1EWKA

Crystal structure of metabotropic glutamate receptor subtype 1 complexed with glutamate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
477
structure length
448
Chain Sequence
RSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
publication title Structural basis of glutamate recognition by a dimeric metabotropic glutamate receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 159
structure length 448
sequence length 477
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewkA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewkA01
1PUXA 3NNDA 5FBKA 4S04A 3DZDA 4MQFA 5BR1A 1QNLA 4CBVA 1JYEA 1FFGA 1DBWA 4IF4A 5TPWB 4E7PA 1JDNA 2VUIB 5ABPA 3D8UA 2VYCA 1QP4A 4H3HB 3K9CA 3GWGA 4KQCA 4F11A 1R8JA 2L17A 3JPWA 3H5OA 2AYXA 2H0AA 5JNUA 1ZAYA 3OLWA 2E4XA 1MAVA 5C5CA 1USIA 3LTEA 2JVJA 3O2QB 1YMUA 5FBHA 4JAVC 3JY6A 4PYRA 5CNKA 3LUGA 1NATA 1WETA 3H1EA 2QV0A 4ETNA 1P6QA 4KK3A 5FWXB 4HNSA 3ROTA 3KLNA 1NXVA 4NICA 3HUUA 1BDIA 1K66A 3EDCA 3LOPA 2VK2A 2NT4A 3M6MD 5TQ2A 1BVHA 2JK1A 4RK6A 1YTUA 3JPYA 1D5WA 3O1IC 3QLUC 4RK0A 3OQMA 1JFTA 1DCKA 4RK5A 2NZUG 2PE5A 1URPA 3T8YA 2FTKE 2IOYA 2MYUA 5KQPA 2RJNA 3UK0A 1MVOA 4RKQA 1DRKA 1Z2EA 4PICA 1IIBA 1P6UA 2CD7A 4ZYLA 1L5YA 1ZDMA 4MQFB 2PUBA 4JA2A 2FMIA 3CZ5A 4MR8B 1JF8A 4F06A 3P9YA 2FLWA 3T38A 3T6KA 2PMCA 2R25B 4N03A 4MS1A 2JVKA 4O1HA 2X7XA 3FFXA 5EWJA 6ABPA 4ZJPA 1M2FA 1A0OA 1DZ3A 1E2BA 3H1FA 1TVMA 1L5ZA 1U8TA 2BGGA 2VUHB 4G86A 4G0PA 3EJWA 3KSMA 3I42A 1RPJA 4YRZA 1GUDA 3E61A 1GCGA 4Z9BA 1P8AA 1QQBA 5TQ0A 2FQXA 3RVPA 1QO0D 1QMPA 5TQ2B 3EGCA 1Z15A 3D02A 4H60A 4PE5B 2QXYA 3N0XA 4LRQA 3H6GA 3HVRA 3MIZA 2PUFA 4RK4A 1F51E 3Q41A 2FN8A 2MYNA 3H5WA 4W5RA 3HV2A 3C3KA 3C97A 5KQMA 4G0OA 4ML3A 4P1ZA 2PLNA 3KS9A 3KYJB 1ZGZA 3W9SA 3SNKA 3M9WA 5CNIA 3NNNA 5IEJA 3IPCA 2MYTA 1DRJA 3CLKA 4MR7A 2FW0A 4LDAA 1JFSA 4MS1B 4N76A 3QX8A 3CTPA 2NT3A 3QLVA 5JNWA 1RXEA 5EWJB 3OM0A 1YS7A 4WUTA 1VKRA 4G0MA 2FEPA 2GI4A 3LUAA 5BRAA 1YVUA 4KMRA 3TB6A 2WY2D 3H5LA 4F8JA 5DCLA 3Q15C 5T3YA 6CHYA 3VNBA 1ZVVA 2OENG 4EYGA 3LKBA 5IUJC 3FGZA 4YCSA 4G0YA 1YK1A 4RXUA 3GL9A 3RVRA 5TQ0B 1ZESA 4YP9A 9ABPA 5JNRA 2F8SA 3M9XA 4NCAA 2GWRA 2YHAA 4RDCA 5JS1A 4OG2A 1QPZA 2L19A 4ZMRA 2IPLA 5JNTA 5KC8A 4NV3A 4DN6A 2E4ZA 2WMYA 3IP5A 2IPNA 4HYEA 3CHYA 4F3TA 3CRNA 5DGCA 4M88A 4XASA 1CYEA 4YWHA 1LJUA 1Z17A 4N47A 1XHFA 2FEKA 3GYBA 2CHFA 1ZH4A 4RWEA 2QU7A 2CWDA 2TMYA 4EYKA 4O1IA 2ZAYA 4RK1A 1PEAA 2FSPA 2OQRA 2KYRA 3TO5A 3LUFA 2E4YA 2FEWB 1RXIA 2MYPA 3FFWA 1QP0A 1UDRA 3HCWA 5TE9A 4EYOA 4MYRA 3TMYA 1LBHA 3BREA 3S99A 2IPAB 1DCFA 5TPZA 1FSPA 1JYFA 2DRIA 3JS5A 4KK4A 5CHYA 3HK2A 1ZITA 2E4VA 4MQEA 4RV5A 4LZLA 2QZJA 2QW1A 4IMJB 3CG0A 4G0QA 3B2NA 2M1ZA 3BRQA 3KJXA 2HQOA 4G97A 1GUBA 4TLMB 3KTOA 3KYIB 5JS2A 2PUAA 3RVNA 2PUEA 4H3KB 4KRFA 4RY8A 1EAYA 4D6XA 1Z16A 2JRLA 3F6CA 2FQWA 3CKMA 1NXOA 2FMHA 2WB4A 4IMIB 5F64A 3KG2A 1USGA 4YS6A 4D6YA 1TLFA 3NHMA 5CNJA 2FKAA 1DCMA 2A9PA 5BRJA 3OO0A 3I5AA 4D74A 3H6HA 3URMA 2H3HA 5D2CA 1E6KA 1D1PA 1XHEA 3FFTA 3L49A 3UKJA 4JB2A 5BQ3A 4Q6BA 4WZZA 5KC9A 3G85A 3HZHA 4NCBA 4EYQA 4RY9A 3HEBA 1D4ZA 4N0QA 3A0UA 3OLZA 2JVIA 3NHZA 2QVGA 3QX9A 2M98A 3LUKA 4XLTA 4MQEB 1A2OA 3O2SB 3EAFA 4KVFA 5GQSA 3RVJA 2ZWMA 2A9OA 1YIOA 3OO1A 3F73A 3JTEA 4MS4A 2A9QA 1SXIA 5E3JA 3MA0A 1AB6A 2P4UA 3SQNA 5B3JA 4L4UA 2LP4Y 3A0RB 1XWWA 3F6PA 1TJYA 1E6LA 4QICA 4MPTA 3HDVA 4WXMA 3SM9A 4FB4A 3OMXA 1LJLA 2GBPA 5JNVA 4EVSA 2N9UA 3CZCA 3MQ4A 4JB0A 4KFCA 1DG9A 2WJAA 5HM6A 3LFTA 4FE7A 1OXBB 3I09A 3N8IA 3MMNA 4O5AA 4W5TA 4MLDA 2I6FA 3C6QA 3GA5A 2FVYA 2L2QA 4Q7EA 3FMVA 4N41A 4OLBA 1MB3A 3QLTA 2PL1A 4MAAA 5EWLA 1U2PA 3DBIA 4N0PA 1Z25A 4XFKA 4RY0A 5TQJA 1J56A 4PEVA 4Z9AA 8ABPA 4KV7A 1JLKA 2CHEA 2FXIA 1DP4A 4LE0A 4P98A 4YGXB 3RVLA 3BBLA 4EY3A 3RQIA 5FWYA 4RK7A 1PHRA 3O1JC 2PUDA 1EWTA 1H9CA 4RS3A 3EQ2A 4ZPJA 4LE2A 3QK7A 4MR9A 2IKSA 2JB9A 4HNQA 4MS4B 2GKGA 3DGEC 3OQNA 2XDYA 1Z12A 4Z99A 3KLOA 2YHBA 5DTEA 3N6VA 1M2EA 3QEKA 2JCGA 3RVOA 5IULC 3IP6A 3QELA 2NUBA 3N0RA 4IRXA 3HXMA 2IYNA 1DC7A 2IPMA 5PNTA 3SG0A 1CHNA 3QEMA 4MGEA 1DJMA 2A9RA 3LUJA 5T7BA 2J48A 2PL9A 3SY8A 2R47A 4RSMA 1ZY2A 3L6UA 4W5OA 2WRZA 2O20A 3N75A 4RU1A 2NZVG 3KCNA 1NXSA 1KRWA 4KQ9A 5EWLB 5TPWA 5EWMA 3GRCA 5I4CA 5B3JC 2FN9A 1RNLA 3I45A 3R0JA 4G0ZA 3ILYA 4Z0NA 1BA2A 1LK0A 4B09A 5DKFA 1W25A 1OXKB 2JBAA 3EQZA 1U2QA 1NTRA 3JVIA 4GNRA 5KI6A 4Z4CA 4MR7B 3RH0A 1M5UA 3DGFC 1DBPA 5KQGA 3Q9SA 1AB5A 4RKRA 2HJ9A 3NNSA 2RDMA 5TPZD 4OLAA 1NXPA 3HSYA 2Q5CA 4OATA 1NY5A 5HQJA 2RGYA 3OLVA 1P2FA 3H5IA 3C3WA 4LX8A 1U0SY 4EVQA 1Z26A 4Z4HA 1HEYA 1M5TA 3QELB 1SXHA 1T34A 3O2JA 4XAQA 1RZRA 2WJWA 4KREA 1TM2A 2E4UA 2LIVA 1NXWA 4XXHA 2R48A 5IUKC 1ISSA 2QSJA 2B4AA 2P9HA 1MB0A 2HPHA 3IP9A 2PJUA 1JWLA 1NXTA 3C3MA 3QLVC 1ZH2A 3BILA 3VNAA 3RVSA 2ID7A 1JFVA 5KWSA 4LDZA 1SD5A 2FMKA 3LKVA 3O74A 4MR8A 4YV7A 2W42A 2V0NA 1ZN2A 1TMYA 5EWMB 4KPYA 4W5NA 3RVKA 3KHTA 3NBMA 2WWVD 4S05A 1BAPA 2MSWA 3H5VA 3H75A 5IC5A 3HS3A 1LBIA 3OLYA 4G0XA 2HSGA 2JBAB 3RVMA 3HM9A 2R4QA 1VRVA 1BDJA 1VPWA 1QQAA 5IBQA 4OBBA 5HKOA 3O21A 1FQWA 5HSGA 1MIHA 1GCAA 1D2AA 3A10A 