7NA 2WB2A 5AVRA 2PYIA 1T4BA 4H3HB 3BILA 3DV2A 4ZAVA 4JUBA 2X9NA 4KQMA 4M8KA 1OHHA 3UFXA 4F2WA 5EIFA 4MUYA 5JECA 1XXHE 1C1XB 1IQUA 1QK3A 1Z74A 4MA5A 4RVFA 3WL4A 4KXWA 3V2UA 1U7DA 4B75A 5COAA 4KFUA 1QCZA 4C4RA 3Q72A 8GPBA 4C0WA 3CPEA 4RY9A 1H6BA 4DRXA 2PYZA 1E8NA 1CT9A 1L7MA 1PL0A 4CIXA 1NNLA 3Q9UA 4NYMQ 5DNWA 5FPQA 5HE9A 5A06A 3WL6A 4Z3KA 1OH8A 1ISGA 5FUXA 1V6SA 3FCOA 4CM3A 2ZZNA 3FNQA 4ESEA 4P7KA 2EKLA 4YXWD 4B43A 3BXFA 5K0JA 1AJEA 4XX0A 2HFJA 3ENZA 1UMDB 2EFEB 3KT3A 4IIDA 3PDJA 1SUCA 4XB1A 5CT9A 5LBUA 4E2YA 3KT0A 1UBEA 1QORA 2EKDA 4TOIA 1E2MA 4WLNA 1TT5A 2HPVA 4PC7A 5JRJA 4IV8A 4AP5A 5KNLA 2EZ9A 2G06A 1DV1A 1WCWA 3C1AA 2ARKA 3I04M 4GU5A 4LTNA 4NESA 1LU9A 1QYRA 3AEZA 4IG4A 2E4WA 4FFBB 3B3FA 4RENA 5T3YA 3RRFA 4BNKA 4ZEVA 3M6LA 3MWDA 5T4BA 4HY3A 1DC8A 1GR1A 3DE4X 1MAUA 2P4EA 1NVUQ 3CPSA 4ZVVA 2ZSHA 1E3LA 1LSOA 2J9FB 4HFMA 1O96B 3L4BC 3OJCA 1LZKA 3QX7A 1L4FA 4LGCA 1J7JA 3KLMX 2KLHA 4MUJA 3CEPB 1CYEA 1UDCA 1DTSA 2HHJA 2FW6A 2XMQA 4JODA 5BNFA 5BY2A 5L4SA 4CF7A 3AR6A 1G7SA 1YB2A 2QQ0A 5FOUA 4Q4DA 5IHPA 1YU9A 3MCVA 3SYTA 1TYBE 1WMAA 1USIA 3BIWA 3IUJA 5L4LA 3KYCB 3MQ2A 4UE6A 1IM5A 1M73E 2BFEA 4MROA 2PY6A 4O2LA 1XPUA 5DU2A 4UCFA 5FOWA 4ZQGA 1FNNA 3HEBA 3KZKA 4RKEA 4NOJA 2QRNA 3UIEA 4KO4S 4JELA 3C6KA 4ZYWA 5CA0F 5ENVA 1VI2A 4I55F 3M3DA 2WUDA 1QP7A 3VO9A 5EERA 1VE5A 3FNRA 3NYQA 4NZNA 3R7AA 1YONA 3GLFB 2MSWA 1PW7A 1P4GA 3PGA1 3JQ7A 2HH9A 2EXXA 2HMAA 3LP6A 5JJCA 1GAWA 1R0SA 4OKNA 4YRIA 2RMKA 4KWCA 1GZ3A 3PT5A 1CZHA 3N70A 5DGHA 3DMRA 3WZMA 1ZGCA 4J2HA 4BZXA 4D4HA 1O6CA 3GJTA 1OXVA 3H2YA 3G5AA 1C7IA 5KI6A 4B84A 3EVBA 1CULC 4EA8A 1UBNA 1T35A 3ZV4A 4CG2A 1ETUA 1GSIA 2LRHA 4GOXA 1ZMRA 2CNBA 2P3LA 3PJEA 4GF5A 5K3SA 2AKAB 2X23A 4DMGA 1WDMA 1KNQA 2HNKA 2R97A 1RI5A 1M6WA 1EUCA 4WJKB 2GUGA 2ZJBA 4HMQA 2HJHA 1AS3A 4MYDA 2EBHX 2WA1A 3OAAD 3T54A 5BMOA 1MJ5A 5CITA 3D7MA 5CXUA 5TQ2B 3SYMA 3U3MA 3JQCA 4FM9A 1Y3IA 2B8NA 4DDMA 1MH9A 4KP7A 2C0QA 2WJHA 4BTVA 1QC5B 4RJTA 4RTKA 1MU0A 5ESWA 3BX1A 1WL8A 2C61A 5FOSA 2I6XA 4YCLA 1KP2A 1XKQA 1ENYA 2BDTA 2V9ZA 3IDSA 1IZ9A 1W49A 3I0MA 1NYRA 5A02A 4FCTA 4RTMA 1E62A 3DD5A 2C3YA 5B3AA 3FYTA 4MULA 4RORA 3I1YA 2EG9A 2P0YA 1FL9A 2B5OA 1UFQA 2X7JA 5KWJA 4RHXA 1NI3A 3HBLA 1GY8A 1FRQA 2GMWA 2HRCA 3R3UA 3GW8A 4YFVA 3PQ5A 5LZ7A 4UTPA 4A8TA 2CLKB 1J21A 2QA5A 3N74A 4IIJF 5CVVA 4ZAYA 3W5AA 2B7LA 3PPXA 1W0CA 2QVBA 3QLTA 2A58A 4HWSA 3ZIAD 1I0ZA 1XMPA 1YI0A 2O0JA 1RBMA 3NTUA 3O4RA 2R5FA 4M9RA 5A3SA 3T52A 5KHLB 2NO5A 3NBAA 4N0EA 5WRFA 2AUTA 2OHVA 3LYAA 4RA9B 3L8EA 4KWIA 3AT1A 1GZ6A 1QQTA 1U4OA 4DFDA 1Y6ZA 1U11A 3A05A 4OSEA 5E9QA 3HXKA 4KQHA 3TR6A 3WYFA 4DM7A 5C7OO 5F7XA 1TAQA 4MI6A 1PO7A 5I5GA 5FEUA 2HW8A 4XLLA 5HZKA 5EXTA 1PJAA 1U02A 5JBIA 5AKLA 3EEBA 1UPAA 4BXOA 1XHLA 1TO1E 3PC8C 4H6WA 3U3RA 3LX6A 2C2KA 2ADFA 1E2FA 4ARVA 1S3IA 5F7ZA 3FCEA 3HXMA 2CBGA 3JR7A 4GQIA 2ZYGA 2I22A 1OZAA 1XP5A 1AB6A 1A9SA 2VPYA 3GMTA 1C30B 3RIGA 4ATNA 1A04A 4C01A 2CDCA 3V6MA 4LFCB 4XYBA 3ZXXA 4KYUA 3PPIA 1ISRA 1N8KA 3WP0A 2B7CA 1KAEA 2AR7A 3UK7A 3HMKA 4I8XA 4M0DA 3FSGD 5PNTA 5DN6A 1QE0A 2WHRA 4DARA 5KNDA 3K5WA 2GXUA 1PT7A 1UMCA 3SLGA 1Z62A 4EA9A 4B48A 3BIFA 1X74A 3P97A 2YXLA 2NUAA 3RYTC 2CXOA 2BZGA 1G8PA 2OENG 4K8RB 4G07A 4G85A 3H1GA 1JZSA 2C1EA 4KMRA 3FM9A 1J9GA 2FEMA 5IZCC 4RY0A 5FIUA 1AA9A 5DHPA 3JWGA 3AR4A 4MV9A 1YB4A 1CY0A 3U17A 2POCA 4F6LA 2P78A 1X80A 4TZ6A 3U13A 1CJSA 4NZ9A 3BXEA 1MC4A 1OGJA 2C2BA 2QMHA 3JR3A 3WKAA 1T3LA 4CV1A 5IYZF 1AO0A 4FFSA 5BXQC 3OY2A 2ZR8A 3SEAA 1QIFA 1E2QA 2SCUB 3CN9A 2IV7A 1C0PA 4HUQB 1P8AA 2ECKA 2HDOA 1Q91A 3PVSA 4HX5A 4YAEA 1U7HA 1ZAYA 3NTOA 4HWRA 2HZBA 1AN9A 4EIWA 2IYEA 3AYXB 5LKAA 1T3HA 1GPAA 4B3GA 1RW4A 1VCMA 1WR8A 3G0GA 3V8BA 2QBYA 3OMWA 2JLYA 3ND9A 4V2IA 4BZZA 1SK9A 4OX9B 3FPKA 1THZA 4G86A 2DECA 3VISA 5AQ1A 4GL4A 1BRTA 3HY4A 1N25A 4RQAA 4EY4A 1IMJA 3OZ7A 2VYFA 3ND5A 4EEKA 3LS2A 4NEHB 2ACWA 2QRVA 1LNQA 4WT7A 4LJSA 1J49A 3MOGA 4UNNA 1KI8A 1MX3A 1KDTA 1N0HA 5H7XA 3X1MA 4TT3A 4JOQA 4WTOA 4NBVA 1QGUA 1SHTX 4JBXA 4HDSB 2N47A 4IUCS 4P4SA 1OU0A 4U5XA 3UHJA 4UPEA 