1EWTA

Crystal structure of metabotropic glutamate receptor subtype 1 ligand free form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
478
structure length
456
Chain Sequence
QRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
publication title Structural basis of glutamate recognition by a dimeric metabotropic glutamate receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 144
structure length 456
sequence length 478
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewtA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewtA01
4MR9A 2WWVD 1VPWA 3H5WA 5KQLA 3TMYA 3OLXA 3Q7RA 4QYMA 4F06A 4D74A 1U2QA 4MQFB 4N0QA 3QEKA 2FEKA 2HPHA 4D6XA 3BILA 3IPCA 4ML3A 4OATA 1ZY2A 5EWLB 4W5OA 3Q15C 3EAFA 1LJLA 4JAVC 4TLLB 1EWVA 2PLNA 2Q5CA 4KNYA 5TPWA 4MS4A 3LUHA 1PUXA 2A9OA 3LTEA 2PUGA 3HEBA 4Z4IA 1BDHA 1W25A 1S8NA 3H5VA 4YGXB 2LIVA 2VUHB 4G0ZA 1LBHA 3RVOA 4NCAA 2MSWA 1GLGA 2MSLA 3VNAA 1Z16A 1JYEA 3QLUC 3OM0A 4ZYLA 4N03A 1XHFA 3TB6A 3QEMB 3LUAA 2J48A 1JBEA 4HYEA 2CHEA 5BRAA 2TMYA 4H60A 4N41A 5IULC 1VKRA 3DBIA 2FQXA 3KLNA 4YR7A 5FWXB 2NUBA 1YTUA 2PL1A 3M6MD 3H5IA 5KWSA 2GKGA 3IP7A 1RXIA 2E4WA 1P6UA 2JBAB 2PKXA 3H6GA 3GBPA 5DGCA 3CG4A 4O5AA 1Y1LA 2W42A 1ZDMA 1SXHA 1GUDA 5HM6A 4RDCA 3MYYA 3RQIA 2B4AA 1DRKA 1DC7A 1L5ZA 3T8YA 4G0XA 4NCBA 2R4QA 1NXTA 1RNLA 1VRVA 1OXKB 3FDFA 5KC8A 3DLHA 1RZRD 4XAQA 5TQJA 4KMRA 2L19A 4TLMB 3RVJA 4XFKA 3MM4A 4TMYA 1ABFA 4RWEA 4RXUA 1FFSA 2FXIA 4KQ9A 3RVPA 1YIOA 5T7BA 3HO1A 4FE7A 2WB4A 5JNRA 3GL9A 3SQNA 3HM9A 1FQWA 4FE4A 4NV3A 4KREA 3O1HB 5PNTA 3NHMA 2NT3A 4MYRA 4EYOA 1U2PA 4YP9A 2RDMA 2VYCA 3EGCA 3C3KA 3OLVA 4E7PA 4KVFA 3OQNA 4IILA 5HQJA 4EVQA 2FMFA 3LFTA 4XXHA 2FEWB 1Z12A 4JB2A 1JHZA 1K66A 3RVNA 1ZAYA 2MYUA 1W9HA 3A3KA 1HEYA 4WXEA 4ETIA 1CEYA 3KLOA 1D2AA 1EWTA 4YCSA 1MAVA 3Q7TA 1DC8A 1BA2A 4ZMRA 1ABEA 1ISRA 1DCFA 2HJ9A 3MF4A 3O21A 1YVUA 3NNDA 2L17A 6ABPA 4OG2A 4HNSA 2LPMA 1IIBA 5TQ2B 2WRZA 1NXSA 1Z25A 2B1JA 3RVMA 2QW1A 3DGEC 1DZ3A 5FBHA 4KQCA 4B09A 5DKFA 3KYIB 3ILHA 4PZ0A 2CD7A 3A0RB 1ZHHA 2HQRA 1QP4A 2ZWMA 3NNSA 1VLZA 3DGFC 3IP6A 5DLEA 3N0RA 2P9HA 2QV0A 1Z17A 1QKKA 3ILYA 3EQ2A 4DADA 1ZGZA 3GRCA 5CNJA 3NNNA 4JP1A 4YO7A 5ED4A 4Q7EA 3IP9A 4N0PA 2R48A 4EVRA 2PUBA 1M2FA 1QNLA 3KTOA 3CS3A 4JASB 4JB0A 4L4UA 2LP4Y 4Q6BA 1JFSA 1UDRA 1DG9A 3JS5A 3NBMA 1QO0A 3DLBA 1U04A 3I45A 4EUKA 3KG2A 2FW0A 4MQEB 3RVRA 1BVHA 2FLWA 4W5QA 4MR7B 2JBAA 4RY0A 1YK1A 2RGYA 3M9WA 4JOQA 4RK4A 1NXOA 4ETMA 2PUDA 1B00A 3E3MA 4G0YA 4RSMA 1E6LA 1C0EA 4CBVA 2MYPA 3N0XA 3C3WA 3QLUA 3LUJA 3SAJA 4MAAA 3HUTA 3C6QA 3OLYA 3T95A 1ZESA 5B3JC 3JVIA 1M2EA 3GV0A 1PHRA 1D5WA 2FQWA 2JVJA 2LUOA 3A0UA 1QQBA 4EGSA 3H6HA 4WT7A 3H5TA 3HS3A 2A9QA 5HKOA 3MQ4A 1NXXA 3M9XA 3HXMA 5JNSA 4F3TA 3RVQA 3JPYA 1CHNA 3I5AA 4PYRA 3HCWA 2IPLA 3B2NA 2PUEA 1EAYA 5CNIA 1J56A 3TO5A 4F8JA 3MA0A 2QSJA 1DCMA 1L5YA 1OXBB 2YHBA 1USKA 4MR8A 1P6QA 1R8JA 5CNKA 1TM2A 3GYBA 5EWMA 1APBA 2FMKA 5C5CA 5JNTA 2PL9A 4EYKA 2GX6A 6CHYA 3H1EA 4KZKA 2AYZA 1AB6A 4YV7A 3HDGA 1SD5A 4LRQA 1USIA 4Y9TA 2MYTA 5BQ3A 2PUAA 3SY8A 3N6VA 4MS1B 2IDMA 2L18A 3HJFA 3LMKA 1M5TA 3P9YA 3HUUA 1TLFA 4HNRA 4PICA 1KRXA 4YS6A 4KPYA 1E2BA 3BRQA 2FVYA 2JRLA 3N53A 5TQ2A 4Z4HA 3CTPA 1DP4A 4OLAA 3KJXA 3E61A 3CU5A 3SM9A 2H3HA 4P1ZA 3T6KA 2FMHA 2OQRA 3SG0A 2GBPA 3CZ5A 3FGZA 3MMNA 5IBQA 4WUTA 4YWHA 4RK5A 4HNQA 1BDIA 4OBBA 1P8AA 4Z99A 4Z4GA 4RXMA 3H5LA 1QO0D 3HV2A 4KV7A 3OLWA 3N75A 5FWYB 1PEAA 4MR8B 2NT4A 3EODA 2A9PA 1DBPA 2FTKE 2WMYA 3LUCA 4QICA 3BREA 5EWMB 1Z18A 1LBIA 5KQPA 3BBLA 3OQMA 4IMJB 4G0QA 1XWWA 1SXIA 3DZDA 1RXEA 5KI6A 2V0NA 3CRNA 3LUDA 3ROFA 3KSMA 2BGGA 3H1FA 4EYQA 4MQEA 4RU1A 1YMVA 1YMUA 1PNTA 3O74A 5C5EA 3LUKA 5TPZA 3JTEA 2QVGA 4MR7A 5IUNC 2GI4A 3OLZA 4IGAA 1JDNA 2I6FA 2VUIB 3L49A 4RK0A 4DN6A 4RK7A 2X7XA 3UK0A 3F73A 4RKRA 4O1HA 3R0JA 4N76A 2F8SA 2XDYA 1H9CA 4LZLA 2PJUA 4Z0NA 2N9UA 4W5RA 4PE5B 4UHJA 3OO0A 4G0OA 1NATA 4G0MA 3O75A 1U8TA 4RK1A 2IPNA 3LUFA 1E6MA 4XARA 1QMPA 2QXYA 3FFWA 9ABPA 1QQAA 1DRJA 1MB3A 2A9RA 3OQOA 3KHTA 3SNKA 1GUBA 4KRFA 3H1GA 5JNWA 4QYWA 4MS3A 2PUCA 2KYRA 1DBWA 1A04A 4RXTA 1DBQA 2RJOA 3GWGA 5EWJB 3D8UA 3HDVA 3G1WA 5FBKA 1JDPA 1URPA 4RK6A 4EYGA 3LKBA 2E4ZA 4RY8A 5BRJA 3KYJB 3GBVA 1P2FA 4L85A 4LE1A 3QLVC 2IYNA 3EJWA 7ABPA 2O20A 1DCKA 2AYXA 2HQBA 1QPZA 2QZJA 3Q7SA 2FMIA 5IC5A 2GWRA 3FMVA 4OTZA 3URMA 2NZUG 1JX6A 1PNRA 2MSKA 4OLBA 4WWHA 1KGSA 4KFCA 4MLCA 3LKVA 1BAPA 8ABPA 1M5UA 1RPJA 3HSYA 3NHZA 2F8TA 3UKJA 2CWDA 5GQSA 1CYEA 2ID7A 1YS7A 2E4YA 5ABPA 4MS1A 4EY3A 1XHEA 2FQYA 3EDCA 1KMIY 1I3CA 5JNUA 3D02A 4FB4A 1GCAA 3LOPA 1EFAA 2JCGA 2JVIA 1E6KA 5CNMA 4MS3B 5JS2A 4Z4CA 1PEYA 5IEJA 5DCLA 3MIZA 3QLTA 4MRMA 5KC9A 3IP5A 2ID9A 2IKSA 1NY5A 1T34A 2ZAYA 3W9SA 1QP7A 2VK2A 2PUFA 2NZVG 3F6PA 4EVSA 1ZH2A 4ZJPA 3JPWA 3EQZA 4KK3A 1NXWA 2YHAA 4KK4A 4GPAA 4RKQA 3OO1A 5KQGA 3OM1A 5FWYA 3K9CA 4ETNA 2FKAA 1JWLA 3FFXA 3UUGA 2P4UA 4RS3A 5TPZD 4GNRA 1BDJA 1F51E 1KRWA 2R25B 4MPTA 3O2SB 4LE0A 5TQ0A 5E3JA 5JS1A 1SRRA 1JYFA 1ZH4A 3JY6A 4QPJC 4UHKA 2WY2D 3CZCA 5TE9A 2JB9A 4MR9B 3O2JA 4F12A 2M98A 5IX8A 1D1PA 1EHCA 2MYNA 3FFTA 1JF8A 