3Q7SA 1JL3A 4WWHA 3HUTA 2MSKA 5ED4A 1CEYA 3IP7A 3DLHA 1DC8A 3UUGA 4L85A 1NXXA 1SRRA 2LUOA 4RXTA 1KGSA 3JVDA 5IUNC 2GX6A 4LE1A 4RZSA 3GBVA 4WXEA 5GOTA 1Y1LA 1QKKA 3EODA 4JOQA 5DLEA 3CU5A 4IGAA 1EFAA 4MS3A 1ZGGA 4GPAA 4YO7A 1ABFA 3LUCA 1VLZA 2MSLA 3F7NA 3LMKA 1Z13A 3MF4A 1W9HA 3HO1A 2HQRA 4NQRA 4FE4A 4UHJA 2L18A 4TN5A 2B1JA 3KKEA 3E3MA 4TLLB 1ISRA 4EVRA 5KQLA 2AYZA 2PAFA 4KNYA 4UHKA 4ETMA 1JDPA 1JBEA 1A04A 1KRXA 1PEYA 3K4HA 4Z4FA 3GBPA 3OLXA 3N0WA 1FFSA 4EGSA 4F12A 1SXGA 3A3KA 3CNBA 3MM4A 3Q7TA 2ID9A 4TMYA 1K68A 3TX6A 4WT7A 1B00A 4Y9TA 3T95A 2PUGA 3LUHA 3BRSA 5C5EA 3HDGA 3GT7A 4MRMA 1Z2DA 3CG4A 2RJOA 1EWVA 4ETIA 1QO0A 4QYWA 1YK0A 4IILA 4E7OA 1APBA 5IX8A 1C0EA 2IDMA 1PNTA 3GV0A 1I3CA 3OQOA 4Z4GA 4MS3B 4W5QA 2PKXA 3H1GA 3O1HB 4Z4IA 1DBQA 2E4WA 1D1QA 2QVCA 3CFYA 3N53A 3TD9A 7ABPA 2FMFA 3IDOA 1KMIY 4DADA 1EHCA 1JHZA 2LBPA 4QPJC 4JP1A 2QR3A 1E6MA 1BDHA 5JNSA 5CNMA 4MLCA 1ZHHA 4YLEA 3ROFA 3LUDA 1U04A 1QP7A 2FQYA 3FDFA 3ILHA 3O75A 3QLUA 1YS6A 4Z4EA 1ABEA 3G1WA 5FWYB 1FFWA 3H5TA 4OTZA 4YR7A 4MRMB 1YMVA 2PUCA 4ZMSA 3EULA 3MYYA 4MR9B 2F8TA 4KZKA 3DLBA 5FWXA 4EUKA 1C4WA 3HJFA 4Q6WA 1S8NA 2HQBA 1GLGA 3Q7RA 4JASB 3SAJA 4DQDA 1USKA 2FLKA 1F4VA 2LPMA 3RVQA 1RZRD 1EWKA 3OMWA 4RXMA 3CS3A 5IEBA 3IPAA 1Z18A 4QYMA 3OM1A 1JX6A 1JH9A 3QEMB 4PZ0A 4HNRA 4XARA 1PNRA
chains in the Genus database with same CATH superfamily
4MRSA 2RJ3A 4P4SA 2C3PA 3TNJA 1P0MA 1TKBA 3WKCA 4A0RA 1HT1E 3IA2A 3WGLA 1TK3A 2PXCA 2D59A 4GEGA 1KF0A 4TWRA 1L1FA 3IERA 2DAPA 1KEWA 2HMUA 4N3CA 1JLHA 1TYEB 2PSFA 4J76A 4MVJG 3DCYA 5CAEB 2BMDA 1AXEA 5IJXA 3ND5A 4Q48A 1UOQA 3ESDA 3JPWA 2GPTA 2GZ1A 1IPHA 3UGKA 4CCSA 4BRZA 1ADGA 3FUTA 3O2QB 2BMFA 1QVWA 1UCFA 3JY6A 2A1TR 1DKQA 4NLLA 5CDTA 5CBPB 1PG5A 4BLWA 1WD7A 1Z0ZA 2A0WA 3ROTA 2WABA 4CLRA 4EATA 3W5VA 2G9ZA 2KHZA 2ZSKA 2A57A 4EHLA 5HRAA 4XVQA 2Q6KA 1Z7YA 2EHJA 2XVYA 1QR6A 4GMGA 3PCRB 2IYRA 2GPNA 1OQAA 5KDLA 3WLSA 1JFTA 2VYND 1O6CA 2NZUG 1DXYA 4RMIA 4OVKA 1LF0A 1WUYA 1DUSA 1LDEA 1V5EA 2Q0QA 4JJ6A 1H23A 4MVWA 3IMFA 5EAIA 3VH2A 1X80B 1YZVA 5KKCA 3C6ZA 3I12A 1CP2A 3NP9A 1MJHA 4PR0A 3S2GA 3ZE2B 3U4DA 2P62A 4Q9IA 1A72A 2YHUA 3C7KA 3QKSA 1MA3A 3G0GA 4IFBA 3V1TC 1DX9A 3GMSA 5BW4A 1TD9A 1W0JD 3TUZC 1E4VA 5C5IA 5AI4A 2XUFA 2R25B 4C9BA 1W5BA 2JVKA 2RHHA 2A14A 2AJCA 1W2WB 3VV3A 6ABPA 3A9SA 2JKZA 4E6PA 5DEIA 5LSAA 4G0WA 2BKAA 1KVUA 1OA1A 1Y8RA 2VIIA 3ZNPA 2Y67A 3OBIA 5E4YA 3RJZA 2JIPA 2QZ4A 5C32A 4TV8A 2YKGA 4EPTA 3TYXA 4EO4A 4PAMA 2V58A 1Q91A 2DJIA 3B52X 1KOFA 1XSEA 2CYBA 2NO9A 3OZFA 5BT9A 4NESA 3UT5A 4JK3A 3RVPA 3H19A 3H2ZA 1AXGA 1CX9B 2BSXA 2ON6A 3MLAA 3VI3B 2JLRA 3LWDA 4XPIB 4XQCA 2X41A 1PAUA 3AR8A 3QFFA 1SC4A 1JHXA 2ZIGA 3A36A 3L6OO 3NRCA 4IIBA 4KR3A 3T1OA 4IL5A 5IN5A 3ZV4A 1LNZA 3KOWA 4YP1A 3TX2A 2P6PA 5HEKA 1DE0A 4QD3A 5K0TA 5B4UA 1JIQA 4ML3A 5ARCA 2OM6A 4L3WA 3HCAA 3DZIA 3OKFA 1S3SA 4GYWA 5H16A 5MDHA 1RKVA 1R8QA 2WYOA 3VU8A 1U3GA 3H0EA 1TJPB 2XOKD 3RIGA 2R1TA 3OJLA 2IPXA 4MQMA 2XPCA 4MW9A 4J7AA 5I7EA 4K0KB 1E98A 2VG8A 4WLNA 1EQUA 1MT0A 2XUGA 4HEHA 1KH2A 1TPYA 1E9SA 4ETWA 1UOEA 1U63A 4D26A 1BFKA 2YXNA 1X8JA 2E48A 4HH4A 3LQ2A 3KT8A 3NPAA 2F64A 2H2AA 3LXUX 3HH8A 3FRHA 4C43A 1WIWA 1KJ9A 1U9IC 1KFCB 3FGZA 1RJGA 2IXBA 4I4TF 4R8VA 5BOVA 4CF7A 3CN9A 2FZVA 4GF5A 3M9XA 4ASUD 2G7MC 4DBLE 1D6NA 2LIPA 3BGOS 1SUPA 4NV3A 1ULHA 2OV4A 5CW1A 1AKUA 1Q50A 1RWNA 3RU2A 2JBHA 1YR3A 5L6MB 3ABOB 4JI5B 4UHCA 1DRUA 3L0SA 3UYLA 2D1QA 3VFDA 1Y6RA 4BFTA 5JDCA 1RYDA 4FHEA 4N47A 4D9BA 3R9XA 1UP6A 1XDGA 2OCXA 3D6NB 4R83A 2NSDA 1TCBA 1CLEA 1ZK1A 3OFND 4MUFA 4ZAGA 3MBIA 4QGGA 4D9GA 2XA2A 3DOHA 3EYWA 5B57C 4HMQA 4P4LA 1RD4A 1KSGA 1IY1A 1NJ2A 2HJWA 1GTZA 3ZD7A 1SCKA 1Q15A 3DSRA 3X3HA 5F23A 4XOIA 4PTYA 4QXOA 4FDAA 2JJ2D 3WLHA 1EK5A 5G53C 1VSVA 2O59A 3I28A 2RKOA 3OE1A 1JJIA 2C58A 4BP8A 3BREA 3AUKA 4K9KA 5JCPA 3WNDA 1QOPB 2ZJ0A 4KQHA 5BSTA 4AYWA 3UMCA 1SO8A 3LE8A 1L5HA 1JYFA 3NQ41 3H16A 3RSFA 1FSPA 4ARCA 2V7GA 5IZCC 2WYHA 1ZR2A 3ICCA 4LZLA 4ZMBA 2QZJA 1H8EA 1XV5A 3NUGA 1G21A 1W88A 1KAQA 2ACWA 4O29A 5KYTA 1NJ6A 1X3SA 5BT8A 2BN4A 4K6HA 4KQ1A 2FPOA 2ANBA 5U9CA 4DRYA 1ZM2A 3NHAA 1BMDA 4QPPA 1I2AA 3AFIA 2Y2UA 4D6XA 2VP6A 3BA1A 4DT1B 1NSFA 1O8CA 2O5VA 2SCUA 3E5MA 1IXSB 3E4CA 4FDLA 4IMIB 4K26A 4WASA 4XDZA 5F1YA 4DCPA 3Q12A 1YDWA 5EFOA 3FPFA 3EC1A 4DJTA 4MINA 4URZR 2YCBA 4REMA 5IJ9A 4NZNA 2QS9A 1SCJA 2AFHB 1NDHA 3UFXB 4OD0A 4ALMA 1C9DB 2DCUA 5DM0A 4K2AA 1ODIA 4BRSA 1HYGA 2IV3A 4M7WA 4JR2A 1WV1A 2VBIA 2F8MA 4BL5A 5C35A 2QN9A 4Q21A 4FHZA 4OP1A 1HV8A 1TA4A 2HMSA 2PTGA 1UKAA 4NFYA 2IX9A 1QIIA 1R6VA 2ZU6A 3KQVA 1KJWA 2R8ZA 1YIOA 3OO1A 4XCQA 6LDHA 1E3QA 4NYIQ 3IT0A 4CF5A 1NX6A 3ZZ1A 4IDFA 3CGGA 3CONA 4Y98A 3VQTA 3WB9A 3PWKA 3WL5A 3W4KA 1E63A 1JQKA 3LYAA 2VDVE 3A0RB 4NE2A 4DMRA 2W0MA 4CLOB 3SM9A 1KRHA 2BHNA 1K4MA 3HDVA 3IEXA 3X2EA 5L45A 4KVGA 4BNNA 3GW8A 2N9UA 1U2EA 2GEUA 1D8TA 3K32A 2VDRB 3I52A 1KP2A 4BNJA 2OBNA 2WOOA 4M7OA 3E7DA 1PDWA 1AOXA 3LFTA 2O2SA 1PW7A 4BMVA 1NU6A 3OE7A 3ZWVA 5CDYA 3KYCB 4UUBA 2ERXA 4B48A 4NY1A 1SIBE 2Y6VA 1LDYA 1WCIA 2L2QA 3NTRA 1DAIA 2HUPA 3SR3A 2PSDA 4MAAA 5CXQA 3BPSA 5ALPA 