1EWTA

Crystal structure of metabotropic glutamate receptor subtype 1 ligand free form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
478
structure length
456
Chain Sequence
b'QRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
publication title Structural basis of glutamate recognition by a dimeric metabotropic glutamate receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 144
structure length 456
sequence length 478
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewtA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewtA01
3E61A 1DRKA 3F6PA 1BA2A 1USKA 3P9YA 3HM9A 1EAYA 4PICA 3SG0A 3HSYA 4MLCA 4FB4A 2OQRA 4RSMA 2QR3A 1LJLA 4OTZA 3URMA 3KYJB 1ZGGA 5DGCA 4CBVA 1JFVA 4MRMB 2IPMA 4QYMA 2PUAA 3QEKA 1RXEA 6CHYA 3CNBA 3BBLA 3Q7SA 1L5ZA 4O5AA 2XDYA 3C6QA 4NV3A 3MQ4A 3C97A 1DBWA 3OLXA 4OLAA 4FE4A 4KK4A 5TQ2B 4KQ9A 2JVIA 1Z2EA 4XAQA 4Y9TA 1YK1A 3G85A 1JYFA 3LFTA 1JL3A 1U8TA 1VKRA 3QX8A 1F51E 4G0XA 3LUFA 1JDNA 1U04A 5IC5A 2I6FA 2JK1A 1J56A 1FFSA 3GRCA 9ABPA 2BGGA 4Z4CA 3GBVA 3MF4A 1TMYA 1Z18A 3KKEA 4MR7B 2GWRA 5JNVA 1ZH4A 1JHZA 1GCAA 1ZESA 3BILA 1PNTA 1AB5A 3CS3A 3C3KA 4RY9A 4TLMB 2GI4A 1SRRA 3IP6A 4NQRA 4KMRA 2L17A 2IOYA 2WMYA 5FWYB 4IMJB 4TN5A 4N76A 1E6LA 1JBEA 2MSLA 4YGXB 2LUOA 5KQPA 3HV2A 5FWXB 3HEBA 2IYNA 3KSMA 4RK7A 3RVQA 2NUBA 2ID9A 3O1JC 3HDGA 1M2EA 2LBPA 2GKGA 2QU7A 5JS2A 4W5RA 1GUBA 4JAVC 2PL1A 1QP4A 3LUJA 5PNTA 4LE0A 3QLVC 4RKRA 4ETIA 4G0ZA 1QP0A 3K4HA 4NICA 4MAAA 1DCKA 1E6KA 3HK2A 3UUGA 3EGCA 3LMKA 4H3KB 1TVMA 4YP9A 3GV0A 1P6UA 1MIHA 3F73A 5CNIA 4Q6WA 2FEPA 4RY8A 4YLEA 5IULC 3L49A 2A9QA 4IMIB 3F7NA 5JNWA 3EODA 2FXIA 2V0NA 3NNNA 3RQIA 3LTEA 1WETA 3FDFA 4YO7A 2RDMA 1A0OA 1P8AA 4EY3A 4W5QA 3HUUA 3H5OA 2P9HA 4JASB 5FBKA 1I3CA 2ID7A 4JOQA 2FMHA 1MVOA 4JP1A 2JCGA 1NXSA 5EWMA 4EVQA 5C5CA 2F8TA 5FWXA 3RVJA 3JPYA 1BDHA 3G1WA 3KG2A 3O2QB 1USGA 1VRVA 8ABPA 5BRJA 3Q15C 3RVMA 3LUDA 2J48A 3RH0A 2R25B 4KV7A 3RVNA 3DZDA 1H9CA 1QP7A 2WWVD 2HQBA 3A3KA 3OO0A 4PZ0A 4RWEA 4OBBA 4MR9B 1QQBA 3CKMA 3OLVA 4WT7A 4YCSA 1ZDMA 3JY6A 1GCGA 1ZY2A 3T95A 3VNBA 2HQRA 4MS3B 2H0AA 2NZUG 1FQWA 5KC9A 2WJAA 3A0RB 4L85A 1JFTA 1DC8A 4HYEA 3QX9A 2Q5CA 5EWJA 4Z0NA 1MB3A 5I4CA 3FFWA 1DCFA 3H75A 2QVGA 2VYCA 4G0OA 5IBQA 2E4YA 2PUEA 4PYRA 2FQYA 3T6KA 1Z25A 4M88A 4QPJC 4IGAA 4TMYA 1Y1LA 2O20A 3W9SA 1SXIA 3CTPA 1DG9A 4D74A 2FLKA 5B3JC 1NXOA 3OO1A 1PEYA 4ML3A 4P1ZA 1DCMA 3DGEC 3FGZA 3T8YA 3H1GA 4EYKA 1K66A 2GX6A 3D02A 3BRSA 3KYIB 4RZSA 3CFYA 4XASA 5TPWB 2MSKA 1MB0A 2A9OA 5IEBA 4ZYLA 4ETNA 7ABPA 1AB6A 1Z16A 2PAFA 1E2BA 2IPLA 4F11A 2YHAA 3NHZA 4XLTA 4MR9A 5IUNC 4MS1A 1YMUA 3IP9A 4LDZA 2L19A 4MLDA 2DRIA 3GBPA 3IPAA 4S05A 4MS3A 3FFXA 1APBA 3OQMA 2ZWMA 4KK3A 5TPWA 5TQJA 3RVOA 4W5TA 1DZ3A 2WY2D 1PEAA 3CG4A 1D1PA 1Z17A 2FLWA 4RK4A 1ZN2A 3F6CA 3HS3A 4G0MA 1CHNA 2FMKA 3MA0A 4YR7A 3CRNA 4QICA 3M9WA 4MS4B 5DKFA 4S04A 3OQOA 1DJMA 1JYEA 1R8JA 4KREA 3Q7RA 1QQAA 1PUXA 4MR8B 4MQFB 4DN6A 1YTUA 3IDOA 4KFCA 1ZGZA 5BQ3A 3KCNA 3KS9A 5JNUA 1DBQA 5HM6A 2VUIB 2PUCA 1A2OA 3HZHA 3O1IC 3QLTA 2R48A 1A04A 1Z12A 4W5NA 2HJ9A 2JVJA 2RJOA 3C3WA 2FN8A 5IUJC 1USIA 2M1ZA 1P2FA 2AYXA 3CG0A 3LKVA 3CZCA 5E3JA 4JB0A 3DLHA 5GOTA 2MYUA 5BRAA 2X7XA 3IPCA 3KHTA 2IKSA 1P6QA 4MRMA 3EJWA 5KQGA 3RVRA 1E6MA 3JTEA 2ZAYA 3TX6A 5DLEA 1ABFA 2RGYA 2GBPA 5TQ2A 1TJYA 3CZ5A 1KRXA 4MS4A 4Q7EA 4H3HB 2IPAB 1M5TA 2FEKA 4TLLB 4MR8A 3CLKA 1QMPA 3O1HB 3QLVA 3H5TA 3TD9A 2MYTA 2NT4A 2IDMA 1TM2A 1YIOA 3DGFC 1URPA 5FBHA 4EGSA 1C0EA 4XARA 4YV7A 2MSWA 1Z15A 1LBIA 4JB2A 4RU1A 1KRWA 1GUDA 4KVFA 4MR7A 3QELB 4LZLA 2FSPA 4O1HA 3KTOA 4LX8A 2JVKA 2PL9A 2KYRA 5FWYA 3BRQA 3TO5A 2PE5A 3M6MD 1RZRA 4RXMA 1XHFA 2CWDA 4D6YA 3RVKA 1Z2DA 4RK1A 5T3YA 1NTRA 4RY0A 1JF8A 4HNRA 1NXWA 4WWHA 3C3MA 4FE7A 4LE2A 4F06A 4XXHA 3N75A 3I09A 1LBHA 2FKAA 4RXTA 4G0PA 2IPNA 4MQEB 1KGSA 4LDAA 4Z4GA 4HNQA 3MM4A 3CU5A 1SXHA 1ISSA 1RXIA 1HEYA 3SM9A 3O75A 3N0WA 1PNRA 1VLZA 1PHRA 3EDCA 3UKJA 2AYZA 4DQDA 4GPAA 2JBAB 3OLYA 3Q41A 3IP7A 3QELA 4RS3A 2W42A 3QEMB 1DBPA 3Q7TA 3H5LA 5KC8A 1K68A 3A10A 1L5YA 4IILA 3IP5A 4KZKA 1QNLA 2QXYA 2L18A 1QKKA 4N03A 1EFAA 3L6UA 3HXMA 4E7PA 4F12A 3HO1A 3HVRA 1NXPA 2PKXA 1BVHA 1U0SY 2E4ZA 5B3JA 2F8SA 2QVCA 1C4WA 1NXTA 3LUCA 2FEWB 4WUTA 4EYOA 3MMNA 4ZMSA 3DLBA 1JDPA 3Q9SA 3GT7A 1SXGA 3H5WA 2FTKE 2JRLA 4F8JA 1D1QA 2B4AA 4G0YA 1D5WA 3T38A 3GA5A 1M2FA 1YS6A 4DADA 1Z13A 2JBAA 4F3TA 3OLWA 3S99A 4Z99A 5EWLB 3SY8A 4D6XA 3QEMA 4Z4HA 2HQOA 1ZH2A 1Z26A 1LK0A 2A9PA 2B1JA 1VPWA 2VUHB 3H6GA 1JLKA 4OLBA 4N41A 4JA2A 2WRZA 3QLUC 2VK2A 1YS7A 3FFTA 1CEYA 1B00A 4MYRA 4G0QA 3EULA 4Q6BA 3RVPA 4LRQA 2PUGA 1FFWA 4IF4A 5IEJA 4RV5A 3N0RA 3RVLA 2FQWA 2NT3A 4MPTA 