1MB0A 2CHFA 1LJUA 2RJNA 4F11A 1FFGA 1ZITA 1USGA 4MRMB 2OENG 2HQOA 2FN8A 4JA2A 2R47A 3GT7A 3H75A 4E7OA 1C4WA 3OMWA 1AB5A 4Q6WA 3QELA 5IEBA 5T3YA 4MS4B 5TPWB 3RVLA 3I09A 1JLKA 5CHYA 5F64A 5DTEA 5KQMA 4H3KB 2L2QA 1Z2EA 2FN9A 1D4ZA 2JK1A 4O1IA 4Z9BA 3RH0A 4YRZA 3CNBA 4LE2A 1Z15A 1JFTA 1FSPA 3F7NA 1JFVA 4M88A 4P98A 3TX6A 3KS9A 4Z4EA 1MVOA 3RVSA 1MIHA 4LX8A 3ROTA 2QVCA 3LUGA 2E4UA 1FFWA 1U0SY 3TD9A 3HVRA 2PAFA 3HZHA 5EWJA 3G85A 5TQ0B 3KKEA 4NQRA 4N47A 3QX9A 1ZVVA 1YK0A 3GA5A 2E4VA 3O1IC 4WXMA 3A10A 3BRSA 5IUJC 3O2QB 3VNBA 2WJAA 2E4XA 2H0AA 5IUKC 3HK2A 2QU7A 1Z2DA 4Z4FA 2JVKA 2PE5A 3IPAA 5BR1A 4ZPJA 3CHYA 5HSGA 1NXPA 3OMXA 4RV5A 4YLEA 3IDOA 3QELB 3QX8A 1GCGA 3C3MA 3N8IA 1NTRA 3JVDA 2IOYA 1LK0A 1TJYA 3I42A 4G86A 4H3HB 1ZN2A 3CLKA 3N0WA 4IRXA 1ZGGA 3T38A 2IPMA 1A2OA 4Z9AA 1F4VA 4MQFA 5I4CA 2DRIA 3K4HA 3Q41A 4ZMSA 4XLTA 5EWLA 4LDZA 5GOTA 4S05A 2LBPA 2IPAB 1TVMA 2FLKA 2FSPA 3CKMA 3H5OA 4RZSA 1K68A 3EULA 1A0OA 4RY9A 3QLVA 4D6YA 3F6CA 1QP0A 4MLDA 1DJMA 5D2CA 2HSGA 3KCNA 4W5NA 3CFYA 1RZRA 4S04A 1JH9A 4NICA 1Z26A 4XASA 2QR3A 5JNVA 3L6UA 3RVKA 3QK7A 4LDAA 3S99A 4G97A 2PMCA 3Q9SA 1JL3A 4WZZA 3C97A 4TN5A 3O1JC 4W5TA 1SXGA 3QEMA 4MGEA 4G0PA 1ISSA 1NXVA 1YS6A 1D1QA 1TMYA 5B3JA 4DQDA 4IF4A 1WETA 1Z13A 1EWKA 4PEVA 2WJWA 3CG0A 2M1ZA 2FEPA 4IMIB 5FWXA
chains in the Genus database with same CATH superfamily
1SQGA 4GWGA 2GK6A 3KJNA 1A7KA 4TXJA 4ZOLB 3WQHA 3QHAA 3TMYA 2EFYA 3PEFA 4ZODA 1U2EA 3EXFA 2XTNA 4GQAA 3W8EA 5REQA 3QEKA 1S2NA 2OD9A 4G4IA 4G5OA 4ZKEA 1XNQB 1PT8A 2WWHA 2BMVA 1AUQA 3NHYA 5DNWA 1JDTA 1QLHA 2IX9A 3DAYA 4TSFD 4R9RA 1J2EA 1KI6A 3BXGA 1LJLA 5CW2A 4C03A 4ZKDA 1NMYA 3RSZA 2VHYA 1VJ1A 2EVWX 4G85A 2M6RA 2QP3A 1CYDA 2AN4A 4DMMA 3KUKA 3EIQA 5L4NA 1UJMA 1JKXA 1JTEA 2QTTA 2P67A 3DEAA 4M1ZA 3ZHRA 1N2CA 1DIRA 2XNDA 4UEJA 2H9YA 2RB4A 4Z5XA 3NBYC 4L28A 3W2HA 2D00A 4IV8A 4YP0A 3QLUC 4GI7A 1AH2A 4L72A 4N3AA 1ZVKA 4FW9A 5BRAA 3CVWA 3EXIA 4XSHA 5JSZA 1LB1B 3AF6A 3U44A 3QPBA 2Y67A 3DBIA 5SY4A 2FSIA 5K51A 2HMWA 4LYYA 2GR9A 1R0LA 2UUPA 3CZMA 1I2ZA 4FI3F 3WMGA 1ZC4A 1EBFA 4B5KA 1ECCA 2O2GA 1SHUX 2JBAB 3VR5H 4HLUC 2H48A 4C6TB 3WWDA 3FOAA 1O6GA 2G5PA 3HB7A 3GG2A 4GBJA 4BFZA 3CWCA 4R1NA 3HZOA 3FPBA 2BHRA 1DUSA 3ESDA 5FUVA 2JLCA 2HW8A 3IODA 1P0FA 4BX9A 1QYDA 2C9DA 2XVMA 2IP1A 2GNPA 3BFXA 5FEMA 1QH1A 1E1LA 1P2GA 4RENA 1XD2B 3RQIA 3V8RA 1A8SA 2TYSB 1T9CA 5CVTA 1SBIA 4B3XA 4B8YA 4QM6A 1H0SA 4WZ6A 3KELA 1TYAE 1PZEA 2C61A 3A6FA 5KC8A 1GZUA 1YZTA 5LZ4A 1NBHA 1XKQA 1UBTS 2XDQA 3NDJA 4KMRA 4H9GA 3R0QA 3CLHA 3BJMA 1HG0A 4LJRA 3F96A 3OFND 4FONA 3CT4A 3U3MA 3HKCB 4BTVA 1U3DA 1II0A 2JCXA 5K3FB 2NP6A 3EZNA 1V39A 3HXPA 1HYQA 3LXRA 3BUSA 2GASA 2OLEA 5I8WA 2AC2A 5FH9A 1MPXA 5J5VA 3N1UA 2FYTA 1SHZA 4BO3A 2Q5EA 3FYUB 4QQNA 4WLNA 3I32A 4D0SA 4Q3AA 1KEZA 1UDAA 1UQUA 2ZTHA 3U6BA 2G71A 1ZGCA 2BTQA 3FSGD 4JLDA 2P2GA 4OJNA 2OVBA 5C1DA 3F5SA 2WD7B 3UCXA 3AR9A 1T3GA 3EGCA 4IZOA 4D8UA 3OLVA 1BEZA 4M1KA 1AHNA 2FMFA 4QXMA 2FJ0A 1TTQB 2CKMA 2FPIB 4XJTA 5U4QA 5JOQA 3E9MA 5KYUB 4HRYA 4E11A 3M6VA 4FXPA 2JAPA 4EW1A 1NT2A 2EZTA 1K7EB 4WIAA 3ZQ6A 3BSFA 3VOAA 3HP4A 4I6EA 4TQGA 5LOVF 4M7PA 5FHRA 4OLAA 3EUEA 2C5BA 4IEEA 5K4HA 2XCQA 3KKLA 4HLDA 1LBSA 4HXYA 1KEEB 2IHUA 1EFRD 4YRQA 4EDHA 4U8HA 1UWVA 2GAJA 4HGRA 3FPFA 1KI1A 3ZQUA 1XT6A 1QCZA 4UCFA 1GD1O 2DR3A 4A16A 1UFOA 4A36A 2WZBA 3N2YA 3B1KA 3ZQJA 4GBMA 2XYRA 4JJFA 1RLOA 2HQRA 2GB4A 3IV7A 2VJYA 3RJTA 3TPCA 3MEQA 1Y1KE 4RJ2A 1J7KA 2OV1A 1WXIA 1SIWA 2OXIA 1EG2A 4TYPA 5JJLA 2J67A 1CUGA 2MTBA 4JENA 2VJMB 1XROA 2Q46A 1MB2A 2P9HA 2X6TA 3DTYA 3EXG2 4KNVA 4BQSA 4JXKA 3T1OA 4YAKA 4FHEA 4O2AA 5EEGA 4D8YA 2JCSA 1ZSNA 2DJIA 3QA9A 4GOJA 3VAYA 4DNPA 1ZVJA 1OJ7A 8OHMA 2YWXA 1A8QA 2BI4A 2EF1A 3MJEA 2HNAA 1IMOA 3UAOA 1VG8A 3NBMA 4FW8A 2H29A 1BHQ1 1BGXT 1FYEA 3B9RA 3D6FA 2J87A 4TWZA 3T15A 5AKIA 1AK9A 1XYVA 3MT8A 2NTNA 4XIJA 4UTVA 1BVYF 4KVZA 3UJCA 2PLFA 3WP0A 4YN3A 1JQAA 2OL4A 2JS7A 3QVMA 1B00A 1XXHA 2IVFA 3FNHA 4IDHA 4UE6A 2PUDA 4J7CA 2BGTA 1QYWA 2VDQB 1ODKA 1Z4QA 3IEMA 1JXMA 1OZGA 4F2GA 1CUAA 3VAAA 2G7ZA 3QLUA 3SMQA 2RCNA 4CM8B 3IR7A 3HUTA 3R3WA 2FPRA 1N2CE 4KXUA 3PGKA 1FJ2A 1TTHA 1VHLA 1O8CA 4COKA 4DZRA 2J1LA 1R9MA 2PN1A 4KQ6A 4PQGA 4WL0A 3SE0A 3M1YA 1PT5A 1QQBA 3A6KA 3RF7A 4TWRA 5B57C 3T7SA 5BSHA 5L9AA 1N78A 4RMGA 1CJTC 2QMQA 1WB4A 2XLCA 3IJPA 1G19A 1NQAO 1XRRA 4U7GA 3IVCA 4JBNA 1P1BA 4YRBA 3QVGA 4IDGA 4HLUA 4KEAA 1LPPA 1GPYA 1PJ2A 4N8DA 5EXDA 1M6NA 4K9RA 5FEUA 2V1UA 2WHXA 2MSCB 1PX0A 4DMRA 1DDIA 5DXFA 4YYZA 3SS7X 5MFPA 1L7EA 1P0IA 2GLXA 1NYRA 3U1BA 4B44A 2SKDA 3L4SO 4LHVA 2IYXA 2JF0A 2GD6A 1DCMA 3Q3IA 4L5CA 1WVMA 5I9MA 2O06A 3TZBA 5LQJA 1TZBA 2GZAA 3B1XA 1LW7A 2EFJA 3OCCA 1HA3A 3VH2A 2AJLI 2X7JA 4EQ6A 3E5RA 3EG5A 4HSGA 2GXQA 1YAHA 3ABOB 3P0EA 1P33A 4NMMA 3TIIA 1P19A 1E1RD 2I6XA 4DG9A 3PFHA 1CJKC 2J30A 3O1LA 2ACKA 1U7OA 3L7JA 4YWJA 3SLKA 3WZ2A 1E9CA 1AXRA 3OZUA 5AVZA 1Y3IA 1BXKA 1GDHA 2ZBQA 1J0XO 1M5TA 2I67A 2VTKA 4NYMR 1JWAB 2HRQA 2QJFA 4EY4A 4YPOA 5KOHA 3A1NA 4X54A 5AI6A 1JHYA 1L5SA 1O4WA 3MB5A 4KRXA 1W29A 3KTAB 4ZWNA 3RS3A 3TTUA 4C01A 5CBPA 5JSHA 1XMVA 1ZK2A 