5JD3A 5K6AC 3N8IA 1N6KA 1QAQA 1U4SA 1Z37A 1VHWA 4P4GA 4TSFD 3TOZA 3U7QA 5K0SA 3I9NA 3U2QA 1IN6A 5KQPA 2WEKA 1IHXA 1KPHA 2O1SA 3A3KA 3C6MA 3HKDA 1B0PA 3JQAA 5I3ZA 4EHDA 1XTSA 4EVIA 1BE1A 4CI0B 3LQKA 2VP6A 5DHTA 1HETA 4DMMA 3PE4A 2J31A 3AI7A 1Z13A 3GFVA 3ZQJA 1T4GA 1NUAA 2Q3JA 1JG6A 2OAGA 3Q7QA 3G5MA 4TL7A 4YAJA 3CUTA 1KDZA 3A1WA 2DR0A 2J9YB 3D8HA 2XGOA 3RT7A 3WIEA 4EO9A 1FQKA 3P9CA 4Z9AA 1H94A 5A9SB 4MAMA 3VU3A 3JYHA 1Z26A 4CL2A 1CJMA 1D8AA 2ZWVA 4MLZA 1ZNWA 4WLUA 1J8YF 4G63A 3WWEA 5EESA 1O94A 1C2YA 1O97C 4IL5A 2AT1A 4QOHA 3U39A 4CKCB 4Q7LA 1M76A 1S2MA 5HVNA 3LPDA 4KBYA 4C5AA 2XE7A 4M49A 1ZUNB 5CUQA 4PN3A 3E8XA 2BJWA 1WLSA 3IEXA 2DTEA 4E1VA 3COZA 3KRTA 3PD0A 4JXJA 1AQLA 4A03A 4HEA6 3KKZA 3NDJA 4K28A 2I9PA 1NT4A 1T26A 3CRZA 1QNFA 3PJRA 2B98A 4EYKA 2I7DA 1GL7A 3K8QA 1M1YB 1P3JA 1H9BA 3W5SA 4PCUA 4JV5B 1H2WA 2H1LA 4NNPA 1ES9A 1QIHA 1TVEA 3IT0A 4AXBA 3P9XA 1ODJA 3DKKA 3PPWA 4WNYA 4DIFA 1YFLA 1R0BA 5CFZA 4IUDS 1IJKA 4FFRA 2A0XA 3CSDA 4MYTA 1ZK3A 3A1FA 3CC8A 3F3YA 3LVQE 2WNIA 3M5CA 1S02A 3C14C 2E7ZA 4JCCA 5DDIP 4JCOA 4E15A 3WV4A 3HXTA 1EFVB 2AOWA 3BRSA 1YQQA 3V8EA 1P77A 1IY8A 3WE7A 4FFVA 5E6RB 2EHJA 4IJUA 3UMCA 3KSAC 4CEIA 3N8HA 4PC6A 4RH0A 1WTCA 1FW8A 1ZGBA 3PFWO 1RTTA 3C3XA 5H80A 4JUAA 4QVKA 2AE2A 2D2XA 1IC6A 2MINB 1IZ8A 2GF2A 3P2KA 4MP6A 3M6IA 2RGGA 3KALA 2A9KA 2NX2A 1JEJA 1VPVA 2ACVA 2J85A 2O4UX 3HU2A 3N0TA 3P2EA 5E1DA 1FEZA 4YMSA 3VVMA 1XJ5A 5JS8A 1G8JA 4G84A 4KLAA 4KKXB 1YHNA 1N77A 5JFGA 2PH3A 1ZXBA 2A14A 1JFFB 5CYPA 3TSAA 3K1AB 3R5TA 3ZWKA 4A8JA 4LKRA 4BNGA 4C0BA 1KEEB 3NWOA 3MJDA 3DTYA 4BO8A 5FOQA 1G8KA 1G0OA 1Z5OA 1UMKA 1XFAA 3IRUA 3NBQA 2QRKA 2ZS8A 5TMBA 3ZR4B 1J4AA 4F5EA 4ZJPA 1M0TA 1HYEA 2ZI3A 2Y2VA 1Q84A 2VDPB 1K5PA 4K0KB 4GBED 1GTVA 4OQYA 2EWWA 1QHEA 4PGHA 4DCTA 1UT6A 4E11A 3F2IA 2X22A 2UUPA 2Q6LA 1G9XA 3OTGA 1Y3HA 2AK2A 1LI5A 3WA6A 2FSVC 1DOAA 2GH1A 2YICA 3LH5A 2ACKA 3K6SA 1KJNA 3ZZTA 1H6AA 3LUJA 1ISFA 4MB6A 3Q5EA 2H8KA 3FSJX 4JBHA 4RDXA 4CLDA 5ALSA 4YDHB 3K6RA 3OFVA 4HVTA 2VDNB 3RVOA 3W6PA 3A0RB 2ZT5A 1TPYA 4QGGA 3FETA 1FXUA 1G5PA 2G5PA 3CLSC 1LC0A 1ELOA 5AVJA 7ADHA 1J1UA 2M9MA 4RLFA 2IV2X 5JSZB 4BNVA 2GPAA 1I33A 1V2GA 4BKOA 2PFKA 4RHUA 1M33A 3WJ1A 5TEWA 2ZRKA 3B1FA 4M87A 1GV0A 5JXWA 1AD2A 2J9ZB 4A10A 3GROA 3OSUA 5HUJA 3K70B 4I8IA 3H8SA 3UUEA 5LJLA 1FS4A 1TEVA 3BJEA 5ALDA 2JLBA 3JD2A 1V1MB 3DMDA 2P77A 4FX2A 2HZ7A 2YIJA 1QMPA 1BSVA 5CFOA 2BM8A 2CV0A 4WY5A 3RJTA 4BVHA 1T2DA 2PX2A 4PM4A 4IIGA 5JASA 2A9FA 4ERXA 3V4LA 3CLVA 3QU4A 1TF7A 4C6RA 1NUQA 4CKEB 3PHCA 3VI3B 3ZI4A 4HB4A 3NYWA 3ZQ4A 3Q4GA 4IYJA 3GLIE 5KVVA 3CTPA 2HK6A 1EFRA 3DO5A 1ML3A 1O95D 1ZBDA 3MBKA 5DLQC 3JAKB 1HX7A 5KNCA 4KXYA 4PYIA 3RODA 2LPMA 4MR8B 3FF1A 1L9XA 2D5BA 5HIMA 3S55A 4DR4B 1T9GR 1QKKA 1Z2EA 2XYQA 5JAUA 2G6BA 3F8WA 3OT5A 4PPGA 3EDQA 3V00A 4AN1A 8MHTA 1IG0A 3RRNA 3AFGA 5J47A 1JEQB 3E58A 3QPVA 2PZEA 3QIVA 4LDPA 7YASA 1XMVA 2R00C 1PK9A 4OFWA 4LTDA 2QTMA 1V16A 2FVXA 4H7PA 4CV2A 1L5WA 2R7NA 2ONJA 3I01M 3L92A 3ICWA 1AUOA 3OQVA 2JPDA 4Z1MA 3DPIA 4AUNA 3NEYA 1RM3A 1K5HA 4YPOA 2QAIA 3L06A 3ORFA 4DGQA 4CTNA 5HW0A 4PZCA 5I8ZA 3SWWA 3E18A 1PJBA 4CEJB 2BFAA 4YRMA 3DFKA 3MMZA 3JWHA 3PENA 1G5TA 1I7LA 3GRRA 1R88A 5FTKA 4MK4A 2HRQA 1QUFA 4F3TA 3SBEA 4AS2A 1CDDA 3GDOA 5KOHA 5F98A 2BSAA 1DO0A 1PSWA 1QVZA 1Y8RA 3HJAA 3HDVA 2BD0A 3HGMA 3TINA 4QU9A 1RWBA 4GYWA 2AA3A 2SBTA 1UAYA 3FTDA 2QAGC 3Q10A 5G4KA 4C88A 5JUWA 5K3FA 2AG5A 3VNAA 2OZPA 1NTOA 1EJ6A 2VR1A 3VUEA 1H2FA 2Z98A 1YCHA 2EW2A 1D1TA 2QD4A 2YRWA 1TJ5A 1KJJA 2X0NA 3FOBA 3PSAA 4G1BA 3BMOB 3UCFA 3WRVA 4AY4A 3PGKA 1G7CA 1LV7A 2I4OA 5AM4A 4EO7A 1UXGA 2HA3A 4G0QA 4PG7A 4C0AC 1J0BA 3N59A 4RZUA 2VCHA 1U2GC 1Z2PX 2WTUA 5SZHB 1TGVA 3ENWA 4MV3A 5IJXA 4BLQA 3AM4A 1KKLA 2IRWA 1XZNA 5CDGA 2RHJA 3CE6A 2WTXA 3KKMA 3P45A 5JNLA 3UT5B 3V7NA 1FFWA 3DEKA 1NBOA 2FW1A 3W3AH 3VXKA 1BGWA 4ZFNA 3MT8A 3B82A 4ZGBA 4F4FA 1R0CA 1V96A 1B15A 1KL7A 4KV9A 2JJ1D 1KERA 4L6IA 4PLFA 4TWBA 5HCIA 4IKEA 2C7OA 2CDNA 3NJ4A 4RIHA 4L9WA 3EPLA 1RABA 2A67A 1Q0LA 2A9VA 3IPLA 4B3XA 2NP7A 4J6FA 