1SD5A 2FVYA 2MYNA 1ZHHA 3D8UA 2PUDA 3I42A 1T34A 1BAPA 5ED4A 4KPYA 1CYEA 3KLNA 3LUHA 4KQCA 4L4UA 2PJUA 1YMVA 2JB9A 1W25A 5JNTA 1EWKA 3KJXA 2E4VA 5HQJA 4GNRA 4Z4IA 4UHKA 1RZRD 2E4WA 1D4ZA 1EWVA 5EWLA 3FMVA 2CHFA 4MGEA 3SAJA 4NCAA 2R47A 3KLOA 5JS1A 1NY5A 3JVDA 3TMYA 1XHEA 2PUFA 3HUTA 3SNKA 5CNJA 4EYQA 4RK0A 4UHJA 5JNRA 1MAVA 4N0QA 5BR1A 1FSPA 3ILYA 4HNSA 4QYWA 4MQFA 5KQMA 5TPZA 5KI6A 1YK0A 4PE5B 1UDRA 2A9RA 2PUBA 1ZAYA 4OATA 2E4XA 3OMXA 4LE1A 1DP4A 4RK5A 1ZVVA 4G97A 1FFGA 1NATA 3H1FA 3MYYA 4E7OA 3NNDA 3O2SB 5HKOA 5EWMB 2RJNA 3EQZA 5TE9A 4IRXA 2H3HA 4NCBA 2OENG 2YHBA 1BDJA 2HPHA 3EQ2A 3H1EA 2LPMA 6ABPA 3BREA 2CHEA 2N9UA 3A0UA 3GYBA 3O21A 1OXKB 4EYGA 3HJFA 1KMIY 3M9XA 3LUAA 3GWGA 4RDCA 1DRJA 3EAFA 4XFKA 4Z9AA 3OQNA 3LUGA 3JPWA 5KQLA 3UK0A 4WXMA 5HSGA 4EVSA 5DCLA 3I45A 1EHCA 1RPJA 2QSJA 3ROFA 4KRFA 2PMCA 3ROTA 4Z4EA 1S8NA 4H60A 1D2AA 4ZPJA 3ILHA 3NNSA 2FW0A 3NBMA 3O2JA 3H5VA 4ZJPA 2NZVG 1RNLA 5EWJB 4N0PA 2FQXA 3I5AA 2LP4Y 1EWTA 1DC7A 4YS6A 4B09A 1W9HA 1QPZA 5F64A 5IX8A 1U2QA 4O1IA 3N8IA 1QO0D 2FN9A 2CD7A 3NHMA 1JWLA 3HCWA 3H5IA 3K9CA 4N47A 3LUKA 3N53A 3H6HA 4YRZA 1LJUA 1U2PA 4ZMRA 4WXEA 3JS5A 3E3MA 4WZZA 1BDIA 2LIVA 3OMWA 5TQ0B 5ABPA 5GQSA 5C5EA 1JH9A 4PEVA 2FMFA 3TB6A 4Z9BA 4MS1B 5D2CA 1XWWA 3MIZA 2L2QA 5KWSA 3VNAA 4Z4FA 3DBIA 2P4UA 2QV0A 2R4QA 4EVRA 2PLNA 4RK6A 2FMIA 3N0XA 2WB4A 1NXVA 4MQEA 3GL9A 3N6VA 1ZITA 2QZJA 5CNMA 2E4UA 1M5UA 2TMYA 3O74A 1YVUA 5T7BA 5CHYA 3JVIA 1IIBA 1JX6A 4ETMA 1ISRA 4RXUA 3R0JA 3CHYA 1JFSA 4YWHA 3B2NA 4KNYA 1OXBB 2M98A 4G86A 4OG2A 5IUKC 1ABEA 2QW1A 3OLZA 1F4VA 3HDVA 3OM0A 5DTEA 1NXXA 4RKQA 1TLFA 3RVSA 1QO0A 3LKBA 5JNSA 4W5OA 1GLGA 3OM1A 4P98A 2WJWA 5CNKA 3SQNA 3QLUA 5TPZD 2MYPA 5TQ0A 4EUKA 2HSGA 3LOPA 3QK7A
chains in the Genus database with same CATH superfamily
4HQLA 3ZXYA 1DDOA 4HDCA 3ER8A 3A9CA 3REQA 3SZLA 2AR0A 4Y6OA 1F2VA 2PX6A 4LYAA 1II8B 1JEJA 1ZSNA 1OA1A 2R5NA 3R75A 4FB4A 2QM0A 1AXEA 4YDRA 5C1BA 1K0FA 5MFPA 1TKCA 1NLYA 4Z3OA 2IPMA 3O4HA 5KINB 2Q99A 2C5SA 1NPDA 4GUAA 1RLMA 3DBOB 3DHWC 3OFSA 4EJSB 5CEJA 3C5WP 5BWLA 1V37A 1N1EA 1OTXA 2D4HA 1FW6A 1VJCA 1AF7A 1N6RA 2P30A 4JXZA 2ECPA 1D9ZA 2W83A 2QD3A 2YWEA 1GNVA 5TQ2B 3ZW9A 5J47A 3ESBA 3MOIA 3GGJA 2LD4A 4X3CA 5AM5A 1Q77A 3NJ4A 4IYRA 2FJPA 4Z0HO 5H70A 1J2JA 3GFPA 4DG8A 2LTAA 2ODEA 4KNVA 4JP3A 4IXTA 4HWSA 2B25A 1JFFB 1WY5A 2YWGA 5B4VA 3W0LB 3RKRA 1TF7A 2F1IA 3QU7A 5MF6A 2WJHA 3K1TA 1K6XA 1R8SA 3AUFA 1V41E 1T4CB 3LHIA 4X93A 4CGYA 1DKQA 4YRSA 1B6RA 2C9OA 3NRBA 3V33A 5EJMA 3EFOA 1FYXA 1CR6A 1GZUA 3K6SB 1ZOSA 1C1HA 2C78A 4D3SA 4LJ4A 4F72A 1R0LA 4MQMA 3WRVA 3LWZA 3HFGA 1X14A 2L17A 1G6KA 5EOVA 1J4AA 3T1OA 2VF4X 4F04A 1FXWF 2W2NA 3L0SA 1JGTA 1EM8B 5HJ5A 3Q5DA 5LYJA 3T3GA 4EJSC 2P4HX 1OXVA 2QQ5A 4RPGA 4DQVA 2IIPA 5EGNA 1DV2A 2NUBA 2VTEA 2ID4A 3JVUA 3KWMA 1VOTA 4OQEA 4RKYA 4ZV4A 3LOUA 3PFCA 4JVLA 3WOVA 1JSXA 4I3HA 5TMPA 4GKKB 3INRA 4WJKB 5EQDA 2N75A 2R65A 4F5WA 5C7OO 2E5LB 3GIWA 1IJEA 3AEKA 1NN5A 3K16A 5ECGC 5G0WA 4BNKA 1Z6YA 4HUJA 2WD7B 1FJHA 2VDNB 2DFKB 3AEUA 1NQXA 2OZLB 3EZFA 4I1OA 1RP1A 1EE9A 3K4HA 3AM3A 4HMPA 3AM5A 1QIKA 4OYRA 1DCKA 1W4ZA 4DSUA 2QYSA 2JHPA 5F52A 3F74A 1SUCA 3D8TA 3C5HA 3DZ8A 1X87A 2P3QA 2GTPA 4FN4A 3C3CA 4TSFD 2PPLA 2H5EA 5EL0A 4DMRA 1VRCA 4P3YA 3I64A 3UA3A 4E6PA 1ESCA 1KQNA 1ORTA 4EW6A 2C5EA 4FI3C 4B43A 5IYZA 5LQRA 1XU7A 3OH8A 4G5FA 4X45A 1EGAA 2AOTA 2GAFA 1SIWA 3SC2B 4BCCA 4DXDA 5J2UA 5GPBA 1E6EA 4NBVA 1PQYA 2O3UA 1VJ0A 1BN6A 1ADGA 1L5NA 2NO9A 2D1FA 1VP3A 5BSFA 1NI4A 3AGPA 3ZJVA 2QM8A 1C2YA 4KBGA 4NTZA 4YQZA 4YJ2A 5EHIA 4ZCLA 2FWJA 2NVUB 3T4EA 5EJ4A 4YBZA 1TKAA 4K86A 3NRCA 3ED1A 4JU8A 3OLQA 1QP7A 3NS7A 3EBOA 1XPUA 4TQAA 4AG6A 1X1EA 2IQIA 4DA9A 1JHYA 1QQBA 1U1GA 2PGAA 2Z2JA 2B5WA 1RQNA 1BWQA 3DDOA 1WZCA 3HNPA 4Q9KA 4WZAE 1TCCA 1BC5A 3VNBA 4MS3B 3IBFA 3W2GA 3DOOA 4G24A 5BN3B 1O96A 1WAMA 3TR6A 3EZ6A 5JI2E 1CZUA 3LI2A 3FW1A 2YS6A 4EHDA 1H4TA 3OEHA 5EWJA 4A2QA 4PYKA 2W2VA 2QEQA 2R85A 4YFVA 4FHGA 3X1JA 4AXBA 3PXAA 5KU1A 1BXRA 1EVYA 1UF9A 2VWPA 4YT2A 3VHXA 5EIBC 2VIIA 4BJ3A 2IIVA 4I0WB 2FR0A 2K7ZA 1LDYA 1W94A 1JAXA 1N4DA 4IDPA 4JLNA 4QWMA 5E2BA 1OTYA 3LM8A 3W9SA 4EYGA 5AOCA 3LOQA 1KU0A 3P8ZA 2Q1SA 2PKWA 1WUYA 3WGTA 2WF7A 3GRPA 1HFEL 5KJFA 2CW5A 3DUFB 2BGKA 2R62A 2ZYUX 2ZUVA 1R0XA 1WV0A 4YLYA 1E99A 2B1RA 2BR3A 1BKDR 1GDHA 3RKUA 3X2SA 4D9MA 3IVAA 1TUIA 5CH8A 1P44A 4P54A 1K06A 3Q3HA 2JD0A 2YX1A 1DWQA 2IV2X 2I2DA 2BAGA 4HYYA 4Q3BA 2F55A 4LHXA 1VE9A 1YVRA 1EUDB 1E8NA 2HLDD 1R5NA 4NYIQ 5HIIA 5T6BA 5GADl 3OQHA 4GMDA 2I62A 2YZKA 4O29A 2VP9A 2OLEA 4F21A 4CEHA 1Z17A 1RJDA 3QXSA 1ZN2A 3SHWA 3PHBE 3ZDEA 3JZDA 4HWKA 1CHNA 4PAGA 5IXJA 2OBYA 1L8LA 5H0IA 1RWPA 1TZBA 