1A2BA 2J9XB 3W6UA 2RH9B 1GR1A 5HF8A 2VQFB 3F6EX 4RY0A 1HYEA 4WNCA 2IEAA 1KU6A 2BF7A 5BORA 4KPUA 5FPTA 2PL3A 4XVHA 4YGXB 3EEYA 4LE0A 1PK8A 2G1PA 2WILA 3T7KA 2LKCA 4RK7A 4I3HA 3LHIA 1NW4A 2PZJA 4IWXA 4GL4A 5EXTA 3HDHA 1V5GA 4GLBA 2F55A 4YJ2F 3WOVA 1IEWA 1UPXA 2QRGA 1TUIA 3DLPX 2O1XA 4DLKA 2QE7D 2R6ZA 1DAHA 2XDYA 1EPUA 1YA6A 5BR4A 4TV8B 1XRRA 2PWZA 4D9JA 3WNVA 4HQLA 2O0MA 5DHSA 3HO8A 4UHBA 1NAHA 3OD5A 2CUTA 1KJJA 4N5IX 4EZBA 1JNXX 1Z7BA 1DC7A 3KXDA 3QKTA 1ZCZA 2J7PD 3GLUA 4H2DA 4Q01A 3U4AA 1CUSA 3IT3A 3LUJA 2PR7A 2VAXA 3UA3A 3COWA 3D6HA 4ZCQA 5IJ0A 1CIJA 4CUZA 1A2KC 2I6QA 1Z8NA 2VP9A 4UQOA 1KE2A 2O2IA 2ZBUA 1EX6A 1CE8A 3G2NA 4XUGB 4WLUA 5JZSA 1I01A 5CK4A 1ODSA 3JARB 2FX2A 1MO2A 1J8DA 2HA3A 3KKNA 3LF1A 4XQGA 4XGKA 3GIWA 4KXYA 3WLRA 4DW8A 3OSZA 3RE1A 2Q7XA 4YRNA 2H8GA 1EWRA 2AEFA 1RRVA 1LLUA 2CCKA 1G59A 3NG1A 2R1TB 3EFHA 3JSAA 3PPXA 4GECA 2VAVA 3B1VA 2B3TA 3N2IA 1UFQA 3TOXA 1FNCA 3D0QA 5I4IA 2B8JA 1H2YA 2AOWA 3O73A 4AU1A 2P4HX 2VWPA 3IIJA 4B6QA 2ZRJA 1PZGA 5FI1B 1Y5RA 4WJZA 2DH6A 4OATA 1ZUNA 1YVRA 3OIWA 1X15A 1CRLA 1ZOPA 4EVQA 3HYCA 3IO3A 1HYBA 1PVVA 2GA9A 2QWXA 2X8LA 1M5TA 3GLSA 4RMJA 5LNK6 1SD2A 2Q2NA 3L8ZA 4MRAA 3JAWA 4Y1GA 4KREA 4TZ6A 5FUYA 1NXWA 3HY4A 1THTA 1QK3A 2FU5C 2HIAA 3W6PA 1QLJA 2A92A 2XCOA 3IP9A 3T5AA 2HPHA 4UXHA 3EGWA 5EIBC 1XJ0A 1NKSA 2CLHB 1RDFA 1MENA 1U65A 3EJ6A 1E2NA 3K6JA 4LJ8A 5F3DA 4D9EA 5BN3B 5J4HA 3O74A 3R9XB 2R7KA 1AK2A 2C2OA 2PSHA 3HEMA 4FI3C 5I9TA 4EJ0A 5KTSA 1EXDA 1QQ7A 4PO8A 1AD2A 4BECA 1U7HA 4D0GA 1QYRA 1Z6ZA 2HSGA 1YCGA 2OTCA 2DY0A 3I3OA 2ZAMA 1XPUA 1WA5A 1JPVA 3MMXA 2AG5A 1RABA 2JS7A 2VDKB 3LC1O 4UMDA 5P21A 4B3XA 3WGIA 4ND4A 1JYSA 2IEYA 4HWSA 3NTOA 4QVIA 3HCOA 4WWHA 4AG5A 3DJFA 2XUDA 2MSKA 2YX1A 1IHUA 4W7SA 1SUSA 2VF4X 2ZCUA 3BL5A 1SC9A 1C4XA 1Z2OX 2H5EA 1HKHA 1QQ6A 3DVSX 2YC2C 4LBWA 3WQBA 3W3AH 5G0TA 3CVYA 3VYWA 4I36A 4JL5A 4R81A 2V54A 1VJGA 3DKKA 3GUVA 4W9NA 3ZUPA 4UZFA 4IHJB 5JH7B 1AGPA 1N0VC 4KVAA 4MV9A 2OBMA 4JY7A 1HZJA 2NTNA 4YO7A 4ZOCA 1ABFA 2EVWX 4JJKA 1RTTA 5F33A 1C7JA 3L02A 1DFHA 3D2CA 4ILEA 5TX7A 5A2GA 5FPYA 5JARA 1FX1A 3RYHA 2NSLA 3QEJA 4H7PA 4PHGA 4MI1A 2AVNA 1Q84A 3T15A 1AA6A 3G9ZA 1RMYA 3I04A 4XDYA 5A9SA 1EDDA 1Z34A 4ZEWA 1FUIA 4MAFA 1IUPA 4A8TA 1NNEA 2NO1A 4XR9A 3FTEA 1OWPA 1Y9DA 1QCYA 1UJMA 1PJBA 1RRPA 3HB9A 4M21A 4OKNA 4O4LA 1XZ8A 2IHYA 1CZUA 1T3HA 1ZI6A 3AKCA 2OO3A 5A3SA 5AM3A 4DDWA 2I9PA 1PEYA 3COYA 1LZLA 3A2LA 2FHSA 1U7PA 1U9JA 3M49A 1KEZA 2XUJA 1YB4A 3HADA 1SXGA 3CNBA 3MM4A 3N8GA 4F2WA 1UBCA 4DLSA 4R71A 3TLGA 1PZXA 3R75A 5L4SA 1RAFA 5DYWA 3H17A 1ZD9A 2Q62A 2ZJ7A 3Q2OA 1I1HA 5J2UB 3AL3A 3CVVA 1GNSA 4LVOA 3RC3A 1FYEA 3Q8XB 4OFWA 5EE0A 5DBGA 2D13A 2XOXA 4H4EA 4EH1A 4HNGA 3V4RA 4KG7A 3RJ5A 1YCFA 1SD1A 3FWNA 3UHJA 3GEDA 1LPAB 1Y8AA 2GVDC 4FSHA 1JKMA 2IOFK 3DL2A 3F47A 4ZODA 1ZCJA 3ZDYB 4C6RA 2VRWA 3MAAC 3TD9A 2OV6A 4OOFA 3VJMA 1I6KA 4CLHA 3HABA 5BQPA 5EQFA 2DSNA 1SCNE 3UIEA 5A06A 3WK6A 3PENA 3FI0A 2F43A 4HGZA 4JI2B 2ZJ1A 1MG0A 4QDKA 2HLDA 3IXLA 4GBJA 1FXWF 1XZGA 2DFDA 1JE0A 4L15A 3G13A 3VU3A 4B76A 5G1OA 1P0CA 1QUEA 3PWTA 4NMHA 5MN6A 1QCDA 4MKXA 5K3AA 3DONA 1S3IA 2BUCA 3L93A 4X94A 1C0LA 4LZOA 5FEMA 2ZJBA 4KDCA 4B6EA 3HVKA 2HHJA 3HKEA 1RWPA 3IBFA 1WY5A 3H5TA 3G5MA 2XQIA 3U9SA 4ZJYA 3NIGB 1KE1A 3DEAA 2H6EA 2D00A 3D6TB 5IXYA 3CX7A 2BLNA 5EIXA 4NBVA 5KBYA 2BGLA 3HU5A 5FORA 5BNWA 2ZDGA 4X3OA 3E0XA 2G71A 4IDEA 4RH3A 4WHMA 1M2OA 3WXBA 4CR6A 8OHMA 1MF7A 1YZUA 4P4GA 4LRXA 4CM4A 3O94A 4TLCA 3L41A 3DMHA 4FJ2A 1Z4OA 3E3AA 4DLRA 1X14A 1IY2A 3GJRA 4MUKA 1MOZA 5KX5B 4QQRA 4YMSA 2GPYA 5B1YA 4FWTA 1N36B 1GFSA 2ONJA 2FA9A 4HNRA 3GWZA 3KDSE 2BHRA 4HRYA 4OXXA 1AUPA 3P9PA 4R0MA 3GNQA 2J5BA 4XVRA 1F9AA 2EFGA 5IJ0B 1OW3B 4F38A 2C20A 1KKMA 2ZYGA 3D5EA 4GZ6A 4R8LA 2X4DA 3H18A 1R00A 2J9FA 3HCCA 5TNXA 2LDBA 2XVXA 2R68A 4YRGA 5ITZA 4X6UA 5IN4A 3U7QA 4IGKA 4JEHA 4KQFA 4QFBA 3VSDA 4IKPA 1NDQA 3EXHB 2J85A 2XNSA 4GBGA 2QLFA 3G9TA 3T7RA 4C03A 5E6RB 2UXDB 3PC4A 4C6SA 3ELWA 3FFBA 4GX2A 4LV6A 2AN9A 2ODQA 3NLLA 4J8PA 1L8LA 2GJ9A 3F96A 1LDBA 2R00A 1IPFA 3FNIA 1DWQA 4EG3A 1IZYA 1RJFA 3LTEA 4ZHQA 4DV3B 4C08A 1R0LA 1O97C 3GG9A 3IB3A 5D6OA 4ETNA 1P6QA 2P9BA 4D9MA 5FWXB 1EFRA 5TLSA 3HUUA 2EGGA 1YS9A 3DB1A 1SCBA 2YQ5A 3GMTA 3M6XA 3WYAA 3AF4A 3EZYA 3GRKA 4BYMA 2O8CB 1ZVQA 3O8CA 3ZEIA 3EXHC 1X1DA 2RKBA 5A5GA 2IEIA 3D2LA 1E5DA 4XQEA 3C4QA 1W0KA 1CNMA 3PTLA 3SJCA 3ZWBA 4O3MA 2HRRA 1XCLA 4YX9A 2RJNA 3O8DA 1MVOA 3A6GA 2YY5A 5E2BA 2F3TA 4LJ5A 2W8ZA 1L7BA 1Q83A 4QX6A 4YT8A 4CXMA 4MVYA 2QAGB 2XH8A 4MGZR 3ZY4A 3RANA 1E0SA 2OB2A 1U8UA 3W5DA 4CM9D 1N6PA 3PEYA 4V2IA 5KOHA 4C0SA 1QFSA 1YQGA 2OVBA 2WA1A 4NJEB 4JU9A 2P3QA 1GUFA 2VKTA 5JS6A 2FWIA 5BSHA 4B3SB 3DZHA 4I6JA 1EINA 1O96B 1QAOA 1YMQA 2HWWA 1W1WA 1NQVA 4WLEA 2JIQA 4PAWA 3THRA 4RAQA 3GLFE 3FDZB 2YN4A 3I42A 1R9JA 4OYYA 3IAFA 1C3XA 4R7GA 3NASA 2VWGA 1ZK4A 1QNFA 4IH9A 1ENYA 5DBFA 1XJCA 1II8A 1MO5A 3JX9A 1JWLA 4F5EA 2QAGC 4TYYA 2IXAA 5CCXA 3DAHA 1PDOA 1WW3A 2YASA 3N70A 5J2TF 1PGNA 1UMDA 4FW9A 1K7EB 2P9ZA 1PNQA 4EDHA 2EBUA 2W6JA 4G5FA 5CG1A 3ZVLA 4DLWA 4ZFNA 4TLEA 4Y6OA 1Z2CA 1BNCA 5BUQA 