4EW3A 3QJYA 1NR5A 2WWXA 3ZBPA 1V9SA 1FXWA 2M1XA 1A8IA 1TJ4A 3ZKWB 1K8QA 5LMNB 3C3DA 3BGWA 2AMFA 2W43A 1GV1A 5B7QA 2RAFA 4I7EA 1EVKA 3VPAA 1BDHA 2AZDA 3GCDA 4OI1A 2Y1OA 1RHKA 1S3SA 4CT5A 5C46F 2GEJA 2XNJA 2IITA 5FORA 3BXHA 4H7IA 4JLDA 1DP4A 2K2QB 1PS0A 1SCJA 3CLUD 3GEGA 3PKIA 4JT2A 1J5EB 4KQ9A 5ER9A 5I4BA 5KTTA 3UC5A 5AM1A 4J3NA 1TA4A 1TVMA 4D4MA 3OQMA 1Z88A 4RPCA 4S04A 4FE4A 1NPTO 3IGFA 4FCWA 4KNWA 2I4TA 3CLTD 1LFAA 1E6MA 2H3EA 2SICE 2FMUA 3THYB 1FUUA 4IILA 5JHHB 5ESDA 2NZVG 3M82A 5U9CA 2OZLB 3IA7A 1EE1A 2YQ4A 1UJ6A 2FEPA 2V7BA 3AR7A 4U6SA 2BZSA 4YAUA 4DV5B 4I1VA 4OQNA 5K8CA 4C7VA 2LCIA 2Q6OA 4UFPA 2FN3A 4POAA 4XFKA 3AEQA 3T3EA 2XNHA 2YN0A 2QTVB 2F8LA 2FX3A 4JJIA 3AFIA 4O4HA 4PBSA 2QN3A 3LWZA 5TB5A 3MPUA 3TQCA 2HHLA 5B4VA 2H57A 5ALMA 1A9XA 5GJVC 3BKXA 4C76A 1G6Q1 2YRXA 3L84A 3TSOA 2W4IA 3UXHA 5A4IS 1IOVA 5MFPA 5GMOA 5TVGA 3M1AA 3WLTA 4TTRA 2E4XA 2GM4A 4H0CA 1TZCA 4R2MA 3R9KA 4FPXA 5K6TA 3HO8A 1RLOA 5EGSA 2WLSA 3EZFA 3WGIA 1MZVA 4BV3A 3PGLA 2ZRHA 3GA7A 3SDBA 4ND8B 1HQCA 1LLQA 3C1OA 4RPJA 3PC7A 2HBQA 2QVXX 2VJPA 1T6YA 3FMGA 4CW7A 2I99A 2XT0A 5JANA 3A1EA 3IAAA 2XQVA 5M5BA 4RK4A 3Q8MA 4B7ZA 3HR7A 4U2GA 5AUNB 1KYXA 2IYNA 4OI0A 1ZKDA 1JJBA 1G8YA 3AEKA 1U7XA 3B51X 5L7TA 3JARA 2FA9A 2WTNA 4KQWA 3T7JA 2QW8A 3UB3A 3S81A 3IKLA 3LE8A 5BSWA 3AQ4A 3T7KA 5F3WB 2MSDB 2P1DA 4R98A 5CM2Z 2WV9A 2VCYA 4ZOQI 1B6TA 1MW8X 2WT9A 2ZP1A 4WI1A 3TW8B 5LWQA 2F55A 3M9XA 3S1LA 4NCKA 5CVUA 2R8OA 2WAAA 4EECA 1HDZA 1T0BA 1NF9A 4YLEA 2P2GA 2H52A 3D8UA 3KZMA 4HEHA 5EE9A 5JWHA 2XUFA 1BW9B 2G1UA 3GNQA 5CYGA 5I51A 1PDOA 2IQ5A 1JR6A 2Y93A 3NM4A 1YRYE 5LMUB 4KDCA 4I5DA 1TEXA 3JZIA 1PT6A 1ZH8A 4JWKA 5EFZA 1B8VA 1SKBA 5DXAA 3DKRA 3TVTA 4F96A 5F2NA 4X66B 1YRLA 2HT6A 3MMNA 2DPXA 4H6VA 4ID3A 4O4IF 1CZOA 2AFIB 3H65A 4ITVA 2CVOA 4HN9A 3OBBA 2P91A 4PW0A 1SUFA 2I6GA 1ZX1A 3HVHA 4IDDA 2XMBA 2C3UA 4RGVA 4YGXB 1MXFA 1QE5A 1VSBA 3K6JA 2I34A 3KKPA 3Q6IA 3FYCA 2G8NA 2C5BA 3QVJA 4O1IA 4B3IA 2PJRA 1QDEA 5EZ6B 3HXLA 3LA8A 4YRSA 4IEIA 2H00A 1C3OB 3WB9A 1U6KA 4I1IA 2W4QA 5CPBA 5U4XA 1BA3A 3KX2A 3F4LA 3TNLA 2DFVA 2VRNA 4JDUA 1R6VA 1VLZA 2GN4A 4NK4A 3R74A 4ZYLA 3MTBA 3ROGA 5B36A 4R1OA 4ARBA 1QVVA 4C6TA 1P0MA 1QNLA 2IOFA 4MDHA 1NJ1A 2ZXEA 5CVDA 3DM5A 3E9CA 3E3LA 4IEFB 5A2QA 4LDAA 1OPRA 2PUWA 4RQUA 1I3OA 1QOZA 3WWCA 3K8OE 5AK4A 3ZQ6A 2ASEA 5IJZA 3Q0TA 3NTRA 4BY9E 3V5NA 3HSSA 2BFBA 5HK8A 3F9RA 2VZLA 5LD2B 2YXEA 3BK7A 2J3IA 3ZYZA 1QBGA 4I99A 1G3MA 1QB8A 3EZGA 4AMBA 2BHNA 3H5NA 4F4IA 1FLAA 1RKBA 3N0RA 4TXHA 1H2EA 2FZGA 3PNBA 4Y2GA 5D5QA 5D7BA 4WCFC 1Z5NA 3X44A 3EPRA 1BOOA 1KKMA 1X7WA 4LZJA 5L95A 2H2GA 4MQ6A 1X1QA 3E5HA 1TFRA 3SGLA 3PEYA 1C1HA 1JKXA 1I30A 1WS6A 3SICE 2QROA 4N3GA 1WE2A 4GR9A 1JHQA 1EMDA 1GA1A 2I2BA 1GGKA 4B40A 2A1TS 1OXBB 1HKHA 3KJZA 4FUTA 4F84A 4W5NA 1Y80A 1XVUA 2Z6VA 1VTKA 1TCUA 1VB5A 1RKQA 2VPXA 1E20A 3HDQA 2CZQA 4JSYA 1TUIA 1QS0A 4RIGA 1Z0SA 2OHJA 3IBCA 3B5IA 3FCXA 4ON9A 4U1RA 3TFQA 1F9AA 1E6EA 4LMBA 3FD8A 1NSFA 3KJGA 4UJ3A 5BPFA 4LYAA 1GPDG 1SUIA 3GZJA 1V8DA 2PGJA 4GBMA 5JT1A 1ZWLA 1D2CA 2RHMA 3H4IA 3E61A 1Y5RA 2AH5A 3AFMA 4U4AA 2IIVA 3FUUA 4J75A 3KE8A 4M1QA 4NJMA 4NQRA 4YP5A 3FGNA 2CFIA 1K88A 2IWHA 3BZWA 2VDWA 2VSNA 3OCYA 5C2JB 2CMDA 1KWGA 3CX4A 2NXJA 1ECGA 4RFLA 3MQ4A 3UEOA 1GL9B 1DWQA 1OX5A 2RARA 3EVTA 4RJ2A 2OHHA 3UYKA 3ETDA 4YQEA 4ALMA 3JU3A 1H2YA 4UAVA 5H3LA 4OU5A 4PHHA 1FB5A 4WOJA 4NG4A 1S2LA 4M6WA 2QQGA 2RH5A 5ES3A 4BNLA 1JZTA 3JD4A 3ONNA 1DAFA 1QKJA 1XVTA 3BIJA 3K0EA 3P9PA 4YRDA 1I4OA 1Q1GA 3KT8A 5DV9A 5AUQA 1ZK0A 5BRNA 2E9SA 1BXRB 4PGGA 3U1BA 1IH8A 4ZQBA 3VHQA 3C98A 3N07A 1ZIYA 1YK1A 2Q5EA 4GZ5A 2FP4A 1HZZC 3PUWA 2JFZA 1PFVA 2RB4A 4G0OA 4B6SA 3D0OA 3HKEA 4M0MA 1PKEA 3MD0A 4RADA 4DDHA 3WIVA 1VBKA 1BMQA 2BFDA 1R15A 1V5EA 4KIUA 4KQ6A 4UU8A 5T4EA 3WGGA 4JJKA 2XT6A 3T6KA 1RQXA 2WY2D 2XE6A 3GRZA 4JVMA 2V3WA 4M36A 3TAHA 4DQLA 3QKUA 4DSAA 1WXEA 4HP8A 5ARCA 2NU9B 2J59A 1V8OA 2PFSA 1CUCA 2IHYA 4RLHA 2Q7DA 2NAPA 1LTHR 1WNFA 2XUPA 2F67A 3CINA 4GI1A 3TIXB 4ER6A 4L5BA 4QG3A 1S4MA 1DKUA 2G77B 2XQFA 2QG6A 3DL0A 3U62A 