1EWKA

Crystal structure of metabotropic glutamate receptor subtype 1 complexed with glutamate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
477
structure length
448
Chain Sequence
RSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
publication title Structural basis of glutamate recognition by a dimeric metabotropic glutamate receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 159
structure length 448
sequence length 477
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewkA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewkA01
3H6HA 2JVKA 4MQFB 5IEBA 3N0RA 4ETMA 1LK0A 2WB4A 4MS4A 4YO7A 4N76A 2QW1A 3EULA 5IX8A 1VPWA 2GI4A 4XFKA 3IDOA 1TMYA 3IP5A 1NXPA 3LUJA 4NICA 3F6CA 4O1IA 4YWHA 1KRWA 3F7NA 3GYBA 3A10A 4N0QA 2LUOA 4MLCA 3SQNA 1D4ZA 3H6GA 3E3MA 3EJWA 1QO0D 2R48A 3C6QA 1YK0A 3CLKA 2E4UA 3I42A 4EVQA 1JFVA 3VNBA 4JB2A 1MAVA 4O1HA 2L17A 1A2OA 5CNKA 1ZY2A 1PHRA 5TPWB 3SG0A 4YS6A 4OLBA 4RXTA 4QYMA 3FFXA 1FFSA 3KYIB 2J48A 4RK5A 3HSYA 2MSLA 2B1JA 5JNRA 1ISRA 2BGGA 5PNTA 3NHMA 4JB0A 4RXMA 2CHFA 4RK7A 2QU7A 1JDPA 1NXVA 4LE1A 3C3MA 2E4XA 4MYRA 3RVPA 2JBAB 1F51E 3MM4A 4IF4A 3K9CA 3OMXA 2AYXA 4WXMA 3SAJA 1DCFA 1JLKA 3FDFA 4CBVA 2FMFA 2LBPA 3ILYA 1ZITA 3W9SA 3I09A 1MIHA 4DADA 5BQ3A 1GLGA 1TVMA 5KC8A 4G0XA 3QLUA 4IILA 5TQ2B 3QX9A 1KRXA 5B3JA 4RXUA 3BILA 1SXGA 3CFYA 1BDIA 5EWMA 1USIA 2HQBA 1E6LA 1LBIA 1DC8A 1QO0A 2A9RA 4Q6WA 3KYJB 1WETA 3CG0A 3T8YA 1JBEA 2LP4Y 2WRZA 3JVDA 4Z0NA 1RNLA 2P4UA 3OO0A 3K4HA 4LDZA 4MQEB 2MYUA 5CNIA 1YS7A 3DGFC 2E4WA 2PUFA 1QP7A 1SXIA 1DJMA 3RVRA 2JK1A 3KKEA 3TB6A 3O1HB 2GKGA 4MAAA 1ZH2A 1VKRA 3FFWA 4ML3A 1Z17A 2FLWA 3ROTA 5EWJB 2QR3A 5JNSA 4PZ0A 1U2QA 2PUGA 1BA2A 1LJUA 3OO1A 4P98A 4MR8A 4PE5B 2FQXA 2MYTA 1GUDA 4G97A 1D2AA 2IKSA 3MIZA 4S05A 5FBKA 3N53A 2MYPA 5C5CA 1E6KA 3TX6A 2VYCA 4JOQA 3JS5A 1BDJA 2QV0A 3A0RB 3NNDA 5CNJA 4UHJA 3BBLA 1DP4A 4RK4A 2FW0A 2E4ZA 3KJXA 4KK3A 3HEBA 1JYFA 1TLFA 5FWYA 3R0JA 1DBQA 5F64A 3EQZA 3TD9A 2LPMA 2NUBA 3DBIA 5GOTA 5JS1A 5FBHA 3C3WA 4O5AA 4Z4CA 4Z4IA 3BRSA 3QEMB 4MS4B 3LTEA 3Q7TA 4MLDA 4KFCA 4H3KB 2ID9A 4Z4EA 2R25B 3DGEC 3IPCA 2WJWA 4RK0A 2VK2A 3RVMA 3RH0A 2QVGA 1FQWA 1M5UA 2A9QA 4E7OA 3HO1A 4HNRA 2OENG 5TPZD 2PLNA 2QZJA 4NCAA 2HSGA 3KG2A 1AB6A 4YRZA 5KQLA 1XHEA 1JFSA 3KTOA 4N47A 3H5TA 3JTEA 3LUHA 2CD7A 3O2JA 1PNTA 3D8UA 4P1ZA 4WUTA 4EY3A 3S99A 2JCGA 4Y9TA 4NV3A 2H0AA 4KPYA 2H3HA 3N6VA 1JFTA 1OXKB 4M88A 3M9WA 3E61A 2AYZA 2PE5A 1U8TA 2NT3A 1JHZA 5IULC 4MS1A 3JPYA 4MRMA 5IUKC 3QELA 1Z15A 3LFTA 3T95A 3TMYA 1P6QA 5C5EA 5IBQA 2A9OA 4G0ZA 3CNBA 3GRCA 3OLVA 3RVLA 2MSWA 2PUEA 1ABFA 1YK1A 1M2FA 3HK2A 3OQMA 1ZN2A 5EWMB 4YP9A 5TPZA 5IUNC 4IRXA 1Y1LA 1Z13A 2R47A 4ZMSA 3HUTA 5E3JA 4EVSA 4KREA 1ZHHA 3C3KA 1YVUA 1NTRA 2XDYA 5HM6A 1YIOA 3N8IA 4XARA 1YTUA 3C97A 3KSMA 2KYRA 1D5WA 3OMWA 3O21A 2ID7A 4XAQA 1D1QA 4L4UA 1NXOA 5KI6A 4LZLA 2FTKE 1P6UA 4RV5A 1URPA 1OXBB 1W25A 1Z16A 3Q7SA 4MR7A 1QP4A 3LUGA 2PAFA 1DRJA 1M5TA 3RVKA 3H5VA 3JVIA 1HEYA 3HZHA 3M9XA 2JVIA 4YLEA 4NCBA 3OLZA 4LE2A 2PL1A 1BAPA 4MR8B 2HQOA 3CU5A 3Q9SA 5KQGA 4YGXB 3QK7A 1PNRA 3O2SB 3DLHA 3TO5A 1KMIY 4JAVC 5I4CA 1YMUA 2QVCA 3IP9A 3OLYA 5KQMA 3GWGA 4JP1A 8ABPA 1F4VA 3H5LA 1NXXA 3GBVA 3BRQA 7ABPA 1PUXA 5T7BA 3P9YA 1JH9A 3CG4A 5FWYB 5CHYA 2PUDA 3CTPA 1L5ZA 4L85A 4H3HB 3CZ5A 3RVNA 3QLVC 3VNAA 3HJFA 2HPHA 1NXWA 2CHEA 1YMVA 3FMVA 3QX8A 2CWDA 4S04A 1ISSA 3B2NA 4Q7EA 2W42A 3HDVA 2L18A 1GCGA 4EUKA 3CRNA 3N0WA 3RVJA 2N9UA 2GWRA 1TM2A 1SXHA 1BDHA 5DTEA 4OBBA 1EWKA 1M2EA 3H75A 2PUBA 1D1PA 2VUHB 1DZ3A 2JB9A 3IPAA 1P8AA 4B09A 4OLAA 4WXEA 1FFGA 5IEJA 4G0OA 5TPWA 3OM1A 3QLVA 2IOYA 1NATA 3EGCA 2FMIA 2X7XA 3CS3A 4WT7A 1QNLA 4G86A 4YV7A 2E4YA 4Z9BA 1DRKA 3EAFA 1RXIA 1Z25A 4G0YA 4QYWA 1VRVA 2PL9A 4MS3A 2MSKA 2FVYA 3KLNA 4Z4FA 1DCKA 4MS1B 1GCAA 3HS3A 2M98A 3F6PA 4MRMB 3IP7A 2R4QA 3H5OA 4YR7A 3KCNA 3QELB 3F73A 5IC5A 5EWLA 4OATA 4Q6BA 1SD5A 5FWXA 1K66A 4HNQA 4PICA 2IDMA 2FQWA 1LJLA 3BREA 1B00A 3GL9A 4MPTA 1W9HA 4MR9A 4D6XA 4EYGA 1ZESA 3FFTA 4XASA 1MB3A 1EFAA 4W5QA 4DQDA 4MQEA 2IYNA 3NBMA 3OQNA 1QQAA 4TMYA 2YHBA 3L49A 1A04A 2PJUA 4EYOA 1E2BA 4E7PA 2QXYA 3A0UA 5D2CA 3I45A 2DRIA 2HJ9A 4LE0A 3M6MD 2FLKA 1DC7A 3GT7A 4XLTA 4YCSA 2FEKA 3EDCA 2GX6A 3GV0A 4KK4A 4RY8A 4TN5A 4ZJPA 5ED4A 1EWTA 3CZCA 3HXMA 3HCWA 3GBPA 3NNSA 1C0EA 4N0PA 5TQJA 1Z2DA 1RXEA 1EAYA 1MVOA 1ZGGA 3N0XA 4RK6A 4RSMA 1YS6A 4RY9A 1ZDMA 4RZSA 1RZRA 3LUFA 4ZMRA 3RVOA 4Z4GA 2FEPA 4D74A 4TLLB 3LUKA 4RKRA 1APBA 3IP6A 1USKA 2RJNA 1I3CA 2P9HA 3GA5A 3O1IC 4W5OA 3SM9A 1NY5A 3RVQA 3HDGA 4FE4A 1JX6A 1ZGZA 4JASB 2NZUG 1DCMA 1QPZA 3OLXA 3MMNA 3LKBA 4G0PA 3URMA 1C4WA 2O20A 2FN8A 4LX8A 3QEMA 1KGSA 3N75A 4TLMB 1JL3A 2WMYA 3G1WA 5TQ0A 4KQ9A 4WWHA 4MGEA 3T6KA 1SRRA 4ETNA 1BVHA 2V0NA 2GBPA 4GNRA 3LKVA 1XHFA 1UDRA 2TMYA 5TE9A 3NHZA 3L6UA 3JY6A 6ABPA 2IPMA 1U2PA 1PEYA 2RJOA 4G0QA 4LDAA 1CYEA 3KS9A 1T34A 3LUDA 2FXIA 1L5YA 1J56A 6CHYA 1CEYA 1LBHA 1DBWA 4HYEA 4RU1A 1ABEA 1NXTA 2ZAYA 3H1EA 3O2QB 3UKJA 4EVRA 2L2QA 3QLUC 4KRFA 1U04A 1Z2EA 5B3JC 2FQYA 1QMPA 3A3KA 1A0OA 5JS2A 3QEKA 3ILHA 5BRJA 2QSJA 1U0SY 