2IU6A 3G7UA 4UULA 3FMPB 2GEBA 5JS8A 1HFJA 2FW6A 4DB4A 3VUEA 2EZ8A 4PYKA 1KS9A 3O4GA 4P1ZA 2I67A 3A6KA 1IU9A 1V39A 3D3KA 3IUQA 3JWHA 3OM9A 3OZ7A 3QQ5A 4WOKA 5AW7A 1CXZA 1EAMA 1GY8A 1CQXA 4URYR 2GHRA 4CQLB 4IR7A 3MOIA 3OZXA 4DA7A 2NP6A 1BXZA 2HA5A 2VHVA 3HY3A 5HE9A 1NQAO 1VL5A 7AT1A 5KIAA 3CTPA 4M46A 4HTFA 2J3EA 1TAQA 3N05A 2XTMA 2CJFA 5BWBA 1R50A 2FDRA 2F9FA 3BD7A 3I72A 3Q87B 1V9SA 4RADA 1KI6B 5E6UA 2CYCA 2XMGA 4W9NC 2QRHA 1TJ5A 4TTSA 4D3XA 4C06A 5ITVA 5KU7A 3EMVA 3LKBA 3SFVA 1UMCB 1XNJA 1G8AA 2P6OA 3QFRA 5FOSA 2P2DA 1CZOA 4PCUA 4HGPA 4TM7A 3UHFA 3RNOA 3AVVA 1PVDA 2B4RO 3EDRA 6REQA 1VBNA 3S0JA 3T7TA 1JXQA 3PQ5A 3WB2A 2JCSA 5KNLA 1DKOA 2B2XA 5IANA 4AZ0A 3ZJVA 1TCCA 5I7FA 1ZOOA 2ZOSA 1GZ4A 3ONFA 4KPGA 5D00A 1XKXA 4RNDB 1C30B 1FFXA 4AWAA 3AM5A 4O2AB 1XCJA 4BNUA 5J5AA 3CZRA 3NM5A 3VR1A 3ELUA 1SNYA 5KYXB 2HWYA 2QX9A 3ER8A 1DOHA 1J1IA 4L0DA 1ZMBA 1YRYE 2AR0A 3OCUA 3PV0A 3FYDA 4MKFA 1L6RA 4O8CA 4PG4A 4ZOBA 1R4NA 3LQ1A 1CUVA 1QS0A 1MW8X 5DBOA 1ISPA 4Z2YA 1JG4A 1R0RE 3OE4A 5EUMA 2F43B 4D9HA 3TE7A 2VPXA 1R4AA 1LPBB 1LBHA 5FP0A 3MT0A 3WI7A 3W5UA 3QHPA 2I03A 1DCFA 3ZH9B 1SK8A 3V1KA 1FW6A 1BMQA 1V5WA 1ZYUA 1Q3HA 3VR5H 4DV0B 3TGWA 4X91A 3CRQA 3NVDA 1Z7EA 1E2JA 2H3EA 3C1UA 3CZ9A 4Z3DA 5TY0A 3EUEA 3HCDA 4BFUA 3UPUA 3SDBA 4JWTA 1YL6A 1YRWA 4L74A 4OMFG 1XU4A 1B8VA 1Z38A 4HG2A 4GPEA 1KY5A 4ZT6A 3I9MA 5JS2A 1AGYA 2BM9A 3RYCB 3W5SA 5T41A 1UBHS 4ALJA 1ZH8A 4FMDB 2ZBQA 1Z16A 2JRLA 5THQA 5JBNA 2HV8A 4OGGA 2JZCA 4ZEXA 1NXOA 2M6SA 1U8EA 2FMHA 2H51A 5F1PA 1P62B 2Y71A 2WJ6A 4YS6A 3FCAA 1PS8A 1W5SA 3I6BA 2CDCA 1Q6YA 3A1VA 4TLBA 2RGGA 5DIFA 3VJKA 4G8JA 1VA4A 4AI6A 1GNRA 4B7CA 3K6SB 3I5AA 3N07A 1ZUIA 2WFLB 1W85B 3QLEA 4IMRA 4BWFB 1K6XA 3TR6A 3ZHXA 3KVYA 4UDOA 3W77A 2ZJ3A 3BWVA 5KC9A 1TADA 2X5OA 2BGJA 3FOAA 3T1YB 2JAOA 1V1RB 1NASA 2IBTA 1XRSB 1Z4NA 1NN5A 2JI9A 4MWEA 4GZ3A 3IV9A 3OCVA 2GMWA 4O2BB 4YALA 3OPXA 4AW9A 1A9TA 2XBUA 4TTPA 2DWQA 3ZW9A 621PA 3BSYA 1BFDA 2WTBA 1A2OA 4M55A 4LQLA 2ZKLA 4L72A 1IHXA 2D62A 4N3AA 3AEZA 3WNBA 4QPCA 3RNLA 5LFAA 4EG6A 5DBIA 1T5HX 3TAHA 5CFOA 4D97A 1H1LB 2J67A 3C15C 2G1KA 1N32B 3ZLBA 2H1CA 1RQPA 3BGWA 4I08A 3FSGD 1ZJYA 1C9EA 1ZZGA 1BHSA 4FB4A 2H18A 1FMTA 1R5NA 1KPIA 5CJPA 5ALHA 3WGGA 1TM5E 2AEJA 1LPNA 4OM7A 4CCWA 4CCAA 3D7MA 2C98A 4G1UC 4B32A 5B7NA 4X6XA 2X2OA 3KWJA 3V5NA 1H3EA 4CMGA 2VDJA 3LLUA 4BP3A 2CY0A 5HM8A 2CT8A 4K88A 1GYPA 3LX6A 2IYWA 2VTKA 2JCBA 1D4OA 4MLDA 1XZKA 1DDOA 3H2JA 2V98A 1YZYA 1M54A 1UC8A 2BTOA 2QU8A 2OCKA 2ZSHA 3EAGA 3K5HA 4EA9A 2HYIC 2VPWA 3VU0A 3ZR4B 1HEIA 2R00C 3ZK7A 4E70A 2FZCA 1KZ9A 3NTLA 2DHCA 3T0FA 2XB6A 5TQJA 4EX7A 4EYSA 2BHTA 2OBYA 2CHEA 2KLHA 2X19A 1JLLA 1RWOA 3K9LA 1YR2A 2ZS8A 4HAZA 1PHRA 4PAQA 2EIXA 1CUCA 2XQVA 3ZIUA 3ABZA 3G0BA 4PPGA 1U9YA 5EVJA 1ONSA 5GZ3A 1G3MA 1CY6A 2DR3A 4BPBA 2VTBA 3SQOA 5H02A 3KSAC 5IM5A 4CEIB 3BN3A 1JDZA 1T1EA 2DPLA 3FWHA 4WUVA 1UXHA 1UFKA 1IN8A 1I1NA 2VDPB 5TQVA 2G25A 2IH5A 1PV4A 4C0WA 4I1RA 1FJGB 1M76A 3DKRA 5K0SA 5K1ZA 2P9QA 4BJ1A 1GUAA 1II8B 1JAYA 1W6UA 5CT4A 3SOZA 3EIHA 4C2BA 5BWNA 3C3BA 5LNK1 4YVFA 3ELYA 2ZIVB 3BSWA 3QEMA 4XWAA 3U1VA 1ZMRA 3DDWA 1XDDA 3KTDA 1EFLA 1P8JA 2UVPA 1F2UA 2NU7A 3FPCA 4LDJA 4YNBA 5EKSA 4EHIA 4RSMA 1MABA 2EJUA 2XMPA 3HA7A 3QKRB 3EXEB 4JUAA 1XP5A 1IJKA 3EH1A 5IVKA 5J43A 1BGVA 2VH5R 3GLQA 2WQZA 2XD4A 3IBCA 2R1ZA 3EVNA 2P75A 4RQUA 1NMYA 1AMOA 2BH9A 4G65A 2ZJYA 4V02A 5FT9A 1AQ6A 1P9WA 1HA3A 1JZQA 1KO7A 1N6OA 1SPBS 1X7HA 1XIVA 3M2TA 3TXAA 1H94A 3R0JA 1OLXA 4UUPA 4BMOB 3ZVMA 1Z4MA 4RVGA 1H2XA 2ZIZA 2JIDA 3BMCA 4D4HA 2EP7A 2W4QA 2DLCX 2NPIA 3DF9A 2W6PA 3HMKA 1GPJA 2AXEA 2DKFA 3DBRB 5C4MA 3H2GA 2W98A 3V4ZA 4EPRA 1FPQA 1L7MA 2BI4A 1PJTA 3AW8A 4G89A 4OOEA 4KSCA 5HG0A 4F5ZA 2FGJA 5DDIP 3HKDB 3PUXA 1NXPA 3F3SA 5AKEA 5E6UB 4QDZA 1L5MA 3M5DA 1Z5UA 3UJ8A 4Q3KA 3O4JA 1VLJA 1SB8A 2ONKA 2WJJA 4Q9HA 1RSZA 1O54A 3RWOA 1M0SA 2HM7A 1YA8A 3EZ2A 3QELB 2GARA 5B1DA 4YDQA 2V6IA 1TM2A 2LIVA 3HU2A 5KB3A 4YJHA 1WTCA 3GCXA 2Q99A 4EJSA 1FSGA 4YO8A 1Q20A 3O4RA 6REQB 3K9WA 3LBFA 3C5EA 1W19A 2CNDA 4O1MA 4DWOA 3BTSA 3I0MA 1E0AA 4TVOA 1T13A 3L7KA 4YV7A 2BY4A 1CULC 1QLHA 1U2GA 1FFXB 1UDWA 1YQDA 1TMYA 2W6CX 2YN0A 2PXXA 3L6EA 4HQ0A 3CBQA 4IHQA 5FF9A 3L8YA 4DTCA 4Q03A 4OGFA 3ZXIA 4B6RA 2CDNA 3OLYA 1PR3A 4BX3A 4FOLA 1AK9A 3R0XA 1R4NB 3U81A 5AVOA 9LDTA 4JGIA 5EP2A 2HA7A 5DULA 2G36A 2R6JA 1UAAA 1K1EA 1T29A 1FQWA 3A3YA 2QRVA 2EL7A 1QBKC 4F1JA 4IOJA 4JGBA 1JL3A 3PNYA 2BBSA 2H48A 5JMOA 3VKWA 1G17A 7MDHA 3CYFA 1M33A 2QUBA 2OXRA 1D2RA 3NIWA 2BFCA 4Q00A 1YDMA 4AECA 4C7OA 1PJRA 4AKSA 1JU4A 1KK1A 4U2KA 4UEJA 3EX7C 5IBRA 3GLFA 1ISIA 4HWGA 2VJYA 2GX6A 3EARA 4QUDA 4XPZA 4LHSA 1JI3A 4EMUA 1YZQA 3UH1A 1KU0A 1LB1B 2QX7A 1RXVA 3T3NA 5CDUA 3TZLA 1JKJB 5L3ZA 1IYZA 5JCJD 3K5IA 3DR5A 1EFTA 3TI9A 3DV0A 4C2UA 2O1EA 3DEHA 5H4GA 5L95A 4UU8A 1ADBA 4DMUB 5CA1F 4YP5A 1DAFA 2RBKA 1GAQA 5D1NA 5TIIA 2AJBA 2WBLC 5U1PA 2I2BA 3WMEA 3TQQA 4IIGA 5LP6F 1X87A 4U5XA 2GN8A 2DBVO 3AM3A 1AS0A 1QRUA 4RM2A 3FPKA 5JFGA 1GCIA 2AYZA 3ZZMA 1WPQA 2C9ZA 2PAFA 2PFSA 4C0BA 2C3YA 4C21A 1EGAA 4EKIA 4I9NA 3BJZA 4GICA 1XA4A 1KOLA 3Q10A 1SURA 