2JLQA 3DZJA 5DM60 3H3XA 4LFAB 3U0VA 4UUNA 3RS7A 4ED9A 1UJCA 2AOUB 2IUYA 2WWVD 4Q1DA 4QPDA 5EY5B 3UK1A 4YCSA 2XOKA 2N75A 5JVDB 4AUEA 1GPNA 1V48A 2DG2A 4IVPA 2O2HA 3BDVA 3M6UA 2XH8A 4P7GA 3ZKAA 4WK4B 4AYXA 3QW2A 2YVAA 4X65B 3DVSX 2JVJA 3I9OA 5FBLB 5FUMA 4UFOA 2FN7A 4A15A 1V45E 2C7VA 5JPCA 3CWCA 2WUEA 3OJFA 1BDIA 4MVYA 4UHHA 1WNTA 2JF0A 4I9FA 4B83A 4D26A 1VP9A 4H7JA 2JDID 4XUGB 4BNXA 4AJNA 1G21B 3TI9A 5AJHA 5EP2A 1C8VB 4AD8A 1ADJA 2JEZA 4FOOA 1V4NA 1VA5A 3VYUB 1KI6B 3AVQA 3RASA 4N6NA 4UKDA 4EG4A 2J32A 4ZEXA 2VT2A 3HCCA 1RZVA 3DNPA 3OQNA 4TN5A 1MOPA 1T9AA 1KJZA 2M6SA 3KB2A 4N3AA 5GPBA 2FDXA 2PTGA 1XELA 3K96A 1MOZA 2FWMX 2W2OA 4LSGA 1PEDA 3TTWA 5FO0A 2WUVA 1K7YA 3SSOA 4B4OA 3R76A 4ILKA 4EJ0A 3EWSA 2E89A 1SXJC 3VMMA 4G5SA 3B7PA 3JQQA 2Y9MB 3CLKA 3IL2A 1PT8A 4HCJA 1TMOA 3PNSA 4U6NA 3RFTA 3QF4A 2Q1UA 2QN9A 3FH0A 3GLGB 1FRFS 3IR6A 3U3OA 1EVYA 4UXHA 1PJLA 2I3ZA 2JANA 3E2MA 4ZOLB 5KU7A 4KAJA 3RARA 4YAKA 4HAVA 4BV8A 3ESXA 4XAQA 2RONA 3K9CA 1OFGA 5EZSA 2FJUA 4EK9A 4ZZ0A 2BHTA 3LUCA 4HXGA 1JG3A 3DG9A 4GE3A 4O2RA 3JS5A 4LF5B 4TS1A 1V1RA 3GARA 3IS3A 5TEVA 3ZGOA 2BFFA 1XEWY 2CGEA 3E8MA 3HY6A 4LWPA 1JJAA 1FZQA 5CYFA 5A03A 4I1UA 2NIPA 2D2VA 2YOFA 2RHRA 2TMGA 4CPDA 1V5WA 5JZSA 1Q7EA 4Q82A 5GGYA 4Q7JB 5DVZA 1ZG3A 3GEEA 5C3MA 4C0SA 2IHVA 3DTVD 3LUBA 3R4VA 2ZT8A 1Z34A 2VS1A 3N2IA 3GEHA 4GD3Q 4IZIA 3D3JA 3G2QA 1KMCA 3AILA 2ZULA 5J43A 1DAPA 1RJFA 2W6NA 2FX5A 4XJVA 1TAHA 2K6GA 4EW2A 1L0BA 3IOBA 3EMBA 3K73O 1I3CA 1A9QA 5B1HA 3NMUF 3TTUA 1AGXA 3TUZC 2GSWA 3GGDA 4JENA 2WG2A 5FFFA 5LLTA 4A7PA 1JU4A 2PZAA 3P8ZA 2NSHA 2EZ8A 4WADA 5F51A 4IDPA 4XVUA 3I9MA 5LLSA 1P81A 3S4YA 2QM0A 1DBIA 1ZD2P 3RH0A 1PLLA 1B0UA 2FUEA 2V6GA 1NSYA 1U90A 4R3UC 4UBJA 4AU1A 5CNJA 1TGYA 2ORED 1W8IA 3WWZA 1LFDB 3R7BA 4WCDA 2N1MA 4BYMA 2OECA 5F35A 2B7BA 3EFHA 1Z82A 2PV7A 2C5FA 2XUGA 3UGTA 1Z2NX 1Q0SA 2B8TA 2QY6A 4I81A 3SVLA 5HOQA 2ZUFA 4FFNA 5EUQB 4BGUA 1HNZB 5KSZA 4IDAA 4KB5A 2C84A 1N2JA 1VPTA 4IFEA 1NHGA 3D6HA 4LOIA 4ZAXA 4ETNA 2OBNA 4HGZA 2FDRA 2FMKA 4PTLA 4XWYA 4N3CA 1EGMB 3MXOA 1V8ZA 3SD7A 4RYDA 1MENA 1MNQA 3DNMA 4V0RA 1M34B 1PDWA 2QR2A 1SIWA 5K1ZA 2FEXA 2GFQA 1R12A 4FYPA 3U9TA 4CQMD 2V9PA 5JV5A 1UT8A 3OJLA 1PJTA 2JNWA 4NX2A 4QATA 3H5VA 1Z2AA 2RGNC 3B9RA 3ONEA 3IKMB 5JXHA 2FWJA 1TT7A 1P2FA 3FPCA 3X1KA 3HNPA 4B34A 1GXSB 2V65A 3LWDA 3NX4A 1D07A 2KPOA 3F1KA 4ZARA 4KR9A 1M66A 1AQIA 4IVQA 2Q5QA 3LT2A 4O0MA 3V3KA 3MIIA 4IYRA 3I30X 1H3NA 3PBKA 3LQ4A 1TQHA 4JYMA 4RE6A 3RO7A 2FAXA 1CVRA 3KQVA 3W6ZA 2GJ8A 3L79A 3JY6A 4PPQA 4G6ZA 4N8DA 1UWKA 4K46A 3NBKA 1DRJA 3ZCTA 5IBQA 4RA6B 4W9RA 2XWQA 1KEUA 3AUTA 3HBMA 1KP3A 1O0SA 2IHBA 1XRPA 2ZI7A 3RHSA 2I6QA 3TZHA 1DCTA 4S1VA 1JR3A 2CMGA 1VLMA 3BGDA 4NPHA 1GRCA 1S9HA 1WULS 2V7QA 2JI7A 3VAYA 3QYFA 3ZLVA 1UBOS 4COOA 2WVGA 4Y6PA 4ILEA 4FW8A 5BW4A 3ZV5A 4X1OA 2PSJA 5AKZA 4E5NA 2EJCA 2QL9A 3N76A 2BGTA 1Y8ZA 3KVNA 5F9MA 3BJIC 3PITA 1R5OA 3NRBA 2JS7A 2HJWA 3GIDA 3KCQA 2MYUA 1NBMA 2PTHA 2XRFA 2ZTSA 2AWNA 3LLCA 2OP0A 4IDBA 4BCDA 4ZCPA 3ZWOA 2EKBA 2PXXA 2C92A 3GH1A 5J2UA 5AVYA 3LHFA 5LZ2A 3IB3A 2GK6A 3HYRA 4CDMA 1HT2E 1FNSA 4R51A 2P2DA 1I3MA 2BKUA 4RK0A 3UMJA 5INTA 1DX9A 2B4RO 4UVIA 2AHRA 1LSUA 3I64A 2X1VA 3WKDA 4X63A 1CY8A 3DE0X 4BAZA 5C8XA 3SDSA 3P2IA 2CJFA 3MMSA 3MGCA 3KSZO 3WNVA 1UXHA 4ER0A 4KE9A 5ERGB 2XKJE 3K9BA 4BX8A 1USGA 1XC7A 4UNIA 2ZR7A 4L0MA 1OI7A 3RSLA 1HYQA 1M2NA 1B43A 1OLXA 1YR3A 2OCBA 2OQRA 2FSGA 2RJ3A 3FNFA 3GBVA 3OPYI 4RJKA 4YAFA 1QK4A 2I66A 1W1UA 3QWBA 3CLRC 4K6MA 1ZU4A 3WSVA 4OHFA 4BB9A 2GTPA 2VP9A 1MO2A 1G2PA 4CTOA 1MLDA 3O92A 4YMLA 3A6HA 5LQKA 4GDMA 3ZWMA 3IO3A 4N7JA 4AX4A 1ZVVA 3MWGA 1PZGA 1WQ1R 1JKMA 2O8DA 2AEMA 4RIEA 1H66A 1A72A 3LL7A 4TXJA 2GRAA 5CB4B 1KBZA 3ELYA 4OQQA 4LZOA 3ZK7A 5JNSA 2BCJQ 4E2XA 5LXTF 3NUGA 2HBRA 1H69A 3BA1A 4K1XA 3S0JA 2PMEA 3C8HA 3H1TA 1SWWA 2AN5A 3ZPXA 4WFQA 4DAEA 4Q4HB 4QUAA 5ELMA 2HDWA 4BX9A 5J58A 4AKGA 3NKFA 2HU5A 3W2EA 1NLZA 1RWWA 3AP2A 1YMVA 4YDRA 1JG4A 4FWBA 1UP6A 1IHPA 2P0AA 1HLGA 5KINB 1PNQA 3AW9A 3HPQA 5ABPA 1Q7BA 2G5TA 1KAHA 4MRVA 4OIMA 