4DN6A 4IMIB 3H1FA 2IPLA 4ZPJA 3RVSA 2HQRA 4MQFA 2FKAA 4MS3B 2F8SA 5DCLA 2F8TA 4PYRA 2FSPA 3H5IA 4RY0A 2L19A 1DBPA 1IIBA 5EWLB 1EWVA 5FWXB 3OQOA 1TJYA 2E4VA 2FEWB 2JRLA 2VUIB 5GQSA 3LOPA 2NZVG 3G85A 3HVRA 4LRQA 1JF8A 4N03A 4IMJB 2A9PA 5DGCA 3EODA 4MR9B 1Z18A 4UHKA 2ZWMA 1NXSA 2IPNA 3KHTA 4HNSA 3HV2A 1GUBA 2FN9A 3I5AA 3NNNA 5KC9A 2LIVA 2MYNA 3CKMA 5ABPA 4KV7A 4RKQA 1ZVVA 3DLBA 2FMKA 5IUJC 3Q15C 4Z9AA 1CHNA 3MYYA 3Q41A 2PUAA 3KLOA 5BRAA 2RGYA 4W5NA 2JVJA 4KVFA 2YHAA 3QLTA 3O1JC 3SNKA 4G0MA 1JYEA 2Q5CA 3T38A 2PMCA 2JBAA 1RPJA 3O74A 1VLZA 2FMHA 1R8JA 3O75A 3MF4A 4KNYA 3OM0A 5T3YA 5HKOA 5TQ2A 1USGA 1ZAYA 2RDMA 4WZZA 4RWEA 1AB5A 4FB4A 1QQBA 4RS3A 4JA2A 4XXHA 4F11A 4Z4HA 3ROFA 5DKFA 1P2FA 3EQ2A 1JDNA 1Z12A 5CNMA 2B4AA 3JPWA 3DZDA 1Z26A 5JNWA 3MQ4A 3RQIA 3MA0A 1ZH4A 1RZRD 1FFWA 2M1ZA 2PKXA 1K68A 1QKKA 3Q7RA 2WY2D 4ETIA 5JNTA 3LUCA 4GPAA 1MB0A 1E6MA 3H5WA 5DLEA 3HM9A 1FSPA 4EYQA 2WJAA 4QICA 1DG9A 4RDCA 3FGZA 2I6FA 5TQ0B 3UK0A 3CHYA 2PUCA 4KMRA 3LUAA 4EYKA 5KWSA 3OLWA 4F8JA 5EWJA 4H60A 2WWVD 4MR7B 5HSGA 9ABPA 4F06A 1PEAA 2IPAB 4IGAA 4EGSA 4W5TA 4ZYLA 3H1GA 4F3TA 5KQPA 2NT4A 1EHCA 3LMKA 4PEVA 4RK1A 4OTZA 1QP0A 4NQRA 3D02A 3HUUA 4KQCA 3UUGA 4D6YA 5BR1A 4F12A 1H9CA 3SY8A 5JNUA 4N41A 1S8NA 5HQJA 4Z99A 4W5RA 1JWLA 4FE7A 5JNVA 1XWWA 4QPJC 2OQRA 4OG2A 4KZKA
chains in the Genus database with same CATH superfamily
1FYVA 1SVIA 2H2WA 2Y1CA 5IEBA 3N0RA 2X76A 5CA1A 5FA8A 1T2AA 1SXJC 3L06A 1X7YB 2OHVA 1FDUA 2H00A 4L1KA 4FYYA 1YI8A 3I58A 1NXPA 3NBYC 5JCXA 3CH5A 1O87A 3COWA 2XZLA 2DCUA 4RL4A 4DW8A 4YJ3B 4BOYA 1UKYA 4DADA 1R8QA 1E7QA 1VBNA 4EVQA 1CWUA 2QV7A 1UJBA 3EMBA 5DTJA 3COYA 1S2IA 5FFFA 3VC2A 4DUGA 4XIIA 4BX0A 4F85A 4RQAA 1SK8A 1CJBA 3ZLVA 2YXBA 1QX3A 2HA7A 3EGVA 4RXTA 1AS0A 1RKXA 5ILGA 3OWOA 1FFSA 1DWPA 1L8QA 2NO0A 4Q37A 2QBYA 1NVKA 4P2BA 5IDQA 4Q1AA 1Q92A 2I5PO 2JIBA 5A6VA 3U19A 4RKEA 1FP1D 3T0IA 1HE5A 2ESRA 3UB3A 4GQBA 2V6GA 3WR5A 3F49S 5CVCA 2XT6A 4BCBA 2I6SA 4H9GA 3C7TA 2BM9A 3MQFA 3IEVA 9ABPA 4AY4A 4I5GA 4TTVA 3OMXA 1DCFA 2YWXA 5ARBA 1XHLA 3U4IA 4LGVA 5FCDA 3SPXA 2QTLA 2Q28A 2Y0BA 2YZNA 3D43A 1P0QA 1HORA 1PDOA 2EARA 3NDPA 4GVLA 3JQAA 3O31A 1IZZA 3PB3A 4WY8A 4X00A 4G56A 4B45A 5LVAA 3WIUA 2IHNA 2PH1A 2UV8A 2HZ7A 1PSZA 1VSTA 2QXUA 2VNIA 3FPBA 2Q4TA 2X4IA 1M1YE 4I5DA 4LZAA 3PHBE 1SCJA 5DCUA 2X4DA 1U1CA 2DVMA 3BGVA 3M49A 3M3DA 1OB2A 3TG2A 1A8PA 2PS1A 4PZZA 1M3SA 1XWIA 1VKOA 2QN8A 5FQNA 1US8B 1Z36A 2WHEA 1NZJA 1XZIA 3WKDA 3VJLA 2H18A 2AJ8A 4DRXB 4DYDA 4YYZA 1V8DA 1GSIA 3KZCA 2V4ZA 3BDAA 3PQ8A 1A9RA 2W0SA 3R75A 1HETA 4IUDS 2BJWA 2J5RA 5F1PA 4EZEA 3GF4A 3NVAA 5H16A 3P9ZA 3LPMA 1VLQA 3B3QA 3GH3A 1U28A 1WBJB 4GYYA 2F4VB 4B8YA 3F8TA 1W0CA 3W6ZA 3UKOA 3DBLA 1LDYA 4U6NA 2UVPB 3G1TA 2O7QA 5KQPA 4YP7A 1PYDA 5BNZA 4JBLA 4AMGA 3L46A 2ON6A 4CUZA 2I3DA 1E6KA 2J0UA 1PU2A 4M1YA 3FUWA 2ZSAA 1NVAA 2FLVA 4QGGA 4KEAA 2X5OA 5AMXA 3R3UA 4JR2A 4H7FA 4R71A 2BYTA 2VHXA 2XRFA 2P67A 2WIBA 3OEWA 3OPQA 2OL4A 4Q1CA 4LOHA 3OP1A 3T3HA 5K8TA 4PSUA 6ADHA 2GEVA 1ABBA 1YRYE 4E09A 1W87A 4BB6A 1M2HA 1KFEB 4C7VA 5JY6A 3OPYI 5TS2A 1XU7A 1SA0B 2GBGA 3UYKA 3S2IA 1GDDA 4ZVNA 3B7WA 3BUSA 1EVJA 1V1RB 3R20A 2Z95A 4HI0E 1DZIA 1SBCA 3CX3A 4MV4A 5LOVA 5FF9A 3PFIA 1NMXA 1UJ2A 3HDYA 3ZTTA 4FYWA 4UW9A 5IS2A 3MLEA 2GILA 3TEJA 4BJ3A 2RBGA 7ADHA 4FM9A 1V96A 2CZCA 3GLFA 1AB6A 4GOOD 5BSGA 2WJHA 1JDJA 3EFBA 4Q1EA 1L7DA 4J8PA 2DFVA 1L4HA 1YR7A 1IOVA 2B4RO 3ESYA 4P1ZA 2HEIA 5D84A 5A7HA 2O2ZA 2RAUA 1U1DA 3N3BC 4C4ZA 4DLXA 6LDHA 4CGZA 4EBFA 1AG9A 3LKZA 4YCCA 3ZKWA 1R9MA 2H2DA 1J8YF 1ZN7A 1ZUWA 2DULA 2V7QD 3AP2A 3HU2A 1YR9A 2NU9A 3O6VA 5FO1A 2PE5A 3L6CA 4KO4S 4DR7B 1MFPA 2C4TA 4IDCA 3CJQA 4U6QA 5HTOA 1PYGA 3FNBA 3R7AA 4YCNA 5I45A 1G8AA 4LF9B 2CF5A 3NEAA 5EINA 4HR7A 3GFBA 5TARA 1WL8A 2AEJA 4U2GA 2D5LA 3CLSD 4IIGA 4DT1B 1O9HA 3M5DA 4KYIB 4B9EA 3HXTA 3CC8A 1XKLA 2ZU6A 3CN7A 4IV5A 4EFLA 2MSWA 4L3WA 4PNEA 3Q98A 5BQ5A 4QOIA 1KDVA 3BTUA 1NJ2A 5G3ZA 1OLSB 1HZZA 5DI3A 2VWGA 1EP1B 5IUNC 3IP3A 4GI3A 5CVDA 3ACBA 2X22A 3G3EA 4TV9A 2JH8A 1FNNA 4M55A 1RWPA 2NSJA 1D6NA 2OEPA 1MFZA 3NWJA 4NOKA 1U0FA 5D5HA 1YH3A 3N8IA 1V3TA 3DOUA 5C31A 1EFCA 1NUSA 1RHKA 3AR5A 3R6GA 2FPOA 4HDKB 1BQEA 3T4UA 3BMOB 2YXNA 4JUDX 2I54A 2ZKLA 4L76A 1W88A 4K9RA 1ZL0A 5H82A 4JXKA 3WIOA 3VHLB 1O6CA 2ZTHA 4XIFA 1DNPA 1P6UA 1KKUA 1MPXA 3DR3A 1OXBB 2VQ3A 3OTQA 3QVMA 3RODA 3DTNA 3JQ7A 5TEWA 3MTGA 2VDVE 2I8CA 1QP4A 1EG7A 2B0JA 1XZ8A 4IXNA 1S4MA 2ERCA 2YRWA 1PZEA 1Y4UA 1GJRA 1LRLA 3TH5A 1IOWA 1XQXA 3AUYA 3AHJA 4PHTA 1GA4A 1PTJA 4CR6A 1ISIA 5K3FB 1YIAA 1YB1A 2V7TA 4MIYA 3VFDA 4FBMA 1H9AA 5AM5A 3CPJB 1PNRA 4AVYA 3KUDA 3S40A 1B15A 2GZRA 4QLBA 4Z7QB 1TIBA 4KR9A 5JATA 1Y1TA 2IV7A 2YBDA 3VDMA 4AJIA 1Q1BA 4LSWA 4UJ5A 4PQGA 3LBFA 1C50A 4MPRA 1E4VA 2X0KA 4QNMA 5EOVA 1W4LA 1XLUA 2XNDA 3PQDA 4G5HA 4IQ0A 3G2HA 4QXPA 4YV0A 1OB5A 5KYKA 2I2XB 1C0PA 1E0KA 1QS0B 4ZOEA 3TLBA 3U4QA 2YNMD 1PL6A 2RARA 1IZ7A 3CTPA 1TIPA 3LQ2A 2G4LA 4JVSB 5CD1A 2NAFA 1UDAA 1XTBA 3B9PA 2A5LA 1ISSA 1J5XA 4JBYA 1TD1A 4JLOA 5EZSA 1TCUA 1Q74A 4ZCSA 2HMSA 2LRHA 3TLYA 2Z5VA 3ZWPA 1W8IA 3PVZA 2X0RA 4OCZA 3BHIA 