3HGMA 1T15A 1PR3A 2GRUA 2R6JA 4G1FA 1E3WA 1VP9A 3AG5A 3JYQA 2C1EA 5IZCC 2FMHA 4M83A 4C7KA 4JUAA 4UD2A 3KQKA 4OKNA 3DFFA 3I6QA 5BR7A 3KQMA 1C1DB 4DEVA 3ETGA 3K6SB 3TR5A 3ZTTA 2WU8A 1ADYA 2NZXA 4BEBA 4KV7A 4RSRA 1ADBA 3O9ZA 4MPPA 4N1AA 2CXHA 3IEXA 4Q34A 1YVDA 1D6MA 3MAAC 5G1PA 5CAEA 1NVDA 1XLUA 3KVYA 1XRQA 4MYTA 1RQRA 3SHWA 4U4AA 3SQOA 3O26A 3V7YA 1US8B 2G63A 4MRRA 4EYQA 2WM3A 2HFJA 2HSJA 3VZQA 3P2MA 2CXPA 1RHQA 1C7EA 3OJLA 1J9ZA 3LQFA 4MR7A 5TPZA 1KK2A 1A88A 3I72A 4FZRA 1SA0B 5A5GA 1T43A 2FWRA 3GJSA 1CNMA 3LKZA 4FFDA 4NBNA 5LZ5A 3PUYA 5DVZA 3VZSA 1FDIA 2LDXA 1E92A 1LNQA 1RIFA 1VB5A 2UYOA 2QN7A 4KLCA 2HXYA 5EIBD 2ZRGA 3NAGA 4GMGA 2V6MA 3QPCA 4C05A 2A5LA 2YCLA 2HA5A 3PSHA 2P0YA 3KRTA 1M1YB 3EMKA 3OZAA 4UM9B 2ANCA 1SH7A 1V5GA 2ETXA 2O7QA 1ZBDA 1F2DA 2A8YA 1FVOA 4IJKA 1QGUA 4XARA 4K7JA 4L76A 3AP1A 4XWWA 1U6JA 1Y1SA 2C99A 2ZAGA 3PZBA 3SNKA 4E07A 5BN3A 2JFFA 3PWSA 4AJOA 3LV8A 4BJ5A 3BHJA 2EJCA 1K0FA 3AUYA 3OU2A 2YFYA 4KE8A 4R8KA 1ONBA 4HRAA 2D8MA 2Z0MA 4QRHA 3WIDA 1EU1A 5JRDS 2JFBA 5FBKA 2IKQA 3LKBA 1E2LA 3Q9UA 4GI2A 3KOWA 1EVJA 2P9TA 1ZIXA 5DCYA 4P36A 3U4MA 1QAOA 2H2AA 3A4LA 5T6MA 1HO3A 3KYBA 3H9BA 4UHKA 5L7WA 2R85A 3II6X 4LHSA 2AZDA 3EWSA 2AX4A 2FWNA 3JWJA 4D4JA 3O95A 3DOCA 4ZQGA 3ZJ5A 2A9KA 3AVYA 1XXHE 3OZIA 2RIPA 1F38A 3RUIA 4O6VA 4D46A 1Y4SA 1U5AA 1JS1X 2H8KA 2QSZA 2BKLA 3Q0IA 3F8TA 3MMZA 4PQEA 3DTTA 3PXGA 4D9HA 5BOSB 4M6WB 5HZGA 5HIJA 4PGMA 1W8IA 2R1UA 4GZ6A 2BFEA 1AZTA 2YS7A 3GK3A 3SJCA 4ZV4A 2JLYA 4ZEOA 1C0KA 2CNWA 2PMDA 1V3QE 2GJ9A 1K8YB 2ZIFA 4N9QA 3HB9A 1AKEA 1GTL1 3MK31 5BSTA 2JCGA 1N2ZA 1T3SA 1Z6AA 2CLHB 2IHZA 5J40A 1Y4ZA 1IOZA 4Z4QA 3OZFA 3KTFA 4Y1EA 4AMGA 4QELA 3IQXA 3TINA 2RH5A 2OHVA 4JQOA 3LCJA 3QKRA 3WBBA 3WLHA 2ID9A 3NP9A 1Z2PX 2VA9A 2ZT7A 3MWDB 3OKPA 2RGNC 4MNTA 2QV7A 5F2KA 3R7WA 2PUFA 1PJSA 1Z2NX 4EHHA 5ALVA 4RADA 2IBMA 4LV6A 1CXZA 1KSFX 2Y1GA 1NN5A 2YHAA 3COWA 3PUJA 2PCLA 5KX5F 5LQAA 2JDIA 3KUXA 5DBEX 2CLCX 5A0VA 2QBYA 3JARB 3RIGA 2H9AA 4IZIA 5KQRA 4GFDA 1PX2A 4GNRA 2KB0A 3IRVA 4LMAA 2IYWA 3JQ8B 3EEOA 1RRGA 1Y1QA 1RMYA 4PPFA 2IHNA 4BOYA 2P2DA 2VVTA 2OLJA 5IKEA 3D9QX 1RZVA 4RY2A 3P19A 3L41A 5CLGA 3RHSA 3RUPA 3RYHA 1THGA 4URWR 2XBMA 1KHHA 5DGTA 3WLSA 2CVPA 1NBMD 3K4QA 3OZSA 1XLVA 3FOZA 1C9DB 4Q1VA 5CYFA 2D74A 1RDFA 5AKZA 3KX2A 1UWKA 4ISBA 1Q7GA 4DLSA 5IZCA 1H4TA 3AETA 1V5FA 5FRDA 2ECOA 2N1MA 1LU9A 2C59A 1UADA 3K2QA 5IS2A 3SYRA 4M89A 2OENG 4QDZA 2Q1SA 3WHIA 2CVHA 4EBFA 4CF7A 1P9WA 3OEHD 3PC8C 3NXSA 5KEIA 1Z7BA 3WAKA 5LXTA 2QJTA 1D8AA 3FHOA 4H6WA 3J81k 3HH8A 3I04M 1TCAA 2O1EA 2G88A 3RTGA 2AOTA 4FN5A 4Z7NB 2JIZD 1G59A 2FW6A 1E1NA 2O4CA 2W43A 4J7XA 5AJWA 2OCLA 1K7SN 1DAOA 5FULA 4PNEA 4YUYA 3RIXA 3PBKA 3ZX5A 1MIHA 3R77A 3HDTA 4RV4A 5IAJA 1B16A 2AK3A 4F5ZA 3R9XA 1U0SY 3C8MA 3FIUA 3GJTA 3HZHA 4J0EA 2X14A 3I9LA 3E18A 1T4CB 3PICA 4P4LA 3EDYA 5E1OA 1F14A 2QTNA 3COZA 2W58A 4WERA 5L3RA 3GHHA 1X14A 1CUYA 4KPUB 5EA2A 3T4EA 3FPEA 3AFOA 3DT8A 4PTZA 4GZ5A 4XFDA 5KVVA 5A9TA 2D7DA 5TSDA 1EZ4A 1F06A 2WMDA 3VI3B 2O0JA 3DMTC 3LQYA 1M2GA 1IONA 3ENZA 3I12A 3IDFA 4B6QA 5LQKA 2NZ8A 5BURA 3ENVA 1VHWA 1IHDA 1ZM2A 1DWPA 2R4TA 3L9WA 4GLJA 3I6IA 4JJ6A 4K3VA 4KC0A 5IYZB 4QRIA 3L6DA 4QBHA 4W1QA 3IUPA 1D6SA 3MRTA 1PKEA 4M8NE 1ZMXA 5JSZB 4RD2A 4HGOA 4I50F 1MXFA 2XNJA 1CY2A 2PD6A 4D81A 4DDUA 1E4EA 3V1YA 3RHZA 1J1ZA 1DX9A 4UXJA 3U9LA 1ZK0A 2WHPB 5CVCA 1F4VA 4OUDA 1T9BA 2DYKA 3LIPA 3UXMA 2QOEA 1QOPB 1P4JA 4HGPA 4TTRA 3W4JA 4YI3A 2BGNA 1E2IA 1WY5A 4CG1A 2QLMA 2ZS7A 2J9GA 4EUEA 1O97D 1QIGA 2PGNA 4AMYA 5C35A 5ITZA 5KYWA 4JR0A 1X70A 1ZZGA 1QIMA 1LTQA 1FMFA 1NIJA 2P2YA 3DL0A 4I2VA 4UBMA 4RULA 2WINI 2X0KA 1GLVA 2BUAA 4WE3A 3SPXA 1I7PA 1WLSA 2NXWA 1KARA 3NBKA 4EO4A 2R60A 1DAGA 4HXGA 1G3MA 1L7OA 2C20A 2FQ1A 3F5QA 3G9QA 3L2OB 3CRVA 3QRWA 2GEDA 3GEMA 4FYPA 4H7FA 4WZZA 3TTXA 3VR6D 5EGSA 4G5SA 5AUQA 1XAJA 1SUWA 4MUHA 1ZD1A 2QTBA 1SXGA 1ZVQA 2PX3A 4NEHB 2ZTVA 5CLJA 1KVRA 1Z8FA 3IDQA 3RIHA 3OFJA 4REOA 2QRQA 1MNAA 4Y2PA 1NQUA 3DF7A 4WOBA 2JGEA 2M1ZA 1LC0A 3V1MA 4D5EA 2AFRA 1K0UA 1VJGA 2FJUA 4K6HA 1CVIA 3TUZC 4CUKA 2WAXA 1YQTA 1GNPA 1MG5A 4OVKA 1EWRA 4IZHA 4NI5A 5IW8A 3OT1B 1M2OB 7REQA 5JD5A 5C37A 3OLXA 3TIGA 3G0BA 3KU1A 4LZPA 4MW7A 3GPIA 4MIYA 1POWA 1HBJA 2PZFA 4QLAA 4RZHA 2WD9A 4P92A 1UEJA 5EJ5A 1RYEA 1CR1A 1QYRA 3PPYA 3U4IA 2RGNA 3K1JA 3ZDCA 4KU4A 4HEA6 2MINB 3UIEA 1CBUA 1BNCA 3THYA 4QYIB 4MJ7A 1OROA 3MHPA 1KDYA 1H2ZA 3N8HA 1Q0PA 3L8GA 2XEDA 3NOOA 4JBWA 2C3OA 5ALQA 3A14A 3SZRA 1GFSA 3RVOA 2Z5GA 4RO0A 1KJYA 4EECA 2Y0BA 1WMBA 3TRHA 3IDZA 3NRBA 3K9FC 1SIBE 4UNIA 3PF9A 3DOFA 4LK2A 4L08A 2VLIA 1Q21A 1B8VA 2XUOA 4FS8A 3TB6A 3TQHA 2GAIA 5CG1A 2QNIA 3BJEA 4CMIB 5FFFA 5LZ8A 3T61A 2PO7A 2JARA 1D07A 4TTPA 1DIGA 1YWGO 4FGSA 4QUBA 1Q12A 3MJCA 3RAJA 3OPYA 3O73A 3EEIA 4RA6B 4LC1A 3U16A 2B7CA 5DB4A 2IS2A 3O38A 4ND3A 5AHWA 5C34B 5L45A 1JA9A 4OB7A 2IV2X 3G2MA 3PUWA 4FD3A 1VKZA 2VHJA 4MDHA 4MOWA 1WB5A 2QUAA 4R9VA 3W4KA 5I7UA 3GBPA 4DR6B 3PC8A 2A33A 4KIJA 1AMUA 1W4ZA 5CX4A 3UZUA 1X0VA 3SBXA 4CMBA 4N40A 2HMYB 1NYLA 1T3ZA 2GO1A 4HVTA 5MF6A 3BDIA 4GP7A 4GI3A 3M6AA 4PR3A 4RFLA 1P0CA 