4FHDA 2E21A 4YASA 1I3KA 2FFHA 1YTUA 4G2TA 1JJIA 2VH5R 4P32A 2P77A 5ES3A 5FLEX 2GBCA 3FYTA 3FDZB 1W88A 1A2OA 3BE5A 1EBUA 3U3KA 5KYGA 2A1IA 5ADVA 4ZO9A 1EH5A 2O5EA 2BHLA 2OFXA 2JVJA 3HNRA 3L8MA 4MI3A 2VXBA 2X76A 2FN8A 5B1SA 3M1AA 3QG5A 2IHZA 4M1SA 1M3SA 2E85A 2ZT6A 3CZCA 4QBKA 4OCZA 1FU8A 1WLYA 4Q5IA 1VMKA 3ENKA 1BMQA 4BX8A 3GT0A 1PZGA 5DM70 2BOVA 5EIOA 3TTXA 1XDWA 2B30A 2FPXA 4TTAA 1OGIA 4ZOLB 5EQTA 3UWDA 1GG8A 1TEXA 5GTDA 4JI0B 4M1QA 1NQVA 1QIIA 3DTNA 4JX8A 4O8CA 3RVRA 3W2FA 2GA9A 3Q0IA 4H1TA 1TCUA 5JE8A 2SNIE 2OYSA 1E2LA 2QRGA 3HUFA 5EUBA 3TX6A 1KEEB 3BM5A 4IHJF 1RKXA 2CHQA 2HYIC 1ZU4A 4MS4A 1M8GA 3NBUA 1F5SA 3OC0A 5F76A 1ENPA 2FNAA 2WM2A 4IUDS 4TTVA 3OOWA 5JSQA 4JSTA 3GLVA 3O1HB 3DP9A 4K9SA 4KGXA 1N3YA 3FGPA 1XPOA 5BQOA 3EXFB 1T35A 4NEQA 2AOXA 2QTVB 4X1YB 3SDBA 4X95A 1FTGA 4S1VA 4DEVA 2OHJA 1MB9A 2X41A 2CLEB 3EGXA 4Q4DA 4CODB 3LLVA 4E5UA 1ZSVA 3CT4A 5C51B 2AN1A 3O8DA 1R6TA 1Q0PA 2NM0A 4PIMA 2JVKA 1GEEA 2IL1A 4F2WA 5K05A 1IOLA 1CNMA 1KOJA 5JCJD 3QE9Y 3TO5A 4GX2A 3CGGA 3CE6A 3FPGA 3RRNA 4BEJA 2X19A 2F43A 2ZBUA 3R7DA 1Z6ZA 1CVLA 3KOXA 3K1ZA 4CT5A 3UMMA 5IDYA 3EXAA 4H3SA 4S2EA 4FCTA 4KQEA 1L7AA 4LDJA 2O2IA 1E89A 3I5MA 3KYDB 4OQXA 5T3YA 4B76A 1QJ4A 4HVTA 4LYDA 3DZFA 4DHEA 2GEFA 3PC3A 1GR0A 3CN9A 2P3SA 4RCYA 1Y63A 1ETUA 2YWDA 4PZYA 3QVGB 4JBIA 1YQGA 3B7PA 4XB1A 3KVOA 4Q7KA 2PSDA 2ZSAA 3E3NA 4X3OA 4A7PA 4BB0A 4D42A 3Q7IA 2O5CA 1WZEA 1B0PA 3IKLA 3CU5A 3MJEA 4XM2A 3TTUA 3LDGA 4K3UA 3RS7A 5J40A 5DTQA 1VG0B 3JRNA 2P9ZA 3G79A 3QELA 4RMJA 4JS0A 1JLMA 2WTEA 5B1YA 1TO6A 3SOPA 1K6JA 4HAOA 1JAYA 1QTIA 1U11A 1YHNA 4F9TA 1CUAA 2R1VA 4EMUA 5E38A 3WA6A 5IMSA 3F8SA 3ER6A 1GAEO 3T1YB 1C7EA 2QGNA 5TXGA 3ZDDA 2X0KA 3WSTA 4GS5A 5G4KA 3H04A 1JG1A 3BBPA 3CNEA 4R68A 4YV2A 3P97A 4IJVA 2E82A 5GJVC 1UEJA 3EMBA 1BA3A 1QQ5A 3Q5GA 3OTGA 2O7NA 1JA0A 1EGHA 1W44A 4B3MB 1MLDA 1IDN1 2C7BA 2J0UB 3D7RA 3KR2A 5FYDA 3QKSA 3KD3A 4KMMA 3DMYA 4D4HA 3MW8A 3D4NA 1HA3A 2GCGA 2PLFA 3PEVA 1RWKA 2YY5A 4LXIA 4DPMA 1D1QA 2Y9PB 1BCSA 3FBWA 3UFBA 1AQ6A 4YT8A 2GERA 1E3TA 5KSOA 3Q9NA 5I45A 2YDXA 1PEDA 3WAKA 1PZMA 1YS6A 1PNOA 3OQJA 1SD1A 4C07A 1Z13A 5JYCA 3GOHA 4WA7A 4FOPA 3L84A 1YOVB 3AL2A 1P6XA 1U2GC 4Q1AA 3C6ZA 1SVIA 4XIFA 4HF7A 3HYLA 1PJ3A 4AJ2A 3JV7A 3GVPA 1VL8A 5IN5A 4HLUC 4JXXA 2H8KA 2F1OA 4ARIA 2EIXA 1OLSB 2OB2A 4XE5A 3FFTA 4AROA 2P68A 2P35A 3VYWA 4EAAA 4GOND 1HYQA 4BNZA 5EJ9A 3O31A 3GDOA 4K9PA 3CW9A 1BGWA 1JSRA 1O4WA 4D97A 3SVTA 3U19A 3NOXA 4Q9DA 5ED0A 3D9QX 3FMOB 3HPQA 5DNWA 5ER6A 5EZ5A 4A2WA 2PS3A 1CEXA 4JJKA 4OQQA 5E0KB 1UBTS 4IYJA 4RZQA 2C94A 3QU5A 4BOYA 3FWZA 2PM8A 1ORVA 3PVCA 1QZXA 3GCDA 5IVKA 1UL1X 1VLMA 4MB0A 1A27A 2V3CC 4Y2UA 3A4YA 4HRVA 2AG5A 1F8GA 1TM7E 2FXVA 3F7MA 4MVJG 4GZ6A 1SBHA 4TLBA 4IM7A 1Z07A 3CR3C 3NHJA 4KI0A 4A27A 4DA4A 4EKNB 1E6WA 2G36A 3IC5A 3KDPA 4ITVA 1S1CA 4PCLA 2FF7A 3ZNOA 4ZC8A 1G291 3WKBA 1NJ8A 4I14A 3IYLW 5EXSA 1U7DA 3TZQA 2BBWA 1HRKA 3I9V6 1FP7A 1VG8A 5TPZA 1XZGA 3KT8A 5KI6A 4BNFA 4G37A 3BK7A 3MT7A 4CQMB 4CLOA 4AJEA 2ZANA 2ZOSA 4K9DA 3B1WA 3CJRA 3QLEA 4N9QA 4NHEA 4WNYA 4JI3B 3JQEA 4EB0A 2ZYVX 3R5FA 3T9CA 2ZYIA 1SBCA 3I9JA 1SVKA 1ECFA 1H0RA 1R10A 3E27A 3OT5A 2QZPA 2YFHA 3C8ZA 3O2SB 2QRJA 1USVA 1F6BA 3JTMA 4OI4A 5LKAA 2VYQA 4XZ3A 2QL9A 1NC1A 4YIKA 3WO0A 3BTVA 4ZT6A 3IOCA 1Y7PA 4L9AA 4N5HX 2XUHA 2B2CA 2VTKA 3O7WA 2C77A 2WHYA 4LXGA 5JG7A 4F5ZA 3HYTA 1NVGA 4CG1A 4R1PA 1SBTA 5B30A 4D26A 5EQJB 1F1BA 3F7TA 3IQGX 1GP2A 3MWDA 4X3PA 1OXKB 4CV1A 3HJFA 3DXZA 3TM5A 4PZCA 1KDZA 4DDHA 4BDSA 4JXJA 3EAFA 4NZ9A 1QIEA 4Z9AA 3STUA 3T9FA 3HP1A 4HEA1 5JI3E 2PO7A 3OIDA 2XQIA 4P7GA 4C5CA 6YASA 4IKEA 3EGDA 5BSKA 2PYDA 4PCVA 4KYVA 1XYGA 2LR0A 1ESEA 3T5TA 3DR3A 4M9XA 2JATA 4UVHA 4DARA 4F38A 1P7YA 2IT1A 4NYMQ 1TKBA 1LNQA 4YWJA 1DEOA 2VDKB 4QHYA 4FUTA 5CDHA 1Z62A 2H1LA 2ZB3A 3BFVA 3EZGA 4EZEA 4ZJPA 4JJAA 1KVRA 5KYXB 1MABB 3QWBA 1IB6A 2PSSA 2Y0EA 3HI6A 4ZQCB 1L4GA 5FL7D 3U40A 4XH9B 5TS2A 1DPFA 5CVEA 5ICMA 4AAYA 1X2EA 3D4BA 1P18A 1KNQA 3TI9A 3DBHB 3UOGA 3S8MA 3ZXSA 1LQ2A 1P33A 3WL8A 3FPFA 5DP1A 2WI8A 4QL3A 1ZIXA 1UAGA 1JWLA 4N47A 4NULA 3N53A 5AJXA 5GONB 4DPKA 4JLWA 4I2NA 5LB4A 4AP6A 2WNHA 1WMAA 2XE7A 4P9NA 2AN4A 2I7CA 1N1MA 4EF5A 1RC0A 4PLPA 4CQNA 1VE1A 4LEIA 2QD5A 2WVGA 5FJIA 1JH9A 4FC7A 4IS3A 3S2GA 2C58A 2IZ5A 5A5GA 2CNNA 5D2CA 3HN2A 4ZDWA 2G4VA 1QHEA 2X77A 3TTVA 4OGGA 4C7VA 2CJYA 4TMTA 4WBSA 1EFHA 1VKOA 1WKCA 2P79A 4Z9FA 1FDSA 4ZP1A 5E9WA 1EFRD 2ZJ5A 3B70A 3QITA 4MK4A 4RK6A 4TKZA 5J2TB 1SCNE 4TSFA 5JSZB 1PG0A 4GWLA 5I7OA 3C6YA 3PDWA 1GPLA 4KXVA 4MRNA 4UD6A 1CY1A 5D3MB 2VJLA 3NKLA 4TVKA 4EQ6A 1R64A 4ETMA 5CT5A 4J6FA 3FE2A 5IVIA 2W37A 1Y37A 1COZA 5LC1A 3F8WA 2XMSA 2ZIAA 2M6RA 