2QE6A 1PIWA 1EYZA 2D0IA 2GLUA 3MUOA 4OBBA 4ZCQA 5H1YA 1RP1A 1KY4A 3DM5A 4UM5A 3WLAA 1RDFA 2C5SA 3ZWCA 3H5AA 4F45A 2BSQA 4MQ6A 4JYMA 3K4PA 2PUJA 1MZPA 4H7EA 1WHTB 4G36A 2Z4TA 1N32B 4MKXA 3SNHA 4QECA 2LZ0A 2O2DA 1ZSVA 1C3OB 3BHNA 4GOKA 1FMJA 3OD5A 2PL5A 2R11A 1WW2A 3A6DA 3OOWA 4TVKA 3ZZ0A 4DA0A 4EO7A 5LZ4A 4JJKA 5EIAA 1RYZA 2NTVA 2A4KA 3GFRA 3ZCPA 4MWTA 2RGWA 1TKCA 1XZFA 3C7AA 3AK4A 2P78A 3X1WA 5CA0F 2E89A 4BEBA 2M1XA 2OSVA 3LNCA 5BNFA 1ZOLA 4Z3DA 3UC9A 1DOZA 5GGXA 3NQ41 3IHLA 4C08A 3WNCA 4BV3A 1UMCB 2VPQA 4ZJYA 4GAEA 2NXWA 1I4TD 4V0NA 1A9TA 2R751 3DQPA 4FMDB 5EZYB 3IHTA 3OZGA 4QPZA 1J70A 2PCJA 3S2GA 2P9CA 3IR6A 3TRFA 4R83A 1ISJA 5FPPA 3N9IA 1TKBA 3OEHD 4AP5A 1H2ZA 3PEYA 1XRQA 1L7MA 2A2ZA 4K40A 2ZE8A 1UC4B 1GPYA 4OBWA 4XASA 3VR5A 4U9HS 1A97A 3SSNA 4ZI7A 1QMGA 1KP3A 4UDXX 1XZQA 3X1YA 1UWVA 1E7MA 4LBZA 4ZQHA 3SYMA 1O6GA 3JQ8B 2BZGA 1YZVA 1BE1A 1M75A 3DE3X 1FDWA 2DPMA 3UW1A 4EKIA 1L4UA 4FUQA 5DLQC 5KKCA 5AJZA 3NB0A 4L02A 4ZTZB 3FUTA 1CK4A 1SZCA 4QAJA 1Y8QA 1EWTA 4EJFA 4RSHA 2WAYA 3KOXA 4UXIA 5KTOA 2I4MA 1Z2DA 5TX7A 3J7AC 1OYWA 3FPEA 4PTZA 1RXVA 1OFUA 4DPLA 4RSMA 3Q10A 3PC8C 4RABA 4B81A 3BXEA 1TQ6A 3VPHA 5BORA 3ABRB 4JS0A 3WMRA 4A10A 1SKUA 5AK0A 3F98A 1UK9A 5CFQA 5AI5A 3UK2A 2Q5QA 4J29A 4RKRA 1VCMA 3N87A 5FUBA 5E7MA 4N5HX 5ISMA 3DMYA 1O8CA 4RIHA 3QBDA 4URFA 3DKVA 4ZT3A 2V0GA 3BRWA 1RI2A 1NOKA 3O8OA 2E6UX 2GSDA 4DIKA 2KBEA 2ZJFA 4I19A 2UU9B 2WV7A 2BP7B 5T41A 4IDEA 1ONPA 3T9AA 5KJEA 1VJCA 2RKWA 3CW2A 2JFNA 2PFGA 3PG5A 1KGSA 3F9IA 3E9ZA 5TGTA 5BNWA 3VU0A 1TJ3A 1LZKA 1P0FA 3TEMA 5EMHA 1UKCA 2BBSA 1DEXA 4ZVLA 3ZI4A 1ZM7A 1RXCA 4IX9A 4KAJA 1PR6A 1T3GA 1O89A 3IIIA 4G2NA 4C30A 2NO5A 2R6ZA 3FNQA 1J2YA 3QVGB 1KWKA 4GOXA 3NDJA 3FZEA 1Q0PA 3H0CA 3N7TA 1GOTA 2HSDA 1B8PA 1HNNA 2I2CA 4QXRA 3TEFA 9LDBA 3TW8A 5JY1A 1GU7A 1OQAA 5AHXA 3FR7A 1I7QB 4NZ9A 1HM5A 1XTVA 3DVLA 3DZCA 1ADYA 4L8VA 3UKJA 3VRHA 4DNQA 3DBVO 5JT1A 2XB8A 2XCLA 4UFOA 1GGFA 2GXQA 3HB5X 4OF4A 5IVPA 1CDEA 1LPNA 4AP9A 5JQWA 2FF5A 3ICWA 3B51X 4IYJA 4JIMA 3STVA 5KTNA 1WDMA 4XIGS 5KOJA 1MQ8B 1WUJS 2EGUA 2QAIA 3OTWA 4OREX 4OQYA 3DDNA 3MJTA 4ND6A 3ZVKA 1OT3A 4B7UA 3KZ1E 4F5EA 3E3LA 2DFKB 4TTAA 1JSXA 4RHUA 1FMTA 4PC7A 2AGVA 5F21A 4H7KA 3WXBA 1NMQA 3ZUPA 4YO8A 5I9TA 5LSAA 3ZWKA 4HMOA 4UUNA 4Q15A 2VDRB 3CIOA 4J3NA 1WB6A 5IWAB 1JF8A 3HJTA 2VHQA 1LFAA 5F1KA 2A9PA 2Q62A 3EW9A 2J6IA 1FTNA 3KSBC 4P86A 1FJGB 3L7JA 2NZYA 2YH2A 3ZBPA 3C7KA 4FHEA 1GSOA 1ODFA 5EPEA 1HDYA 2Y1KA 2P27A 4UU8A 1R6BX 1XVVA 4IG4A 4Y1RB 4MVJI 3QJGA 2QTAA 1H4VB 3V7NA 3EZ6A 4N8DA 4PLTA 1I32A 2Z8ZA 5GADl 2PYIA 1CETA 2IU3A 1EKXA 4JD5A 2DT5A 3KQHA 3K35A 3VZPA 2VP4A 1U5CA 2FN3A 2PK3A 1D4AA 2GJKA 1GUAA 3ILVA 2DHEA 1EFRD 3PC2A 4KXFB 4PSCA 1EVIA 2FN4A 2HJRA 3QBJA 1FTYA 4R1QA 3OKCA 3RUDA 3UH1A 1YR2A 4A36A 3OX3A 1FNCA 3T9CA 5DHAA 1HL3A 1N1DA 1FS6A 1Z4KA 1VL6A 3BKWA 2Q7DA 2JL1A 1CULC 3RTDA 1YSCA 2QT1A 4IMPA 3D7MA 5ARDA 4B4OA 2CLEB 2IGBA 3D31A 2YVAA 2JGDB 4MUBA 5CM2Z 5K7SA 5ENDA 4HDRA 1H9BA 4LRSB 3VTFA 4QRHA 4DCSA 1FZQA 4EO4A 1U9JA 2HJGA 5FHRA 3QEBZ 4BTEA 1RJFA 1UBEA 3HR7A 4I8DA 2FPPA 1FYFA 1J20A 1BVUA 5JIBA 2XGMA 3WBJA 3I6QA 2A84A 3LUCA 2CFCA 5FULA 3AHIA 3QKTA 4KX3A 4OHZA 1I8TA 4PR3A 1FSPA 1LNSA 3HADA 4ADSG 4QICA 1HE8B 3K72B 4B6SA 4BNNA 1ESMA 4RCZA 3ODPA 5BMVF 1G38A 4KMRA 4YCJA 1RI5A 4EB3A 2H52A 4KN9S 3BGWA 5FTLA 2QL5A 4MB6A 4H16A 1KQ3A 3EARA 1J5PA 1DEAA 1DSSG 2WJGA 1VHDA 3D81A 1GR0A 1IHOA 1YR8A 2HMAA 3OT4A 4QJ4A 2WZDA 1B3BA 3D6AA 1PZMA 4LS3A 3L40A 3PC4A 4F46A 2IS6A 1R4MB 2C5BA 1G4HA 1Q6YA 3C3JA 4DR5B 5FL7D 3FWNA 1B6RA 4O4HA 3RVBA 2VDNB 4HRXA 5DP2A 2X7HA 4HJXA 3AOEA 5ECYA 3U7IA 5F2KA 4AN0A 2NYVA 3OC6A 2YASA 1YT5A 4LISA 3ZDEA 1EZZA 4BIIA 1EBBA 1HEUA 1QF7A 1TB4A 2Y1EA 3BMCB 2W2XA 4Z99A 3AF6A 2IU0A 1JWLA 4ZK6A 2O8BA 1X94A 1DIOB 3FNFA 1TTHA 2X1MA 4M9SA 3DFZA 3O8DA 4HWOA 4MQFB 3UAXA 1O9BA 2B83A 3ZG6A 3D3QA 5F73A 1TQ4A 2BN4A 4W1PA 3DT8A 3SR3A 2BDTA 4IJVA 4J0JA 2H8KA 3CX6A 2H1SA 2PIAA 4GEKA 5F98A 1S6YA 3R3WA 2DJIA 4LMRA 1PUJA 2X6QA 2IYZA 2B69A 5ES4B 1QPGA 1YS4A 4B6EA 1OPXA 2EAUA 3PPWA 3GJ6A 3CF0A 2JGNA 5BUSA 4M9RA 3D4BA 3OIUA 4F38A 1JIUA 1UK7A 3DKIA 4P0QB 1Z4MA 3A70A 1QP0A 1NQ5A 2J4CA 5LQAA 3AEKB 2WQ6A 2CVZA 1XDBA 3WGMA 1G6KA 3MSCA 2YRFA 2QQEA 2BR3A 4ZO9A 4RK5A 3HSYA 1K97A 1UR5A 4NPAA 1JDVA 3Q7PA 4JNCA 4KBFA 3PHHA 3ZU3A 5HRCA 4CTNA 1CJSA 3EH2A 3IIJA 3NHMA 3KUCA 4NWIA 5AW6A 5IH7A 1T9HA 2WSSD 2AD1A 1LF5A 4HZGA 2CXUA 5AKGA 1J6UA 2JI9A 3B9BA 3EXIA 4DSAA 3C6XA 1UPAA 2ZULA 4MUEA 1DTWA 3AVPA 1EX6A 1P2TA 1T9DA 1ZINA 4R2WA 4JU8A 3QFHA 4C1BA 3X1XA 1J21A 2LBPA 1ZXLA 3DUFA 4IGKA 4PG7A 4YUWA 1T4GA 4JBNA 3FFBA 1G20B 2C5AA 2HMYB 2JLZA 2HTEA 5B12A 5DXJA 2RG7A 3SQXA 4AP6A 1HV8A 1HOTA 2CLFB 2GN0A 2ZYRA 3BXXA 4TL8A 1PJCA 5H3CA 3J81k 4HWPA 4M1WA 2B7BA 4ZDIA 3C6BA 1U28C 4RFVA 4DLPA 1WETA 3TNLA 4XIYA 1AC5A 3Q3JB 3CG0A 1ZCBA 2GMWA 2ZAIA 4PXYA 3R7WA 5D3KA 3GRAA 3RC7A 2BOVA 2VTBA 5DE3A 2WIKA 3SXJA 3FDZB 5LQNA 4W9MC 2YZ2A 1X2BA 4V1CA 2QAGA 3OC0A 3SX0A 5L45A 4WZAE 1VJ1A 4YAWA 2PMEA 3UPUA 5KO2A 1GPUA 3E48A 5KB3A 1C1XA 2XBUA 1I2ZA 3QMPA 4XDZA 3VR2D 3FTFA 1LV8A 4IDQA 4IV0A 