2B30A 2ZXEA 3IP3A 3CONA 3VZCA 3V7WA 1MQSA 3K1TA 2QR5A 4J1TC 4TS9A 4TKUA 4DAEA 3AEUB 4IOJA 3WL3A 3D6JA 3R9IA 3SK0A 4JLKA 2CF6A 2JHFA 2ZAMA 3D6AA 2X2EA 2LRHA 3M2PA 1M33A 3T99A 2F1KA 4BFYA 2NZ2A 2ORYA 4MWCA 2DUNA 3LHDA 4K6FA 1PL8A 2FR8C 2I4LA 1SXJD 3VZBA 5GJVC 1QZ3A 4GF5A 3W7AA 2OOKA 2Z6VA 1KKLA 4JUBA 1GAJA 4RHXA 1AA9A 3DMTA 5E4YA 3W79A 3WBFA 2WJHA 4R1LA 4H3SA 4DAOA 1R16A 5JAQA 3HM9A 1C50A 4HFJA 1FQWA 4ND7A 3CX4A 3RJZA 3W04A 4TYWA 3PQCA 1GU1A 2XB9A 3O1HB 4F3NA 4DJFC 1DC5A 3LNCA 3C6KA 4YIKA 4OP2A 4Y2VA 1P3Y1 4KVFA 4IILA 2FI1A 2X1VA 4ZV9A 1Y9JA 1T9KA 4RH0A 3R20A 3IHLA 5FNVA 3RU7A 3VKUA 4UQLA 1PRYA 1K66A 3TOXA 3ZU3A 1EZZA 1FFXA 421PA 3CURA 2VQDA 2YWGA 1OREA 1HEYA 1BXZA 4MA5A 3T9AA 3WWEA 1KU6A 4PLYA 1ETHA 1MAVA 2GPAA 4ONEA 5JZBA 3IHWA 3SOZA 3DYVA 5L3SB 3MBIA 5FI3A 1VIAA 3JWEA 3QTTA 3COYA 3IAS6 1PWYE 4IL5A 5DH9A 6ABPA 1EFTA 4ARVA 2A3RA 1AOXA 1T4MA 4I14A 1AGPA 3OLQA 4QJ4A 1K8ZB 4C0JA 3R3UA 1Z25A 1EZ1A 4EI7A 1SQSA 3TNLA 5KJCA 5HKLA 4YBRA 4BFLA 4D8VA 3N2ZB 5TC4A 1KY2A 1NU6A 4RQTA 1PJ3A 3GJ8A 2H17A 1OXSC 2FX5A 5KDDA 3ROPA 3M1IA 4Y2RA 2RG1A 1GO2A 3HMQA 1NF3A 3RI3A 2YXLA 1N33B 4NH0A 5LYYA 1NDUA 1O1YA 2PNJA 1QV7A 3JAKA 1M75A 4JT9A 5DJ5A 1PTKA 5FL7D 3CC8A 4OJMX 5FBRB 4FR0A 4X6XA 1R6DA 1BJTA 3UW3A 1V43A 4L15A 1KEUA 1OBCA 3B7GA 4AZ0A 2NM0A 2I1QA 2J3MA 1G60A 3W06A 2DHDA 4LXHA 3B3AA 1NLZA 4HAZA 3N6RA 1ZONA 1VCMA 4PSVA 1RRVA 3BE5A 3D6TB 2DULA 3B60A 3P5BA 1JJ7A 1M8KA 3LRPA 3HDQA 5FOUA 2O4UX 2WTMA 3GUZA 3ZJTA 3V80A 1E3QA 1P6XA 1Z5VA 3COVA 5FQOA 1SB8A 3Q98A 1FRNA 3HFSA 1Z0DA 5KMGA 2SECE 3TH5A 3KZ1E 4QHSA 1JU4A 3TFQA 4ZDJA 3LUJA 5DZSA 2V7WA 1SCKA 2BI7A 4FQ7A 3TQRA 4DGSA 1RKBA 3EF0A 1Z6GA 4LA4A 1PR9A 1UXJA 3AO0B 3JD0A 3CH4B 3KC2A 5CIWA 5DRYA 3KB2A 4OQPA 4BZXA 2FP3A 1WZNA 4JVNA 3P9IA 2C0QA 3RAFC 1KAQA 5IXYA 4ZOCA 2J41A 1TMKA 1SXPA 1DV2A 3KJEA 4WZBA 3C6MA 1KZ9A 3CRRA 4Y1RB 4DXHA 3Q88A 1U3UA 1Z5PA 2OQ2A 4Q4JA 1E94E 4FM9A 1SMKA 3RFXA 4BKPA 1KS2A 3NPAA 1EFVB 4ALMA 1HSOA 3CW2A 2IUUA 4G4JA 3CCBA 4HO1X 1KVQA 3MGBA 4BFSA 2VN8A 1KC1A 3T9FA 4PCLA 1COWA 4F8JA 2J7KA 2ZJ1A 4E4TA 5BV2P 2ASVA 1Q57A 1OFGA 4A03A 4YJ2A 1APBA 3ZZNA 1B0PA 1PSDA 2D1TA 3H4TA 3HLYA 2H1OA 2D5AA 2XAUA 2ZT8A 1YFZA 2Q3FA 3R0ZA 1KNXA 4YV7A 1L4UA 1A9TA 2H00A 2RARA 4FKMA 4TROA 4JQSA 2V7EA 1ZNQO 3C2QA 1SU4A 4ER6A 1P62B 3ZWDA 3PNQA 1P9RA 2H1RA 4L9AA 2CBGA 3V4LA 1BWQA 1M2KA 1I94B 1G2IA 3BRQA 1JR6A 1IHUA 2ADMA 2BGMA 4HUQA 2NPIA 1JXAA 1MJHA 4QBGB 5GGXA 4AO6A 4EO7A 3KWJA 1OPXA 3PRYA 4ZEWA 1DP4A 2OKGA 3OWOA 4IJMA 4D9BA 4CRWB 2GEJA 4R0NA 5I7OA 2F62A 2L69A 3OJEA 2Z98A 4AYXA 1XSEA 1FUEA 1UK9A 4DCUA 3RVBA 5CEFA 4YLYA 3WDLA 8ATCA 3NYQA 1JHDA 3MWLA 1W0KD 3TLGB 1ZCZA 4BIMA 1KWGA 1AN9A 5E8RA 5BUSA 4W5WA 3HJNA 1PWHA 4FTWA 4D6PA 1AE1A 1O6ZA 1MEJA 1BE6A 4FFBB 3GIDA 1KMHA 2GK7A 1WCIB 4MTCA 4XM0A 1J20A 1O6CA 1U2DA 1XTIA 3GLSA 2C5GA 4A27A 5KQPA 4YRPA 1XZEA 3PJDA 1RXEA 3DKVA 1JDSA 1HYHA 3EQ8A 4H16A 3SEAA 2JFVA 4IQ8A 1EA7A 1N3LA 1PJLA 1QQ7A 1VBNA 2VPPA 3IAEA 4KZPA 1NKTA 5EE1A 3RUCA 4E46A 3BGSA 2G83A 3LUKA 3UAVA 1DBRA 3O3CA 3ZWMA 1IY9A 4CV2A 2SCUB 2ZRKA 4K9NA 1U2ZA 2X22A 4K1LA 1KO5A 5BN4B 1D2EA 1CUBA 4A6DA 1QTQA 3HUDA 4YT5A 3EFBA 2XITA 1S2IA 4UTXA 4AMBA 3REQB 4MYCA 4GX0A 2VHZA 3CUVA 3B2EA 3GJRA 2NO6A 1E9RA 2KBFA 2WG1A 3OO0A 5I7WA 2NMVA 1OWLA 1LRJA 1K6JA 2IPNA 3CRQA 1XDDA 4IHJA 3PDIB 3ZE0B 4H7EA 3C3XA 1S8OA 1NPTO 2QXYA 2R8EA 3GMIA 1EEHA 1YBHA 4J75A 4R8LA 5KYKA 2OHXA 1OT3A 3AEXA 5DMXA 2EFEB 2QY6A 3EZXA 4M9CA 2VUUA 2HJHA 4LRYA 1X1CA 1CUSA 2OHHA 5LOVB 2X9LA 5JFGA 1DBQA 2RJOA 2R8PA 2QVXX 3FCSB 4B4WA 2AN5A 2VPZA 1FY2A 1XPRA 3C3PA 5KYGA 1Y1RA 2IY8A 2QZ4A 2QN9A 3OWXA 4B34A 1GKKA 1SUCA 4KHPB 4MV0A 2QUZA 2CF5A 5D7BA 5F4ZA 2ERYA 4BE9A 4ECAA 4OOFA 2I7DA 4X9XA 3EF3A 1XZQA 1NVKA 1CDZA 2P9YA 1MB4A 3NHPA 1TF7A 1A5ZA 4MSUA 4ZT7A 1TA4A 3URMA 1L9KA 4IJVA 1DBSA 4JEIA 4ZT4A 1VBFA 1X2BA 4ZQBA 1B8UA 8GPBA 4TZ0A 2VSFA 3LKVA 2CFSA 4M8SA 2YVLA 1BOFA 5HTKA 5D1HA 4Z3DA 3UH0A 2BD0A 2GCOA 4LYGA 1RTKA 1ZCBA 1OTHA 4YVFA 4ILEA 5HZHA 4JLMA 2A88A 4P3NA 1YVRA 1ZSYA 2GYYA 4ND5A 4Y6SA 4ZK2A 1V9SA 4Q1CA 5A3SA 3W2GA 2FG7C 3C3JA 3LOPA 5D3MA 2IYZA 4RHCA 1T2VA 3EYAA 1FLVA 2ZJ6A 3OWHA 4XGIA 3WBJA 2RIRA 2DH6A 3ESAA 1N9KA 1EFCA 3HGTA 2QNRA 4M0EA 1VSVA 2QIPA 2XNCA 3D31A 4WZBE 4X7BA 3WNBA 1LWOA 4AKHA 1E77A 1M6VB 4B2PA 2GH1A 1E2UA 1HT1E 4PXAA 3ENNA 4ZDKA 1VL0A 1RLUA 4M99A 2EW8A 4UUAA 2J3KA 4OQ4A 4KXXA 5TGDA 4K28A 4KK4A 3W6OA 1MABA 3THXA 1E9AA 1A9SA 1CJVC 1MA3A 1WXQA 4CCAA 3UJAA 2PS3A 4ETNA 5T57A 1ZEMA 5JYEA 3N70A 2G09A 1H0KA 1IK4A 1A9ZA 1ULTA 3PT5A 4EA7A 3IELA 4CMGA 2XQIA 4LE0A 2GAAA 3DVAA 1JYFA 3IQZA 2JLRA 3MBKA 5EAIA 5IBPA 1E8MA 3FDZA 3IP1A 4O4LB 4BJ1A 3WK7A 4DHEA 3F1LA 2PEZA 4N48A 2UZ1A 2QQGA 5BQ5A 1WXXA 3L8FA 1RRCA 3BA6A 2YWJA 3H3XA 4Y7DA 2R96A 1KJ8A 2J3DA 3HO8A 3ZZMA 3O4FA 3R5TA 2E5WA 1C4WA 3D4IA 3QELA 3GDHA 3L79A 4D9MA 2C7OA 1ZCFA 4KO8A 1A1SA 4CNQA 4OL9A 4HYYA 3RYIA 2OKCA 1TUEA 1YS4A 3MB8A 3K9GA 2DF8A 5EXTA 4AYWA 5LZ9A 1GZDA 1ZQ1A 4FK8A 3QZUA 4OYYA 1QFMA 3OZRA 3WMFA 4FYMA 3HACA 3QMWA 1MVOA 2J5XA 1ZJ6A 3QYPA 4HHEA 4UUBA 4YA6A 1TIPA 1W94A 3ZE6A 4JI0B 4QVGA 1C0PA 3MUOA 