3H0CA 3RBVA 3C41J 2Z2IA 1NVFA 2A94A 4U7TB 3M3DA 2VTEA 1R4MA 4LHXA 2QEQA 4WADA 3GJYA 3MCWA 4XD2A 1XAHA 4KBYA 3TE6A 2MHCA 2J09A 3QEBZ 1MIOB 3B2QA 3D5QA 3VYTB 4JI0B 2ASEA 1Q92A 1U0TA 4MGYR 3S6JA 4YAOA 2C9DA 2PWYA 4PQGA 4BVAA 3LX4A 5KNBD 4M0UA 1UP7A 2O7RA 4CKWB 2VPZA 2DECA 1NBAA 3VRHA 3W6OA 3IXQA 9MHTA 1K6MA 2XB8A 1E79A 1EBFA 1QE5A 1K8XB 1Q2XA 3IVAA 3MFYA 4ZKEA 1YQTA 4NAUA 3X1ZA 4A6DA 1ZNZA 2GASA 3HRHA 3KB1A 2ACKA 4LGMA 3JWGA 5KJCA 2PBFA 2D1FA 3G89A 3IE2A 1PG0A 5A5VA 2PCJA 3A04A 4TV9A 5G1PA 1D2CA 1UC5B 4MV5A 3H5NA 2FP4B 2G0TA 2QQEA 2RBGA 2RCYA 1YOBA 4UEKA 1T35A 5CPFA 1YIDA 1U3UA 3FWYA 3HWSA 2FMTA 2X9LA 5LZ2A 3K16A 4YI5A 1Y4SA 1V3VA 3LGSA 3OX4A 2VSOA 3ZU4A 4YRAA 1MT3A 4HC4A 4ZVRA 1E2LA 2I1VB 4BFSA 5HJ5A 1YB5A 1BWSA 3AF5A 4L95C 4A5SA 1N92A 4IZ6A 1T1GA 3CT4A 4MI3A 1E2MA 4TX1A 3KQHA 3MC1A 3P97A 1OTYA 1A9YA 4XSVA 5CT6A 4AZ3A 1F5NA 4CLDA 2LKDA 1M1UA 2VOEA 3DMRA 1A8UA 5K0LA 3DWFA 4A6XA 1NR7A 2RMKA 4DM3A 4DLNA 5BWLA 4RTPA 2K5UA 1FEZA 1CD5A 4HB4A 1Q7CA 4BKOA 2VTBB 1BWRA 3QVTA 3BK2A 2ZGVA 3H8JA 3G1TA 3D3WA 1WXGA 1G9TA 3FKSD 1GLGA 4GM1A 2IL1A 4DQDA 2UKDA 5ADWA 1FDSA 3D9QX 2APJA 1ZJZA 3ZGZA 1OH5A 3O8NA 3CIOA 1KZGB 1IN7A 2C1XA 3ENZA 3REFA 3C39A 3SZUA 3UMYA 1I51A 4N5LA 3VZPA 2FCRA 1XG5A 1GNTA 1XKLA 2ZREA 3QEMB 4UCWA 5D5PA 5BW6B 3OSUA 1A97A 2PZAA 1F2UB 4ECAA 5AKJA 1QZTA 2FR8C 1CRZA 2HGZA 2O3RA 4Y2UA 4Y2VA 4D0LB 3KOYA 5B12A 4GM4A 5BR1A 3QVGB 2ZUDA 2QXTA 4RGYA 5GJBA 1JHOA 2X5KO 3MJFA 3A1DA 2BAGA 2NZJA 2WHQA 1DEKA 2XRFA 2ZROA 1GEEA 3P2OA 1BDMA 5JAMA 3IUYA 2MIIA 4O4JA 1MJGA 2V4ZA 3PUVA 4L4YA 2WLTA 4ZYVA 1GT91 3DT6A 1BOOA 2JRCA 2WFZA 4PXYA 2R1VA 2H7YA 4WPGA 1T5OA 3UMGA 4ZJUA 1QC5A 1ADYA 3EWNA 4GWLA 5HQTA 5KYYB 5LN1A 2BFFB 3P2IA 1V11A 4N3GA 2AN4A 1A9XA 2FVXA 3AP1A 1D0SA 1TRHA 5CNKA 2GS9A 5HR5A 1ZCBA 3T1VA 1A50B 5H8WA 4Z7OB 4NZOA 5BSEA 4BNTA 4QXAA 1BEEA 4FZJA 2YXLA 4KAJA 4Q66C 4RK6A 3U17A 4DQVA 4N48A 1QVVA 3CKLA 1W2GA 3WK8A 3ZXXA 4TZTA 4EJSB 1WW2A 2KI5A 1JIXA 3BE5A 4HLNA 1EIZA 3QGMA 1NONA 4KR0A 4UAJA 3AT1A 4CTMA 4P93A 4OL9A 2FPUA 3SVZA 4XVCA 1P45A 1Z2EA 4PICA 1M2HA 1L5SA 3CE9A 4XGQA 2CFSA 3EZXA 4F86A 3V1UA 5CUQA 3F8WA 1L5GB 2EKQA 3QX3A 4QUAA 1MNQA 1G66A 2JH3A 3N2EA 1KQOA 3C8MA 1Z5WA 3B8EA 4U8GA 1FY2A 1SKAA 2O7SA 1IEXA 2GZDA 4A0QA 5FOWA 1RHRA 2P5UA 4CPDA 4DCTA 2X7XA 3A14A 1PLKA 2C0CA 2YS6A 1C0KA 2VDWB 3D59A 3WICA 1KYVA 1MAHA 2WUVA 1NG9A 4EARA 2W48A 5HTOA 4ESVA 3C3AA 3C8DA 1QGZA 5IDQA 2DF8A 3T5DA 2HW8A 1O95D 2WV9A 3WYCA 1ZHFA 4C20A 4PC2A 2HDHA 4EJSC 2QRVB 7MHTA 1SC3A 1E8DA 1US8A 1C1XB 2A33A 3B51X 2V65A 2VHZA 2RAUA 3K9GA 3UZUA 2FG5A 1T5IA 1QORA 1C1YA 4Y9UA 3IELA 4KH1A 4AP6A 2AE1A 3G8DA 1C8VB 3DW3X 3WHPA 1VKOA 4AMBA 1B8OA 4GFDA 1OTXA 1QO0D 1FNBA 1Y9JA 1AF4A 2BFCB 4LZJA 2V6GA 4ZA2A 5IKPA 4C7OB 4UHDA 3WLJA 3HWX1 4DPMA 4BNFA 5A5DA 4FKBA 2PPVA 3L1VA 4C4TA 1JS1X 1TYZA 4XB1A 1NW7A 1NF9A 1R8XA 2JASA 3GG2A 1OXXK 4KRGA 1O89A 2BGUA 4MP3A 5DXFA 2OXFA 3ISJA 4G0OA 1B0PA 1XTSA 1XYVA 1QO9A 1NFRA 1OFUX 5I7AA 3KS9A 4AXBA 4PNPA 1T1IA 5HXAA 2YL2A 1BFUA 3IPCA 4PPFA 1JDUA 1J1ZA 5KCMA 2AG8A 2D2VA 3BHIA 3JTMA 4AN0A 2EEPA 1BS9A 3IHLA 2HQSA 2P3SA 3LLMA 4OJTA 1LDGA 4X00A 4C04A 3BMQB 2VWHA 2EJWA 4NV1A 1Z0IA 5ECDA 4MW2A 1C7QA 1DO8A 4IUBS 5DPMA 3Q6IA 3SQLA 3RSOA 3T5MA 3G2PA 4RJJA 3A6FA 1HRKA 4HDCA 2XCRB 1QU3A 3TW8B 3HJNA 4ZVMA 2VRBA 2V5AA 3QIVA 4QDJA 1JHPA 1KEEB 2Y76A 4L6IA 2H57A 1CUHA 3GLHB 4RXUA 3GL9A 4RC9A 5KYNA 2VHUA 1EWYA 3EFOA 1I0ZA 5CDSA 3GZ4A 2QTHA 2X8JA 3K4QA 3Q7IA 5C18A 2M6RA 2VSXA 2FRVA 4JBWA 4B75A 4XGIA 3RDPA 4LJ7A 4ZDJA 1T9GR 4KSYA 1JSXA 3L1UA 1FQOA 4MUHA 4NBLA 3QSGA 1RI4A 4Q24A 1CNEA 4QPZA 1CYEA 3L4EA 2XRZA 1WXEA 1ZGAA 2F3UA 5E7IA 2HMYB 3GYBA 4PYNA 4HY3A 3FDXA 3BCSA 1EUCB 2IQ5A 2WD7A 2ZTLA 5B6PA 5DLPA 2O6LA 4MX8A 5JCOC 3O0TA 3CVJA 1JTFA 4FNAA 1D07A 3IAAA 3K5WA 3H65A 4MP6A 2H4YA 5HFNA 3F8TA 3BFJA 3GA7A 3KJHA 3FTPA 1ZW6A 5KO2A 3LC2O 5JJ5A 3A6JA 5ALZA 3H9GA 3TQHA 1LPSA 5KPJA 2M2IA 4WFJA 3EY9A 3II6X 3GRPA 1N75A 3K30A 3M3HA 4BVJA 2V1UA 3DXYA 1R6TA 2OXEA 4FHCA 4EELA 4J49A 3BH6A 4GEKA 4NYMQ 1U1IA 1KAOA 5IVPA 3NHRA 4L5IA 4AZ3B 4TLMB 2IHJA 1JZSA 3FJ1A 4YXWA 3THSA 5BNZA 4EW2A 2IBSA 1ZEMA 1AMNA 2R66A 1PT8A 4BV3A 4DSTA 1O58A 3K94A 3PL5A 5IJZA 3A6LA 5EGSA 4M0PA 4BWYA 1MB9A 1QDLB 2CLCX 2YMMA 3E7WA 1JJFA 1RAAA 5BV2P 3UMMA 5GJWC 2FF7A 4ONEA 4D74A 5MFPA 1F2VA 1E69A 2H3HA 2QYOA 4Q1BA 2DPGA 1HEUA 2G4LA 3L1IA 1U3WA 4TTQA 4G37A 2WINI 1AG9A 4XYMA 3SC2A 4CFYA 3SXJA 4RCYA 2C1EA 4AF8A 3V6MA 1J0DA 4IG9A 3Q8LA 4R1TA 1CSEE 4UFOA 4XM0A 4N40A 2W2LA 1SQ5A 2TMKA 3QWAA 1A71A 2A84A 1UAYA 4U6SA 1P7PA 4C6HA 2C88A 3RS5A 3BRWD 1R6AA 2XYPA 9LDBA 3GJTA 3R9WA 3U3KA 1I1QB 2AOXA 2I3ZA 4QTUB 4DCJA 4G63A 3J81A 2V0GA 1QC5B 3UW1A 4R51A 2C7PA 5B3JA 1T0IA 5I7HA 3U7HB 1ZP6A 2CBZA 2J6HA 2XWSA 2Y0EA 3WKEA 1C1HA 5LA6F 1XWWA 3WFIA 4YJ3B 4QJIA 4YJGA 1YFZA 2VRCD 5EN4A 2EJBA 2IYVA 1UANA 3B1KA 3LNTA 5FL3A 5ARDA 1G60A 2KB0A 4CTNA 3OFKA 4AUMA 1ETHA 3DL7A 4U5QA 4YHBA 1DG9A 4A91A 2YUIA 1ZWLA 5KCZA 4IZIA 2XWQA 4PIPA 5JVDF 1ZCAA 1CBUA 1QSGA 4I50B 2COEA 3MQ2A 3I1JA 1B43A 4KDRA 1ESMA 1X7ZA 1N5RA 4BU0A 4YMHA 2HTFA 2GN6A 5HIAA 5T6MA 2I3AA 