4JR0A 4LNUA 4NBSA 3K05A 4P0TA 5F3RA 4DARA 4JIGA 2EG9A 4K9DA 4LYYA 4ZQBA 1M54A 5H83A 1AKRA 2NU6A 2IS2A 2WU0A 3NXSA 1XZNA 3Q40A 2O6LA 1YR3A 1GCOA 2P2SA 2QMEA 3C7DB 4HS9A 3QF4B 4O2LA 4C3VA 1Z4PX 5CDFE 5LM3A 2PUGA 2Z2IA 4V0ME 3LC1O 3LDHA 4RO0A 2BFMA 3A36A 4QO8A 4BO2A 1IEXA 1NNUA 3OWHA 1B8NA 3PQCA 5ILOA 3ZHRA 3WRXC 2JFYA 1WHSA 1ZD5A 2JGIA 2J5XA 1YHYA 1IBKB 2RK6A 3NNDA 3REOA 1PSWA 1DP4A 4DMMA 3IUBA 3AETA 3R5SA 5FTKA 3WLRA 2OXIA 1F60A 4LV6A 3NBZC 4MICA 2IYWA 1P5FA 2BGLA 2Q49A 4LVOA 4WUVA 2OQVA 5CB4B 3HI4A 1JU3A 1I7NA 1E77A 1CBUA 1PNQA 2FPGB 1SOVA 3ASUA 3PUHA 1OX4B 2YDYA 3R1IA 4FPXA 3JATA 4OQ4A 4OI1A 4MCHA 4IO0A 4JLWA 5CRIA 3U1TA 1Y8CA 3Q3IA 5I7UA 5K4HA 4OXIA 4J9UE 3HC7A 3U3RA 1KH1A 3KHKA 2VRNA 2AWOA 3CLVA 5EYPB 1F48A 3ZTYA 1KZ9A 1GXSA 2FW9A 1QK5A 2CVOA 2G4VA 2VHYA 1FTSA 2QVGA 2WJWA 3D4PA 4MMYB 4QTXA 1KSGA 4Z4GA 3NT5A 3KOWA 3PDUA 3QUCA 1AXEA 5FBLB 3LWDA 4ZVOA 3WRVA 2HSGA 5EJMA 3RYCB 1SB9A 2R0QC 4HDMA 2XCTB 4E5PA 3MWEB 2CJWA 5E4JA 4UUMA 421PA 3LUHA 2X42A 4N7RA 5JE8A 3BXGA 5THXA 2OXTA 4RTQA 2X6RA 1C2YA 3NT4A 1WVMA 5DOVA 13PKA 1TDJA 1N2IA 3CV3A 4YAJA 4UCFA 3W3AH 4BMCA 1A9XA 1T9CA 3TJZA 3ZPXA 2IVZA 4KPYA 2VJQA 3ZDZB 4DLNA 4PY2A 5K45A 4NOJA 3MILA 4OAOA 2J87A 1J22A 1D1TA 2FHSA 3P0RA 3R9IA 4CMHA 1XNQB 1H8ED 1NVTA 2FI1A 2R68A 1NHGA 4LJ7A 4P53A 4QYIB 4QYXA 1P61B 3IE2A 4WEOA 4D9FA 5HF6A 5A6SA 7YASA 1Y81A 2AX4A 2Q5OA 2WA1A 2XUDA 3AERB 3AXSA 1NQTA 4D4MA 5GJBA 2X9VA 3S1AA 2KX7A 3NUQA 4DDUA 2ZQZA 1QU2A 2V5AA 3Q1KA 2QM0A 2A4MA 1EFPB 1DFHA 4Z9FA 3V8RA 3JAWB 4QOEA 2ODWA 3RAGA 2I2DA 4MNTA 4OSEA 5ALEA 1XA4A 5IKXA 2YN2A 1XD2A 4MUIA 3HKCA 2A0KA 3MGAA 3B5EA 2NIPA 2ZI3A 1KGDA 4DSZA 1RZUA 1NQUA 4QDKA 1FUUA 1XA3A 5IKMA 3LNTA 2WWYA 3UATA 2K2WA 3MTBA 4PZYA 2O7NA 3C3KA 2X14A 3WJ1A 4G1VA 5HM6A 1PT5A 1TPZA 5KYNA 5EP2A 1Y6JA 5A9RA 3HYRA 2KYRA 2WJZB 4KVGA 3SIWA 5ITVA 3MAGA 1T2UA 2G9ZA 4NG5A 2N1MA 3HQ4O 3ZW8A 2DWQA 1H1TA 2Q8NA 1C30A 1W35A 1ZEJA 3QOWA 3T61A 5LP6B 3F4LA 1DINA 3W8NA 1RW4A 1B6SA 1GQSA 4ND1A 4W1RA 1X39A 1G2OA 3RKUA 1UFRA 3RV3A 4ZN6A 2BGRA 1G63A 4RGYA 2BELA 2AHRA 4D4HA 4EY5A 1BAPA 4U00A 1U65A 4DQXA 2G07A 2C9MA 1I3KA 3WB2A 1MCZA 1FW8A 3QK7A 1XRNA 3WSVA 4XWGA 2JATA 5KINB 3KQKA 4NZZA 3QZUA 4TPKA 1GHTA 1QOPB 3NIGB 4M49A 5EIFA 2N3ZA 1UPFA 3GWGA 3PA8A 4J0IA 5I4BA 2JFGA 4R0VA 2DAPA 4WACA 3GJTA 2XIQA 2QL6A 4XOUA 2WE7A 2X8BA 3M5CA 2Z3ZA 4YASA 3GDHA 3N70A 1QE3A 4WKBA 4N5LA 5CHYA 1EE2A 5A3SA 2WYVA 4D9IA 2F1OA 5B1IA 5HS6A 5B64A 4WN9A 3KWJA 2O14A 3UMSA 1NXWA 4B4KA 3IS3A 1W0JD 2DLDA 3EASA 4TWRA 2XHEA 3S5UA 3WAGA 3I0NA 3KETA 2JGMA 2GD1O 2HW8A 3ANYB 2HHCA 2QM8A 1EA5A 3K4QA 2ZR0A 2B4YA 4URWR 1ODCA 3TIIA 1AQ6A 2HIHA 3COJA 1NWCA 2P9GA 5DTEA 3TQSA 3CVXA 4CG1A 4O08A 3L0PA 4YFVA 4UFPA 4L4ZA 1AGNA 2PUBA 3C48A 4PPGA 3LLCA 1XK6A 3AUTA 4PX2A 3CLTC 3BWYA 2O8EB 3N2GA 1U8UA 3FUCA 4I3FA 1Z06A 4QKQA 2QQGA 1I0LA 5IJ9A 1E6WA 3W7VA 4PR0A 3OIVA 3RFVA 5AW0A 5B30A 3EXHB 1Z7YA 5ES3A 4ZT7A 2PNFA 1K2VN 3KQLA 4LOAA 2OBMA 2A9FA 4JYPA 2PQ6A 3EYAA 2LW7A 3QFCA 3ZJ4A 4QOFA 4C03A 4CLRA 4URZR 1C9NA 1PR2A 2BUBA 4EMBA 1X7HA 4ZOAA 3VC7A 1YHZA 1GN8A 4ZU6X 2QK4A 2G0TA 3OTOB 2JCXA 1L4EA 1ZC4A 2EFCB 4Y3UA 2J6CA 3OEEA 4FDTA 4AS2A 5JZMA 5GTDA 1HT0A 1SEPA 1SHUX 3K09C 1E9SA 1OFVA 2GCNA 3NTLA 4LYEA 4JJ8A 1T1RA 2PZLA 2PRIA 3FPAA 3PHCA 3LCJA 1NF9A 2C58A 1BS9A 2IDMA 4L15A 4XQEA 3L0DA 1IBCA 3DBHB 5FJJA 3GAAA 2NO7A 4R1PA 4HGYA 1SBTA 1F14A 1RQ2A 1XC7A 3DYVA 3N39C 5TT0A 1E66A 5EZ6B 5FOSA 5CCXA 1MB3A 1SUFA 3L7KA 1Z7BA 3OKPA 3AKYA 4MQEA 5IAGA 3OBIA 3OQNA 3NBMA 2A59A 2VSXA 4C14A 3IURA 3L49A 3KEQA 1YQUA 4TVOA 5EE9A 2GB4A 3ROKA 2BFFA 1A9YA 3LK7A 4LE0A 3RS0A 4YV2A 4BP9A 2AZMA 2EYQA 5JASA 3OJ0A 3ZWXA 4CL3A 1TJPB 1A96A 4ZFNA 2ZRGA 5A4JA 4RZXA 3V7WA 1DARA 1X80A 3PNOA 5TQJA 5B3LA 5CVVA 4B76A 5MN5A 1Y8RA 2HLDA 4QFDA 1A7JA 2G36A 4BDTA 4UOEA 4P8RA 3SP1A 1A98A 2XMBA 3A1DA 1GN9A 1LDBA 3A1WA 2BBWA 1Q20A 2J0VA 1ORHA 1U7PA 2WP8J 1C1HA 3CNQS 4MWSA 3VZDA 4DSTA 1AO0A 4JJAA 2QY6A 3OTIA 3TRDA 2G71A 1FPQA 2GBIA 1UOEA 2XF8A 3L0BA 1ZUNA 3DOJA 2OXEA 3NH6A 1KDPA 5AJWA 3Q5DA 3QWFA 2FQQA 1UBLS 1JR3E 4X1OA 4XYLA 3URMA 3OJLA 1TYDE 2R00A 2BIFA 3OZCA 1G7SA 4EI7A 3FAKA 1V26A 2G67A 1JXAA 1P19A 5C1DA 3WWYA 1HOXA 2V0NA 1C9DB 1R6UA 3D2CA 3GCDA 5DPMA 521PA 5HRAA 1F0KA 4R6WA 5TY0A 1Y1SA 2C82A 1FE8A 3W9UA 3VU9A 4Y6OA 1GNPA 3W8RA 3JQ9C 3G8DA 4JI3B 2CUZA 4L73A 3VZSA 2FFBA 4DBZA 4TX1A 3BJZA 3GAZA 3K8YA 4JQSA 4OQDA 3ETJA 4LECA 3WSTA 1Y8ZA 4RU1A 5JS7A 3IAM1 1WG8A 1LPAB 2GJAA 1KAHA 2YV4A 2ZFUA 1J06A 2GPSA 4KQ6A 2I0FA 2F3UA 3WIDA 1DCTA 2TSYB 1AD2A 3QEKA 4HC4A 2QSJA 1TRKA 2WA2A 3NM4A 1BKDR 4RVCA 3D1JA 4TRJA 4YP5A 3R7BA 3TI7A 2HYDA 4D3FA 7MHTA 3TL2A 3SBDA 3HA3A 3ZCVA 2H5LA 4LSMA 2QKYA 4MS3B 3A6EA 4FYMA 4HPXB 1H6AA 3EH1A 4R7ZA 2CNOA 4G4SP 3X1MA 2VTKA 5KNDH 4K2HA 4MYUA 3X1JA 3U5ZB 3AV3A 2BGIA 2ZRFA 5I7AA 3QPVA 2H06A 3RROA 3HFGA 4KXUA 2WMOB 3P9QA 2RGRA 1NLUA 3A2NA 3VNRA 2WJ4A 4RD2A 2QTTA 3HUDA 3AHCA 4YJ3A 3HVRA 5FIUA 3ZGVA 1L4YA 3LQQA 4LWPA 3TTSA 2XTAA 2C2HA 2YX1A 3H2IA 4Q3LA 5FV7A 1N2CB 3T52A 5HIAA 1DE0A 1J09A 3C4QA 1QYDA 3CRVA 2C4HA 2ZW9A 3MPOA 1MX1A 1EE9A 1FEZA 2ZWMA 2EKQA 