2E4UA 3MRXA 1J8DA 2PAFA 3HABA 1JFFA 1HLPA 4J76A 2Q4TA 2XW6A 3KB6A 2GVZC 1MU0A 3NC1C 4EGFA 1QG0A 5JI3E 3T7EA 3H04A 4R9UC 2YMLA 5CLQA 4N12A 5FPSA 3GP3A 3JQ6A 4AMVA 3KZXA 3TJMA 4EHNA 4R1OA 2V5VA 2BBWA 4IJUA 4Z86A 1CUFA 1Q6ZA 2C95A 3CJQA 2DEUA 3HL4A 2XQJA 1LLDA 4IDOA 1VL8A 3E70C 3EOZA 1C30B 3UHAA 4B6PA 1RE1A 1YE5A 1P1IA 1O4VA 2XE7A 4ZPJA 3YASA 2UUAB 1ZWLA 4Z9FA 5D8DA 4CGYA 1Y9AA 1KK3A 2FW7A 1HT3A 3EQ6A 4Z9XA 4JC5A 1XLTC 5HSGA 2R7KA 2GZDA 4YY3B 4AUKA 4K9OA 4CKEB 4FEEA 2GPTA 2NU7A 4NS1A 1EFHA 1JPJA 2AI1A 4MV3A 2H2HA 2VAXA 4PIVA 1G2QA 1ZI9A 2PJDA 4H3HB 1K5GA 2OC9A 4AFNA 5KSOA 1K5DA 2IPMA 3IUJA 2JA2A 3MJFA 1ZXBA 1A2OA 2VH1A 4MV1A 3TR6A 4MGKR 4ZQCB 4RBNA 3M3DA 2DRIA 1ADJA 4PLCA 5JCOC 2AMJA 1DOAA 1A4XA 1GAEO 1W5TA 2EP5A 4G25A 4DSZA 4N3GA 1FDRA 2VZEA 5AVUA 4U00A 2GZHA 1CUZA 4MQ5A 2DUJA 1MAWA 1PDOA 3EA5A 3P32A 1GT6A 3IPLA 3UK6A 3SC4A 1C8LA 5KNCA 2FCRA 2BFDA 3RGGA 2ZI9A 4RE5A 5JYBA 4ZN6A 1KMMA 4FSXA 3GZTB 1VGRA 4M9RA 2IH4A 4AJHA 1NR5A 3Q9SA 4UATA 2OYCA 3RB8A 1EVZA 4LJAA 3RSSA 5A4MS 4NDAA 3EH2A 5ICSA 3E4CA 4S04A 3CIOA 3PQ4A 4NCHA 4CIWA 3TEJA 2NU9A 4NJOA 1GV1A 5LL6P 4J7AA 4BRUA 3GAAA 5FDFA 1B14A 2CLOB 4JHLA 1ZHFA 1ZL2A 3B3QA 4KFUA 4P3YA 5ALDA 3U0VA 3NTXA 2E55A 3UJPA 4UDXX 3RIYA 5D5PA 1X42A 4NARA 3FJOA 4EHJA 1NJGA 2WWVD 1VPWA 2BI8A 4QT0A 1Z4IA 3Q7RA 2ECPA 5LFAA 3I6YA 3QEJA 1GNSA 1B6SA 2IU3A 1TA0A 1MIOA 2TSYB 4PG5A 3KSDO 1V5WA 5EWLB 2RAPA 3Q15C 2ORVA 2W2XA 1FB5A 4MVJI 2D5BA 4QQKA 3ND5A 3F46A 2FE1A 4XIIA 1Q19A 3BAZA 4C22A 3T1YB 2AHOA 1JTFA 3C85A 2AKYA 3OEYA 1UQRA 2O19A 2TMDA 3E35A 3P97A 2IP2A 4C08A 2O2SA 2V98A 1G38A 2H3EA 2XUZA 1AQYA 2EBFX 1O94C 4CMAA 4ID9A 1B2LA 2VUHB 5IJAA 1LBHA 2XOXA 2O14A 1XCJA 5FL3A 5F2NA 1ZOSA 4PRZA 2NAFA 2QD4A 3WGZA 5FV7A 4TTVA 1R6VA 1SRQA 4FFLA 4MUKA 4Q01A 4LOLA 1Q1AA 4QOJA 3E5NA 1PQUA 2QB5A 4GKVA 4RPHA 4UNRA 4BRSA 3VGPA 2TMYA 4M60A 5KKNB 3UJ8A 2X8LA 4YR7A 3PFFA 1PJ4A 1UBOS 1W85A 3DS8A 4FX5A 3G2NA 4GOMD 5E6SA 4JKOA 4NG4A 1UJNA 2BEJA 5THQA 3TD6A 3R9XB 4Y67A 1RXIA 2WVHA 3OKCA 1PKXA 1TIBA 1IHOA 1G8JA 1VE5A 2ZJ5A 1SFRA 2DECA 3HVIA 4DUYB 1XCPA 2QJRA 1FSGA 1IU9A 1HLDA 3M4YA 4KRYA 2FMUA 2W37A 4XPIB 2YHIB 2P3LA 1ACMA 1JP7A 1NMEA 2X4GA 4P81A 2KWIA 4YREA 1E7WA 5KX5B 1V9CA 1WZCA 4UNNA 5GWXA 2ZYVX 3T8YA 4JI7B 5KOYA 1DXYA 2X2OA 1K6MA 4B7AA 4X1IA 1GKIA 1XCMA 1CUHA 1U7XA 3H65A 1LK7A 4OFZA 2XKBA 1WHSA 5CVUA 3AIIA 4NFLA 4OV6B 1NR1A 3PCXA 3C7TA 3UHFA 5A5DA 1RPAA 1C8VB 1K88A 3ICEA 4ZOAA 1ABFA 4D3SA 4RWEA 4XR4A 4WV3A 4FQ8A 2FFQA 3IA2A 4BNYA 1IXZA 4CV1A 4H7HA 2OP1A 4TZ6A 1K27A 2V54A 1NG1A 4MZXA 1NAIA 2ET6A 3CX3A 3R8XA 3MVEA 4TT3A 2XB2A 1B6RA 1XLTA 1JEQB 2V0CA 2IODA 2ONKA 2YCBA 2YV4A 3LLCA 5A0FA 3CV3A 4MI6A 1VFPA 3C6BA 3IBFA 3MD9A 5J63A 2G9VA 2RJ3A 4EI9A 4UREA 1HQDA 5TF4A 4E7PA 3MJRA 3QJGA 1E96A 1P2DA 1Z45A 3IVAA 4R1SA 5IAOA 1JG3A 4JB2A 1MENA 4ERNA 2JHCA 1ZAYA 3FKSA 2XUKA 3L7LA 1VSTA 3T94A 5JATA 1CEYA 5JCOA 5IHXA 1V1RB 1JSZA 4M49A 5KNLA 3RF6A 5FPHA 1T2FA 5HJ2A 3UAYA 2I3DA 1KPHA 1OX5A 3IHTA 3MTAA 4HZGA 4U3JB 3VMMA 4YMTA 3R23A 5K2OA 4BU1A 3OZGA 4HNSA 4OG2A 4F04A 3MMSA 2O8DA 2HIAA 3KETA 1OGIA 2QVBA 4GPBA 2IYLD 2OHIA 4INOA 3TBFA 4AJ4A 4AS1A 2FW1A 4FWBA 5DKFA 3ZGXA 4RANA 4OK5A 2LWIA 2Z9DA 3P2KA 3Q3JB 2G8LA 4GI5A 4GC9A 4IJQA 3JAWB 3R7LA 2VG8A 1G3UA 4P34A 1VLZA 4EKIA 3KZKA 1LZKA 1QTRA 1K8XB 4DGQA 3KPWA 3H0CA 5B36A 1Z17A 2ADOA 3F5DA 3AXSA 1L7BA 2ATVA 4CTKA 5ED4A 4PY2A 4WCFA 1SCJA 5AI5A 3DR5A 5DV9A 4ZZ2A 4I50B 3JR3A 2WILA 3WJ1A 1C0IA 4Q6BA 1IVNA 2QRVB 1TJNA 1CY6A 2B1GA 3STHA 2IELA 3ENQA 4HDKB 1KBOA 4AJ9A 2RH4A 2PRYA 1U3CA 3JS5A 4OGLA 1UBKS 1TW3A 3VSCA 1R4NB 1UBNA 3RVRA 3AVVA 1SOVA 2QE7D 2D7CA 2P9BA 4W5QA 2H1WA 1DKLA 3WGIA 2QK4A 5JAOA 2P4SA 2VDWB 4WECA 3EVFA 3O90A 1V8DA 3FUXA 5GONF 1M6EX 4AIIA 2C4MA 3LCMA 4EJ2A 3QXHA 3BZWA 4II7A 1H4VB 1Z5WA 1XMSA 2QMHA 1O94A 3OJOA 4FVTA 5H81A 3SQXA 5TGTA 2UDPA 2O8EB 3S99A 1G5FA 4FUTA 4J2TA 3LS2A 5JFOA 1YVPA 3U56A 1IM5A 2FU5C 4D0GA 5CEEA 3PNPA 3BZBA 2ZUBA 3WLAA 5JROA 1R4MA 3TCNA 4BYGA 1HI9A 5C51B 4RTNA 1CU1A 2DBQA 4A5SA 1LSOA 1D7OA 2FQWA 2BEVA 2P5SA 3GUHA 4H4DA 4ND1A 2F55A 4NYJQ 3MTQA 1GITA 3DUWA 1W49A 3BMOA 1QIDA 4EHDA 3ELBA 5D6OA 3HS3A 4DCCA 4YMSA 4F92B 2NO1A 1KR2A 1ZGJA 3ZNOA 3M9XA 5D51S 1T5TA 2A84A 1TQ2A 2CB0A 3HO6A 1EXVA 3ETEA 4LHWA 4FT2A 3JPYA 4HXEB 4JC8A 4OA8A 5HBGA 5A2GA 2O2ZA 4QRDA 4H77A 2K7ZA 5IAEA 4RHEA 1C9EA 3LK6A 4WXHA 2XZOA 1RQNA 3CVJA 3MA0A 3VHQA 4XUEA 1NIPA 4OMUA 1UWCA 2R00A 4G6ZA 5H16A 2J0QA 2C04A 4G37A 3ZW9A 2EXXA 2PL9A 3AFMA 4HPXB 2O54A 1YA4A 3BJRA 5CCBA 3P2EA 5BSRA 1RJGA 4LY0A 3DAHA 2HWUA 4EG3A 1WQ4A 1KQOA 4IXDA 1ENOA 4LQCA 5AOAA 1RI4A 3DZBA 2ZYWX 3N6VA 1W4BA 2CT8A 1JQKA 3OZ7A 1RLTA 2WKWA 3VGJA 4C20A 4DR2B 3TZHA 2ZQYA 5KYNA 4GYKA 1EXDA 3HUUA 1D2HA 1F2TA 4PICA 4UTNA 5J47A 3V4OA 2MSDB 1WKCA 1BRTA 1IIRA 2VXBA 5CPBA 4DLUA 3DBLB 2X7HA 1PZNA 2W5UA 2ZAOA 4Q9DA 1UR5A 3T52A 1NVFA 2X42A 1U7HA 5HK9A 3VR4H 5JCXA 1E3TA 5FAXA 2ZYRA 3EZ7A 4HNQA 2CJXA 2Q3CA 2X9NA 3PUHA 4UQOA 4X1KA 2HGZA 1XCGB 3FG9A 3K96A 2W93A 3FLAA 1YZQA 4GS5A 2MU1A 3TAUA 3WICA 4E4YA 5CM2Z 4K9MA 1ORTA 2BFWA 5JZVA 1JHPA 3A2MA 2XYQA 1HFEL 4D4IA 