1QMGA 4X8MA 5M3BA 3OY7A 3RVSA 1DMRA 5ALLA 1C4XA 1QBGA 1MN6A 3A1TA 3Q3IA 5K3AA 3VPGA 4XGQA 5JTTA 1FS5A 3JQAD 4JLAA 1HDIA 3ENVA 1WXIA 1LU9A 2EJTA 2GAIA 3E61A 4AICA 1DRKA 4R31A 4Y1RB 4TUYB 1T1IA 2XKBA 3C7AA 4JSYA 2X4LA 3LPCA 5JFTA 2ZAGA 2P7IA 3AZOA 2XMGA 4V0OA 5D85A 2IU0A 3W1EA 3IP1A 1FMLA 2QR3A 4MVJD 2F64A 5GGYA 5DGCA 4R84A 4TRJA 4MRMB 3M6UA 1GGHA 3EYAA 5EVJA 2Q21A 1PKEA 1TRKA 3N87A 2DBRA 4KP7A 1Q1BA 6CHYA 1T5IA 3KOWA 3F5MA 3SJCA 4DSTA 1OI2A 4FYKA 1TYAE 1G8GA 1ZCZA 4U2BA 2I3DA 3IVCA 4L5BA 3T1QA 3A2MA 1WZUA 3IVRA 1TE2A 3P0RA 4FZVA 4MAMA 3S2IA 3HBFA 2WIJA 2B34A 3ZD9A 1Z5GA 3C6BA 4JIMA 4YN3A 2WFLB 1RHKA 2R6CA 4HGZA 4ON9A 1CZRA 1NM5A 1P7CA 4UTXA 4XIJA 2QSYA 5K8CA 1Z83A 4WAUA 3M9LA 2OB1A 2HNBA 2Q6LA 1U9IA 2H1VA 1J56A 3AOEA 3EWNA 4FNAA 4HN2A 4M1OA 4RKEA 4XI9A 4YQFA 3EH2A 5I47A 4LZJA 2GD0A 2NWQA 1UKVY 2W8ZA 2MOKA 3KSDO 3F71A 2BV3A 3WIUA 3CS3A 2H3EA 3FOFC 4UFOA 1V9LA 1V95A 1NMXA 4G2NA 2CJWB 5F7OA 1L4EA 4UCFA 4RPCA 3K5WA 3K2QA 2ZWIA 2R6JA 2CWWA 3PFFA 5C37A 1UBHS 2D1TA 3OKFA 2C9BA 5CTAA 3TCNA 1SA0B 3P4XA 2RIPA 4ZT5A 5AUQA 1FVXA 1X6VA 2JLRA 1FC0A 5KJCA 2HLHA 3UMGA 1LDGA 1UEIA 3ESXA 4JNCA 4CLXA 3UTDA 1O03A 4JR0A 4WQMA 5EZ6B 1A5TA 2GASA 2ZM6B 2B36A 4KODA 4AIIA 3VU1A 4TYQA 2C1ZA 1XYVA 4D0GA 3LWDA 1CG6A 1GRNA 2TMDA 4KXQA 4AZ3B 1GQQA 1RYDA 3L0DA 2QU8A 1BNCA 3PR2B 1WBBA 3AV3A 3TTTA 2WQ6A 2G76A 3HY4A 3BKWA 3JWJA 2ZJ1A 4FSHA 1SCQA 5MHTA 2REOA 3BH6A 4ZQBA 4EYEA 4KUHA 4GM4A 3HB9A 1X8XA 1C9JA 2V0NA 3QKTA 1PVDA 2ANCA 3A2NA 3FETA 2F8TA 1RLJA 3DL7A 3VU8A 5LOVA 3IULA 1XMJA 2QWXA 2VHEA 4WOPA 5CB4F 3FPBA 1NQ5A 2CVZA 3MERA 2ZI5A 1L7PA 3DLAA 2XQFA 3RVJA 2Z3WA 1SVOA 3AF1A 4PYOA 5EP2A 2C2HA 1EBBA 1G0OA 2FPLA 2GARA 4G4JA 1E2IA 4Q18A 4FJ2A 4CEJB 4RYLA 1HQKA 221PA 4OQPA 3SU8A 3LXXA 3LUDA 2H11A 1IQRA 2JI6A 1I0ZA 4JDPA 3ZCXA 1FJ2A 1XTJA 3FF1A 2P1DA 2G4LA 2BF4A 2IEAA 4DBLC 1W5AA 3EGIA 4MQBA 3X1DA 3QYJA 5A05A 1YULA 1E63A 3LVQE 5DO9A 3OLVA 1PT5A 2FCAA 4QO8A 3U49A 4Q7LA 3BIWA 3K05A 3N8KA 5FBQB 1ZY2A 3R3VA 1Y7TA 2CVOA 2FKNA 3QY9A 4X8OA 1IAQA 3CVVA 1JFTA 3ZGZA 2J3LA 1PW5A 3WNCA 1O8BA 4ESHA 2YS7A 1E3QA 1HY3A 5LNK6 2VWGA 1TYBE 4ZXPA 4FBMA 3MUFA 1KJZA 1VL0A 3CM0A 3OOEA 3LLSA 2BFDA 4DE5A 2E49A 2GA8A 1V96A 1V8FA 1L7MA 2ROQA 1PS0A 4HAUA 2Q4TA 3PGLA 4O8ZA 4Y2JA 4YNBA 2QROA 5DP2A 3DFMA 3EF0A 4I50F 1XRSB 1XRNA 4E46A 4B81A 1KZ4A 3PRYA 1I4EB 2JLAA 3IKJA 1DG9A 2WW8A 1Y7IA 4DW8A 1PEYA 2D0PB 2E1RA 1OT5A 1KMHB 3D0RA 1GGEA 4L3VA 2HCBA 3VV2A 2IUSA 4EYKA 4BJ1A 2C0CA 3KYIB 2I55A 1YQQA 1QR2A 4GXQA 3ZWDA 1A4UA 1U0LA 3Q8LA 1EGMB 3QQPA 3EG9A 2ZSIA 3GK3A 1E60A 1I5OA 3CO0S 4ZGBA 4X60A 2W2KB 1KF0A 1TTQB 1K6IA 3HADA 3GU3A 4XLTA 3C8UA 1TTPB 1L4HA 3B5EA 4Z8XA 4RTKA 4FKMA 1UMDB 1ZRSA 2W6PA 3WV5A 3E05A 3LBAA 4TYNA 1SULA 1UOQA 3H9BA 5TPWA 1ZM4A 1GQRA 1PEAA 3CG4A 1RBQA 4IWNA 3TL2A 3PC2A 4XKJA 4ZPXA 1JKMA 4BNNA 6PFKA 3B5IA 1OH8A 4FTWA 1EP2B 2FPPA 2BHSA 4ISBA 2FUEA 1ONBA 4UNIA 4ZAYA 3MT0A 1OH5A 4JJ8A 1FFDA 4HYTA 1XP5A 2X9NA 4U63A 3IUQA 4K6OA 3VZSA 4DN6A 4DC1A 3GQBA 3K15A 4B7UA 1W2HA 1BWSA 5AXDA 3CZ9A 1AMNA 4V0MA 3DKKA 3ADPA 3TEMA 5D00A 1UP6A 1NUSA 1HL7A 1ULHA 2HA4A 2XE6A 4ARZB 2PSJA 4WY2A 4ERNA 1IY9A 1P2FA 1XZDA 4MA5A 3L2OB 4NV0A 4XGNA 4EW2A 3VJKA 1EGVB 5K6RA 3BDVA 1MOSA 1EG7A 2X7XA 4CNBA 3C3XA 4RD1A 5IAJA 3NOOA 1G6OA 2IKSA 2MSDB 2A0FA 1V16A 1BVUA 1RQXA 3KJQA 3MOGA 2YWXA 1VLHA 3NOQA 2C31A 2C9ZA 2EHDA 5C7YA 2JGDB 4CKBB 5B2FA 2BHRA 4CE6A 2VUUA 3WYDA 3ZHUA 3OBIA 2C7QA 1P0IA 5F78A 1JHQA 2ERYA 3UB4A 5DLEA 1Y4AE 3ZDAA 3V3TA 1LLQA 3CZ5A 5CJJA 1DX4A 2C57A 2YWBA 1UPUA 3UMBA 4BIIA 2B82A 5FWAA 5LDHA 1NP3A 1M2WA 3D5TA 3OZBA 4XFDA 3K0CA 1EUCB 2E9SA 2N1BA 3CT6A 4K8OA 4MW4A 4PX2A 4M0DA 1F8YA 1E5LA 3ACBA 1GNSA 2HJSA 3MRXA 4PC2A 4L8GA 2PSEA 1CRLA 4EFNA 1PDOA 1NULA 2QDXA 3FJ1A 4UOEA 3SWWA 1F1JA 4P4SA 5LLDA 2QD4A 1QC5B 4MKHA 5J5VA 3GA7A 4KUEA 3WK9A 3NOVA 3EIEA 4MQLA 2IUYA 1CUSA 3I58A 5EFZA 4CUJA 2FEAA 1V1JA 2O2SA 4I6GA 3KV3O 3IMKA 4MWCA 4J1TC 5J4LA 3JYOA 2X5JO 4CNQA 1D2CA 4KEAA 5IKMA 2FH5B 2O2HA 3P9IA 5EGSA 2IA5A 1JH8A 4M0CA 3SF8B 3OZAA 3X2FA 5BV8A 5F2EA 3CTMA 3G2IA 5EJIA 1SKBA 2BEVB 4MUMA 2WWWA 4WWHA 5THKA 3S1AA 3N75A 4ZVTA 1SEPA 5LN1A 1Z8NA 2OQ2A 4XTCS 1J2EA 4IF6A 3WWYA 1KGSA 3GAMA 1AGXA 1P2VA 3OVMA 3M4NA 1JLSA 4OMFG 4ALLA 3M3DA 2P5YA 3U7IA 4CHGA 5TEVA 2IEDA 5AH0A 4G1VA 2VSOA 5KVQA 1X7XA 1W29A 1J0XO 1AUOA 2F1KA 3I76A 4HGOA 2Y1LA 4P0TA 3C3JA 4B5LA 1LSOA 3I72A 3PDIA 3C3PA 5KNDH 1C4OA 2NU7B 3R24A 5F3DA 1X1RA 2MSCB 1SZCA 3W77A 4NC9A 2QR5A 5LA6A 3UO8B 5DCUA 3DS8A 5DBFA 2LDBA 4U0KA 3U3MA 5BN4A 1WZNA 1SUFA 5LKRA 2Z4TA 1II9A 2DPLA 5TNXA 3REQB 5K0FA 4AF7A 5BYBA 1SVWA 1YDWA 4JU9A 4P2GA 1N1DA 4OFWA 4B3RB 5TMDA 4AQYB 2FWMX 3SGLA 4HDAA 