4NMMA 4DKJA 3DDSA 4CUZA 3EWNA 2WWTA 2ZTHA 4MRMA 1OY1A 4BQOA 1JECA 1XQVA 2GT1A 2FUNB 1DHTA 4QYWA 1GU0A 1T4CA 2JCSA 1N0WA 1NXVA 2PL1A 2YJ5A 1F2TB 4ZCSA 3LXMA 2LCQA 5CB0A 1Z5UA 1DU4A 3ZGZA 1XL1A 1Z75A 3OM1A 4UD6A 4A9AA 2W7TA 1N5JA 3P20A 3BXGA 4LPKA 1SM4A 4JC4A 4EVSA 5BSGA 1XXLA 5BQXA 4KX5A 2ZLBA 1XZJA 1DWPA 1W7AA 1EVQA 1W1IA 4YFYA 2VTBA 2IWRA 4KIFA 2VQ6A 2QLFA 3TX2A 3KWLA 2QJTA 3B2QA 3GA5A 5CTJA 1QH1B 3P5BA 1D0SA 1CQPA 3OA0A 1JYSA 4DIUA 1EFRD 1MEJA 3DVAB 4J9UE 4QNNA 4GMGA 5DIFA 4A16A 3JRWA 3FIJA 3I58A 4FGZA 1LDBA 1PWEA 1ECCA 4WW0A 3WG9A 5IVKA 1RRMA 1RLUA 1X7GA 3QMVA 4NOMA 3OLZA 5SYNA 2ZUDA 4EHKA 4NBRA 4CLHA 2PX0A 3ZD6A 5KQSA 3HU3A 5J4LA 3LW7A 2JBAA 1H42A 4C3OB 1CZRA 1JQBA 4OJNA 3NGLA 2RFLA 2Z9DA 3MB8A 2YY6A 3T9BA 2GPWA 2QTWB 4HRYA 5SV2A 2P6OA 1JEDA 4MIYA 4BDSA 2VBIA 5FBKA 3X0DA 2OLKA 4C0QC 1Z6QA 4MYHA 5BURA 2NNWB 4RL6A 5ALQA 3TBKA 4KQKA 2RH8A 3PR1A 1O58A 5G4LA 3VNSA 4EY5A 3I6BA 3RKUA 4GYKA 2CK3D 2I87A 2WRZA 1ZONA 3BL8A 4WUVA 2W6PA 4GE0A 4TV9B 3C16C 3INYA 5FBZA 5KJ1A 1DUVG 1ZVKA 3DUFA 1GARA 2H59A 2P90A 4K0RA 2AB0A 3GJQA 2J67A 1KZHA 3RYIB 5IX8A 3RC2A 3AYZB 4HSEA 1SD2A 1LK0A 1QCYA 4HMOA 2E3JA 3UV7A 2E48A 2X0DA 4XWOA 3CKKA 5ALEA 4Q4JA 1L5VA 4J07A 4BVLA 2H2AA 4JIMA 2OT3B 1EAYA 1PIWA 4P5DA 3RUFA 3HYCA 1D9XA 1Q0RA 5FB3A 3C3WA 4WFJA 5TGTA 4D9HA 5EKXA 5HUQA 5HBGA 4KREA 4HWTA 1XXHA 1OPXA 2HCFA 1EBFA 3C5HA 2Z5FA 4EO4A 2D59A 1ILEA 3L6OO 3CX7A 2OMKA 3CN7A 5FBRB 4ZKDA 5DHSA 1SHLA 2FI1A 2ZJ1A 5HF8A 4C7JA 1DG9A 5KX5F 3UO8B 3BMQB 4LYFA 3BGOS 1OAKA 4UM9B 3V7FA 4ARZB 1E64A 1CQIA 1WABA 3K0AB 5LP6B 1RCTE 1B7GO 3OJEA 6CHYA 4OUDA 4LWOA 2ISQA 3L8MA 5AVVA 5HIIA 4KWTA 2CNLA 2Q0HA 4GI7A 2DRIA 2X5KO 4TQ9A 3N7UA 2VA8A 3EC2A 2Q8NA 3G2OA 4CT0A 1E6UA 3QYPA 1XRMA 1CJVC 3VO2A 2J0UA 2GXAA 2ZQ5A 2O48X 4UAGA 2VZ9A 1V8BA 4OGKA 3LXXA 3TB4A 2JJQA 3H2JA 3S3TA 1GNLA 1E1QD 1LCIA 2NXWA 3WC4A 1Q0PA 1JJ7A 3PSHA 3WYNA 4PHCA 4KNYA 2HWWA 4AMZA 5A2GA 3OCUA 3VYTB 3IUQA 3LPMA 4Z99A 5JW6A 2GS9A 3S1AA 3BQ9A 3N6VA 3KYDA 3NHBA 4V24A 1OA0A 3BJRA 3V4OA 5EXPA 4Y2HA 3KKOA 4LHEA 3TKAA 1JH8A 3IH5A 3IIMA 1R4MB 1FRZA 2Q2NA 4V1CI 1F12A 2VQEB 1E7SA 1M2VA 1VI5A 3O74A 5HRAA 2B61A 1UZAA 2A84A 2VLIA 5EJ8A 1KH2A 2F3RA 1BVHA 4ND1A 4QDTA 2YZ2A 3CR7A 1ZI8A 4ZIRB 4Q15A 5KNBD 4XTCS 5BVGA 2BF4A 3S5UA 2ONYA 5CIYA 3H2SA 3RC8A 5KTKA 2IKSA 1HNXB 3W3ZB 1GTL1 1EK2A 2ZI5A 4WJLA 1JS1X 4FEYA 2D1YA 4TXMA 4EJMA 4QQFA 2QN1A 1ZWKA 7MHTA 5IM4A 5HFJA 6Q21A 1J09A 1ZIXA 5L53A 3KPWA 1DLJA 1QZXA 3UFXB 1QJCA 4LDZA 5D51S 2VDQB 3PK0A 3HCOA 4LZNA 2FH5B 2NVBA 3QXXA 4KACA 3G0OA 4INOA 3H18A 1DKMA 3ONFA 4N7RA 3T7SA 4ZN6A 6AT1A 3AK4A 3FTFA 1XTZA 3CX8A 1M2OA 2FR8C 2J9XB 2R3SA 3R6LA 1ID1A 3D0KA 1TM3E 4F1JA 4PBTA 5C0OE 1G8GA 3THWB 1NI5A 3A7EA 4EFMA 3EAGA 1SC6A 1RLMA 1YRHA 3H16A 4HQFA 1EFAA 4JQOA 4F4UA 1CRPA 4GX0A 1F0PA 2VP2A 3QPDA 4FGSA 3CCFA 4DL9A 1RYYA 1HKUA 1S96A 3AR2A 3IPAA 5JXGA 3GJ5A 4MW4A 4FYJA 3OZBA 1HLDA 3JASA 4RZQA 5BV8A 1VKZA 1AZTA 5J5VA 5JPDA 3UJNA 4EMSA 3FOEC 2C9YA 2QI9C 3SMVA 5DBGA 3OIGA 4ZGGA 2ZJYA 3CA8A 1J24A 1TRHA 4PWYA 1AZWA 3HU5A 4H35A 4L2IA 2R6ZA 1GSAA 1EE9A 1D2NA 1PWZA 3PJGA 4PANA 3IIKA 3DEAA 2NO1A 2W2KB 3R09A 3TSWA 2LD4A 3ZHQA 3AW8A 1I7QB 4J4HA 1LPMA 2ISCA 4X85A 4RMHA 4BCCA 4CMIA 5DH9A 1JE1A 1NW3A 1Y8AA 5IUJC 2EQ5A 2A86A 4KMOA 3FVWA 3AI3A 3E9NA 1GNRA 2ZAIA 3FIUA 1WY5A 3GR6A 3M9LA 2IYUA 4LZLA 1CQJB 3GQBA 1L7PA 4OOFA 1FJXA 4LRSB 3TR0A 1T2CA 4FJ1A 2JGLA 3O3CA 4G8JA 4QDUA 3VPBA 5BNZA 4MJ7A 2VK1A 2ZJ7A 3OLWA 2DHQA 3QA3E 3BGVA 4K9QA 1GYQA 4DBVO 4OHBA 1D2EA 4B73A 4O4LF 1YZ3A 4OEHA 1JXOA 1U3UA 2BFEB 2I3DA 5D7NA 1OH7A 3ZBQA 4AO7A 3OM0A 2FR0A 1EWKA 1PR9A 3WLQA 1RC0A 1QF6A 1KBQA 4MVJM 3TOVA 4DNPA 1F48A 3QXSA 2P3SA 1WVGA 3SMQA 5KJFA 2O5VA 3RU7A 3LC7O 1L9KA 4Q03A 3VGJA 3ZCUA 4K6HA 1K2VN 4DG8A 4GOND 2QTZA 3PUJA 5EIBD 2F3PA 3EVDA 3RTEA 2BCGY 1DKLA 3NHFA 1H2AS 1QGED 4CU5A 3ZDZB 2NTYC 3K5PA 4X20A 4JIGA 2W22A 1GYPA 4IKOA 2JCXA 1ABBA 1JTEA 1WZIA 1NWHA 2AD1A 2NO7A 2Y6VA 3CZ9A 3GT0A 1OI3A 3R7WA 4BFLA 1EUDB 3IMFA 5DMXA 5BSKA 1U8EA 1M10A 4PFKA 5CW1A 4CWAA 1X3SA 2VCEA 3V9AA 