3H9EO 1NVAA 1NSTA 2EW2A 2IYAA 2JAPA 3TSOA 3RFTA 1CNFA 3KFLA 1ATIA 2VBFA 5ELMA 4TXMA 3R24A 1ILEA 1N6HA 5FPHA 3JYOA 3HSSA 1DP4A 3QKIA 3ZD9A 4QJ3A 1A9RA 3KEOA 3WL8A 2OO7A 2FEXA 3C85A 4DIMA 1SVSA 3HI6A 4BVHA 3VA7A 4X1KA 4KDFA 4EYEA 1PSZA 3E4DA 1U1GA 3QFTA 1KHHA 3ECCA 3T5TA 4D9KA 1Y5LA 1DHTA 3FPLA 1ZLYA 3BD6A 1US8B 2JCGA 5F21A 3LZDA 2JFVA 3SYKA 5E8JA 4DFDA 2QUKA 1V37A 3RUIA 3ZHOA 2X40A 5ADHA 3L0YA 1PHPA 3SG0A 4MGEA 4DCMA 1JG7A 5COQA 1GTSA 3PRJA 2PL9A 1OFVA 4JMLA 4MEBA 1PNRA 1NW6A 1GGEA 2O8DA 4RLHA 5AJUA 2QLMA 3EEOA 3QUCA 2HREA 2YOFA 2OAGA 1E3JA 1HFWA 2HCJB 3AOEA 4RETA 4FBGA 3OJOA 3ZGLA 3PCXA 4G24A 421PA 2WUEA 3GRCA 3TOZA 1KJ8A 3HJBA 3RF7A 3KE8A 3LCCA 4DR3B 1NA5A 1E9CA 2R9VA 3BRCA 3OPVA 3Q1KA 3JVIA 2YRFA 2Q3LA 3ANTA 4GUDA 4BMZA 5E3HA 4Z4CA 1Y4AE 5CH3A 2HGSA 4EQ6B 3S8EA 1EWQA 4YCMA 3IKLA 2ZTSA 5GAJA 4PYQA 2BKVA 4DZRA 1ML4A 5LYJF 4WKGA 3OH8A 3USCS 2QSZA 1Z06A 4G3XA 4GOND 2Q3EA 3NR2A 3PFBA 2RGYA 1CUFA 4NABA 3JQGB 4IQ0A 2B82A 3WRYC 3IMGA 5FV4A 1CZNA 3K8ZA 2C4KA 2XT0A 1U90A 5ITWA 3SGLA 2IEGA 4HDRB 1K8YB 3T3EA 4RIHA 5HOEA 1LDMA 2R48A 1QYDA 1MOPA 3AFGA 3HG7A 4FMCF 3P2MA 1KY2A 4LWOA 2P0EA 2P9HA 4IUCS 5BRNA 3ICQB 3TDNA 1BS2A 3QENA 4TL8A 3B38A 2LW7A 5IH3A 1JFVA 1JR2A 2OK8A 4CIWA 1BJTA 3LKVA 4JA0A 2LNDA 2B25A 4MR8A 3B53X 5LQMA 1UZLA 2V0NA 4QYSA 1H93A 1QHHA 3RS4A 4YAFA 4QA9A 2EX4A 2WD7B 1CETA 4M8LA 3KZMA 2EX1A 4PTLA 4OFXA 4L3VA 5F51A 4D82A 4FT4A 3LVBA 2JBAB 1S9HA 3C6KA 5D85A 1PFKA 3DAOA 1XPOA 5F9FA 1NT2A 1VRVA 4GX0A 3FBGA 3ZTYA 3R7SA 3EZ9A 4WXHA 3E2IA 4OBBA 3E9RA 4FYJA 4RTJA 4FBLA 3TDKA 3ZX4A 2HF8A 4QDTA 1CEYA 2ZBEA 4Y7CA 1F8FA 4ZVNA 3AETB 1SQFA 1N3YA 4DSOA 2XVMA 3AMVA 3U61B 4HZUA 4OA5A 3GFBA 3TQSA 3CF6R 4JP8A 1E32A 2IUUA 3TSAA 4BMNA 4NU5A 1O9BA 3EGEA 4A4DA 1OA0A 2OR3A 5D8DA 3PLAE 3G2LA 3PRHA 1JPNA 4QUIA 2Q2WA 1UT8A 3EQ8A 5BOSA 3GLIA 3RC7A 1QKKA 4JOQA 5K4GA 4IGAA 4AZTA 5DISB 5ECYA 1ZGGA 2SNIE 5EINA 4GXTA 2QY6A 1VLMA 1VLZA 3EXG2 2IXTA 1KR2A 5DI9A 2XMBA 2Z3WA 5JISA 3A9CA 1IVYA 2B0CA 2JFZA 4KNWA 1XA0A 3HQ4O 3LQRA 4CMCA 2O8EA 3D31A 3FVVA 2CW5A 4PCLA 3SJZA 3V7UA 2B7BA 4EVRA 3RSSA 1M83A 4ZOLA 5BSFA 3IDZA 5KMGA 1ZSVA 1NLUA 4N4AA 4ZCIA 3U5TA 4HGNA 3HKCB 2O14A 3T61A 3ROGA 3S2YA 5B36A 3S3TA 4O4HB 2YZGA 3JAKA 1RYZA 4L73A 4S24A 4ERXA 1ABBA 3OEWA 4EGSA 1SOWA 3ICPA 3A3KA 2OAEA 4I4IA 5SICE 2EWVA 2V3CC 4ZEOA 1FZQA 5HUJA 1VMEA 3ZCPA 3OC0A 3HDGA 5AOAA 2VF2A 4EKGA 1NPTO 5G0VA 3VTFA 4F56A 1T3LA 3G82C 1W5EA 4CWAA 1YK0A 3DEJA 1QZ3A 4GP6A 4EB8A 5KVSA 4AJKA 5AI5A 1NX9A 2IK8A 3KQOA 4EQ6A 1P0QA 1PNTA 3QE2A 4MUEA 4P36A 4UM8B 5COAA 4A8JC 3OTQA 4TMKA 3UN1A 2B4KA 4BB0A 3OIUA 2B1GA 1PKEA 2J3MA 1L8XA 1D1QA 1R0KA 2XCLA 1T2FA 2X9QA 2Q3BA 2BL4A 2JGRA 2ORWA 4C7JA 1Z63A 4OP2A 4U00A 3DDZX 4BFVA 1G7TA 2O3SA 4N65A 4YRTA 4MKRA 2YBDA 5CW2A 3WDSA 1IQPA 5K0CA 2V5UA 2OFFA 2X0FA 4HS9A 4Y1FA 2AQKA 3MCVA 3EG9A 4YK7A 1XT6A 1CU1A 2WU1A 5EZQA 1UXJA 3IOEA 4EVIA 1N33B 4CL2A 2J32A 4US0R 1F7UA 1LNSA 1EUYA 4DUGA 3OZGA 4R2XA 1ABEA 2QUHA 3G1WA 1HX7A 4CI0B 1I30A 1P3JA 1UPFA 3MK31 3RWMB 3H84A 2QK4A 1FFHA 4J6EA 1GTJ1 1LC3A 1EFPB 4TTTS 3R09A 4KZKA 3WZLA 1YBAA 1TQ8A 3T52A 5FKJA 1YBVA 1V41E 4QUGA 1VYTA 4BLRA 1GNPA 4JASB 3LO8A 4DZZA 3IP1A 4Q1CA 4D98A 3ANLA 4LGVA 4OQPA 3WZ2A 4ENSA 5IASA 3I37X 4PFKA 1EUZA 4GQIA 2RHJA 2Y1LA 2FWAA 3OMWA 1FZTA 1N78A 1MUUA 3A1SA 4KXXA 3RAFC 3DKPA 5JWHA 3TVYA 4HAUA 3UYKA 2VWQA 3DUFB 4MQBA 5I9BA 4JJ4A 3PXGA 5K0BA 1QWSA 4R1UA 4RJIA 1S2NA 3DFMA 2Z4RA 2FN7A 4UU0A 4EAAA 3QMMA 3ZIAD 1IATA 1KORA 1G55A 1XZIA 2IE8A 3FCSB 1B8UA 2H52A 4KQ2A 4A0GA 4CBVA 2QL6A 2I99A 4B31A 1FTGA 1X7WB 2WWIA 1JDNA 3EIOA 3W5AA 4LYGA 2VYCA 5J3JA 1P80A 1HGXA 1QP4A 3U4MA 5JZMA 2AUNA 5M7EA 4HVCA 5HCUA 1W44A 3LVQE 4IZHA 1XXHE 2QT0A 2ZE5A 1Z33A 4RO0A 3RG8A 4BE4A 5C5CA 1T6YA 1F17A 3AVTA 4B3BA 2P68A 4PYRA 3EW7A 1RBYA 2MT9A 3A3NA 1ZO8A 1TE2A 2NW6A 3DMTC 3M6IA 4OHPA 3E5RA 2EDCA 1QHSA 4QAQA 4B3IA 4V1CB 4RTRA 3TTVA 4BY9E 2HSJA 5ICGA 3R3XA 3W2FA 3N2YA 1MXHA 2WIDA 3AOEC 3C3XA 2PVSA 2F1HA 4ZV7A 2ZUTA 3OJWA 3QYPA 5JUWA 2IH4A 1WCXA 5LLTA 1VSTA 4GI1A 5AHKA 1T9CA 4ESEA 3ESCA 5CA0F 5C7OO 2GXUA 4PZZA 4FFVA 2BJVA 3C8UA 4JJZA 5IARA 1G7SA 2WVGA 1KDVA 4BV2A 3QE9Y 1Z8HA 4YLGA 5FOTA 5C2JB 1RJ9B 1DRKA 2O1WA 3D3NA 1FRVA 2PGLA 1GAJA 3NIBA 2O7NA 2VTVA 1H8HD 2D74A 2H2WA 3QMWA 4MR8B 4NVRA 4GUAA 4YJFB 4F06A 5HOQA 1QHHB 3ZWOA 4W9RA 1EJ2A 4ND3A 3O92A 4JBLA 3AJAA 3P32A 1D04A 1T3SA 5EWJA 1M2FA 1G2QA 1EXMA 5TGTA 1HT3A 3QU7A 4AF6A 2BGGA 1TLLA 5U4XA 1D4FA 3K1TA 5H4HA 4FYWA 2Y0BA 4MI9A 1K08A 3QFHA 2A35A 4BN0A 1RPJA 3DFZA 4R8MA 3NU1A 3NV9A 1JW9B 4K81B 1Z39A 4OSOA 1X7XB 3P9SA 2NPFA 4HZUB 3WLPA 2P9EA 2XV1A 4YRJA 2A1UB 2OC4A 2VJOA 4BJHB 2X9GA 2ZJZA 3QKWA 3CNQS 3E1GA 5JAZA 3GLIB 5BOSB 2AD1A 5JMPA 3L1HA 4WBNB 4ARIA 4I14A 3KBOA 2VPPA 2IEBA 1UXOA 1JJBA 2VXYA 3D8HA 3ZC3A 3I1YA 1Q1NA 1T36A 3CM0A 3C2QA 4OQ4A 3VHLB 1J42A 3KYJB 2IZZA 1O5IA 2GOYA 1UFOA 4F1WA 4NOLA 3NVMB 2VNSA 2FE1A 1T9HA 4RPJA 1ZXLA 4Y1RB 5THKA 3RYIA 2NT3A 1QFXA 4KB5A 3RBZA 3TRFA 2C83A 3OM0A 4WKBA 2GI4A 3AJ9A 3DXZA 4OA8A 2ECKA 1H9AA 1RCTE 1UQRA 1QBGA 1WVMA 3JAKB 4DOMA 1WW8A 4D6PA 3AY7A 4NCHA 1PWXA 