2ZBVA 1QE3A 1X92A 1ZVQA 4M0FA 3AUKA 4S1WA 5K03A 1F9EA 4MW9A 4ZQEA 1RI5A 2I99A 3KVNA 2FTKE 2TSYB 4E2FA 2JGEA 2EX1A 4J2OA 2V7PA 4IKPA 5K0BA 4HP8A 3E9DA 1V47A 1V4BA 1W52X 3M6IA 5JVDA 4KSBA 4RHYA 2OGTA 3K32A 3RUEA 4LJ9A 1Z82A 5JAMA 1OREA 2JBAA 3H3XA 4YDQA 2VPPA 3WJ1A 2FZCA 2HQOA 2BFCA 1TNDA 4E0BA 3F6SA 3RIGA 2KBFA 3K5PA 1XVLA 1OFVA 4QREA 3PWTA 4LNUB 4NBSA 3IILA 1YE5A 2WRZA 2J9YB 3GR6A 1H6BA 4O5OA 3EFOB 2H51A 3MJSA 4LRTB 3NJ8A 5JRZA 2RK4A 1I7SB 1F2DA 2GM5A 4FR2A 2AT1A 4NFSA 2PCJA 1KQFA 2II6A 1ZI6A 2V6FA 2V9PA 3VOSA 3J80A 2Z9CA 3RVLA 3HVKA 4OK5A 1OASA 4I2VA 5TB5A 4HNGA 4PHTA 2CY0A 2FVYA 3AL3A 5AUOB 5AW4A 3WQHA 5DLYA 5LPNA 2XMRA 3MK31 3V55A 5LYJB 3CVXA 1EFRA 1CYEA 1F2UA 3AUJB 2HJVA 2ZU0C 3IOMA 3LUHA 3DL2A 2BBTA 2IYQA 4J29A 3B60A 3UAYA 2HMAA 4Z3KA 1O4VA 3GOQA 1N0WA 1YBAA 3WK7A 4A6PA 1PR2A 1SH7A 3R9WA 3X2EA 2XLCA 4F71A 4RYDA 1N2JA 2GK4A 2IZOA 4OKNA 4U39A 3AEKB 3BWDD 3Q1LA 3QE4A 1AY0A 3W5VA 4W5WA 3W8NA 3RC7A 4D5EA 1TU3A 3WP0A 2QYTA 3V8MA 4QZVA 2EP7A 1XL0A 3KLOA 4JK3A 3AEUB 4OGFA 1C41A 1UPAA 3UUWA 1CKEA 3OM9A 1UANA 2I2CA 3KJHA 2XOEA 4QHSA 4IOJA 3ST7A 2ZTLA 2HY7A 1VXOA 1YMQA 1P9LA 4S35A 5KQMA 4LDPA 3AJ9A 3BFPA 4JYPA 3FWPA 1I4OA 3WFIA 4X85A 2CB0A 3MS4A 1FMCA 2PRJA 4L9RA 4GLJA 1CUCA 3SX0A 4CMHA 1CY8A 1PBTA 2XRZA 2AOTB 3T3IA 1R9JA 1MEOA 5F21A 1XJ5A 3KUXA 4B3DA 1ZVVA 5J2UB 3ZK7A 4DDKA 2PTHA 1ODLA 3RS5A 5ALJA 3LYHA 3PXXA 5I9LA 2REQA 4JWTA 1CY0A 2AFHA 2AW5A 4OH7A 5EJFA 1FJXA 1NI4B 2OENG 3G59A 4MDYA 3KUDA 6ADHA 1S9HA 5CVCA 3DR5A 3EYWA 3IAM6 3ICWA 4UE2A 2EGHA 1A97A 4BJHB 3EHEA 2ZIZA 5LQDA 5EP3A 5E9AA 4M1TA 1QGUB 3BD9A 1Y4DE 5FD8A 1L5HA 1E92A 1QUEA 1A9RA 1G18A 3LC7O 3NHKA 1M54A 2CNLA 2YQ4A 3OQNA 3D6MA 1WWKA 1C9NA 2IK8A 4Q15A 1GPUA 4GE3A 3NYIA 1FPQA 4OHCA 4P3PA 4TWBA 4TT3D 1OA0A 2X0DA 5A2GA 4UU7A 5K0CA 1C8KA 2J9FA 1NQOA 3BD7A 4PLZA 3L8YA 4AJOA 5IF9A 1LPAB 4HEQA 2GEDA 4UBLA 2X5NA 2ZSKA 2L0XA 2WB2A 3OTQA 3ROTA 4OI0A 3OSZA 3EY4A 3TYXA 3V46A 5TR9A 2EQ5A 3O2JA 2F4NA 3MXTA 2QTGA 4HAYA 5EWJB 1T9KA 5TSDA 1V3QE 5IFKA 4XQEA 4ZO4A 2D06A 3PFIA 1LJ8A 1ISMA 3CR8A 4NMWA 2C99A 2JJYA 2YYZA 2P3OA 4MUAA 3BZBA 3VHXB 3ZQUA 4AMZA 1AQNA 4TQGA 4IDFA 1ABBA 1HQCA 2XE4A 2QAGA 1Z8FA 5DNCA 2GHIA 3WC4A 3PD0A 5ES4B 3WWOA 3CVYA 4PGGA 1SC4A 1UPFA 2CD7A 1H2ZA 4E4RA 1GQFA 1MRNA 2P9YA 2NN3C 3IAEA 2ILVA 3SR4A 2FRXA 2JPDA 4M0UA 1U9YA 4EABA 9ATCA 3TOSA 3LRTA 1QM5A 1T29A 3TL3A 1J33A 3JAWA 3RBXA 4EOGA 1YV9A 3FTCA 2CLSA 3F4LA 2JAXA 1SBIA 5CXUA 1UK6A 1N8NA 4GZMA 5ALZA 5E6SB 4C0QC 2CXTA 3MIZA 3V9AA 1WU8A 1UOPA 1QDLB 3MTQA 1VE6A 1MENA 4DIMA 2GK6A 1P61B 1OFHA 2O2EA 3PNQA 4UU0A 5DM2A 3CCCA 5IW8A 5KTSA 4UVIA 4EB8A 4QDXA 3CPHA 4LC9A 2YW2A 4FGUA 3NTOA 4OK6A 3LDHA 3SS7X 3FCUB 1ISRA 3PNVA 4KO1S 4V39A 2RB4A 1AJEA 4QOIA 2WFMA 2XHEA 1TB4A 3PWKA 4JEUA 1AS2A 5P21A 3D3WB 1UXJA 3A6DA 4IUCS 4NONA 4BLWA 4D99A 1ABEA 2GAAA 2XTMA 3AR7A 4FJ0A 3SS9X 5HOQA 2A86A 2AK3A 1AK9A 1W88B 3ABRB 3N6RA 4GMXA 1U8EA 4M83A 3TD6A 2SHKA 1WXDA 5H9VA 1FSFA 4X8LA 4K6GA 1G6Q1 5JPIA 2OCPA 5U1PA 3BB4A 3WIVA 1ZNYA 3R7LA 3UK1A 8OHMA 3VV3A 1U28C 4UTNA 3QP9A 4MV4A 2Q0XA 4H4EA 4OHXA 1VRWA 5HS6A 1ZN8A 2UVPA 4JR2A 4M89A 4IWYA 3V7WA 4LF6B 4MCAA 3QPUA 5EINA 4E1BA 3NUZA 4A8PA 2OQRA 4R5MA 4DMCA 3UAXA 3F7OA 4F93B 1Z6TA 2VK4A 2FOXA 5EKUA 4HS9A 4CBVA 3D6NB 1XNGA 3ZGXA 5LMCA 4AKHA 1RQRA 1XRPA 2NV2B 2ZRQA 3LPDA 3Q7SA 2CXSA 5KTNA 1KJJA 2MWMA 3DQZA 3D3KA 3FVRA 3I1YA 1JWAB 1JEQA 1P91A 3F3SA 1DBWA 2BP7A 4PLTA 1G59A 2ZJ4A 1XTUA 4LOHA 3KKQA 3RYIA 4KK4A 1GDDA 1DMSA 1XZBA 4TLEA 4CTJA 2GJ8A 1PRYA 3TZLA 5IKEA 1IK6A 1XV5A 1QRRA 3DP7A 3T06B 3L9XA 2VHUA 4CV3A 2PV7A 3FWYA 2P4QA 3JWIA 4M36A 3UB3A 1MF7A 1VHJA 3HKEB 4LQCA 1Y48E 4G5HA 3T3OA 1P1BA 4MCJA 5UKDA 4ZI2A 2UXCB 2GN2A 3DJYA 1Q0TA 1IMOA 1KEWA 4UDYX 3CZMA 4K5QA 2GAOA 4XPZA 3EGXB 1DG1G 1ZZEA 2ZRPA 2DWOA 4Y2QA 1SPBS 1ZH4A 1JHZA 2PFKA 1ZESA 4FMPA 1Z2CA 2NX2A 1QKJA 1FFXB 2FWRA 2VYNA 3KD2A 2OO7A 3KUUA 3P2EA 4KXMA 1Z4KA 3VO9A 3TPFA 5FUQA 4NU0A 1JILA 2DHEA 4Q03A 3J81k 5K1ZA 3AESA 1C3OB 2F43B 2Y6VA 3SSNA 4J91A 4CM7A 1NVKA 5HKLA 2UVDA 1TD9A 2IYNA 3KSMA 1QDUA 2CXPA 4ARAA 3U17A 5K4HA 4NECA 1K7EB 5CB6A 3ZV4A 1NF9A 1V5GA 4GD3Q 4NNJA 3ASVA 3QMWA 4PHHA 1O0BA 2XAAA 1M7HA 1M2EA 2HMWA 4NS4A 4E2WA 1PX2A 2BFPA 1UT8A 1JPUA 1KU6A 3EQ6A 2CXNA 1U0RA 1OYWA 1RHQA 2VNJA 3PWZA 4CI0B 1TPYA 2VJKA 5DYYA 3KR0A 3KVVA 2ZRLA 3OT4A 4V38A 5L6LB 1IXSB 3PC7A 4URYR 4B82A 1E6KA 5JRDS 3AI2A 5EN4A 1N25A 4W8GA 3U7GA 4H3KB 3FKQA 3SIXA 3GRAA 2GSWA 3COJA 1X19A 3GCZA 2AV6A 4XVCA 4MVYA 5B58C 3PE6A 2FP3A 2DM6A 2C7GA 2R1VB 2O3JA 3I0MA 3LTEA 1Q1GA 2OCIA 1T9DA 3A9UA 1IN8A 2OV1A 4D9EA 4DIEA 4E5PA 1HOXA 4W5QA 3G13A 3P7MA 1YI1A 3T15A 2YJZA 2JGFA 5EZSA 4DUGA 2JZOA 1RWXA 