3DE6X 3IE0A 1X7ZB 2LGJA 1L4GA 4G5FA 4L74A 4ZAFA 3WGJA 4YMHA 2J07A 5BN3B 1S2DA 1MH1A 4GXTA 5I7RA 2IW3A 4MCAA 4R84A 4X84A 2I76A 4U7PB 5FR1A 3WG9A 4L7QA 4JLKA 4F0JA 3H17A 3AQIA 1JR3D 2P79A 1OLOA 1QIIA 1IZYA 1Z0JA 1EVQA 2CL6X 2KLHA 4IINA 4Y2YA 1RKVA 1UC9A 2HCJB 1E4YA 5JYBA 1KJYA 2L82A 1A76A 3SX4A 4CXMA 4JBXA 4ZT2A 1XZJA 3TE7A 3HWWA 3BWBA 3FCCA 3OZSA 3UMBA 4AICA 3D3EA 2ZVPX 3HNRA 3WQBA 1GNLA 3GMIA 2J45A 5EHGA 2BPOA 3R76A 5F77A 4AMBA 1JPVA 3O4IA 3E9YA 5HMLA 4CCSA 4AG6A 3K9HA 2KS6A 4WZZA 5KYWB 1DJNA 2Q3EA 4FWTA 3LP6A 4DZZA 5EIXA 4GT1A 1X8JA 1OI7A 1P2FA 3G2KA 1MORA 2D2VA 4S1PA 2QZPA 5CNMA 2OB1A 1EDOA 1UP7A 5L3RA 2J46A 2WHPB 4ITUA 2QD5A 4R31A 2FG7C 1KZ6A 4M7WA 4D0RA 1XRMA 2RSLA 4DRXA 5JNWA 5JXHA 3HDTA 1WCXA 3ICOA 4MUGA 5IT5A 3BSSA 3Q7RA 4PV7A 1NN5A 4G63A 5JSYA 3HJUA 1UC5B 4ND4A 1MB0A 2RB4A 1BRTA 1KDOA 2IGTA 3EVNA 3HFSA 1T6NA 3ULKA 1DLJA 4GGMX 3R3YA 1AUXA 2OD7A 3WJAA 5FYQA 3EZ9A 3UAZA 1VL8A 4X6LA 1I2DA 1RRPA 1VIVA 3NFRA 4RJKA 1NBIA 2E18A 4ZYLA 1R3DA 2PYDA 3TJRA 4EI2A 2UVPA 2W90A 4MYCA 2J4DA 5HGJA 4Q21A 1L4FA 1VL2A 3W2IA 3G0OA 4RK1A 1Z7WA 1NZDA 4W6ZA 2EG5A 1G17A 4MVJA 1JMVA 1E1DA 1OXUA 2AFRA 2F3TA 1JDBC 3LL7A 1NVVR 1WP4A 3A8TA 3AW9A 5B55A 1WB9A 3L6DA 4OYRA 4QA9A 5CBPB 2QX7A 1BJRE 2JDID 3DWFA 4COKA 3PBKA 2JFBA 4NSNA 4BC0A 3P71T 1S2MA 3DEYX 3H3FA 1JVSA 1XIVA 4Q0MA 1IBMB 1Z0IA 5BV8A 2PT5A 3AEZA 3FIJA 2BI4A 4DMFA 1BEZA 5EFZA 2R7NA 1DPGA 1V1RA 2IYAA 1JGTA 3WOVA 2V7PA 5TJHA 4O1IA 4F2DA 3LUJA 4IUBS 3F6CA 2EV9A 2C3YA 2CVHA 2XEDA 6REQB 3PNQA 5TRTA 4L4SA 2AD5A 4WA7A 2E6KA 3FOFC 4N7BA 2RHLA 1RLIA 4YRMA 1KWGA 4FYHA 1XPRA 4GRDA 4MWBA 2R48A 4LOKA 2E49A 2E4UA 1C9EA 3FVRA 3K15A 3BK2A 1N2BA 2WWRA 4TRNA 3B1WA 4FS3A 3UK1A 3GRRA 3BSYA 3ODGA 4GLOA 2UYCA 4X66B 1UXKA 4ZDJA 2JG3A 1E3MA 5L3VA 4PCUA 4TQUS 1CQIB 3A1TA 3PVCA 1V8FA 3TSYA 2C2OA 2Q45A 4HCJA 4KCGA 3KKQA 3MQ2A 5HMMA 4ENUA 4H27A 5C7IO 1W4BA 4RXMA 4DIUA 2HMWA 1OMOA 3V33A 4CL0A 5B3KA 4QSHA 3C3MA 5IAKA 5IEJA 5AW1A 4R3UC 5EG5A 1E6CA 2HK9A 4L4XA 2M6KA 1TCVA 2F3QA 4UU7A 1R0LA 1WXQA 2QAGC 4DT1A 2YWCA 1M7GA 2O52A 2RJ3A 2O4UX 3D64A 3EA5A 4M6WB 3UQYS 4DDTA 3BWMA 3VGJA 1D0VA 2Y0CA 2QRPA 4IXWA 3RAJA 2IC5A 2NSLA 4G0XA 4AXXA 4B3XA 3I1JA 5HDBB 2AJDA 2WG2A 1QBGA 4EWLA 2ECPA 1OLSA 4HQFA 1SXGA 4HEHA 2GA9A 1GTMA 2JH3A 2P6NA 1Q7RA 2VXCA 2GFHA 4RD4A 5AIAA 1I36A 3ILSA 2A9RA 4Q6WA 4AJ9A 1R66A 1VC2A 4BO0A 3KKZA 3T8YA 1MAAA 2C8KA 2GPYA 4KPUA 5FTWA 4ZYTA 3NR2A 4P3NA 4BMVA 1OA1A 3BMOA 1X7WB 5FBZA 1X1SA 1BNCA 1F0PA 1QANA 2GJ4A 3IV6A 3P2OA 4Y2XA 5J2TF 5DLYA 3IKLA 3NANA 2OPBA 5JTUA 3N86A 4LX0A 4BJHB 1UMDB 3TB6A 3ZHUA 4AQ7A 2MWMA 3O3OB 5FOWA 3EEBA 1H2XA 1X7DA 4ML3A 1HE2A 1DEKA 3NDRA 3ZVRA 3VX3A 1M0SA 3G5TA 2FLWA 3PQ6A 1VLVA 4X93A 3E5NA 4H0CA 3L92A 2O8FB 2I6XA 4YLGA 2PO7A 4FMPA 1XXHE 2Q4RA 2QMHA 3GJ0A 3K5WA 5EFOA 5K3FA 5JFGA 3ETGA 2FQXA 3T1NA 2J41A 4NDNE 1ITZA 4TMXA 2JGFA 2NYAA 3GNTA 3M6VA 4C6SA 1E98A 3K0HA 4ER0A 2I4RA 4O33A 4AMYA 4BNYA 5CB6A 4ENPA 3FUVA 4OHMA 1AF4A 3JTMA 3WYFA 2V9PA 4GBGA 5SZKB 1SZJG 1XLTC 4E5NA 5G4LA 2HQ1A 2GWHA 2ZJOA 3FD8A 3PDHA 3W4IA 1FSGA 3R5KA 1QS0A 1Z6ZA 4RCVA 2KPOA 3W9YA 4FXPA 3R6DA 4Q03A 2XA1A 4H59A 3TUJC 1S0UA 3V1NA 3K31A 4E5DA 5GGYA 2JHGA 1F8YA 4XX1A 1K7EB 2W6MA 1Q1NA 4BGEA 2PQ2A 1TMGE 4C4RA 1C1YA 4CG3A 4Q7LA 3T9BA 4AIIA 1P3DA 3TR6A 2FP4B 3BGSA 1FY2A 4CLOB 3PUIA 1T8TA 3OZTA 1IXSB 3M70A 1EQ2A 1YONA 2VTDA 3PT9A 2PAAA 3QXJA 4KXXA 1H2WA 1O7JA 4Y1FA 3D1VA 3I8SA 2QZJA 2ILVA 4X6XA 1OROA 5JH7B 4NCAA 3VVLA 1PFUA 2VDQB 1NTOA 1VTKA 1T5TA 3FDJA 1T13A 1QE0A 3GEIA 3H5TA 2COEA 4OX9Y 1C0IA 1WDWB 9GPBA 5G0SA 2FW6A 1N3BA 4LV5B 2A92A 1GKYA 1C3OA 1FDVA 2ZRAA 4NMWA 1FQOA 1RM0A 1MO3A 3EIEA 4UAGA 5BURA 4E88A 3GPLA 3AVXA 2I2BA 4M2LA 4PSKA 3T1VA 2ONYA 1XXLA 3BCUA 3NC0C 3TUZC 1C7ZA 4NU8X 4DNOA 2KI5A 2GERA 4JITA 3MJVA 4JT9A 2HB6A 2YWDA 3EA4A 2M32A 1SHLA 3K9LA 1Y80A 3GHHA 1N6NA 4QXMA 1YCFA 2JGRA 3IUJA 6AT1A 5C4IA 4LQDA 5EERA 1QF9A 4ONEA 5C34B 3KR1A 4M9XA 2Q2OA 5EZYA 3ZHQA 3B85A 3OP4A 5F35A 1U7HA 4G0ZA 5DYTA 4JUAA 3FGNA 4M0CA 4CJXA 5DNDA 2YWFA 1FRNA 3GNLA 2I1WA 1G0OA 1M2FA 4R7TA 4XFDA 4AKTA 1ZN2A 3D1LA 2CL7X 5EWMB 4EKEA 5I5GA 5GIPE 3GEBA 4S3MA 1U1EA 2C8VA 2HGZA 1M1YA 1Z38A 2VXOA 2ZAOA 3AOGA 3HUTA 4HJRA 5E3JA 5BSVA 3DTVD 4FFNA 4LDNA 4MQ5A 4TYYA 5JS8A 3OOYA 4MRAA 3PLAE 3Q88A 3JQ8A 4HS4A 1YJXA 4OHKA 2IK8A 1QHIA 2PD3A 1U1FA 1RWKA 2XCOA 3F3KA 3ONDA 1NF2A 3DAGA 2DC1A 1GCUA 3ZV6A 3L0IB 3KHSA 5L4NA 3BD7A 3P4UA 4RTKA 2V7QA 4ALIA 2CE2X 3PXXA 1EIWA 3I9FA 3C4JA 2JFVA 2FETA 1P1HA 3BIJA 1H0SA 4MCIA 3IXLA 4FYKA 1A1VA 3HLYA 4OLJA 4DJJA 4WI1A 3ANSA 3RJZA 2C9CA 1NJSA 3JX9A 2DWPA 3PP8A 3ED1A 3GZNB 1ZN8A 4FFBA 1BMQA 3IJRA 3Q3HA 4NCXA 5JCOA 3UGTA 2BD0A 3EZNA 3O2NA 2AXPA 3FZGA 5IARA 2ZR8A 5ALJA 4EG4A 2C7OA 3OLYA 5FA6A 1BS2A 4PSVA 2VOJA 2PBFA 3E03A 2VSFA 3GW8A 3I1FA 1OFGA 3QF7A 3WRYA 3TD2A 2PEYA 5I5EA 3BRQA 4BFVA 2FEMA 3P9YA 2BP7A 3UMJA 5EGNA 2RIRA 1DADA 3C87A 4H3HB 3A11A 4FHGA 1CIVA 1EEHA 1CEXA 1VLMA 1KZ1A 2D7CA 4TMWA 5IZ4A 2DY1A 3I76A 5FFMA 4B47A 2BR5A 3QMWA 1WZEA 4FLMA 2GTHA 3NCTA 2O2JA 3NM5A 3QTLA 4MVJG 2DX7A 3WDKA 3EVAA 4WIAA 5AKKA 1FFXA 1OLUB 4KREA 1M1UA 