3GDWA 1TO6A 1C3OA 1P0PA 3MJRA 2PRZA 3ADBA 3PX2A 4UZEA 2PCLA 3O84A 2HK7A 4M1KA 4ZVOA 3P20A 1XTBA 3LZ6A 1ACJA 1DBSA 2XIQA 4GOOD 3KXKA 3AL0C 1G3UA 4ESOA 4JN6B 4QGBA 4FX2A 2A5YB 4I19A 1JXMA 1FVOA 3QU9A 1QIDA 2SHKA 2H1VA 1LW7A 5FDFA 3KTFA 5FBRB 3E35A 5T3UA 4BP9A 4E32A 2CHFA 1ZH4A 1M7HA 2RCNA 2EFCB 3OEED 2Z2JA 4UD6A 3PRYA 1EFUA 1PR1A 1NAIA 3UMVA 1B0AA 3E2MA 1IAVA 3NATA 5E9WA 6Q21A 4UM7A 2FK8A 2H4WA 5BUCA 4BTEA 4H15A 1I3MA 2GK3A 2QRUA 1QG6A 3FFWA 1FTSA 2GTPA 1XTVA 2QY9A 1NVDA 1U0OC 2DLDA 3GLRA 5DGIA 1EVQA 1VE6A 3UH0A 3R5KA 3EUFA 3PGKA 1MV5A 4FW8A 2FETA 3BSSA 2SBTA 4TPKA 3W7AA 3ZU3A 3SWWA 4EJMA 5DE3A 4DMCA 3BMOB 1SB9A 2IU3A 5CHYA 3R74A 4DABA 4G8CA 3OJCA 2GHIA 1LWOA 4EFKA 1TRKA 2TMDA 3MLEA 3VKGA 3PT9A 4BQEA 2QM3A 4TWIA 5BWCA 3ULKA 2I4RA 3EDYA 5A6SA 1Y6GA 1CQJA 2ENWA 2YW9A 4ACBA 2WKQA 2YXPX 4QG3A 4DLLA 4FPXA 1GOTA 3KYIB 4D8UA 1JVSA 2AJDA 4B6SA 2PEZA 2JDIA 1E7WA 1BCSB 2AMVA 3CCCA 3ME5A 3RVNA 1XD9A 1YQWA 3E9QA 3V2IA 2ZIAA 3FTFA 4UDXX 3L7AA 4Y2SA 1DC3A 3MD0A 1NWCA 1ARZA 1YCDA 3CKMA 3PHHA 5EXPA 2WI8A 4WESA 1DIOB 2XECA 2QMUA 2GXQA 3PDIA 4W5JA 2I7DA 4MVJE 1CZRA 3WDKA 4RESA 3BH7A 3ZW7A 1X9IA 1TX4B 3LXXA 4DMLA 2WJYA 3PJGA 1J24A 2GZMA 1ODFA 3O4HA 4R4JA 1JEJA 4P3PA 4AROA 4BNMA 5JADA 5JZBA 1SIUA 2OBXA 3DO5A 2GEVA 3AF2A 3AUSA 2NSYA 3BWCA 1WVGA 3AHDA 4G1EB 3OPMA 4YRDA 3OT1B 3TLKA 4HTAA 3KB2A 3OE5A 4MYTA 5EPEA 5FWDA 4HDSB 4KGVA 3D7RA 1EZ4A 3VTZA 3SLKA 2M98A 3X44A 4MQEB 3ITNA 4QBIA 4EFMA 2G8LA 4B47A 3PDHA 2PJZA 3PXDA 5BNIA 3RC1A 5HKKA 3IV7A 1MVNA 2QBYA 2AHRA 3K4PA 3QG1A 5KWIA 3QM1A 3CWZA 1AKYA 3GZTB 4ZO7A 2JK0A 2C9YA 2FSIA 2Y1FA 3L1JA 1QAMA 4FLEA 1KBZA 1U2TA 1XZDA 2EQ5A 1JR3E 1RLMA 1WABA 2E5WA 4QEZA 5KWEA 4QQKA 1VG9B 4I9GA 4UM5A 4JENA 3Q2KA 5IJWA 1T2EA 3TL6A 3A4LA 1HT0A 3BMNB 1FSZA 3HL0A 4L3OA 2NTVA 3CVOA 5F9HA 1LUAA 1QHEA 3VZQA 1YGPA 2P90A 3HBAA 2A0YA 1RWBA 2OZEA 3LO5A 4DCSA 4KFCA 2WC1A 2R6HA 3BFVA 3RM3A 2QPLA 3M6WA 1Z0DA 2FPGB 2VJAA 5HM6A 2PZFA 3COVA 2FX5A 4FE7A 4MUNA 2WWFA 2GUWA 5I51A 5CLGA 1ESEA 2ZBRA 2DFTA 4ZRNA 1A98A 2FZLA 2HMAA 4IF6A 4BC1A 5HKAA 2VPQA 3R7WB 1XRJA 3OX1A 5AJWA 5EJ5A 3I58A 2BFBB 4XFKA 3MNFA 3OPYA 4TS1A 3V00A 3L8FA 3ZWAA 3GLGB 3ROKA 9GPBA 3C98A 2PD4A 2VK1A 8ABPA 2XBLA 5KKNB 5I4BA 5IDWA 3ZVRA 5FA8A 3RQIA 4E09A 1P4SA 3I8XA 3O1JC 4HCJA 4RFLA 5A7HA 2V7VA 3TH5A 1I5OA 1TZ2A 1GXSA 1T8PA 1AS2A 1AK1A 2H1LA 1IRIA 4KXFB 4CRWB 4MA0A 1XEAA 3ZXYA 1SULA 1SUDA 1WU7A 3FGOA 1QRDA 3FR7A 1NHWA 1W36D 5AUPB 3CIFA 2F4VB 2G1JA 2V9ZA 2XJ4A 4AY4A 2W7TA 3NVAA 1GFZA 2Q5IA 3GJ5A 1IUOA 5FI5A 3FOEC 1LVHA 4RYLA 3IUBA 3G2HA 4EDFA 5IFKA 4JEUA 4KQ6A 3JVEA 4LOJA 4UHHA 2PKYX 2EZ4A 2PVPA 3B7WA 2JJQA 4DLBA 3QXGA 1I7SB 3U3JA 4OHKA 3VZBA 2VQSA 4EW3A 5B58C 4IDCA 3AHIA 1DO2A 1WHTA 2ZT5A 3ADPA 2WRZA 3N75A 1JHQA 5K8JB 3E9DA 4Q9KA 3CUUA 1NVUQ 3CJTA 4NEHB 4RE6A 2X76A 4X64B 2VR1A 3AQ4A 1A8IA 1KQFA 3F4LA 3WB0A 2AQ8A 1IVNA 3I6YA 4MCAA 3NO4A 3Q7QA 2GYYA 2PQMA 4Z0NA 4BKQA 1BYUA 1MOQA 2YXBA 1QFMA 4GRIA 1N5OX 5EQDA 1R5OA 1OXKB 1XTIA 2E49A 3H4MA 1OAKA 4LNAA 4YONB 1CDDA 1PBNA 3U2QA 1DCTA 1OX4A 3PUWA 3OJXA 3OX2A 3BGVA 3IPRA 1ZJ6A 4R8SA 3FYTA 4EB6A 3N5CA 2V6JA 3RUHA 1AB5A 1RI5A 2F1OA 5DFAA 2X6TA 3I6MA 3H1BA 2BP7A 1ANKA 2Q5CA 2BHSA 2HHLA 1WQ3A 5FCDA 3FUXA 4FT2A 3WIEA 1KGDA 2P65A 2EG9A 4GXNA 5AD1A 3NWEA 5JAPA 1XXHA 4TMXA 2OY0A 4TT8A 1C3OB 3RU7A 2Q6OA 1XRQA 4P3KA 2WJWA 2ECOA 4PVDA 1P1CA 1E5QA 3FYCA 1VJDA 3AR9A 4Z9FA 3PPWA 2FJ0A 3DOJA 5IUKC 3H7AA 3WGZA 5I5EA 1IN1A 2B4AA 2CXQA 2WPDD 1HURA 2NNLD 3BILA 2AC4A 4LJSA 1OB5A 2ID7A 2JLZA 2QQGA 1T0PA 1V3QE 3LSTA 1CR0A 1E6WA 5K45A 1WQ1R 4PYOA 2MINA 2JFPA 5UKDA 5JYDA 2QOEA 2VK8A 3HKBB 3QUTA 4H7KA 4QTZA 4Q7LA 4NZMA 4MUIA 1N2XA 5P8WA 2WWVD 3HS3A 3SYLA 1Z7GA 2LCQA 4UHEA 4HATA 4D4IA 1Z0KA 2CXHA 4B7ZA 5IVIA 3HM9A 2JLYA 1J9GA 4R1SA 5DX1A 3WSWA 2VDNB 4K6MA 3O21A 2EGUA 4CHTA 2GEJA 3D0KA 4F91B 4YUZA 2HK6A 2JI4A 2R44A 5DM70 5FV7A 2EZTA 1KZ1A 4KLCA 1FS4A 3HN6A 4B3JA 3WLNA 2XNKA 1AIPA 1PGJA 2QVYX 5M2QA 3X1DA 4MW5A 3WMWA 5A6VA 1J8FA 2ISSD 1D0VA 2WJGA 4JLDA 4R3NA 4ISBA 4CNQA 4RXTA 5EJMA 3NEYA 1PYOA 3TS1A 4DHWA 4JQCA 5KYWB 1QK5A 3W5BA 5J63A 2Y0DA 2OO5C 1IG0A 1NLFA 1OV4A 4QECA 3V1NA 3B6MA 1G18A 1HTBA 4J0GA 4KLAA 5LQAA 2Z8YA 5ISMA 5IS2A 4D0RA 1CDOA 2EZ9A 1PR2A 3EXFA 4LRSB 4Q3BA 1J7JA 3MWDA 1ZD4A 2GXSA 3DE6X 3DP7A 2XNDA 3GJ7A 2C77A 3TM4A 3JZIA 2JCYA 3Q3CA 1OFTA 2GPJA 5DI3A 4IVQA 4J1SA 5EIWA 2QRJA 2RFLA 2UZ4A 3OC6A 3V32A 1KZ6A 5A1TA 1F4LA 3DO8A 2R7NA 2ZSJA 4OUKX 2I8AA 2B6NA 2D7JA 4U9UA 2ZEJA 3UKDA 3N39C 4Z4FA 2WYVA 4J0IA 5EIFA 3I4FA 1EIWA 5DMXA 3KV3O 5DSZA 1JHDA 3VH4A 3HGTA 4TMYA 4J16A 3BE8A 4X24A 1ZKMA 3RFUA 1V71A 2PKWA 1P72A 2HSWA 1QIMA 3PHLA 4Y67A 1ECCA 3VVCA 3TG8A 3G5LA 5C8YA 3ZG6A 3V2UA 1YQQA 2QBYB 1L7PA 3KELA 4FGUA 3WL6A 3PHJA 3OVMA 4EABA 3IJRA 3OP4A 1OMOA 5JEDA 1XKTA 4ZQEA 5G0WA 3VPAA 2C8VA 4TYMA 2H1WA 3AUAA 3AY3A 3FJOA 4CIBA 5LIPA 3RTGA 2GWHA 2ONCA 3K1AA 4C4OA 3AIKA 3OQVA 1Q3TA 1SAYA 2DPXA 3NHSA 1JSRA 3Q7PA 5AM0A 4LDPA 3S40A 4D57A 4Z4IA 2QJFA 1XNHA 3WTBA 4A2WA 4GPBA 2WVJA 3ICWA 2WM2A 1I80A 2JH8A 4IIEA 1EDBA 1THZA 5F5NA 4OSEA 4ZCLA 2XZOA 3L0ZA 4OAQA 1Y3AA 2PU7A 2CL7X 