1OOEA 5JCXA 5G4KB 3A1VA 4RHCA 4QXMA 2A0KA 2XIJA 1PFKA 1GAWA 2W0SA 1N2OA 1RYEA 1SU8A 3B52X 2YN0A 5HF8A 1RFLA 3FD8A 1CQJB 1QZ3A 4NYJR 3JVVA 3O2QB 5JWHA 1VRVA 2WAYA 4I6JA 3IEIA 1XU9A 1TAGA 3A37A 1N2CA 1FOEB 1L3BA 3ZY4A 5CAEB 3AEQA 4C5AA 2J48A 1VIYA 2XJ9A 1UFRA 3E9MA 4MB2A 5ITZA 2YHUA 1ZMXA 3QA9A 2J3QA 3KKNA 1IN7A 1J6UA 2GVZC 1BCSB 4HGYA 2BEUA 1MNQA 3RBZA 4H2DA 3DEFA 4QPZA 5HK9A 3RFFA 1A72A 2A14A 3D0KA 1T8TA 5JJBA 4BMDA 3S6JA 1F17A 2QPLA 5ECWA 3C98A 1JP7A 5I8PA 4YV0A 2QVXX 1GTG1 1WCIA 2WWGA 1REQA 3QYFA 4F3YA 1IOWA 5JAQA 5E4TA 1KP2A 2EKZA 3BE8A 3QX9A 1AKWA 3DCNA 3K1JA 3KYBA 4YRKA 5ULLA 2EFEB 3FFWA 4FU0A 5IWCA 4BCBA 1HDOA 2I4OA 5DNVA 1WQ3A 4ZCQA 3TPZA 5ALNA 1B15A 3FFBA 1QZUA 1GO2A 1GZ7A 3N7UA 1Z25A 4FE3A 4MQ6A 1GTVA 4P7BA 3ZG6A 2PXHA 4C0BA 3TW0A 4E5KA 3DQPA 2OHVA 4F1JA 3DWFA 4FI3F 4NRDA 1YA8A 4NFHA 3WLNA 5L7TA 1MJGM 2OHXA 2D5AA 3KEGA 3W8DA 1E4YA 3KPUA 4XX1A 4H7IA 3SXUA 1CJTC 3A4TA 4MPPA 2AUNA 1FRNA 4P1ZA 3N2ZB 1Z29A 2ZYAA 3FUTA 3T8YA 3BL8A 3EMVA 4KMOA 2B94A 2EFJA 2GX6A 3NHFA 5DK6A 4EDHA 1F5NA 3VR3A 5DN6D 5LP6B 1XPRA 1LFDB 5IEBA 2Y99A 3PIIA 3U4AA 4RLFA 3RLFA 4WZAB 3E9ZA 4EKYA 1XCMA 4DR3B 5IUNC 1XQVA 4IV0A 5JASA 2XDQA 2XOKA 5JANA 2DG2A 5F1OA 1GRQA 1GAXA 3ZKAA 1DX6A 2GN4A 2KX7A 3GJ8A 2R8RA 3PEYA 4W5TA 3U3XA 5KS2A 4JCCA 5JEDA 2N42A 3ZQJA 2TMKA 1NVUQ 2IEIA 1L3CA 1KKLA 1RLUA 4E2YA 4R40A 5HOEA 4I1PA 1K3TA 2ZIUB 4EY4A 2IYRA 2OEPA 2C5LA 4KREA 2WIFA 1OFTA 3MHPA 4CLOB 1X3LA 1NU8A 2WD9A 6NULA 4C30A 3MGKA 1Y9AA 5D7NA 3WZLA 1GT91 1V8DA 3JATA 3ZZNA 3B9BA 4KXLA 5LP6C 4ZHQB 2ZJBA 1JDBB 2BMAA 2C2ZA 4IG4A 5FHQA 5AW9A 5C7IO 4UTOA 3L6BA 5BWBA 4JX9A 2HM7A 1X8LA 5JQGA 3F6EX 1AE1A 2CXOA 2CUTA 4Q9JA 9MHTA 2YXDA 2BGUA 3SFTA 1ID8A 3MWDB 2OCYC 5FOUA 3H84A 1CR0A 2CYBA 4EZIA 2Q6KA 3V34A 2C2GA 2OC9A 2QS9A 2WHXA 3JSXA 3OUZA 1G20E 4LXUA 4PPGA 1WS6A 2HO4A 5DFAA 4FB5A 1FDTA 1XZKA 1ZXXA 2J9ZB 1MEEA 2GCIA 2NTVA 2ZAYA 1HNWB 4LVUA 3K9QO 3WGNA 3IEKA 3EGDB 3ZOZA 2YHSA 1QF6A 2RGYA 1V35A 3EEFA 4CLRB 3RSQA 3AUSA 5K01A 1KRXA 2PRZA 1MDBA 1X2BA 1Z3CA 4QQRA 2FZGA 16PKA 1KJQA 4FX5A 4WOJA 1N6IA 3NWPA 4ZGWA 2B8JA 3R5TA 1MHTA 1O9HA 5DHQA 4HC4A 2DOKA 1GUAA 3VU9A 5BN5A 5CCEA 2EJUA 1Z0SA 2DECA 3K7EA 4DABA 4EG7A 3HXQA 1ATIA 2RH4A 3JD4A 3IDSA 2B8TA 2W22A 3QPWA 3UYLA 1I24A 4OGLA 1AZLA 1OFGA 4MR7A 1VGVA 1B2LA 1JDBC 4TGLA 1GPMA 1YUBA 2OBFA 1E7YA 1YE8A 3HR7A 4GC5A 4C4SA 4EGJA 2GPYA 1M2OA 1XDDA 3KBOA 4ASUD 8MHTA 2VSXA 2GNPA 4MA0A 1BO6A 4TMWA 1MXFA 1I13A 2ZJZA 4IFBA 5C1PA 2Y8EA 4QU8A 3M6XA 4OHWA 1DLIA 1Q1ZA 1Z4PX 2QN9A 4HLQB 5JMTA 1P1FA 1HNZB 4FFOA 4R6WA 4F8EA 1Z2DA 2C2MA 1JQ5A 1NV8A 3IQFA 1JF8A 3B78A 4MUEA 5DM1A 1IUKA 4MVJI 4RTMA 5HZMA 2HL6A 5T5QA 4J6EA 1TMGE 2WT4A 2YJTD 2G07A 2LXNA 3MRVA 3EW9A 1OVMA 1UZLA 1ZK3A 1Y9ZA 4IIHA 1QNFA 1U1EA 4QRIA 1KI1A 3MM4A 3QWIA 3MVEA 2AF4C 1GGVA 1HEYA 2ECKA 2AKEA 1O57A 3PS9A 2ZRDA 4EQ6B 3WBKA 4PSAA 4DMKA 1GZSA 2VYVA 1SOWA 3QV1A 2PZBA 5H4HA 1DC3A 1O54A 1F06A 1KE1A 3Q7TA 3DM5A 4ZEVA 2A78A 4GOMD 2EIHA 3EVBA 3WJ2A 1VECA 4IILA 3TXYA 4PIPA 1HURA 4UUMA 3BS4A 5GINE 4G9EA 4CLDA 1FP4A 1T6XA 4AF6A 4EQZA 4RNDB 4MW1A 2JCSA 2Q3DA 3ODGA 5KHAA 5LQNA 3LK6A 4W4TA 3L8FA 1B1AA 2QX4A 2QVCA 3JAMA 2QY6A 4RVSA 4H6XA 1IM2A 2OO5A 4QUIA 3C87A 2FEWB 4QQFA 4R16A 2QQGA 4HQRA 2IYSA 5DDIP 3ZZTA 2KS6A 3H8JA 4TT3A 3SP1A 6REQB 5KYUB 4X20A 4JKIA 3FZGA 4JA0A 4O08A 3DDHA 3L77A 5TDHA 5KNDD 2PKQO 1G64A 4F4CA 2Z6VA 2KPOA 4S3MA 1M34E 2B4AA 4G0YA 4INZA 4HUTA 5TT1A 5IK2D 3LT1A 1HMYA 2HSEA 4LWOA 3PSHA 4N49A 4CTMA 4CF6A 4BASA 3IE1A 5KJ1A 1ZHOA 3A9VA 2WEKA 4LGCA 1Q50A 3Q3CA 4JL6A 1MX9A 1EA5A 2D7CA 1JPJA 3ESYA 3M81A 3OCXA 3TNYA 3AEXA 1S3FA 2HCTA 4RF5A 3NALA 4H15A 3THRA 2VEOA 1B26A 4PYLA 4DKJA 3LIIA 1VPWA 1N0IA 3L8DA 2SCUB 5FEUA 2HN9A 1LC0A 2CF5A 2HB6A 1JLLA 2HYDA 4KX5A 4ND8B 4FCVA 1O95D 4EG8A 4R9VA 2WT9A 1TZ2A 1ZJZA 2GF2A 2Y76A 3PF8A 3PKZA 3CNQS 3H65A 3T9AA 2VPQA 3WLJA 2A1TS 4TVSA 1SURA 3KZNA 1MGPA 4GMKA 3MTIA 3MJTA 1HDYA 3PNMA 2O8BA 1U6JA 2O8FA 2J33A 2Q9UA 3CZQA 4WCFA 4IV8A 2CD9A 1P4HA 3IQIX 1UBUS 1ZHHA 5T41A 4V0KA 4WJLA 2CZQA 3FHTA 2NXWA 4YRCA 2FR1A 5C8XA 1W34A 3HM2A 3KC2A 2DFTA 4HGRA 4J03A 3NC1C 1E0JA 1GPH1 3DMRA 4FYXA 3L04A 4E21A 1E66A 1GITA 1AIPA 2JB9A 3UH1A 1C30A 4NCIA 3K0HA 3R7SA 1NMZA 3H7IA 2KLHA 4HDKA 1K9SA 5T8KA 1P45A 1RYNA 3JZAA 3OWXA 4WINA 3NM6B 4DNQA 3SK0A 1Z35A 1W4BA 1P7ZA 1XDBA 1NM5C 2Q2VA 3FCOA 3LLUA 4RZIA 4DM3A 5A02A 5FOXA 1FK8A 1YRBA 4XRRA 5JS1A 2WWTA 3MTDA 1XHEA 2QN2A 3OWHA 3AOEC 1U9IC 4UBIA 5BSHA 2WAAA 3S28A 3MTAA 3EFEA 3EVGA 1G98A 2C5GA 5EPUA 1WBJB 5JFOA 2AEFA 3KKPA 2JGIA 1HGXA 1VE3A 3AILA 1G5HA 1RKVA 3DV2A 3AONB 5DH9A 5COQA 3F2IA 2H2HA 3NTQA 4CM5A 4C0JA 5KSZA 2XZLA 3PEFA 1V43A 2E4XA 3OMXA 