1XVLA 3QVGA 1EUZA 3ENQA 1P9NA 5I7OA 1YU9A 2QW0X 3T7SA 3H5RA 4R2XA 2YIDA 2BEJA 4QOJA 1X8KA 1EA7A 5KVSA 5LQKA 1U7TA 2IP4A 3AEUA 1T2CA 1UBJS 1K8QA 2C92A 2C5FA 2QIOA 4W1SA 1T8RA 5AVKA 1PG5A 5B1EA 1XFDA 2D00A 1RZ3A 2E4YA 2WHXA 3E9RA 4FDUA 4QGHA 1GZ4A 1GILA 4DLWA 1R6AA 1Z25A 2AA3A 1BQ3A 1ZM3A 2CL0X 4U1RA 2CMDA 3QHPA 3OOEA 4II7A 2M6LA 2LCIA 2MSKA 4Z4FA 4GKJB 2YNMA 3GVXA 3TDMA 3R9KA 1U3DA 3O0TA 1G9TA 4MRMB 3IP7A 3D6VA 3VPDA 5F1YA 1H2EA 3G5UA 1E1CB 4NZNA 1HDXA 4C06A 3LI2A 4MITA 1NUAA 2OO7A 2ZJAA 2X0NA 4F3CA 2VH5R 4E46A 3UCFA 3RJ9A 1MKYA 4HH4A 1Z2PX 3LYUA 4WN3A 3KOMA 1EHIA 5FNVA 4OI0A 1U8AA 2CMFA 5BO5A 1MZVA 2PUWA 1W47A 2ZDQA 3EGIA 1ZVKA 3MGKA 5DNVA 1T2NA 3ICQB 4I55A 1H5QA 1P81A 4C87A 1ZI9A 2HSZA 1U5BB 4TSFD 2G7MC 4CKYA 1OGYA 1R64A 4IIJF 4B1FA 1N1MA 1N0UA 4N7JA 2D4HA 4ITRC 4Y1RA 3TOVA 3PQ3A 2QXYA 2XKAA 4AY5A 3QHAA 1N3IA 1VHLA 2XT0A 2DHCA 1CRPA 4ZCRA 4C7MA 2XCUA 1I6KA 5IG2A 3VNUA 4UZFA 4TZ6A 3PD1A 4Q3KA 1AKWA 3LHIA 1BX0A 4PCVA 3TIGA 5ERXA 5ED4A 3UFBA 2GBLC 1KFBB 2IPXA 3RWOA 5HZKA 2BMFA 5DSXA 5IYZA 1DG1G 3TLEA 3WWDA 2WSLA 2O06A 3ITDA 4PG6A 1W581 1C9MA 2UYGA 1VE6A 3GGPA 3Q7QA 3CLHA 4MJLA 3LWZA 4KC0A 4REOA 5EL0A 2HLHA 5LA6B 2I03A 4LK2A 3T99A 4KQFA 4YRSA 2GEDA 5CDGA 1FZTA 4WY2A 5AOBA 4D74A 1XXHB 2JGDA 1YZNA 2JI8A 1NF8A 1A8HA 1RP7A 3P94A 4J0GA 3OEHA 1ZYUA 2C54A 2NQ2C 1PUIA 3E9CA 3JQGB 4O4LB 5DO9A 1PLLA 2JLCA 4BX3A 1XCPA 2AWNA 2P35A 2P9ZA 1WTAA 2HD4A 2R6DA 3DWEX 3LW8A 4HPJB 4IWXA 4EY7A 5JRZA 4BFTA 1TO1E 2AMJA 5CT4A 3IKMB 2CXNA 4R41A 3CONA 1J07A 5KYTA 4O25A 3DMTC 3DTVB 3EVFA 4WOJA 2CY0A 2DPGA 4QQNA 3ZWBA 1P1IA 3KV1A 5JADA 1TO2E 4HOYA 3G49A 1E1QD 1O6FA 1WCV1 2O1SA 2OO5C 1U63A 1WXFA 1SQGA 2O3UA 4TS1A 4Z0PA 3ST7A 1E9VA 2QQ0A 1CS0B 1R4MA 5IAJA 4G0QA 1XALA 2XE8A 3A6PC 4W6QA 4EG5A 4JCOA 3CBGA 1LF0A 4DQKA 3AG5A 1X8XA 4MO9A 1NXTA 1WS6A 2O8VA 3H1EA 4EHBA 3QGMA 4OXKA 3WIBA 4J6EA 1SQ0A 1H1LB 2B30A 2B4QA 2DQSA 2W4IA 4QDJA 4YALA 5B3JC 3PJGA 2HFKA 3A27A 1B41A 3BMCA 1AU9A 2QGZA 1U9YA 4IMIB 3TQIA 1RYFA 1WCIA 5HJEA 1EP2B 3NFYA 1XTSA 4MP8A 1GKKA 4MO2A 4O8CA 2HHLA 2XHZA 3L8MA 3NHKA 1XO1A 1GIAA 4MQFA 1MVNA 1UDCA 2I67A 1EDDA 1NJ8A 2R8RA 4N40A 4NU6A 4XTCS 1TYZA 3UMGA 3TK1A 3DL0A 4KODA 2ZB4A 4CM9A 1L4MA 4CLXA 3QUSA 5KYVA 3L5KA 4EVIA 3STHA 3CKYA 3SSAA 3U6KA 2OZLB 2QUAA 3ZGOA 2JRLA 2V97A 4WKOA 3LOPA 4HVCA 3PX3A 4Q47A 5H80A 1DIAA 2PA3A 4N03A 5FAXA 4XEUA 4KITB 3WL7A 1M8GA 1WQ1R 2QR2A 4G85A 4GM0A 4OM7A 1ZNXA 1L8OA 4ENRA 3P27A 3TNFA 2O1EA 2EFYA 4L5JA 1HFEL 3JARB 4RFSA 3W06A 3KYCB 5K2OA 3NNNA 1DB3A 4RWZA 1W75A 5J40A 5ABPA 1Y33E 2B4KA 3HB0A 2QQFA 1ZVVA 2BAGA 2PRKA 4XVCA 1E8DA 2HK8A 3TSCA 1Z08A 3ZK7A 5BRAA 1CUXA 2JVJA 3FNHA 2JIQA 4DR6B 3DV9A 1ADGA 1YNOA 3KE9A 1KYQA 2QSUA 3Q6MA 4HD8A 4JDUA 4NMHA 5DX0A 5EJIA 5KX5B 5AK6A 3O74A 3WWOA 4BWYA 5IWCA 3C70A 1ZFNA 3WAKA 5AUOB 3B9RA 1U8YA 1EK6A 4J91A 4H17A 1AKYA 3DHWC 4WH0A 3S7TA 4I1PA 1E94E 3R4VA 4JLBA 5T3YA 3OQVA 1G20A 3D3WB 3TQQA 3WKAA 1HX7A 4LQLA 3V32A 5JD6A 3BSFA 2CFTA 4JQZA 2MIIA 4RS3A 3OCCA 3OFSA 2DPYA 2NSDA 3I64A 3ROFA 5DKFA 1RQLA 2A5JA 3DE4X 4BE4A 5AHRA 4DJDC 3K8QA 1L6IA 4EM6A 3HKEB 4ZVRA 3WFJA 4RBNA 1VIMA 1PFKA 2ZIGA 3BWVA 1YD7A 3CSUA 1M74A 4LWQA 4Q5IA 2GRUA 1RZRD 2SKCA 1OHHD 3FDZA 5JYCA 4EFKA 1V4VA 1IN1A 4NYMR 3H2HA 4RDHA 3IAM6 1SG0A 1VPLA 3QH4A 5BV1A 2C94A 2IOFA 3TZEA 1SHZA 5JYDA 1DAHA 3UV7A 1SQ6A 4OHWA 4XGNA 4PZ9A 4HGQA 4WTOA 4HRAA 5KWSA 3FMFA 4F8JA 3H9EO 2WHRA 4LYHA 4A8JB 5AM0A 4ZGWA 3C8UA 4K8OA 1N6OA 2ZLBA 1XVUA 2JRCA 1F6WA 1PQPA 2BZ0A 3FPKA 3PHLA 3U2QA 2PXAA 2HWWA 2VWPA 2XQKA 3AUKA 4M3NA 4EK9A 4XZ3A 2I7DA 5KTRA 3JQBA 3A2KA 1W19A 1FYWA 1ZU4A 4XW2A 1G19A 3G68A 1H65A 4QC2A 4JXZA 3OPNA 1PL0A 3RTEA 2C2YA 2WJVA 3FY4A 3W8EA 5FTNA 3AYZB 1DJOA 1EG2A 2J3MA 3DFUA 1BMFA 1WKCA 2ACKA 1AN0A 2YY5A 3LE8A 2DSTA 4O0LA 4N41A 3AY7A 3COPA 3WMEA 4BZZA 5JNVA 2NV6A 2MSEB 3CNHA 3EIXA 4BFWA 5CB4A 3P9NA 2HWXA 4TTIA 1CY7A 2V7UA 4OHBA 4DMGA 5C37A 1OX4A 1Y3DE 2E48A 2Y93A 4DLKA 2H16A 1NVUQ 2HCFA 3EULA 4FUTA 3VKVA 4D9GA 1TD9A 5HILA 3NBXX 5M2QA 3NCHA 3IP5A 3N2KB 5EYPA 3QI7A 3AR9A 4B4VA 4HB3A 1QIKA 1GL3A 1OV4A 3DAYA 3RYCA 1F2TB 3PC6A 4AECA 2C7PA 3IIKA 4U9IS 2HPAA 1DELA 2QIPA 3JQEA 2LDBA 1C4OA 2VH2A 2IYUA 3O9MA 4X6UA 1WU8A 5JMOA 3ONFA 2DMRA 1K8YB 1A2OA 1PZXA 5FL7A 2ACVA 1ZY2A 1ZWKA 1LY1A 1ZLXA 1ZZGA 2O05A 3QFRA 4H6PA 5KHAA 3UMMA 1HH4A 3N8DA 1KOJA 4OYHA 721PA 2O2YA 4W8OA 2PCLA 3CO5A 2G9UA 4RVSA 1DO8A 3N6XA 1XLWA 4PAMA 1XPJA 2XUPA 2FEOA 4LHWA 4PG5A 3JYOA 4QULA 2W2LD 5CJJA 4RTOA 1HKUA 5JSUA 4MEAA 3WP0A 4Y2QA 2GN4A 1B3RA 1ZRSA 3AERA 2I71A 1OC4A 3QVOA 3BN3A 3PDWA 4FNGA 5CU7A 3SAJA 4AJ4A 3K6SA 2Q0HA 4HSEA 2CJYA 2I33A 2H1OA 1M1XB 3CZAA 3GT3A 2HF8A 5K6RA 1EFPA 3WQHA 1E5VA 1O4VA 3JAWA 4E2WA 4ZK2A 1FRFS 5KPJA 1D8TA 1R6XA 1TVMA 3V6LA 5A0FA 3KC2A 4JEUA 3BILA 4JLJA 3TQTA 2F55A 3CFYA 4IIVA 1QCCA 4X20A 3C3YA 5BXQC 4LYFA 1MBZA 3PYLA 3RNOA 2DKFA 2HQBA 3HRHA 1NI4B 1KH2A 1FVOA 4EB8A 1FDOA 2R6FA 1YE3A 3KYJB 5KVAA 5LJLA 3EMKA 3EUWA 4UHFA 3IHWA 3B1XA 4C2BA 4C5AA 4EMUA 3SQDA 4KNWA 2NAPA 1EGVB 1RRGA 1S2LA 3FF4A 4FYJA 5EMKA 1KNXA 4C0LA 2MHCA 4FOLA 4FB5A 2PSHA 1UBRS 2UXCB 4MK4A 