4V03A 4OHBA 2HBZA 3BFKA 1SO8A 1Z18A 4Z0HO 1BD4A 3RKRA 4F7WA 4UTRA 1SXIA 3NAMA 1KFCB 2DG2A 2EGUA 2QXUA 2OFFA 4DJEC 2O8FB 3GUUA 3K2BA 3KDSE 3L0SA 1FXUA 5LIRA 4QQ8A 1GQ2A 4PSUA 1YMUA 3H2YA 2Z9BA 1SCBA 1NV8A 3RC9A 1YFLA 1UOQA 5CDUA 5CM8B 2P6PA 1QDEA 1OAKA 1N0VC 1U2RA 3QFCA 3DLCA 4IIJF 3EISA 4RCYA 4YBZA 1Q20A 3VA7A 1OB5A 2QN6A 4O1HA 3VPHA 2XDYA 1OC2A 3C8ZA 4P3OA 3TTSA 2OGSA 5H9WA 1PK8A 3MSXA 5J4VA 4HH0A 2BFCA 4RLQA 2PH5A 3DMPA 4P5DA 5ALJA 1GRQA 4IKPA 3NEJA 3OM9A 4Y6GB 1RWWA 4IEFB 1II8B 1P5RA 2BGKA 4Q9KA 4R8RA 4EHAA 4KBFA 3AKEA 4WJKB 2ZRHA 1GEGA 2OO7A 1R9GA 3GMDA 4YACA 3BEOA 1XALA 3LY8A 5HP4A 5DNAA 3NWJA 1E7MA 3PRHA 4XD7A 1C3XA 3H1GA 4AG3A 3CTMA 2BBSA 3W3ZB 4V0RA 2VQ3A 1PWEA 1Z8DA 3HDVA 3HBAA 3WRVA 1KWKA 2DOKA 1Y3CE 1JDPA 2E4ZA 4K88A 3MRSA 3OZCA 1DPGA 4LXYA 4YV2A 1ZK4A 4LRXA 3IUEA 1WTAA 3L6OO 4ENUA 3KYJB 3S2FA 4QE3A 4CE6A 2D5CA 2HQBA 1G20B 5J1TB 1RVDA 3NRCA 1H3FA 3CIFA 4I81A 1EM6A 3O2NA 4W8HA 4F6CA 3LGXA 3V1NA 2MSKA 4DLWA 5EJ7A 2INGX 2WTUA 3BCRA 4J16C 1LSSA 4M1SA 4NV1A 4TXNA 5HFNA 1RPJA 5ELLA 4R71A 1QIEA 2Q7XA 3RBAA 3PXEA 1OWOA 2PBFA 1TQHA 1C1XB 1OCEA 2JH3A 2RHDA 3P27A 2H4YA 1CNEA 3D6VA 5DMHA 3IAFA 4C7VA 3JQQA 3OOJA 2JKYA 3G9XA 3T5BA 5SYAA 2FFBA 1Y8RB 4D57A 2IXBA 1R5NA 1T26A 1VLMA 2JVIA 1QGOA 1XIVA 2BL4A 1A27A 1RP1A 2GN8A 1A8PA 4HNAB 3OU6A 3F3KA 3EVAA 1YBMA 3EFOB 3DBHA 3U4HA 3D3WB 4MRMA 3UAWA 1KOGA 4R51A 2CN1A 2X41A 2P6MA 3GFOA 4JY7A 3LT2A 1YZHA 3BICA 3X44A 4Y9SA 3A3PA 1GIAA 3KB1A 5F4BA 5AIBA 3GZJA 1QORA 2BZSA 4WKCA 5ENVA 3KVVA 3N2KA 1S2OA 4AO8A 1C2TA 1NP6A 1E9DA 1FYWA 3F47A 3R8CA 3THRA 3UT6A 5TMPA 3DH0A 3AVUA 8MHTA 1T8RA 2EYQA 2JFQA 4CQMD 2ZJ0A 2R25B 4QEKA 1FTSA 4JNKA 3D4PA 2Q1XA 1IM2A 2G5TA 3EHEA 1JI0A 1J70A 2P77A 1F9EA 1OZ0A 1L2TA 3ONEA 4LF5B 2OFXA 3QMPA 2G3YA 2GTPA 1XZDA 4KUEA 1N4AA 4BO1A 3HZRA 2G06A 3K1AB 4JL6A 1QUEA 4NDZA 4M1TA 2B78A 3CW8X 3DBRA 3DLPX 2GPNA 1OWPA 3R2JA 4IIGA 1LEHA 5IG2A 2YNMD 2ZAIA 1YZUA 3EC2A 3ZDDA 3CSDA 1E1CB 1MO5A 4TTTS 5CYGA 1A4IA 2R47A 2ZDQA 4OP1A 4RLSA 4RESA 4GNKA 3OPNA 4TZKA 2GJSA 4Q6WA 3ZIDA 4D4KA 5BSVA 1WHTA 2D2IA 4YRAA 4AIRA 1WCV1 2L2QA 4KQHA 3ZLUA 1D4ZA 3JRXA 4JH0A 3WLRA 4KTTE 4BNLA 3ZHXA 4X65B 3L8CA 2VF7A 4BY9E 1OZAA 2PKEA 1O2DA 4CFZA 2BVNA 4HI0E 2HWWA 3BEDA 1KEVA 4HQRA 4XM1A 1MTZA 2JEZA 1XYYA 3FPAA 5TT1A 2QM8A 1IXYA 3DTNA 1QKJA 1UC9A 3BRWA 2OILA 2EIHA 3E23A 2H59A 3H2BA 3OCYA 5DHRA 1P4RA 1OYVA 4WKBA 2J7PA 1R0BA 1NBWB 1YDFA 2OBNA 2R6R1 3QV2A 3WLOA 4BEJA 1BKDR 3G85A 4HQOA 3ICVA 3MINA 2IIQA 5C7YA 3HSKA 3L0CA 2ES4A 3A1DA 3FSEA 3QX9A 1E9VA 3DVRX 3O1IC 4GXQA 4LTNA 3NALA 4RVUA 1BN6A 4XDHA 5F2EA 5ADUS 2JJQA 3HBMA 4X8HA 1FP4B 1V9LA 5IH3A 4A91A 1HTTA 4MB6A 2YBDA 2FPMA 2ORED 1QB7A 1RYHA 1IPFA 1JDZA 1GTZA 2J85A 4UMFA 5HGJA 5HK8A 3G68A 1IWPB 4A92A 3F74A 2PH3A 4ZT2A 5FOVA 621PA 3V4FA 5AW6A 1NPDA 2K5UA 1RJEA 2YVQA 1TKRA 1PUJA 5AXBA 4XQ0A 1M1XB 3M4NA 4C14A 1OB2A 3MTGA 4XB1A 3DHWC 2NO9A 3RSLA 3SBEA 1RXUA 4MDEA 3VDNB 2YYZA 5FO0A 2ZJFA 5KNDD 1HM5A 1FU7A 5AXDA 2OCDA 1U1GA 5KSYA 3WX0A 3A36A 5BR8B 3GLKA 1E1MA 4UDYX 3ZXXA 3IT1A 3CEAA 3JR7A 3TSAA 4AJIA 2VT3A 2OYSA 4QTTB 1QZZA 4ZYWA 3BMCA 1KC3A 1V96A 2Z08A 1DXQA 5JPCA 1NUTA 2VCHA 4XQGA 1IZYA 5GJBA 2FLKA 4NJEB 3ROGA 1UXGA 2ZSBA 1EXMA 3I92A 1P5JA 3UM9A 3ZNNA 4JUDX 3N2GA 4G8JA 4TYNA 5EQDA 1B93A 4YONB 1KU0A 2YZGA 5FXMA 4W5NA 1A2KC 4CVNA 3CFYA 4K46A 1Y7LA 4DUGA 1N5DA 4ZVQA 2Z09A 5DXAA 2WAAA 1C8BA 4EB8A 2CC2A 3LUBA 3NQ41 4BGDA 4G97A 2CY0A 4J16A 4MINA 1T13A 3RARA 3TKAA 1AHPA 1J1UA 1ZM3A 1JG6A 4WRRA 4MYHA 3O8DA 1ZRMA 3O1JC 2FF7A 1QE0A 2EQAA 1ID1A 1J8QA 2HXGA 3AP3A 3TBKA 1VRCA 1OR8A 2QORA 3BM5A 4Q9AA 3ROMA 4BNMA 3CG0A 2RHBA 3RTAA 5TR9A 4C2UA 3BK1A 3CEJA 3GJ7A 3JV7A 4Y2JA 3KSBC 4FR2A 4LZZA 1I0IA 1I0ZA 5ALXA 2WF7A 3KQLA 3WHPA 4F96A 3GVIA 3AIKA 2OPBA 4JVSB 1XZ8A 1CW2B 2VZ9A 3P4XA 5JH7A 2J3JA 2GN6A 1WSWA 4GLFA 2CNOA 1II9A 2QU8A 5AK6A 4EYSA 3IMGA 1XZKA 2FZVA 2EKQA 2JIOA 3OCZA 2XGSA 3TVYA 5KNBA 1R5OA 3C43A 3VU0A 1EWVA 1E1KA 2IYYA 3FCCA 3HKDB 4MS4A 1XD2A 1DKOA 2Q6OA 1J09A 2CYAA 2OD2A 3FH0A 3FYDA 2H4JA 2ZROA 3LTEA 1SK8A 5CP8A 4PN3A 4LPKA 1UFQA 5JIBA 4ZTZB 3UB3A 5KYXB 1TK2A 4WY2A 2X8JB 3OICA 2MSWA 3W8NA 2VTBB 1UJ6A 3BD8A 1NI4B 5I7RA 2YW9A 4D92A 2CZGA 2VYQA 2X5XA 5KHOC 4KWHA 1E5DA 2PZ8A 1XFDA 4F2PA 4KAXA 4L6CA 1J9GA 1OSNA 2DWCA 1H23A 2H5IA 5IAGA 2NSYA 4A6EA 3OIWA 4Z7QB 3USES 5KWSA 1ILWA 2Y1FA 3CE9A 3LT4A 3ZV5A 3PE6A 3JATB 3O8OA 1UXIA 3M4XA 1FX0B 1P3DA 1Q1EA 5CH5A 1WB9A 3CG4A 5JMOA 1HX7A 4US0R 1FNDA 1PLLA 1NMXA 1R8QA 2C57A 2QAGB 5DTMA 2ODPA 1QTNA 3ZH2A 2PTHA 2HLDA 3ZE1B 1RWQA 1UKZA 3LH5A 1KDZA 4E5UA 5AM3A 1ONPA 1BS9A 1B74A 4L0QA 1C9NA 1W8DA 2BUBA 2FA9A 3Q7PA 2G07A 5FLKA 2IUFA 1FUYB 1EE1A 1PZMA 1T5LA 2DP4E 2NVUA 3O4JA 4ON9A 3UQZA 3B53X 4KXNA 4EMBA 1WV0A 3VU9B 1Z5OA 3BFPA 3PD0A 2RGAA 2P91A 1EA5A 2HJGA 2W6ID 4Q15A 5BSFA 3FDFA 3I6BA 2XYGA 5JV5A 2ZSFA 2YJNA 1GADO 2BM9A 3OF5A 3HJUA 5DCLA 2L19A 3S27A 1Y7TA 4RGYA 1R8SA 2PZAA 3IJEB 1MDBA 3E03A 4RXUA 4I1RA 1I14A 3OZDA 2J5KA 3E81A 3ZR4B 4Z6KA 2VK1A 3AEZA 1EESA 4OJTA 4F4JA 5P8WA 1Z82A 2EHDA 2PFKA 1PFKA 1YB5A 2W8ZA 4X97A 5CK4A 5DTRA 3OQIA 2FW8A 1C4OA 4MWZA 