4LE1A 4GLLA 1DP4A 1RYBA 1SOVA 4DMGA 4RGBA 3MYYA 1Z7YA 2R96A 5HRAA 3KQWA 2PWYA 4JC8A 5AJYA 3W9UA 3EQZA 2GHQA 1W47A 2IEZA 4EVIA 2O7VA 3V8VA 4U1RA 4C2TA 5AT1A 1G0NA 1C50A 2LPMA 5DI9A 1G42A 1QF7A 2VDMB 1UDXA 2H07A 5CLHA 3HJCA 4MKZA 3NAGA 1BOFA 1RM5A 1X1AA 1ZL0A 1NF3A 2DUWA 2FN3A 5JZSA 1Y89A 4IIJF 4BL5A 5C1OA 3FWKA 2C92A 1ZUNA 3RIEA 4ALJA 2OYCA 4B7XA 2QI9F 2WM3A 1HDCA 3WDMA 1XAJA 2QG4A 4MUHA 1ID1A 3GNSA 5E1OA 4Y2GA 2AVNA 1KOGA 3T7IA 1NHWA 4RQBA 1V9SA 2CVPA 4YREA 2MTBA 1C1DA 1XDSA 4BQNA 1RRMA 2O7RA 1QAQA 2B78A 5A6SA 2PN1A 3U7RA 2YWCA 3AYZB 1N78A 1P2GA 1NKTA 1R8YA 2WJ3A 4S2UA 1OU4A 4N48A 2BFDB 3COZA 2OVBA 1H93A 5AW5A 2MHCA 3DO5A 1JHRA 1JU4A 4GH5A 4GGOA 4NCKA 2BTEA 3ZTYA 1HT3A 1XU4A 1OYOA 5CX1A 3LQ2A 3N8IA 4G07A 1HG0A 5DN9A 2BZGA 5K3DA 2GJSA 2ZLBA 3FNFA 3VQTA 4BMNA 3CX7A 4I8XA 1CUGA 5FI0B 2IS2A 3UENA 3AR4A 4OOEA 4R81A 3BCHA 3PUIA 2FJ0A 4HK4A 1CPYA 2R5FA 2Z8XA 1G20A 4Q3CA 1T1SA 2I6UA 5I01A 3H3JA 2C4MA 2H5IA 2ZYGA 3EG9B 1Q0RA 1T9GR 5DX1A 2H2DA 5K8LA 4K9NA 3HJNA 1ZD4A 1V8OA 3PUZA 2D54A 3A6PC 1E69A 5K0JA 1BROA 3L7MA 1UJ2A 4UTVA 5KTPA 1A2BA 2BFMA 4HD8A 3RJ9A 4ZAWA 2EKLA 3RJMA 3NWBA 4BAZA 3PPVA 3OOYA 2HF7A 4B48A 3TECE 2ZYTX 1M6NA 4WN9A 5TPWB 4CJXA 3ORYA 4QYXA 4BWYA 1KP3A 2YFQA 5K9ZA 1ZD8A 3OZDA 5CFQA 4ZCMA 2CV1A 4CGZA 3QY0A 4O4JA 4B3CA 1OQAA 1VL1A 1VSUA 3JVIA 4P3OA 1KERA 4O4IA 1KHHA 1VTKA 4XRGA 1UP4A 2FPPB 4BX3A 3U4MA 5BW5A 4LC0A 5B58T 4BKRA 3CHYA 5EJ6A 4OXNA 4PYQA 5FB3A 4M3NA 1EX6A 3HEMA 4M8SA 2UYQA 7AT1A 2Y68A 2Z8YM 1A8IA 5IT0A 1U2DC 1SXJA 3FOWA 5D3KA 2H9IA 5HDBB 4X65B 2J4CA 4JV5B 5EESA 1T6ZA 2ZJOA 4DHWA 1SHUX 2FWBA 4C7XA 2ET6A 2WE8A 4X24A 3QUQA 2HHCA 1ORIA 5ESWA 2VYFA 1EWYA 1U80A 3KKZA 2I4NA 3BERA 1N1GA 3EF1A 3HSYA 3BEDA 1D04A 2R68A 1TAHA 1WXEA 5M29A 5BUQA 1JSLA 1M2VA 2XYPA 3ZCSA 5IBCA 5LIPA 4QYMA 1GN8A 1FDUA 1V16B 1KIMA 2C03A 3ETEA 4FZRA 4GXTA 4EITA 2DX7A 1P77A 1HQDA 1RHRA 2IY7A 1OB5A 2PT7A 1UC5B 3DEKA 1CC1S 3LVBA 1C7IA 2R79A 3E3OA 4PN7A 1XX6A 4RD0A 3GUUA 1H2XA 2HA3A 3VTFA 3DB1A 2WKWA 5C3UA 5AHWA 4YP7A 1CRZA 3BJMA 5TVKA 3L92A 4Z7NB 1RR6A 2ODQA 5JZOA 4JI7B 2V65A 3ZI4A 4AUNA 1KTVA 2VAVA 3FSRA 5CTJA 4B8WA 5HG0A 1Q14A 4I5IA 4WLUA 2NU8A 5HBGA 4L4YA 3E7PA 4RKFA 4ALIA 2NOAA 3B3GA 4HTAA 1T1EA 2QRMA 3T3EA 4RPHA 4I19A 4D4MA 3O3OB 4Z1MA 3RAGA 5GONF 4AS3A 4EAQA 2O8EB 1N8TA 3CLSC 1UT5A 3W8RA 2Y1OA 3CRVA 3LX8A 2V8OA 4J8PA 3Q3EA 2R6ZA 1CP3A 3FNQA 2C3MA 4C4RA 3A1DA 3F9CA 5C8ZA 1PIWA 4EM6A 1JHAA 1CY4A 4S0ZA 2Z08A 3OHPA 2QNIA 5BWNA 2HRQA 1UK9A 4GQBA 1WV1A 2FJUA 2GXSA 2JFNA 3H4IA 3MTGA 1C0KA 1J2RA 4A0QA 2NPFA 4UBJA 2BGRA 4W5RA 3QVLA 4UE3S 5EI5A 4ZMBA 4N5LA 4UEQA 1I3NA 2VRWA 3DMNA 4JUDX 4F1KA 1F38A 1JDUA 1T2VA 1TTHA 4LE0A 4TRNA 1WHTA 3VGJA 4QOEA 2ZIVB 3H5AA 4I9GA 3BJEA 4GI2A 4RD3A 3HK2A 1EZ4A 3ZUPA 4L3WA 1FQOA 1ULSA 5TT0A 3GLIE 4DLTA 1X7XB 4OX9B 3D31A 1R18A 1H23A 2ODNA 4BJ5A 3V8PA 5KJ6A 1ZMRA 4M0KA 3TE7A 3EXG1 3PDIB 3T7CA 1NBMD 2BFBA 3C6KA 4ECEA 5J4VA 4X6XA 3CR7A 3R3YA 4FFVA 4XEUA 4OU5A 5LA6B 3TQSA 3QHAA 4A2PA 4DSAA 5E0OA 4ARCA 2FMHA 1JAHA 5B2EA 1OLUA 2BMEA 4TUYF 4RNCA 5AKXA 1SG0A 4RF3A 3SJZA 4BC0A 5AVTA 1HDEA 2BEKA 3W06A 5J43A 3KAKA 2VPTA 4Q3AA 3LZDA 1IXKA 2UYHA 2NYAA 2QY9A 2PVSA 1NOJA 3FPKA 4NBTA 5ALQA 5BSRA 4L5YA 4TMKA 3RJTA 1I7DA 3RRZA 1YL7A 2O5VA 3B2EA 1RFGE 4J90A 1K4KA 2IBMA 4FJ1A 4NL4H 2FPSA 1RQPA 3IUSA 4O4HF 1DX9A 5EHZA 2FK8A 2HQBA 5LLSA 1HMPA 1AD2A 1XO1A 1YDEA 4E08A 1OHHA 1GUYA 2B92A 5BORA 2YJNA 2DPYA 4WY5A 1IAVA 1ECPA 4FD3A 4MYUA 3W6OA 2ZIXA 1JEEA 3G2PA 4NP6A 4M8LA 4ND3A 2HJHA 4WKNA 3OCUA 1V3TA 3A7EA 4WSOA 5DHSA 5IM4F 3AP3A 3PXUA 2BPOA 1JUDA 3IQEA 3WDLA 5AJWA 1ORHA 4Z0NA 4INJA 4XCXA 3ZHVA 1G5FA 4D4JA 1IC6A 2ACVA 3IO5A 1YSCA 3HYRA 3WL3A 3WSVA 3W4KA 4ASUA 5HIAA 4EMBA 4Q7MB 5CFLA 3FZQA 2ZUCA 4QU5A 5FWDA 4TZ0A 1L5LA 2J6IA 3ZC3A 4BNDA 1CQPA 1VHTA 2GYUA 2NU6A 4UAGA 2H52A 2XVYA 3NDJA 1KC1A 3GNQA 1UDCA 3OQBA 3W9YA 3CBQA 2BD0A 3QWAA 5CDGA 2REXB 5IZ4A 5SY4A 2ATIA 4YXFA 2JHAA 3CFYA 1P8JA 5LYYA 2MSKA 7ABPA 2WWIA 1D7OA 1CDOA 3GFVA 1Z16A 2WP0A 2VJMB 4QFCA 1QCYA 3FMGA 3NAQA 5EYPB 3VJLA 5ALSA 4QVIA 1F2UB 1IPFA 3P2IA 4NIMA 3IQWA 4MR9A 2W2MA 1IG0A 4MS1A 2CXQA 4FS8A 4RW0A 2J0VA 3NO4A 5AHRA 2QTHA 3I32A 5KREA 3Q3JB 3E1SA 2ACEA 4NENA 1GZVA 2X4DA 3PIRA 1DKRA 2JFFA 3AWDA 1DELA 3DMHA 1DQZA 4KYTA 3CISA 5JWRA 3KJGA 2AK2A 3FTQA 3ZJUA 1Z4IA 1SOMA 4DREA 1NBAA 2PX8A 2NXEA 4LFCB 4EEKA 1U5CA 9LDBA 3WLSA 3FUVA 2IF2A 2SICE 3CRNA 3G9TA 4AYWA 5DKFA 4S04A 1AGPA 4B4WA 4KX3A 1J7KA 5JIBA 4B7AA 4KFCA 3FB4A 3LO8A 4HDNA 4OLHA 4PPYA 5KTKA 1G4UR 1LRLA 2OP1A 3MINB 5TY0A 3T5CA 1ZVJA 2OKCA 1YU6A 4QC2A 1JI0A 3C1OA 3LGSA 3OJWA 5JATA 4I08A 2GPSA 3ANMA 4DILA 4ZZ0A 2REQB 1RHUA 2AFHB 4D81A 2WC1A 5KNDA 