2VP6A 3AUFA 1V1MB 2H6EA 4KG7A 1BA3A 4L8YA 3TGWA 4DMCA 4EUFA 5LP6A 4MVYA 2B2CA 4MHSA 1V9CA 2YVLA 1VKRA 2R5NA 4RVOA 3SM3A 4HAUA 2D3TA 3GARA 2WSSA 1YACA 2FWNA 1FS5A 1CEQA 2ZITA 1ZOOA 3PJRA 3AF0A 3MXOA 4JL8A 2JW5A 2R6R1 3CNEA 5TVGA 1L3CA 3QPAA 4XI9A 5I51A 1A69A 4X3CA 1E2LA 2QN1A 4JQOA 2GO7A 5LDHA 3O3CA 1B7GO 3I2IA 4NL4H 1VG1A 3DR5A 1N33B 4BNDB 3QFFA 3WLOA 5EUMA 3SZGA 3VPFA 1GG9A 4IL5A 4CV1A 3A0RB 3KEGA 1FUKA 1G2PA 1UUFA 3OICA 3ORRA 2ECOA 3A05A 3LL4A 3E7WA 4FDVA 3NWBA 4FEEA 4LDPA 3KJXA 2A35A 3O8NA 4G8DA 4RTJA 3AONB 3AT1A 5FPQA 1J8FA 4RKFA 3E1SA 1V6CA 4JHLA 3NBQA 4KWIA 3UAYA 5GOTA 1E2HA 1A82A 3M4YA 3V8VA 4YUYA 1ZOIA 2JFFA 3H42B 4JUIA 1GYPA 3OHPA 4OP3A 3GJQA 1Q2UA 4JNKA 3H99A 4H3KB 3VR2A 4C29A 4X95A 4XVHA 3S55A 5ITWA 3DCYA 2VK2A 3Q3VA 4OXRA 3VHQA 1SPXA 1P3Y1 3VR6D 4R1MA 3SICE 1O58A 2PBLA 3GGJA 3WLFA 3SZUA 1YKGA 3E8SA 1G8YA 2DBRA 3NPMA 1P7VA 2O8EA 1K3UB 1FLVA 4D6PA 2ODBA 2CNKA 3ICPA 3ANTA 5CFLA 2BFDB 3QOXA 4XWWA 1FJXA 3L7BA 2OLJA 2CXPA 2IODA 5KMGB 2XD4A 4M9CA 1TYBE 3E0XA 1OPRA 1UZMA 4MWZA 2ZP1A 2ASVA 1VYUA 1XKXA 3ZUGA 2RK4A 4FFRA 3ZY5A 2FSSA 4KGDA 4RJTA 4GSKA 5TEVA 3WOHA 4BV2A 4LI3X 1P75A 4LXTA 2IXFA 1S02A 1XRLA 2VIIA 3EWAA 4WBXC 4QPCA 1BVYF 4GKVA 4FJ2A 3PXDA 5K8UA 2GZMA 2QYSA 4C3UA 4MIEA 1EGAA 1JECA 1OFTA 1OWOA 2GPTA 1K7SN 2PH3A 2XNCA 3KELA 3JD3A 3NASA 4IDDA 3FPFA 4P36A 1C0LA 4AF7A 3ZNPA 5IPFA 2DXIA 3DBHA 4OAQA 4FYXA 3ZIDA 4QFBA 1E9EA 3I32A 5CYPA 5LWQA 3L8EA 3RRMA 4NESA 4MINA 1V37A 1TQDA 4QUKA 4AQYB 2F9LA 5KYUB 1CSEE 1DKQA 5C4GB 1NTRA 1R37A 1PF7E 3PSHA 4Q9JA 3M34A 4YMUA 1YTUA 5JARA 5KDOA 4YROA 1L5FA 1JJFA 3D8RA 5A05A 3UUEA 1DKLA 5JCOC 4ZP1A 4F2GA 1SWVA 4MW2A 1QKIA 2R4TA 3OG9A 3UB2A 4D3SA 5KUTA 2D7DA 1QH8B 2FTKE 4US1R 4ZOCA 4WZAA 3VU8A 4MWOA 4BYMA 3Q7SA 1XV5A 1KK2A 1NHWA 3MS4A 4F6CA 5EI5A 1H8EA 5EXPA 3RRFA 2GASA 4M76B 2IV2X 3ZDQA 5C8YF 3P2IA 1YS9A 4BDSA 1FU7A 1VMEA 3LY5A 4KOAA 3CF4A 3MIIA 1MJ5A 4JC5A 1NW7A 5ILQA 1NPTO 1Z33A 3TRHA 3KSAC 4MR8B 5CM8B 5CDFA 3EDMA 2BSXA 1ETHA 3ECSA 2PKWA 3FPCA 4V0MA 4DANA 4BBJA 2H2HA 1QG4A 1ZVMA 4JAVC 3QUTA 3ROEA 3S2UA 1L5NA 1TUGA 4KFUA 2Y6UA 3C43A 4L8LA 1MO2A 1JZTA 1UM8A 3H5NA 4RZ3A 5KSPA 1ZJWA 2EYUA 2YHUA 2Y2VA 3Q6IA 2PZGA 3DE7X 2QLBA 3O8LA 3EF3A 4KOEC 3L1IA 5COAA 1OWNA 1Y6QA 1U4NA 1C7FA 4RPHA 4XUDA 2HV8A 4UREA 4B6FA 4JOSA 1C0KA 2IRWA 3ZNQA 4ZZ3A 3IMKA 5T7BA 4MW0A 2OVBA 3D6NB 4QVIA 2X0EA 2ECKA 1TEVA 1G1MA 2HL6A 5AK3A 2PHZA 5JRDS 2X0DA 1RKBA 3GMTA 3RFUA 2IF0A 4BLQA 2Z6QA 1YE5A 1SBQA 2AQIA 1CNEA 1ZM2A 1M0EA 3CRNA 5EKDA 4HQNA 3M7IA 2HN9A 5K01A 2HF7A 1SZPA 3C1UA 2VT3A 1WXHA 3DMPA 3QM1A 1OT5A 4K6OA 4NU5A 2UZ4A 3WV5A 1H4SA 3RNLA 2EW2A 2HSWA 3PR1A 5L9AA 3DBOB 5K51A 1JMYA 3AESB 3IT0A 3SS8A 3VR4D 1WM1A 3QLVA 3QV1A 2OOKA 3G9QA 5LBIA 3IVAA 2C2GA 4EUNA 3KEFA 4FD2A 2DF8A 3QUBA 3HM2A 2G8NA 3VR6H 4D5EA 4QFCA 2IJGX 3K1TA 2ZU0C 1DEHA 4Z9BA 3ZGZA 3KSDO 1RHRA 4KIGA 4NNOA 4NPHA 4HZUA 3THOA 3AEQB 3UT5B 4MS3A 3HRKA 2OXFA 4Q3OA 2ZRQA 2DH6A 1DCKA 5EKUA 1KYYA 1POWA 2ZS8A 4KWTA 3AJDA 3CUSA 4HKTA 4AURA 2ZYUX 5ADWA 2BJHA 3QELB 1W0JA 3DWIA 4RACA 4CN9A 3TW0A 3NHUA 5B57C 4H31A 1GA6A 3O4FA 1LU9A 4WASA 1N2ZA 3EVCA 4FTWA 4W1QA 4G6ZA 5C1OA 1LK5A 3P52A 1Q7EA 3QOFA 4I9NA 5JI2E 4J43A 4KIJA 3NHJA 3ZV5A 1X7ZA 4FT2A 5A4KA 1E7RA 2F64A 3W6PA 5BN3A 2HDNB 3EFOB 4WK2B 1I13A 3O4GA 3FTDA 3DKKA 4UBLA 1B16A 4KMOA 5KYXB 1OC2A 1KK1A 1RYNA 2JLWA 3CW8X 4YT2A 1R9NA 3ZE6A 2ZPAA 3P2EA 1ZBQA 2DQKA 4X8LA 4CHTA 5JSZB 5EY5B 2O8CB 3I45A 4ARZB 1P77A 2PGIA 3ONVA 1LTKA 3REGA 1E2NA 2Z1DA 1IC6A 4U0KA 4URXR 5B3AA 5ALPA 5ICEA 4KK4A 5FI0B 4F56A 2L69A 4XWAA 2WIAA 2P6OA 2WWHA 3GBPA 3KXDA 2P5SA 2XZTA 1RXEA 3L1UA 4RF2A 3WGIA 1P4GA 4RK6A 4KZPA 2I80A 1VKJA 5CTJA 1DTEA 3ZU4A 3HO6A 4UM8B 3QV2A 4ZDKA 4RZSA 3VU3A 3RREA 4ALLA 2O54A 3PXEA 4P5PA 1CZKA 3ZD8A 4YRNA 5KYWA 1CW2B 2OFPA 1G18A 1NQOA 3BD9A 3P0JA 3LUKA 1HY3A 3SXUB 3RFTA 1APBA 4BNLA 1L5WA 1Z34A 2B1QA 2X1VA 2Y1GA 1AUVA 1NY5A 1SB8A 1KKMA 1PK8A 1JIJA 3KDPA 3PUZA 4DABA 1JX6A 2AXQA 3AF2A 5IJAA 5LLDA 3KEMA 4C0HA 5F7OA 1E32A 2CW5A 1PQ4A 1P4SA 2JLUA 4CCWA 4MRRA 5F33A 1LJ8A 2YWJA 4BFLA 4TLMB 2GNAA 5AJHA 1EFTA 3WA7A 2ERXA 4RTNA 2DECA 5A4MS 2YQ5A 3B5JA 3ZGYA 1PT7A 4ZQCB 2XSZD 2B6NA 2BGNA 1Z4JA 2GBPA 2GHQA 1IL0A 2VG8A 5FDFA 1BMDA 4AC9A 1JG4A 1RWMA 2O0MA 2QTHA 1BXRB 2PSEA 3C85A 1NV8A 3JWJA 3PWKA 5CXXA 1T8PA 2WNHA 5EKXA 2WZBA 4D57A 3EVBA 2G8LA 3A9VA 4YY3B 4KIWA 4KW7A 1M6EX 2LKCA 2MMCA 3G0DA 4V24A 5D5QA 1ENPA 4JQCA 4MKRA 3VSEA 3IJEB 1NDHA 5JAIA 4FW8A 4QEKA 2LV8A 1V0JA 3RV4A 1SC9A 3NORA 1DBWA 2EBWA 2JI7A 2ZIVB 4FMDF 1I1HA 4TTRA 3ZZ1A 2PPLA 5EA2A 3QLUC 5E8JA 4C76A 1UEIA 4C5BA 3LU1A 5CBPA 4JCCA 1YIDA 5C8XA 4PZDA 3KQYA 5DCYA 5BRJA 3G2IA 2HAEA 5EIBC 4OVKA 1DQSA 3P4YA 4WPGA 2X3YA 2WF9A 1OU0A 3AXTA 1RWQA 3VSCA 3HBAA 5JDIC 3Q3EA 3KT8A 4OD0A 2A7QA 2B3TA 3JQDA 1XDWA 3GVCA 4JKOA 1CY6A 1V8ZA 2PT9A 1D5CA 4QGFA 1NPYA 3A9UA 3EGXB 4ZTUB 2XYHA 3LSYA 4A1OA 2O3TA 5HWSA 1IIBA 4B80A 1DKNA 1G7TA 5F51A 4WXYB 6REQA 3OQOA 1WVGA 3OFND 2NYUA 5ALLA 4ZAGA 4UM9D 4ZCPA 1XZGA 3R7FA 3OCZA 4UE3S 1W93A 2JCBA 4X8HA 3RR2A 4OI4A 1E7YA 2D06A 3GRYA 1R4ZA 4BMNA 4BHTA 5J23A 1F3OA 2YJZA 