4Q5IA 3CLRC 3WGJA 3G0HA 5JS8A 3Q7IA 2ZBRA 3GRKA 4DTCA 4FHZA 2AI2A 3VDXA 2XF8A 1MR3F 2RC6A 5JG7A 1E2DA 4ZANA 1C1YA 4FEYA 4OIFA 3VH4A 4F56A 1A9QA 3E15A 3RK0A 3OQNA 5G41A 2HZBA 3NTLA 4DR5B 4MUJA 3KXIA 5AI8A 2J4DA 2JZCA 1FRFS 1KKMA 2QDKA 3N7TA 3V2IA 4F5WA 5BW4A 3HR8A 2UXBB 3D1VA 5LJLA 3L7NA 4P2GA 4M4SA 2CXTA 2WSSA 1SOMA 3OX1A 1TTPB 4WFIA 3QKIA 3RABA 4WGFA 4MLPA 3HJAA 4GKBA 4LY9A 4UHEA 1VPVA 4UFNA 4DMCA 5A3RA 1BA3A 2WRZA 2VDLB 2WW8A 4KB5A 2I71A 1XTKA 5FBHA 3AVOA 4Q19A 2IWHA 2R8XA 3PFBA 4PZ0A 3LQKA 4DRXB 3A0RB 4DUPA 1J9EA 3NHWA 2ODQA 1UPXA 1P72A 2GZMA 2IT1A 4NZOA 1RI1A 3AL0C 2DT5A 1NBAA 1CC1S 1KQFA 5CDYA 3GT4A 5BMOA 3DULA 1MXHA 2ZJYA 3SF8A 2DMRA 2PZJA 3BWVA 2WB2A 4IFEA 1SJ9A 1QKKA 1JTVA 2BRUA 2VYFA 4L6IA 4YRCA 1O54A 1Y6RA 1IJBA 1YT5A 1ZGZA 4CM1A 2EKLA 2WLTA 3QXJA 3QUTA 4PQFA 3MOIA 3L8EA 3DEIA 4EVRA 1CY1A 1V5EA 3CH6A 1M66A 1RHMA 2IXEA 4MWEA 3WQRA 2P2NA 4LC9A 3TECE 4G84A 3B3GA 2WYUA 5LBIA 1UKBA 3FF4A 1UDRA 1TKBA 1VB3A 1JQEA 2QT0A 4LHYA 3UWSA 4H1WA 2R7LA 2YWBA 3N8KA 3SQLA 1RXWA 3CO0S 4KDFA 3GPBA 4JA0A 3ZJYA 1YDMA 2L82A 4JSRA 4R05A 4WACA 1LXCA 5CM9C 2BCJQ 2PS0A 4L57A 3IUBA 1U0JA 3CUTA 3NKVA 4Q00A 2IGTA 3V6MA 1QVAA 1V25A 4V38A 4Z3OA 1F4LA 1D6JA 1OLXA 1TEVA 3DM5A 4JN6B 3F6BX 2ZVQX 4DIMA 5TJ9A 1VE3A 4DY4A 2XGGA 2BEWB 3TD2A 4A7PA 3PEUA 2XKKA 3LC1O 2MYPA 1A5AB 5HBRA 5LQCA 2FRDC 3KQUA 1NBIA 3BHMA 4JVMA 2IUSA 4O0LA 1TEZA 1KEKA 4NL4H 3L6CA 2B20A 1MPTA 1HDGO 1U65A 1N3IA 1TF5A 3F5FA 4FE3A 2HF9A 2CLSA 3ZXSA 1VHDA 3JVIA 4G0WA 1M2WA 1VECA 1VFNA 5IP5A 3NHUA 3WSVA 2A0XA 3TQSA 4MH0R 2VHUA 3UJ9A 2C8JA 3DOIA 3GHYA 3Q2KA 4G5XA 4XYEA 3RRZA 4EGSA 4DPMA 3MERA 3K2EA 4LSMA 2G77B 1RPTA 4RM2A 4A8JC 4B71A 3NM6B 3KOUA 2FWBA 4OBEA 4WN9B 5D01A 1NC1A 1JU9A 5BVHA 4UAVA 5A4KA 3W2EA 2WF9A 4QXRA 3HCWA 2XXAA 1OHHA 3GCGA 1JLLB 5CT8A 3ZXIA 3SC2A 3A28A 1P45A 1MB9A 3O4VA 2BF4A 2JH8A 3C6YA 4NPAA 4UBKA 3ZVNA 3WOHA 4Q3CA 1ML3A 4FDVA 4HN2A 4ODIA 2JLZA 1C3LA 3ND6A 4G9EA 1S2LA 3RIEA 1VPDA 3GYBA 2R6FA 4YP6A 3UOWA 3D5TA 3BMNB 3TEMA 4BECA 1G16A 1IBLB 2QG4A 2RH9B 3O7MA 4YMLA 4PLPA 3FJ1A 1AB6A 4C4TA 3G5TA 3A2KA 4EB6B 4JCCA 5HR5A 2ZZKA 4ZAWA 3DFMA 5TEVA 1KYZA 3QGMA 3REFA 2HK9A 4BATA 2DCUA 4P38A 2M6SA 2PH7A 1FDVA 1E59A 1UFKA 4QA9A 1UKCA 3E8MA 4BV2A 5C5DA 3KP1A 4QGGA 3BMQB 5ALFA 1DBIA 3ZOZA 1E2BA 4NPHA 4BNVA 3DZFA 1I6MA 1MW9X 2H51A 4PXSA 1RXCA 1CZUA 1H05A 1ZG3A 5CXXA 4I6GA 2GCEA 5ETJA 5LDHA 1KPGA 4M0MA 4JD5A 3M70A 1K7CA 4B84A 2QTGA 5BNIA 5DBGA 2ZBDA 3F8SA 3BK7A 5HVNA 5IBQA 4FGWA 4L1KA 4YWHA 1CQWA 1NKSA 2GHQA 4UUQA 6NULA 2H65A 3EWAA 4PSKA 4PQRA 1Z4OA 4O08A 3UT5B 4PZAA 1LX6A 1SKYE 4BP9A 4XQ9A 1F6WA 1T0HB 1O0SA 2HC9A 2WMYA 4FOOA 4ZAVA 2J0UA 2XWJI 3ML1A 3Q8LA 1GSIA 1Z73A 3CZ4A 4KSCA 1QFSA 5BY2A 2Q1WA 4HBGA 2E1RA 1RQLA 3DC2A 2FN7A 4EITA 2QYSA 3H1FA 2G82A 2C7RA 1CUEA 1E6EA 3HA5A 5KTNA 2DY0A 3QTBA 3DV9A 3DVQX 2ZWAA 5LM3A 4Z51A 5DYYA 3ZIAA 5JD4A 1MX5A 1SCUA 4EDFA 4DN6A 4B4DA 3QSYA 3Q3EA 1ZD3A 1V8PA 1E99A 4RKRA 5CLHA 4Z1MA 2HJRA 1XG5A 2GPWA 2Q6KA 4MPJA 1UM9A 1YR3A 1QAQA 1SUAA 5J2TA 2QZ9A 2FUNB 3R24A 4FJ1A 3SQWA 3D4LA 5BQXA 2ZPUA 2VYND 4OQZA 4UCXA 1J8FA 3E22A 3NWBA 5FNVF 1O0BA 1NFRA 2PRSA 5H3CA 1ES9A 2P1RA 2YOHA 4BFXA 4BQNA 5KTRA 3DM9B 4GMDA 3FOCA 3W3AH 4B7CA 3VR2A 1G6OA 4IXTA 5CDGA 4ZAFA 1OX4B 4EJSC 4IQ0A 1OH5A 1TJ4A 3EXAA 2C07A 4L0CA 3OZTA 3MJSA 3D8UA 2B1RA 4O4JA 4P08A 3Q3VA 3FKQA 4ZCIA 2ZJ8A 1QDLB 1I2BA 4WSOA 2ZI6A 4X1OA 2Q7DA 1ZIOA 3KD3A 3T1TA 4HOYA 3AHEA 2O8CB 5EE0A 3F90A 1ISIA 3QLVC 1KERA 2BLLA 3SHFA 3SYMA 4IDBA 2QRZA 4BMYA 3N5KA 4LCJA 2FRDA 3BDVA 4Q3BA 2LCIA 4X20A 4RVGA 4OY3A 1ZWKA 4BQOA 5J2UB 4YCAA 4EA9A 4H59A 3W5UA 2VBFA 1E3MA 1MFZA 1AKQA 1XTPA 1GGFA 1IEXA 2EOAA 2GM9A 3GVPA 5YASA 8ABPA 1SVKA 4AJ2A 1OJLA 1U4SA 5A9RA 2Z6AA 1OQAA 3FHTA 3TLEA 1YS7A 3VR3A 2IXTA 2VHTA 3UPDA 4ETWA 2NU8B 2BBTA 3WR5A 4A8JA 4FHCA 1OAOC 1KZYC 5JZ9A 1ORWA 5JNUA 1IOLA 3OLCX 3HP1A 1SC6A 2JGLA 2C94A 2LW7A 3AEYA 1XA3A 3VR4D 1OILA 2YMQA 3WIUA 4BO7A 4N0EA 1DDOA 3QPAA 4H2DA 2GGSA 2VDUE 2PMWB 2ONZA 4KBYA 4TV9F 2LKCA 2WJYA 2QMEA 2DR0A 4IDNA 1T5DX 3CE6A 3IV9A 1C5KA 3AR4A 4RW0A 1Z2AA 3K05A 2RHHA 3V9AA 2QTAA 3A4TA 3V2GA 4BWYA 1HDEA 5GONB 5JHGB 1ODSA 1DPFA 1ADGA 4U5QA 5JD6A 3ES9A 3FKSD 4QM7A 4B3HA 1X9HA 4QGAA 4GPAA 3EOAI 5FADA 1OH7A 1M8GA 1IATA 2W71A 3GGJA 3PQFA 2FKAA 5AKEA 3ZYCA 2FPLA 1CQJB 1IBRA 2HO4A 2PPLA 1L1EA 4NYJR 1N0WA 3VC3A 2WA1A 2XHEA 4N49A 3NT2A 2AN9A 4UXHA 3EUFA 3G8DA 5JD3A 3MOGA 3TTTA 4DV2B 4PVDA 2CJWB 1XRLA 1X8XA 3BPSA 3BXOA 2HIHA 2W2QA 2WIBA 2WNHA 3ADKA 4L16A 1ZUHA 1KQPA 1DB3A 3FWNA 2C29D 4G56A 5A6SA 821PA 1VJ5A 2IU0A 2VTDA 3C3DA 3SE7A 1EHCA 2VSYA 5REQB 1U4NA 2YJ5A 4FU0A 1G63A 2ZRQA 5CFNA 1N5KA 1EXNA 1KI6B 1ZITA 3MELA 4ZZ3A 3R7DA 2Y93A 3MJTA 2Q07A 1L5LA 3K0CC 3QUCA 1Q50A 1R9NA 3OMWA 1X1TA 2W2KB 2VPIA 4C4SA 1SKBA 3LWNA 3UWPA 4K6GA 3RVLA 1Y6ZA 1JPVA 2GZ3A 5J4KA 4MKFA 4YJ2F 2WIDA 4QOSA 3OAAA 5GV7A 1N2CB 3U0BA 1J5EB 3D8SA 1ENYA 3L7BA 1IFXA 1P80A 2CKDA 3DDOA 1ZAKA 1Z6TA 2BFFA 3N2NA 4TYYA 1KJJA 4JXJA 2W6QA 4BMCA 3VYRB 1EBBA 3RVSA 1UH5A 2XCUA 2EBUA 1P2UA 1AUVA 1U7UA 2VRCD 3G2PA 2DFDA 2NO5A 3F6RA 3CXRA 3G8BA 3G7UA 1ECGA 