5IS2A 4MQEA 1CZLA 4CKBB 3COPA 2J3LA 1VE3A 2ZYWX 2QZ9A 1K86A 4WOKA 4X3CA 1EUCB 4J76A 5JFTA 4NNOA 1EINA 4NP6A 5IVDA 2PUEA 1LBTA 4TWZA 3GBPA 3NH6A 1AIPA 4IOLA 3SVTA 1U63A 1V37A 1KQ3A 3EIQA 3A4YA 1UDWA 3MW8A 2XCSB 4IOJA 4FZJA 2OA0A 4I4NA 1IQ0A 3OIWA 4HXFB 4N12A 1G6HA 2NYAA 3IAM1 4DN6A 2WJJA 2MDTA 3FYUB 2YMMA 3WMWA 3KETA 4TM8A 2FRDC 1XZFA 4WBNA 3EFBA 4NZYA 4EF5A 2AKEA 2INGX 3GRKA 4R5MA 1EYZA 5CH8A 1Q7CA 2Z3WA 2BUCA 2W2XA 4DKXA 1AKWA 3GDGA 3PIDA 1RRFA 1ADCA 1M6NA 3QEAZ 2QNIA 3PU6A 4NAHA 3I37X 4YBZA 1I9GA 2FZCA 4G1EB 2EJBA 4GXQA 1IVYA 4UTVA 1F0YA 3V1NA 4B6JA 4DSNA 2P4HX 4GWGA 3ZWWA 3OLXA 4LVNA 4KAFA 3WWDA 1WUJS 4IOKA 5CFLA 4H15A 3GJZA 1SVKA 2V5AA 4R40A 5FUQA 1QGYA 1XNRB 1QGAA 2O5EA 4CV0A 4Q05A 4IFTA 2ILTA 4QULA 3W6UA 2UZIR 5REQB 5A5DA 5LQAA 1XEXB 1XVVA 2PN1A 4UEOA 2BL4A 5DHQA 4DYVA 3FZQA 3L6UA 1B3RA 5DEIA 1VYUA 3GPBA 3PPVA 2H9AA 1VBFA 2FQWA 3KR1A 4FUQA 3G8YA 2XNCA 4ITRC 1X8JA 2QLJA 3JTMA 4H3VA 4A26A 3VKGA 4A0QA 2XTNA 3R41A 1B73A 1OYYA 2O2ZA 3MJFA 3RFVA 3ZWQA 2Q1SA 4FZVA 2BH9A 3NJRA 2CF6A 4UTOA 3WNZA 1RWPA 4PAGA 2JFUA 2C9DA 2VQDA 1QWSA 2ZKLA 4MS1B 4Q4LA 4GLBA 1ZUHA 5FLXA 1W87A 3UZUA 1QQAA 3NS7A 2L19A 1LPBB 1LDYA 4RVNA 5F77A 3DOCA 2IHZA 3VSBA 4I50F 4LZAA 3KZ1E 1W0JA 5GM2A 3UWDA 1SHKA 1F9EA 2RGRA 2WJIA 1M7BA 4N49A 4DA8A 4RXUA 3NXSA 4HX2A 1Z28A 3C87A 5BWBA 4WKCA 1ZW6A 2DTDA 1QX4A 1YBVA 1W8DA 4O2AB 2IX9A 2CNWD 4JR2A 5EZQA 2GTHA 4HQOA 3RYFB 5DOVA 5LUAA 2CDAA 3BFXA 5DNUA 1OD6A 1SQSA 2ZJAA 2V3VA 3KU1A 2CDBA 3TO5A 3W2IA 2VJDA 2BGGA 4FFDA 4FHFA 4MKHA 3QKSA 4MV7A 1UIMA 2QT9A 2ZU0C 3DA8A 1Z0ZA 2FQXA 3VR5A 4KFCA 2AL7A 1FLDA 2KLBA 2R4TA 1SCKA 3AF6A 2IYFA 3T38A 2BGIA 1GN9A 4B8ZA 1JHVA 2X9QA 4KE6A 3VZSA 4XQEA 1XLTA 1A8HA 3S27A 3LLMA 1IXSB 5K05A 2C4WA 3CB4A 3OUTA 4LBWA 3DPUA 2GCIA 2Q49A 3LD9A 3OOWA 1Y42X 5EYPA 5HZHA 2UUBB 1D5WA 3T3GA 3FUXA 4I0WB 4K6OA 3TNFA 1LWOA 1X80B 4R1SA 4IF6A 1P1CA 4AFNA 3TBHA 4FWIB 4BN5A 3PX7A 3PWZA 3GDHA 1BH2A 1R9NA 1U1GA 2DQSA 4N9QA 3JQBC 4UEJA 1V7QA 1N1GA 3I76A 4GSYA 5JG7A 4RK5A 3ROFA 5E6SA 2EWMA 4G5XA 1N57A 5K20A 3O2SB 1U6JA 4C7BA 4MQBA 5AKHA 4DIMA 2QOEA 3TECE 2ODNA 2J45A 2O2EA 4WVLA 5DP2A 1NVFA 3RGGA 2PANA 5DM1A 1RRPA 3AGPA 1DQRA 1R7RA 4ZOBA 1CEYA 1SXGA 1HT0A 3A26A 3DC2A 821PA 1NE2A 2DPLA 2W8ZA 2HU2A 1H9CA 3NATA 4AZSA 2P1ZA 1PQYA 1E2KA 1LLDA 2CCJA 3EG9B 4YWJA 2BTQB 4KSCA 1OAOA 1D03A 2AI2A 3MM4A 1D1PA 1GKKA 1EFKA 1QHGA 5ALVA 1YULA 1OLUB 3MWFA 3EGXA 2A35A 4M8SA 4NV3A 3GCXA 1K8RA 1DELA 3X2SA 5HKLA 1DEKA 4RVSA 4RS4A 1G3IA 2G8LA 4DC1A 2GARA 3NDRA 1Y8QB 1C9NA 1JQLB 2P75A 4LN1A 4WDRA 3BWXA 3PDWA 3FZEA 4DEYA 3DT8A 3GWGA 4QOIA 4EDHA 3QVGA 4YQFA 4MQLA 4F93B 4Y1FA 2DERA 5JWOA 2VYVA 3QWFA 4HQ6A 4C89A 3ZDBA 5IKXA 4YROA 1OFIA 1ONNA 5TPWA 3EIHA 3HCDA 4Y30A 1SC4A 4OHUA 2IEYA 4NDZA 1FXSA 3RIYA 4LYYA 2E18A 4I66A 1ZZEA 4N5LA 4J16C 2FQ1A 3A3OA 2JAXA 1KZ4A 1X1BA 3WO1A 2PE5A 2WWWA 1XZ8A 4FZ5A 4MV5A 3M1YA 1UKBA 1NFRA 2WFLB 1GZDA 3BAZA 2Q2QA 1K4KA 4R8KA 2V7GA 1TVKA 3D7SA 1A77A 2GR9A 2EWVA 4J8PA 4C4PA 5HXAA 4XOIA 4BFCA 4EJFA 1O95C 2NU8B 4Z53A 4MVXA 1U0JA 2P3QA 5IMBA 3W2GA 4D74A 1XNHA 5ED0A 4F3KA 3NWBA 1Q3HA 4R1PA 1MIHA 1UDAA 5HCUA 2B35A 1CY1A 4NCAA 2TMDA 2H2WA 4EA6A 4DMUB 4PZLA 1RRKA 5JCOC 3EDCA 3AKDA 2WABA 1H4VB 2R84A 5H02A 4WKPA 2P9JA 4WFIA 1C7JA 1Q19A 1ZM3A 3KJHA 5DX1A 1DJMA 1JLMA 1IUOA 3DMHA 2WDPA 2HSGA 1NYTA 2RK3A 2WF9A 1DRKA 4LEIA 2EJWA 3MINB 4REMA 1IG3A 5CB6A 3ZVKA 1M8JA 2HYIC 4KXNA 3EB9A 1Z5ZA 4BEBA 3AHCA 3CEHA 3BSYA 4BV9A 3SS8A 3ZDCA 3OICA 4WK2B 4AP9A 1HPLA 1KKUA 2H06A 4P34A 1N2ZA 3QJGA 4FQ7A 4OY3A 3D3EA 1UK9A 2X7XA 3P2OA 2A5DA 1XMXA 5D3MB 3MRXA 3R7SA 4BVJA 3JVVA 1Q0HA 3SQDA 1GTG1 3G9UA 3P4UA 4C03A 5HOEA 1TM4E 3BFVA 3WB0A 1TZJA 4B0OA 2GJKA 4JR1A 1AQUA 3EDOA 3MOSA 5EI5A 3FOFC 4F8EA 5K0ZA 2WLTA 3WLRA 2F8TA 5ERYA 3OLQA 2NO4A 2RHTA 2ZRGA 4IMPA 5CLJA 2CBZA 4Y2TA 2WSSA 3DF9A 3H83A 1A98A 4FFLA 1CQWA 5D2CA 4FOTA 3HBJA 3ACDA 1U8ZA 4JZKA 3THRA 1KBOA 1DC4A 1U04A 1KXZA 2XECA 4HC4A 2YR0A 3GAMA 1N2IA 4X0EA 3EXAA 4JHXA 1ZUWA 2NYUA 3A0UA 2QJFA 5LZ8A 2R8EA 4BCBA 2IPOA 1Z5PA 3KHTA 4PG8A 