1J8MF 2AJBA 2PN1A 4G1UC 3WLHA 4Q9IA 4B8WA 1KJIA 2R2GA 1JEAA 2EHDA 1MB4A 3FLEA 3RJTA 4FOPA 4IDGA 1SC1A 3D7SA 3JYPA 4GC5A 4EOGA 3KQUA 2IOFK 3HUFA 2IEDA 1EBUA 2C57A 4NFSA 3W5BA 3U26A 3EOBI 1EUCB 4DJEC 1CQIA 5K09A 3JVEA 1R5NA 1S5PA 1M2OB 2J8ZA 1T0IA 1UF9A 2Q4DA 3F96A 1CHNA 3HPRA 3ONWA 2DZDA 2X0JA 1A9ZA 1RRMA 1T4MA 1UJCA 3EUEA 2N46A 1WKVA 5CBKA 5LUBA 1L7NA 5FV4A 2XBLA 1Y6GA 1E3TA 3U7GA 2PX4A 3P96A 1GNQA 5DT2A 3GG9A 1T1IA 2V6MA 3M6FA 4HUQA 5DBOA 4I4IA 1GPBA 5KSWB 4KR7A 4P22A 1Z2AA 3D5QA 4M6WA 1NYQA 2PZJA 1N75A 2XQVA 3QY0A 2R8PA 4WNAB 1NVMB 2YMQA 2YY6A 3VAYA 1VE1A 2YIMA 1A5BB 1VG8A 2R84A 2BM1A 1X13A 4GKKB 4F11A 5REQA 3BFVA 7REQB 5H5JA 1AQYA 2P6MA 2ZTSA 4M8LA 3B8EA 1EVKA 3O92A 3DDHA 3UWMA 4EABA 3NEJA 3WAJA 2B7CA 1F9AA 2NSYA 1J2RA 2AOXA 4GX2A 4TXLA 5EP4A 3RHSA 2PGOA 2C9OA 1IQ0A 1KZGB 3H1AA 1P7YA 3JQBC 2NTJA 3LPNA 1X7WA 4JJFA 4N3AA 4PSDA 4E3WA 5HF9A 4E21A 2OCXA 1IWPB 1JR3A 4GS5A 1UMDA 1PT9A 2WJAA 4WLVA 2I6FA 2IOQA 1PWYE 2B98A 1J00A 3L2OB 3UXYA 1TQ8A 1M73E 5TMPA 1QDEA 5DGDA 1PJRA 3RK1A 3LZ6A 2Y9MB 4V0OA 2O8FA 4HF7A 4JLVA 4FCVA 4ROSA 5JWHA 3ZYZA 4EAAA 3M6IA 4GP9A 1MB2A 3WIVA 2PMKA 2EX1A 5FWDA 2CCJA 2GBCA 2BR4A 1INLA 3E3NA 2XUOA 4JYCA 1ZSNA 4EGJA 5AESA 5FOXA 3VDQA 4RTRA 3U37A 4BC1A 3JSAA 3N2LA 1VBKA 1WXIA 2ZBQA 3QLJA 3TDKA 1NE7A 1WCWA 5JNUA 4WCFB 4XUEA 2IZOA 4CNQA 3IBFA 4FI3F 4CQLB 2UZ0A 1BH2A 1JW9B 2UZ1B 3UMCA 1R0BA 2QN2A 2X13A 4QPJC 2OQRA 4NZMA 4XH9B 3SC4A 1UXIA 1GRNA 1HDRA 4CODB 1SVNA 1I3NA 1GPJA 2DQ4A 4M7RA 5EQTA 2IV3A 1N5RA 4B31A 3IH5A 4QIHA 4BJ5A 2QW1A 1TJ4A 4CLOA 2FP4A 1E2IA 3D54D 3BZUA 2FOLA 2ID4A 4LCEA 1NW5A 2HF9A 4Q12A 3RU3A 1R9GA 4B9AA 1OLXB 3GYBA 2R7LA 3SZ3A 3GN1A 3KFXA 3EDQA 3FYDA 2P9FA 4N6OA 4Y8VA 5JH7A 3R5JA 2G88A 4R8RA 2XB2A 3ANNA 5JDCC 3A31A 1JEQB 1Y5RA 2OG2A 4DPKA 4D98A 3FUXA 2HM7A 1JHDA 2QU8A 4PNZA 5CJPA 3THWB 1A2BA 4ASUD 5TT1A 3WHLA 1PHRA 2O3QA 3OOSA 4RADA 3SOZA 1M83A 2PZKA 2VN8A 4N8SA 2Z9DA 2OCPA 2TRSB 1RJ9B 5DX1A 3ZY2A 2IHVA 3GPCA 2I4TA 2JDIA 4MRSA 5AQEA 2YFHA 2GVNA 4A91A 3ZCTA 5IZCA 3T9FA 4C0QC 4TS4A 4ZD6A 1U7ZA 1NQXA 4MYRA 2FCAA 2NO1A 1UOOA 3Q72A 2JJ8A 2REBA 1Y5NA 1T5IA 2WICA 1ACMA 4NZOA 3MJ4A 4V0KA 3FDFA 4EKDA 2Q1XA 4CBVA 3K9WA 4IGEA 2QRGA 4AJPA 1WB5A 3W9SA 4L3VA 2B36A 1YBFA 5DNWA 2BEKA 5J4VA 3KFVA 3PXAA 3HCEA 3SWWA 2NOAA 1PD1A 4QPNA 1K98A 1BXZA 1R0YA 1W5BA 5EWMA 3UHOA 4UM9B 4GW3A 4ZT5A 2ZIAA 1Q3HA 5CTAA 1E6LA 1X1CA 1QRUA 1Q0ZA 1CVRA 1CJKC 4EMSA 4KPEC 3H04A 3NYRA 4PQEA 4F5YA 3MGCA 3PHJA 4PZAA 1RNLA 1XJCA 4LDZA 4X1IB 4AZ3B 2FDCA 2DLNA 2V03A 4K87A 1CFZA 5CNIA 5JVDB 4K8RB 1P4AA 3AY3A 3U16A 5TDHA 1EU1A 4D8XA 3KKEA 5H4GA 3GCWA 3OMLA 3ZBQA 5JROA 2D2FA 2ZT8A 3N0TA 2GKGA 3N8KA 1ZCZA 2AN9A 2V74B 3BWEA 1NSTA 4FN5A 2G77B 5F78A 1KC3A 3ROTA 4BCCA 2QLTA 6Q21A 5EWJB 1QHYA 1QO7A 1ULTA 3KL2A 4QODA 3CX8A 2NZJA 1LX7A 2YJGA 4IG9A 2BW0A 4II3A 3R5HA 4Q18A 4YK7A 3V1MA 5ALRA 1R6VA 1KQNA 3IEIA 5P8WA 1NBME 3GZNA 4G97A 1IWOA 3EVZA 1JRLA 1PR3A 2XWQA 3A14A 4MYDA 4ESHA 1P4JA 5C5CA 4CEHB 5FR2A 3JQQA 3NBFA 3JS5A 4HQKA 4RIIA 1IY0A 1JALA 3P1JA 2D2XA 1ZKDA 3F5DA 4F1JA 2YCLA 2XZPA 1U2GA 3NAQA 4DRYA 3KWMA 4B3IA 1F2DA 3B6ZA 4HNAB 4S1WA 2VA9A 1DBQA 4YUAA 1CZRA 1C9JA 5IT0A 3RC1A 2NUBA 3AR3A 3A1NA 4TTJA 1HEIA 1QQ6A 2NU8B 2PLFA 2AW5A 3TIXB 4QYSA 4Z4CA 3BQMB 3NKFA 1GPMA 2CFOA 1KVSA 1ORVA 1CS4C 4IVQA 5EESA 3PTLA 1A9PA 3DW1X 2HUPA 4MLDA 4C7OB 3K9QO 1RWNA 1N7GA 2W7TA 1NMEA 3B13B 2TMDA 3PFFA 3OCWA 3RTCA 4GSLA 2RGGA 4PXSA 1OLUA 1P2GA 1X87A 4Q9HA 2I78A 3HO1A 1RSZA 2JPDA 3BF7A 3Q6NA 2EIXA 3A26A 1DC3A 1YCHA 2QYTA 3PNLA 3DD5A 1UT8A 3WK6A 4BUJA 4TYMA 4IPTA 3O2JA 3SHTA 1E6UA 5IRCD 3EGEA 3FCSB 1FXSA 2XF2A 3V5NA 1V16B 1UOPA 1Z56C 3TW4A 3U4DA 2GZAA 3ZX4A 3OKFA 3ORFA 4DLYA 1Z5VA 5KNCH 1ONOA 3D8HA 4R2HA 2JD0A 3GUCA 3N6VA 5BYKA 2JZCA 1EDZA 4OGKA 4YMTA 4M88A 1ZEMA 1GNTA 1S01A 2EL9A 1ST3A 4MV1A 4Y18A 4GBJA 3I3OA 1TK9A 4GDMA 1QHEA 2NT3A 3RU2A 2O0KA 2YJ3A 4BRUA 4EJ2A 5IULC 1BMTA 4YACA 4MRMA 2P2YA 1FVHA 1I2MA 1PGQA 2OY0A 5ALFA 2CC2A 5ECWA 2E3JA 3KKPA 2PKRA 3GLGE 2FOXA 1W5TA 2X4GA 4B8ZA 1NC1A 4DV5B 4YRCA 1W73A 2H17A 5EQJB 1EXVA 4ZA2A 3IT3A 1GQ2A 5HCUA 4IR7A 3SQOA 5L40A 4YP0A 4DXAA 2YBEA 3ME5A 3PL1A 1I2CA 1UFQA 221PA 2JK0A 1NBMD 3DPIA 1DS6A 3GB9A 3K9BA 5I9SA 4BVFA 1SU8A 1DV2A 4I46A 1ABFA 1I80A 2GAAA 2RGUA 3IQZA 3MWKA 3O73A 2RKBA 3PE6A 2KBFA 4RSRA 1U4OA 2CUTA 1Y1LA 2J3QA 2EP8A 3W2EA 5DHQA 3H16A 1U5BA 2RHJA 4GG1A 4TMTA 5HIJA 4C78A 4AF8A 5CDSA 2YJ5A 4YJFA 2QUHA 2BHNA 1M1ZA 2OYRA 4WL0A 4PBTA 1H1DA 2NUPB 1QVAA 3T7CA 3MCTA 1MEJA 1G3RA 1UJMA 5GP1A 5HG0A 3WL5A 4D3XA 4EQ6A 1DAGA 1EX9A 2VPYA 4LYAA 1K92A 4NMXB 1XMPA 3PDIB 1CDZA 3HFJA 1CDOA 4RV5A 3D7RA 4AKEA 1PYOA 3WK7A 4EITA 4M46A 5M7EA 2CV0A 4BX2A 3IMFA 1NBAA 3JALB 4KR2A 3OJEA 2WWGA 1KETA 4HRVA 3CH6A 4I4LA 4BO5A 3GG2A 3OLZA 3BEOA 4WJZA 5KAMA 5FBQB 3D4LA 1A77A 4TQAA 4F92B 2HQOA 1S2GA 3D2AA 3HLKA 1XXHA 1KBQA 3A4LA 1O95D 3O2SB 4BWFB 1S96A 3QVKA 3ZV3A 1CIPA 2CKDA 2EZ4A 4LDRA 3ZBUA 5CD9A 1R18A 3KKMA 1WZNA 3ONEA 3HO8A 1KEPA 3JQGA 4O4LA 2OFWA 4GR4A 2C3OA 3NJ4A 2UXDB 1XDZA 1QBKC 5F5LA 1LLQA 4WGGA 3RIMA 1XNGA 1HFKA 1FDRA 1E60A 1DG3A 4U3JB 5CIWA 3G5MA