4V3BA 3ZWWA 3EXIB 1L7VC 3DL2A 3QI2A 4WLOA 4DLLA 1QHXA 2JI4A 3ZHVA 1RQ2A 3WGUA 2D1RA 1NTOA 1WBBA 1U81A 3KJIA 1GG9A 4JB8A 3TFWA 3VKHA 2ZS8A 3ZHBA 2WJAA 3A9TA 5AKHA 4DRZA 1I4EB 1E2NA 2HKIA 2P8SA 3TDKA 3TTWA 1FUKA 2I2DA 5BR1A 3ZX4A 2EKDA 5LVAA 1HZZC 2OBYA 2YDXA 4G9BA 5LNK6 4C6HA 3A6DA 1FNSA 2PSJA 3IULA 1QH1B 1P0MA 3EAQA 4MI3A 5LU9A 3PSAA 5LCXA 1RRMA 4BCCA 1JYSA 3FZQA 3MPUA 3N8IA 4KFTA 4AG6A 4EJSA 5HKAA 1VCHA 3I42A 3P9PA 2JGIA 3RUAA 4WFQA 4QPDA 3VAZA 3RAEC 1T0PA 5DNUA 1KO1A 3MD0A 4QNRA 1KDVA 5EESA 3MAJA 4XRRA 2ZUDA 5C1BA 1MOZA 1Q0UA 1QIKA 2Q6TA 4Z9AA 1CIPA 2XDQB 3I9V6 3PHJA 2GKSA 5EZYF 2BGWA 4LDZA 5GOTA 2VF2A 5HX7A 5KIAA 3H5OA 4G8BA 4KSYA 1Z38A 3BSWA 3FAZA 4Q7JB 4Y1FA 3DZ8A 4EFKA 4ZU3A 2A0WA 3QLVA 4XWGA 5B37A 4MICA 4EENA 1TCVA 2JFYA 3AY0A 2FWAA 2ZSHA 4QFMA 2IOFK 4Y2UA 4C4YA 2JPDA 2WIAA 3JRNA 4DV3B 3RT9A 1DKRA 1JEJA 1DOHA 1WIWA 2OAP1 2QW8A 3BFJA 5DIFA 2H0QA 4IHJF 3PIIA 4C0HA 4DC9A 5CCXA 2IS6A 3I9MA 4UVGA 1ZNYA 5JZMA 2Y92A 2VSNA 3LBAA 3WL8A 1IQ0A 2Q9AA 2ZJOA 4FB5A 2IXFA 1G8HA 4CMIA 4ZZIA 5HOQA 1NC3A 2FKNA 3NOQA 1YKFA 3OD5A 4ZGBA 2B3DA 4R1MA 1FPMA 3THWB 5AVYA 1P8JA 2WU4A 4PYQA 3TIVA 5EPUA 3B9BA 3D6NB 3NWPA 3TRIA 4ZCQA 5H83A 3SDBA 2IU6A 3KWMA 4GBED 4F06A 1U2QA 3OJCA 2HA4A 4N0QA 4CR8A 4YMVA 3V8NA 2UZ4A 3WV4A 2HL6A 3SVTA 1Y6JA 3AJ9A 4NCKA 2EW2A 4EPVA 2Q6IA 4ZVKA 4LS3A 3E9DA 3M5PA 5DM60 1PFVA 1K75A 1GCIA 2EARA 3AY7A 3KOYA 3TNDA 3DMDA 3OBIA 4ZU1X 1BH2A 1JNXX 3DAGA 2RGDA 3KM0A 3H2ZA 4OXXA 4W63A 3WOVA 1DE0A 3AEUA 3PWTA 2HD4A 4XLZA 1XA4A 5JDIC 3J81A 2Q2WA 3GLQA 3PGXA 1E5VA 1DAIA 1RM0A 5AJZA 4QZVA 4S1PA 2P2CA 5TGZA 5ITWA 3RYTC 4EJ0A 5K6TA 4DIKA 4ZVPA 1VLJA 3G17A 3L04A 4RF5A 2JBHA 2YV5A 3AWIA 3K31A 4GSYA 3PYLA 3ZVKA 1P2BA 2A14A 4P7FA 2ST1A 4MIOA 1PAUA 4UMDA 1GPAA 4I1YA 5F7ZA 1KJWA 3LT5A 4F6LA 4KGDA 4PPNA 4N41A 2W11A 2ZETA 4XTRA 1YTUA 3OTQA 3PYXA 4X71A 3B51X 5CFLA 3QY9A 4G24A 1PW5A 1U2TA 3AONB 3CUKA 2NX2A 4FI3C 1F3OA 3H6GA 3ZWQA 4C4AA 3KZCA 3K0CA 5BYAA 3HCRA 2EW1A 2R68A 2VNJA 3V3KA 1XXHB 3GLRA 3PDUA 2DFNA 1YJXA 3EBLA 1QLJA 4FINA 5BWOA 3DVSX 3A1UA 1E5TA 1SUBA 1QG2A 1ZN8A 1ZRHA 1VSBA 4HUTA 3D8TA 1QQTA 4UW9A 4AJNA 2DLDA 3TYXA 1FJHA 1Q0HA 3PPWA 5K8JB 3IUMA 2A67A 4E5MA 4MMZB 1LNSA 3LDUA 1RNLA 3H83A 2H7YA 2HCFA 1KAGA 1VYVA 2XQVA 2P4EA 3PGJA 5KS2A 1WW2A 4TVBA 4P58A 1GILA 1ZNZA 3ZDQA 4MGYR 3SJAA 3N3AC 4J4TA 4JITA 5B3LA 1WDKA 1FTWA 1YE8A 3L0OA 4QJBA 5DYNA 3H05A 3ODPA 3QVGB 4MUGA 2XIQA 3MLEA 1HE2A 2WB4A 3ZCXA 1ODIA 3EZLA 1V95A 2ZIWB 1G7SA 1HZZA 2WYWA 3ZDRA 4U2FA 2PFSA 3FLMA 1IAQA 3NHMA 4UBNA 1BYUA 1M1ZA 1GTMA 3F0TA 2WJ4A 1N2HA 1OIWA 2GF9A 1EDDA 3D2AA 4G63A 1GG8A 4I4TF 4NDNE 5JCPA 3GLTA 2CHUA 1KKUA 4EVQA 4PBRA 5B3KA 4J0KA 5KYVA 1KDOA 5TJHA 3REOA 1CR0A 3RG2A 4C5CA 1U31A 2QJWA 3P9ZA 3G13A 4OF4A 1Z12A 2AMYA 2HMTA 1WSDA 2QYOA 1P1KA 1N2OA 4IGFA 3R74A 4PNHA 4F4DA 1C9KA 4EG1A 3ZG6A 1DCTA 4ETIA 1BJRE 4FFVA 3UYLA 1B8NA 4Y2GA 4D3FA 1BE8A 4ESOA 3Q7TA 3QE4A 2BISA 1E32A 1SBTA 1X38A 3IH5A 3WB1A 3A70A 4MVJD 3SWWA 3SCZA 5KOHB 3GRUA 3X43A 1HKUA 4JCOA 1BQ4A 2EZ8A 5F5LA 3UT0A 4QOHA 5CBPB 3AZOA 3MUNA 2RFLA 5DBFA 3GFGA 3GH1A 2REQB 1E3WB 2YHUA 1QS0A 4RDXA 1OE0A 5HIMA 3AVQA 1J5PA 4FFMA 1GTJ1 3EY9A 3FHCB 4CHTA 4TLEA 3PX7A 1RABA 3MS4A 2VDPB 4G1BA 3WGVA 3ZGVA 1SCQA 5DN6A 3KOZA 3HXQA 3G79A 4EHKA 3V8QA 2X9GA 3IP9A 2YTZA 1X1QA 4O1MA 1AXGA 1R2QA 1DAPA 2R48A 4NBWA 4OYHA 2RGRA 4ZVMA 4BQEA 3C3AA 1O9BA 4L4UA 2I65A 2PVCA 1LH0A 1X0XA 2WJ3A 2AR9A 2DSTA 4P4GA 1EP9A 1MLDA 1K1EA 1U04A 3CJRA 1YHNA 2G8NA 3FCAA 3ILSA 4IIDA 1BVHA 4J0DA 1FTNA 2X8BA 3I8XA 1MJNA 4AICA 4AL4A 1P2VA 1GAQA 4MR7B 4P4NA 3HTXA 1U8UA 2H8GA 2XX3A 2AW3A 4UQPA 1RI2A 4GKAA 1AMNA 4KGZA 4OQFA 5AJXA 4UZSA 1V47A 3R09A 4I5DA 1KGDA 2R6DA 3D8HA 3QNWA 2DPGA 2OR3A 1MJ5A 1VXRA 5FUYA 3PHHA 3ZY6A 5GZ3A 4S0ZA 5JDIA 5FTLA 4F21A 3AHFA 3VXKA 1VE9A 1Y5MA 2GZ1A 2J7PD 4L50A 3SAJA 4J94A 2EFGA 3AT1A 3VNRA 3R0IA 2X5NA 1AMOA 3R9WA 3I05A 1LLCA 1ULSA 2QAIA 4TMKA 4DPLA 1JAXA 4ND8B 4AWBA 3WAJA 3TNFA 3F7OA 3NETA 2OWEA 3U13A 3S3TA 3GR6A 1VA4A 3H6HA 3AB3A 4M46A 4ZK6A 3K9BA 3AW9A 4F8YA 5FAKA 1E5QA 1VIMA 2PRJA 1O9GA 3PV0A 2W7TA 3GU3A 3V7UA 1PVOA 2NXEA 1ZH8A 2G36A 4JOSA 2HU2A 1YU9A 5DGXA 3SKYA 5HF6A 1Z5UA 2GZRA 4MYSA 3TLGA 3B12A 4TSRA 1NVGA 3TW0A 1AXEA 1JVBA 1RFGE 4TL8A 2QL6A 3HMKA 1L5YA 1V11A 2YHBA 4KCGA 4PONA 1D4FA 1IG0A 1R8JA 1T2DA 2HQSA 2R1VB 3DEJA 1D2NA 1WNFA 3DHEA 3VV2A 4DLKA 2X77A 3M33A 3QX3A 4JI1B 4WLUA 5ULLA 2VP9A 4MPDA 1RC8A 1H3NA 3B9PA 2O0KA 3RS7A 3G5UA 3HN7A 3NHKA 4OHRA 3BS4A 3KEOA 4WLEA 2GYUA 3PUKA 1CRLA 1XZPA 1TLLA 5C4GB 8ADHA 4YCNA 1NAHA 2BFNA 3SY8A 4B7UA 1J2RA 3ZU6A 4F7DA 2EJVA 1EUYA 4MXDA 3W0LB 3I73A 1XVVA 3NAZA 1DO2A 2A0KA 1FS5A 4HNRA 3R0XA 4YS6A 1BMFD 5BN4A 3A4YA 3N0TA 2JRLA 4O5OA 3RJ9A 2COEA 1H1DA 2P0EA 4OHMA 1YD7A 2RE8A 1SEVA 4F2DA 2B4TO 3FNGA 4MW0A 4OREX 3R7WB 1SVNA 1TIKA 3CZ5A 4INJA 4RVFA 4A6PA 3I76A 4NE7A 5HKKA 3E1SA 1TL7C 2B82A 3QU9A 1COZA 2WJJA 4OH7A 2XYHA 3ABQB 1NNSA 4M1WA 4FZ5A 1L6IA 4CQJA 2BSAA 3UUFA 1ZGHA 4YP1A 5JRJA 2Z57A 3BTSA 3DMYA 2QBYB 4DE5A 2OG2A 1DBPA 2FTKE 2CUZA 4EO9A 3JQGA 3C16C 3L1HA 4JJKA 3T7KA 1X1RA 2AG8A 1I4DD 3ZCUA 3RYHB