1TLTA 4UVDA 2M6KA 4DUGD 9ATCA 3GT4A 1ND5A 4C1NA 4LF7B 2WIDA 1KJ9A 2R8PA 3OI7A 4GXRA 1OKKD 1N33B 2EHDA 2O8EA 4YJ3B 3TD6A 1CUEA 3IAS1 4BNHA 3K6SB 3BHMA 3EOAI 1FFEA 3G2IA 3WNQA 1DQNA 1ODCA 1JTFA 4HZUA 2MOKA 2C31A 4D4KA 1LS6A 4LS3A 3AL2A 2OWDA 1A76A 2OGSA 5T7BA 2GZ1A 4HHEA 3UJ8A 3ZVRA 4LY0A 5C9ZA 1U7OA 4MI1A 5FA5A 4YC7A 3O4FA 1NWCA 1J70A 3ZWYA 1ADFA 3CLUC 4JFRA 4KBFA 3ZUGA 2HDNB 4AKEA 2PPVA 2IGTA 1RZUA 3D8SA 4JL6A 4BWYA 4IR7A 2C42A 2B36A 4RHEA 3V8NA 1IVSA 2WJ4A 2WPNA 2AFIE 3VR6H 3ZDRA 1FDVA 1FJHA 1JW9B 2AVNA 2BGKA 4DLPA 4Y2XA 1PEYA 3N86A 4OBXA 3PYLA 3EQ7A 1EQUA 2YZKA 3OHPA 1TLFA 4WJZA 5KUTA 5JO9A 2IS6A 3CLTC 1WZEA 4AJ4A 3ANTA 4CV3A 1RAGA 3AOEC 3FNIA 1DIRA 1AKQA 1MB4A 4Y6QA 3W34A 3IP1A 4JI3B 3Q7IA 2FZWA 2E55A 3MAAC 3PQDA 4QPNA 4AJEA 3IEMA 3KQNA 1WX1A 3U4QA 2R1UA 4OQLA 3HHEA 2VNSA 2QP9X 3FRIA 4BNMA 4LHWA 4DWVA 1XPOA 4OGWA 4KO1S 3VC7A 2QW0X 5A4AA 1L4UA 5EJ6A 5J4KA 3QKWA 1ZR2A 4X1IB 4D79A 4RMJA 2FLVA 3IPYA 2YJ6A 3SXPA 5CA1A 3BXPA 4DC9A 3IUEA 4UVEA 1EVIA 1X1EA 4RKRA 1X7XA 4MUMA 4C9BA 1HQYE 1T24A 5FOVA 2BSQA 4NFYA 1EHYA 1W76A 3R7LA 1U0RA 3KOYA 3L04A 4OMUA 4DA9A 3P4XA 2XLCA 5B30A 2C4NA 1IUNA 4G5YA 3AB3A 4K86A 2R1ZA 4EJSC 1QR6A 1Q0QA 5EHGA 1N3IA 1Y1KE 4YRQA 3RWMB 3ZWVA 2W2TA 4AS1A 3QQPA 3NLLA 1FUEA 2FV8A 2Q3LA 2LKCA 1GFZA 2XMSA 5HUHA 5JS6A 1A9PA 3DV0A 2QW1A 3GD5A 3UHOA 4O2BA 1Q7TA 1SOAA 2REQA 3M3HA 3EHEA 3U7FB 4BIMA 3ZS8A 4CIWA 1NR1A 1PVVA 2JK1A 3DYBA 3ZCRA 4OQXA 1MF7A 3N2KB 4ENUA 3C7AA 1PWYE 1Y8RB 2OV6A 3OZSA 3O1LA 1HBJA 1LPNA 1P72A 3N58A 5HMLA 1K66A 2NZUG 3CIOA 3O8OA 4DR1B 3KXDA 5HDBB 4IV5A 3INRA 3K9NA 5K3FB 3V9PA 2AN1A 3HG7A 2QVZX 3HZRA 4PYQA 1LD3A 4J03A 1FRNA 1W44A 4DS3A 2FSPA 1UT5A 1NU8A 2BI7A 2DE0X 2NU7A 3DLIA 1QV9A 4ONEA 5GTDA 1ORWA 3EPJA 3B36A 2HL6A 4LOLA 5JJIA 4Z49A 1GA4A 1BU8A 1WXWA 4N0QA 4B2IA 2YINC 1P7PA 2DWOA 5FTWA 5AK6A 2O1EA 4B17A 5BRAA 2I2AA 2NTEA 3NNNA 3UG7A 2XBLA 2DPGA 5F23A 1YBMA 3FPHA 2BBWA 4FILA 3V2IA 3GL9A 4XWWA 4IF4A 2DETA 3CEAA 3QPWA 4IDFA 1H05A 2EYUA 3GVCA 3CGGA 3HUEA 4HLCA 3T94A 1A8QA 1G2OA 1MT3A 1O4WA 3FYSA 2OBXA 1S1MA 4AJLA 1P6XA 3AJ9A 3FPJA 3LP8A 4ZQCB 3UC9A 1GRQA 3ZCSA 4ZDIA 3OECA 4EB6A 3PCTA 4Z9XA 3GRCA 4C0HA 1GGMA 1P75A 4GDFA 3R9WA 4NYJQ 3X3HA 4EPYA 1QCDA 1WPQA 3ZWXA 5J2UF 3D2BA 2UZAA 4J9VA 3GLQA 3I3SR 1J2UA 3P96A 1ZGGA 2EOAA 2WNSA 3T3OA 2C54A 3GV0A 4Q5IA 1GTSA 1U7UA 1CUZA 3DAOA 4IIVA 2X86A 5EWLA 1E7WA 5E9WA 2QE7D 3AHFA 5JYBA 4ZTZB 1FZTA 3GRVA 5EE1A 3MTIA 3G85A 3TR5A 1VJGA 1UWLA 1OROA 3G5UA 3F78A 4UHKA 3ZW7A 1GZ4A 2XUJA 4AO6A 1P9WA 3WIUA 4KV7A 3LRTA 4Y9TA 1E2HA 3KLPX 2Q1YA 4IRMA 2B4QA 3DOHA 4ND4A 4ZALA 3UM9A 4A6XA 3PGJA 4TKVA 1TKCA 1Y4DE 2VBCA 3UOWA 1MEOA 4ZO7A 1VIAA 3FWYA 3ML1A 1IK4A 3HYTA 4BAGA 3MGAA 3T7IA 3T7AA 3B6IA 3U5TA 1N32B 3FZGA 5H5JA 4FS3A 1R0XA 1T8PA 1YJCA 1T5TA 2W48A 3N7AA 5AXCA 1TK3A 2IYXA 1NI4B 3QXGA 3HTXA 2B4TO 3UBTA 2EBFX 1WW3A 3JSXA 4ZDWA 3TIGA 5GIOE 4KPUA 5FLKA 3DDNA 4OHXA 4MRPA 2X8JA 3OZEA 1IQRA 1SXHA 3DLPX 4HBGA 4I9GA 5AVXA 3CVYA 1ZJYA 2B6HA 5HF9A 3KL4A 2OBFA 1X92A 1NJ2A 3DH0A 4XIGS 4YONB 3BK2A 2P8SA 1VHDA 1KDYA 3EXFB 3WHLA 3WMXA 1XDBA 3FCSB 3UCEA 1YNSA 3MAJA 2OGTA 3QF7A 1NDUA 1VJRA 4XR4A 1JDJA 1RLIA 4CKZA 1FMFA 5AHOA 1JIQA 1C7RA 1B1CA 2RHBA 4GG1A 3VV3A 3UOAB 4BKQA 2OB1A 3Q8KA 1L4EA 4YMIA 4J7CA 4CNBA 2BBTA 3RVBA 3TL2A 3GH3A 5AVUA 3GZ4A 3V97A 1AKVA 3DXFA 3UF0A 2LIPA 4N5DA 4HN4B 2YVUA 2BEWA 3V48A 1BOFA 1C0EA 2AXQA 2P2NA 2QPLA 5JZVA 3Q8LA 1SC9A 2WHPA 2F43B 4F3YA 5B7GA 1ZGHA 3NDBB 3JARB 4EY7A 3ESBA 3F7OA 3OZFA 4Q1EA 3BGSA 1SOWA 3SIRA 2PKQO 5AXBA 1N9KA 3CO5A 4IHJA 4F56A 4TLMB 4X1KB 4YN3A 2ATVA 1U0BB 4RJJA 5JMOA 1NW7A 3GPIA 4WE3A 1RIIA 2YDYA 1G20A 3SC2A 1KEVA 4EKGA 3K0SA 1T5OA 2GI4A 4V0OA 1VSTA 3CCCA 2Q0XA 2Y0PA 1Q1AA 3HA2A 4UNRA 5ALHA 1QYXA 2AF3C 2IY7A 2VXBA 4HNSA 1RJGA 3DVRX 3L1VA 2QD2A 4PRKA 5ADVA 3LKVA 2PNJA 4DREA 2VYND 1GAJA 5EWMA 3NANA 4ICIA 1TCBA 4GNKA 3B8HA 1OX4B 4TKLA 2IU4A 3O1HB 4LSWA 4MGZR 2V8BA 3BBPA 3FTEA 1T3GA 2NMVA 3CEJA 5A04A 3PQEA 1JHUA 3PXXA 1R6TA 2HF8A 2RC6A 2WKSA 4GKJB 1LBSA 4P81A 1NVAA 2BMWA 2GVNA 3EDYA 