1WUHS 2AOVA 2BGIA 4C7VA 1TQ2A 3QU4A 1N5DA 1RPTA 3ETDA 3HUEA 3I64A 1ZK2A 4Y30A 1SU6A 1ZHHA 3VNSA 4Z54A 3KUUA 2ZR7A 3GPCA 1U04A 4KN6A 4F60A 4MW7A 3PC8C 3F6BX 3QNWA 1Z35A 4HWTA 4IHKA 4GD3Q 1VJRA 3HP7A 4I81A 1UF9A 2DGDA 3A9WA 4Z7QB 2AT1A 1XQ1A 1BX1A 1BKYA 2VOJA 3WRXA 1K6EA 1NM5A 2CJXA 4IPTA 5JBIA 1AV7A 4L8FA 1P75A 2HU5A 1TCVA 2QMYA 4MRMB 5EJ7A 2N1MA 2ZE8A 4XWOA 5ARBA 3FJYA 1KNQA 4BYGA 4NMLA 4OY3A 4QSHA 2VFAA 1JIIA 1W8DA 4TMZA 4WCFA 1DC4A 2R65A 4UQLA 3HJFA 1QZXA 1S8NA 1Z4PX 2J07A 3MT7A 1ZRMA 2GESA 4EF5A 1P4GA 1L4KA 3OHMA 1USKA 2Y93A 1F4VA 1G3QA 3AR3A 4BO4A 5LMZA 1FNMA 4L4SA 2YZNA 4EUFA 1X70A 3IUPA 1TB4A 2O5EA 2Q5JA 2ST1A 2XNCA 4N6OA 3VPFA 4OLHA 3OFJA 1RQ2A 4JKOA 4DVGA 2JAQA 2FRDA 4V0NA 3UQYS 1VCNA 1B4DA 4NMMA 4P84A 4W5HA 4K05A 3SXUA 2FSVA 5BN5B 1EVIA 1SVMA 1WHTB 1L1QA 4PM4A 1Q74A 4ARAA 3UOWA 3U4HA 1L9KA 3ITDA 4EG7A 2QD2A 1A88A 2V0CA 1ZN9A 2WVAA 2GEFA 1PG2A 1WDWB 4B4WA 3KZKA 3WMGA 2J9RA 5EXXA 2AQIA 1YAJA 4MVJA 4GMFA 3FTDA 5A62A 4TZ0A 3VH3A 4J4HA 1PS9A 3R6GA 1Y8QA 4AXXA 3FIUA 1R0XA 3I62A 4WD3A 3PCTA 4MICA 5AYVA 4ADSG 3AZOA 3SXPA 2VSYA 3JWIA 1CYDA 2O2CA 4PGFA 4C4XA 4RM3A 4EB6B 4KIGA 4O4IA 5J47A 4OXRA 4YR9A 1WETA 1KI4A 4GC9A 5GWXA 2GF2A 4GKAA 1S8OA 5F5LA 4BEWA 1ZN8A 2CMGA 2G5TA 4GO1A 1R12A 1S2IA 1JA0A 3MS4A 4Y2GA 3TQIA 3VMFA 2P2YA 1WKCA 2L0XA 3KEFA 2UZ0A 2BV3A 4C5AA 1J2YA 3GEPA 1JR3A 2GBLC 5JD5A 2XY4A 1PQPA 2H9IA 1Z0FA 3OQMA 1OYOA 2PGJA 4XIJA 3QOXA 5FJJA 3WLOA 2IA5A 1URPA 4ZZ2A 1E2QA 4N49A 4B4UA 3JQBA 2XCUA 3DTVA 3IBGA 3W3ZB 4FFBA 4M8IA 2JIMA 4RKQA 3TXYA 2Z56A 3QBVA 2CSUA 3F3KA 1N7GA 4H0CA 2IUEA 5CH8A 1DRVA 1TZKA 3FA2A 1DJOA 3UY4A 3VPCA 2PUBA 3UB3A 4P9NA 5TB5A 4A5OA 1P6XA 4OLJA 1P5HA 2MSNA 3AG6A 3O4FA 2MINB 1RHKA 3DE2X 3C70A 3NWJA 2C78A 1UBSB 4WOBA 1XA3A 3FHJA 3LYLA 4MS1A 2HIHA 4XFJA 2PTHA 2ZP1A 3D7KA 3ORRA 4J9VA 3IVXA 1KSFX 3PXAA 4KUEA 4CR7A 1NC1A 4D3YA 1ZU5A 1TVMA 1U8TA 1V1MB 3CUVA 3GNSA 3LHKA 2VUHB 3ZGNA 3M1IA 1CF9A 2E1PA 3AH8A 3SHOA 1ID1A 1G20E 1WXWA 1T5BA 1T10A 4M4SA 3BTUA 5LUAA 3LOQA 4IFIA 1G5PA 1RWWA 2CK3A 3UWMA 2V9CA 1OC4A 2H59A 2HBZA 2XRMA 3WXMA 3ZI7A 1L4BA 3TPCA 1I0LA 5FEUA 3AEUB 1L8AA 4MTLA 1MC4A 3NM6B 4IYJA 1KA9H 3MYRA 3C4JA 2VAWA 5D3MA 2O8BA 2H08A 3DOIA 5F3RA 4GAEA 4RKYA 1XMJA 2WFAA 3AU9A 1NOKA 3BOSA 1OLSA 4D3FA 3THYA 4AJEA 3RS0A 3QUBA 2PUFA 5KNBH 4ZT5A 1E6EA 1Z5NA 3EISA 2NUTA 3EXFB 1P3Y1 1G64A 4XX1A 1NBOA 5I9NA 3FWKA 5GOZA 3V8RA 2HTEA 2Q1YA 3IR7A 1PZHA 1MKYA 4HB0A 4M76B 4JKIA 3U7JA 1QYWA 2IS6A 2PMFA 1ENOA 1DRJA 3WLFA 5DI3B 4RJ2A 4IWYA 5KX5F 1XDWA 5BMVA 3DHNA 4QJ4A 1C7EA 1J8YF 2VDQB 3SBOA 2AI3A 3DOEA 4DLXA 1MX3A 3ES9A 4LY9A 2NAFA 4FE3A 1RT9A 1N5LA 4BBZA 2IP4A 2BEVA 3J81k 2NYAA 3SU8A 1ZK0A 5IUJC 1N8KA 1V96A 4LSMA 3TMAA 4DRZA 3JQ6A 4G0YA 2O06A 3K8QA 1F5SA 3CH7A 4RZUA 4XIYA 2Z1MA 3WKBA 1ZESA 1QXSA 1V3UA 2I2XB 4L07A 2F8SA 3ECSA 1JSCA 1X0VA 1JE1A 2OCYC 5H3HA 1AS3A 5DGTA 2HLPA 3IP5A 2E2WA 2P9JA 4EW6A 3B5IA 1B3RA 4EL5A 1U98A 3SVLA 4YP0A 4JIGA 1BMFD 1FS6A 1Z17A 4XZ3A 5DOVA 4RSGA 1Z22A 5G0UA 3UHPA 5K09A 2VPYA 1ZRSA 5KVVA 3H2YA 4P7FA 2DFVA 3IT1A 1U7WA 2GM3A 3BVPA 4CW7A 2OD2A 3GGGA 5BXYA 4N1AA 2P2LA 3I2JA 3NEPX 5F52A 4BO3A 5AVRA 3HFJA 4CVNA 2HO4A 1TT5B 3F90A 3LUFA 3Q3HA 4OHZA 1ZEJA 2JLAA 4YRPA 1ULZA 3MMSA 4J2TA 3D43A 2YQZA 4E51A 2O2DA 5SZJA 2ZB8A 3TMYA 2IGBA 2CLEB 2GYUA 3INNA 1FK8A 1OAOA 1QIGA 1EG7A 5FNVA 3B1YA 3K0CC 5KYUA 1GGHA 1L7RA 4EZEA 2QA5A 4D9IA 3LY5A 3OESA 1ADCA 3HWRA 1P7CA 1CFJA 1UJ5A 1OZ0A 3L04A 3BDAA 4G0VA 4GDMA 3WZMA 3W4IA 4C4ZA 1GA1A 1S2GA 3AERA 4PO9A 3KJXA 1IBRA 2QD4A 5ERGB 2QKYA 3KAJA 3KTOA 3OZBA 5ICMA 2C5FA 5KSPA 2IU0A 4G09A 3SHFA 2X23A 3VKFA 2H2IA 4WCFB 3NC1C 4N5MA 3ED1A 3EZLA 4H3KB 3TB4A 4B9AA 2WIBA 3P19A 3P0FA 4OXNA 3S29A 1W46A 2FF5A 5DYNA 1PWZA 2AMLA 3KG2A 4MGKR 4DR5B 2FW8A 3OHSX 6YASA 1Y4DE 3P4UA 2V7UA 4F3CA 6NULA 1KDZA 1JIJA 4IOLA 3IQWA 4NTZA 4ZQHA 3CZPA 2F1RA 4KDEA 3WRXC 5A04A 4WDQA 3IH5A 3QE0A 3KSRA 4BIIA 3BTVA 1OFGA 4B83A 4RHYA 5IHXA 2XYHA 3DL4A 3M4ZA 2QJOA 4LYAA 4EKNB 5C8VA 2VBCA 5IAOA 5LXTB 4CETA 1U7OA 2YR0A 4WCFC 3VNRA 3CINA 3B1ZA 1B6GA 3QX7A 3V2GA 1N34B 1WB6A 3CZQA 4JHLA 2VHEA 1N1EA 1R74A 2PHZA 3BWEA 3Q1LA 1QDEA 3EAFA 3K2QA 4E4RA 4REQB 4TTRA 1YC5A 2B36A 3ORQA 3MVEA 3VZCA 4YIKA 3HDJA 4MS4A 3PSHA 2XDWA 1W59A 3FPEA 1QIHA 3GPBA 3COSA 1LK5A 2REXB 3OECA 2JFOA 1K5DA 4R2HA 4P92A 1A1SA 3AJRA 1JXOA 4HVAA 3ITEA 4YQYA 3HYSA 5TVKA 3KOXA 3PWZA 1ILWA 4ENQA 3IOBA 1T5DX 2AFIB 1SXPA 4EG4A 1DB3A 3SF8A 1SG0A 1VM6A 2J5RA 3MMNA 5DHPA 1XYGA 3H4TA 1KMHA 4LGYA 3S27A 1FTQA 2YHIA 3DT9A 1UKVY 2EBFX 2W8BB 3DTVB 2GCOA 3GPIA 4K9RA 4YACA 5DGXA 3CQ9A 4JNCA 4WKCA 3UOAB 1FX0A 3AR7A 5IYZB 3PQ4A 5EKUA 5EYPA 1MPXA 4X7MA 1QRAA 3AHCA 4U4AA 3SBEA 1C7IA 5CLLA 1MORA 2A78A 3GUUA 3WR5A 4MWBA 2FXIA 4P98A 3ONEA 2FB9A 4EW1A 3TQTA 3FZQA 4X1YB 4UNRA 3H5AA 4RA6A 5EIBD 1Z6TA 1KK0A 1RHQA 13PKA 3I8OA 1K4YA 2GN0A 1KBOA 2VHXA 1H85A 3QK7A 1F4PA 2NV6A 2IF2A 2GBCA 3QPUA 3IQHX 3BEDA 1LNQA 3DEZA 1L7OA 3KUKA 1NV9A 1X74A 4HXEB 2QD5A 3TF5A 3D3JA 1FMCA 5DZSA 1KFEB 5LOVB 5DNCA 4CDNA 1U7ZA 3E81A 1FQJA 2P9YA 4JQOA 2NTYC 3VR2D 4GSKA 5AW8A 1Y5NA 2IPMA 1Z36A 2R84A 2JLWA 3KHSA