4QGAA 1RXYA 2YFQA 2C2MA 2HHAA 4X64B 4ALKA 4E22A 3LY7A 5AW3A 1HTWA 1SQ6A 3OBIA 3I9V1 5BPHA 5AQEA 3CGWA 4R1TA 3EF0A 1VYHA 3LQFA 3O0TA 2YZ7A 3GQVA 3IEUA 4TS3A 2ZYAA 4TWIA 1YS2X 2QYSA 4YRKA 1QUEA 1YQWA 3RNOA 1IXRC 3CZPA 4FLMA 1FTNA 3R6TA 2XZLA 5EPOA 1LJLA 4DYDA 1IOLA 5B2EA 5G3YA 5KVAA 1TZBA 2WTEA 5KOYA 1I24A 5DGXA 4LJ9A 1PGJA 1E1YA 3QOFA 2PEZA 3ES9A 3FLMA 2WD7A 3ZJUA 4LSZA 4C6TB 1AGRA 2CSXA 5JARA 4GGMX 4DRYA 5EXDA 3C5WP 3OTOB 2R9VA 4D96A 4F4JA 5I4IA 2HFKA 4X54A 1TRKA 1E4OA 3OOSA 4DGSA 1E2JA 4MUGA 3MGKA 3LY5A 4UW9A 4W8GA 5EMMA 1ORDA 1E1RA 1RI3A 4X8HA 4CCYA 4DMLA 1RXVA 2K4MA 1D0VA 4YT5A 1KAOA 4W7SA 5IM5A 5C8DA 3PHLA 4Q9JA 4MEJA 3OKCA 3ANLA 4PRYA 1VRVA 3AF1A 3AUXA 1K8XB 4GOJA 5DYYA 4CG0A 1AM4D 4FNGA 4M1YA 3ZE1B 4EMBA 3GDWA 5DGDA 2AZXA 1BCSB 1M34E 3AF0A 3OKFA 4XCXA 1T6XA 5EXXA 5D1NA 4BLPA 5A4JA 4BFWA 2OCPA 3BFKA 4EGQA 4JASB 1TQ8A 2I65A 4BE7B 3IAS6 4XPIB 3FUVA 1OT5A 4MS4B 5EJAA 4UCQA 5BN4A 4PZYA 3SFZA 1ECBA 2YIDA 4YV1A 1REQA 4IOMA 3ILSA 3FROA 2ASVA 3O6VA 3F5SA 2DXIA 1JFRA 1QRAA 2FWNA 3A6ZA 1NA5A 3AJ8A 3TLBA 5K0NA 5JZBA 3LY8A 5GADl 1QYDA 2BGLA 4LDQA 4YO8A 3CHYA 2FEWB 1JHRA 4UE2A 4QGFA 2WV7A 4RZHA 2ZUCA 4HDMA 2IYAA 3CT4A 1PDVA 2ZJZA 3ER6A 3MLEA 3NIFB 5DNEA 3SSMA 4BNIA 3MFQA 2HOQA 2EV9A 1RM5A 1V7PC 5FOTA 1XLWA 1FLNA 3SZUA 3G9ZA 4FI3F 3G59A 1ZN8A 5EZYF 3EA4A 4ISBA 5C80A 3G3EA 5JH7A 5KC8A 3GU3A 4KR7A 1LVHA 4FKBA 4MMYB 1QFJA 1TDJA 4ND7A 1ACMA 3GFGA 1MBZA 1J7KA 1RXUA 1XZBA 3PHBE 1FP1D 2PUCA 1QQ6A 3T1NA 3ITKA 3L7DA 2PUVA 3KAPA 2FWAA 1OFHA 2FP4B 4D3SA 3ZHRA 3VOTA 3HKEB 1FTYA 1NXWA 1CW2B 3WWYA 2XDAA 1WZ2A 3KTDA 3UT6A 4F9EA 3TZQA 4EG8A 4A0GA 1WVMA 2H3HA 1AMUA 4LRUA 2HPHA 2ZIVB 3UPDA 1F4LA 2C7PA 1LK5A 2HKIA 3IOMA 1BXGB 5IBRA 1XNGA 3B12A 3NBUA 4ZODA 5BQOA 4G1CA 1U1DA 3R9IA 5K01A 5HKOA 5LVAA 5B58C 5H1YA 1MNAA 4AJIA 4U2EA 4UC0A 4DBZA 4DLXA 3QG1A 3W8EA 4C21A 5IBCA 4JJGA 1JDBC 5LN1A 1QIGA 2WWFA 4ARAA 5HCNA 1YUMA 4K6FA 4HTFA 4PGAA 1W34A 5IKMA 1SCBA 3ADOA 1JKJA 1N4AA 1NMSA 1PJ2A 4L8FA 5CFQA 2P8JA 3LBHA 3O2QB 4ZYZA 4DLYA 3QVXA 1Y9ZA 5FX2A 1UBRS 1EX1A 1LI7A 1DFGA 2L0XA 1D2RA 3AB7A 2F1RA 5KS2A 1S8NA 1O3YA 3ZK8A 1UEJA 5IDQA 1WZUA 1W9MA 2IS1A 3CNNA 3NGMA 4K8OA 4OA8A 1U9YA 2J4DA 2L82A 2ENUA 3OIVA 3MLBA 4IRXA 1K68A 5J1SB 2VRCA 3VTAA 3ZY6A 1E18A 5CBPA 3PEUA 3PA8A 4YJDA 1E2DA 1XA4A 3AY6A 3MJRA 3W1WA 1JDPA 3VDRA 5C8ZA 2QP3A 3STYA 4B7AA 3PTLA 1XA3A 1W0JD 1G41A 1WMDA 4W5HA 5AW6A 1N1EA 3QFRA 1UM9A 4QARA 5BSEA 2Q28A 4LJAA 2XUIA 3COVA 3DZKA 1AZSC 2QTCA 3TNDA 4D9KA 5KC9A 4JI0B 1FYVA 3IFSA 4GC9A 5CDTA 4GEKA 4ZCMA 2REXB 4W5WA 2EBWA 1BS2A 1M6EX 5E7JA 3ZZ1A 2BM0A 2R1VB 2H07A 1C9KA 2V58A 3N87A 3WMEA 1U7PA 2FU5C 1QFYA 5DI3B 3UGKA 1F1BA 3BZUA 2RKWA 4MYUA 3B13B 4HJXA 3GZNA 2HJGA 4D7AA 2IW3A 1WUKS 2GZSA 1KZ6A 1RQ2A 3L05A 4FCCA 3VR5D 4LQ4A 1EM8A 4A36A 5ULLA 3L4SO 3SHVA 1V2HE 3HS3A 3IAEA 3I12A 2G72A 2JJ2A 4NARA 4V38A 4DV6B 4QXPA 4RLSA 4MGHA 5BQFA 1O8BA 5GOZA 5DHAA 4RIFA 3LFTA 5KEIA 2GF9A 3M1IA 5DNAA 2Q3CA 3O31A 1X7YB 5E9JA 2XV1A 5HE8A 4GSKA 5COBA 1YGYA 5AKIA 4FSXA 1CQXA 1XRSB 2V6JA 4A8JC 3VKHA 1JE0A 5HKAA 2BYTA 4DT1B 3KAQA 4H17A 3VDQA 4WA8A 5KPDA 3CZAA 1XR3A 1L1EA 1YAHA 3K30A 3RREA 4B4WA 1C9YA 1SVMA 2LIVA 4G0VA 4JI5B 5AJYA 1VP3A 1Y1TA 1XZPA 2WT8A 4AI6A 1N7GA 1UXKA 4PSCA 4PSAA 5LSAA 3QE2A 4QM7A 3GEIA 5I9MA 4IBOA 1JAYA 3QVMA 3QU7A 3F5DA 2OZKA 4EZBA 1SU8A 2ZSEA 3GHYA 4J6EA 5C1BA 3AONB 1UC4B 2Q1WA 2RDMA 2O2CA 3SS9X 2DFNA 2ZUEA 3HI6A 5E1MA 1O2DA 4L8VA 1S2NA 3K31A 4ZO6A 4W1QA 4B87A 3JX9A 1E1DA 1X7DA 2NQ2C 4R2JA 5J3JA 2W6ID 1D4AA 1EXNA 4PQYA 1SXIA 3W8DA 2VSYA 4AL4A 1LDNA 4EPVA 3QEMB 1DO2A 3DDWA 1XI2A 3H5RA 4NFSA 3QFHA 4N3NA 1DTWB 1E63A 3EQ2A 4U7JA 5GM1A 1M6YA 4KCGA 1ESEA 1MRNA 1JMVA 3F6YA 3TPZA 5JXJA 4KX3A 4CM6A 1C1XA 1E4YA 4KE8A 2VYVD 2F90A 1QVRA 4ZAGA 1IL0A 2PD6A 3LO5A 2CFTA 2ONCA 1ZZGA 2ZBEA 1CJUC 5EIOA 3UQZA 1TQ2A 3EPPA 3MMXA 4HAZA 2DCMA 3ZV6A 4BVBA 1E79A 4HYQA 4U9IS 1PNRA 2EJTA 1KNXA 1MW9X 1U9JA 5CBKA 3O9VA 4LE2A 2HHCA 2P2ZA 1W48A 3HA7A 3RVKA 5BMVF 5DBOA 2ZCJA 3FRHA 4A23A 3D7RA 3F7MA 1JJVA 3Q2OA 2CHFA 4KIJA 3IQGX 3N2ZB