4QXOA 3LKVA 4PZEA 5FL3A 3NLLA 5IK2A 2DLNA 5IMBA 4EATA 2XZOA 1R6DA 3BXFA 5EZYA 2AEEA 3WISA 1KAHA 1VI5A 4O02B 3DHVA 1L5HB 2ZS9A 3AR2A 3PR3A 3PGJA 2WTUA 2BEWA 1J0BA 4FMCF 1PI3A 5CEFA 3TF5A 3ICQB 1ICIA 3WGOA 1FX1A 4YEDA 2NW6A 3N2KA 3V2UA 2GBPA 4PQYA 3IS3A 1TDJA 2CDBA 4L8LA 2NTJA 2VDUE 1O95A 3IBCA 3QBJA 3HVUA 4NY1A 4WECA 4PFSA 1ECBA 4WH0A 4CU2A 1ULBA 1YIOA 2G1KA 1E1NA 5F1KA 4C08A 1S2DA 3VPDA 5BPFA 3WL4A 3AY7A 4QKQA 4L2IB 3L0YA 2KMLA 3KFXA 3ZHXA 1SBYA 1U0JA 3K0KA 3U1TA 3KOMA 3EG5A 4C78A 3GJYA 4X7RA 4HH4A 1OZHA 4DBZA 4NG5A 1MIOA 4K1LA 3SQMA 1CE8A 2QTMA 4EGFA 2POCA 3A3OA 1C7JA 4O4LF 4C0HA 3C1AA 3BQ9A 3L5KA 5HFAA 1E3LA 3LBYA 1XD2A 4JJZA 1E0AA 3H86A 1H4QA 4L8VA 3JAWB 3IVGA 1U4OA 1Q1NA 1XCJA 3MQFA 3PGVA 1T1RA 4RSGA 1YF3A 1TO2E 4CTOA 4MJXA 1SUIA 2VQEB 1X1SA 1KMQA 1T15A 4AKIA 1XEXA 2EBWA 1CSEE 2QX6A 4IEIA 1F8XA 2IIQA 1ZIOA 2I4LA 2IVZA 2QLNA 3A6ZA 3I09A 2AX3A 4NAHA 4BFSA 5CH5A 4DV4B 2CXUA 3B36A 4X6LA 1Y3AA 1U0GA 5E95A 2I65A 2VJPA 5E8RA 5JC8A 4F7WA 3TQRA 2C8VA 2CLLB 3KZVA 2ZRIA 3UCXA 1IULA 1PTKA 2QL6A 3G0CA 1VLZA 3NVMB 4G85A 4IXNA 3DFFA 3Q9LA 5L4SA 5M7EA 2PRSA 1SAYA 2CVFA 2IWRA 4BNHA 3NTXA 1AXRA 1QF9A 1U7OA 3LL7A 1BXZA 1WL8A 3Q10A 4UVGA 2ZSFA 3QEMB 4FEGA 1EDBA 3JASB 2J0EA 3ROGA 4ZZIA 2ZDHA 1UMCA 2IZ1A 4Q1FA 1DEKA 1GJRA 3P27A 1NP6A 4I1SA 5FI3A 5P8WA 3DMGA 2H2WA 1FY2A 1TPZA 1OU0A 4R7ZA 2J4FA 1OBVA 1Z0DA 4FYIA 4KIJA 5ANRB 3TLZA 1JXQA 1SU4A 4D92A 2IRWA 3N8GA 3AF2A 4BLUA 2WMNB 3TKLA 5NULA 1PR1A 2OPHA 3HP7A 2FSUA 1IN1A 2UVPB 4NMXB 3OIFA 4OP2A 5JV5A 1YCHA 5HDQA 3GDWA 2VNHA 3FHOA 3GMTA 4AN4A 2X2PA 4GQAA 5JBNA 3C8MA 4JLDA 5LZ7A 3FZNA 4MKIA 4ZMSA 1Q22A 3J81A 3H2SA 1G5TA 4A9AA 3CRQA 4QUAA 1KEUA 3DDUA 5HZGA 3HA5A 5FV7A 3H5WA 1NPTO 4UXJA 3PR1A 3RADC 1D5WA 1P2SA 3A06A 2CFOA 4LHSA 1EG2A 2ZGVA 3W7BA 2BP7B 3T38A 2QTFA 3GA5A 3RYIB 3AT1A 3KEQA 3V4LA 3I34X 3GLIA 2R8PA 3H2IA 4HWGA 1K3FA 2NP7A 1RXSA 3OLWA 2OOKA 5KQRA 5AOAA 2QE7A 3B3QA 3NU1A 4EEXA 1AVTA 2QYHA 4BHTA 4Z4HA 1LK0A 4A4DA 1SR8A 1LI7A 2HREA 2LCQA 3ZHOA 1Z7BA 5KYKA 5AI8A 4Z7QB 2ZPTX 3CH5A 2HJRA 1OX5A 1O5TA 1E2MA 2ZWVA 4IINA 4JBGA 4JBNA 4LECA 2RFLA 4L72A 1XCOA 5HE8A 1B00A 1KBZA 4A8HA 4BO2A 3S8EA 2JI7A 1Z0KA 3IBSA 2H5LA 1EFDN 1FFWA 4LQDA 5E6RA 3WYAA 1KO8A 2YZ7A 4RV5A 5G02A 5ISMA 4V03A 4UMFA 1I1HA 2FQWA 5KHOC 1M74A 2F3UA 3AESB 3QBVA 1SU6A 4MPTA 1SD5A 2WV9A 2YIJA 2QGFA 2YW9A 1T0HB 2P40A 3M70A 2EV9A 3HABA 2C5AA 4QU0A 5LJLA 3H2HA 2IZ7A 1GD1O 1PD1A 2H63A 4V24A 3WIBA 4XJXA 1G21E 1X7DA 2BH2A 1PK9A 4OQDA 1VG1A 1AC5A 3I9V1 2B8EA 1EWKA 1NKSA 1IM8A 3LT0A 3HU2A 3LH5A 3VAZA 2Q1YA 1RXCA 2V7VA 2Q41A 2C84A 2XTZA 5EWLA 4P86A 5H02A 4YPVA 4AJIA 4DNXA 1XUOA 2XWJI 1HE4A 2ONZA 3SC3A 1QTRA 4HXYA 4EO4A 3PD7A 2VF5X 2RGXA 3DBVO 3EW7A 1DKMA 3IIKA 3N86A 1OW3B 3NBAA 4OJMX 3SNKA 3WR5A 3NT2A 4AO7A 2NYUA 2WD8A 3LRPA 3AFIA 3CE9A 4O0MA 2C2WA 1MHPA 5CVVA 1Y8QA 4HNSA 1WUTA 2X6RA 2NO7A 5ECDA 3RS4A 1SIOA 1LK5A 2BT4A 4B35A 2A7XA 4LK3A 1UBGA 1ESMA 2YMPA 2QJTA 2WF6A 5J1TB 1I0LA 4MJ7A 2CDAA 3NHWA 4FONA 3EEQA 3MPOA 3RSLA 4B8ZA 1E32A 4NYJQ 1QLJA 1XZEA 2DFDA 3NHPA 1BDJA 1TMOA 2JFOA 2XYQA 1JG6A 5H1YA 4F1WA 3ODPA 5JJLA 1CZOA 3DE5X 1P0CA 1N2CB 3UWOA 1CR1A 2NSLA 3I8OA 3OF5A 3QFSA 4C1BA 5I5EA 3EPLA 5ITZB 3O8RA 1VIDA 1QQ6A 2V7QD 4QLOA 3K0AA 5IHPA 3O84A 4TL7A 1AV6A 5AJVB 3PPWA 3QTTA 1NIPA 1K5PA 3EOAI 1KI8A 1K4YA 3T7TA 4B0PA 1DQYA 3EXEA 1XNHA 1P1RA 2WM8A 2GCEA 4MHSA 4BY9E 1WCIB 3U3DA 4BZQA 5A3QA 1DQPA 3ESRA 1OX4A 1P31A 2RCYA 3KO8A 1Z9BA 3FLBA 2I2BA 3D43A 2XUJA 2Z6UA 1XD8A 1H1LA 1TK3A 2LIPA 2VHQA 2BLLA 2XGOA 3ANNA 3I5AA 3T3MB 2AH5A 4C21A 4CCSA 2X1MA 3KT6A 3KUKA 3RRXA 1MO5A 3DAOA 3QKRB 5F5NA 4BO9A 3AJEA 1QYDA 4M87A 3VC7A 4UMEA 3S44A 2CMFA 4RFVA 4DSNA 3VPCA 1KXZA 3V4FA 3AHEA 2QJRA 3RVBA 3NHMA 4XVUA 2DLCX 3SXUB 4M9CA 4LWQA 5BSGA 5LQJA 5FT9A 1EIWA 1NZDA 2Z9BA 4CU5A 4D9KA 1XNQB 1U2PA 2CKDA 1X7YA 3MBOA 2OECA 4J4BA 5LYJF 5MN6A 4LZNA 4BQRA 1NWCA 3LSTA 4JI6B 4YB8A 1Y5NA 1GZDA 2E6UX 3WWCA 2N3ZA 4M1MA 3BSSA 1P17A 1Q92A 1BXGA 1YGPA 2XDQB 3WKDA 1YQTA 2XDWA 3A3NA 3Q7QA 2QMZA 2ECQA 3F9RA 1G2QA 3SBXA 2P4UA 4QDKA 3DOUA 4GEKA 5CNMA 5DM0A 1D9XA 5GOZA 4NXNB 4TWIA 5G0UA 5A4KA 3MB8A 1EQUA 1J5XA 1M2KA 1T8YA 1TRHA 1NBMA 2H17A 3B53X 3CEAA 1A4IA 4JZKA 4NZOA 4TKVA 5JAHA 4AKTA 1Q20A 3R0IA 4MRSA 3R0JA 1VI6A 1NONA 4NOJA 1QHHB 2CMGA 3H83A 4NOLA 1GNPA 5IYZF 1EE1A 4RE6A 1DJOA 4P5EA 4G86A 3BULA 4KZPA 1PL7A 2AJCA 5LXTA 3HCAA 4A1FA 4X66B 2B4QA 2DHQA 2PIDA 1IEXA 1W30A 3L0CA 3P0FA 3UV3A 1W6RA 2C42A 3IBYA 4OXYA 4B87A 5J2UF 5JSUA 2PVCA 2I0FA 2WSYB 3LYAA 4HWPA 5DXJA 4E32A 3HLKA 3SQNA 2ZITA 4LYYA 4F3RA 3DF9A 4GKJB 2G1UA 3EGWA 2HSGA 2JAOA 5IHXA 2XCOA 2F8SA 2JASA 3BQNB 3ZE1B 1OI4A 3W8FA 3II6X 1DFGA 1C7ZA 4YJ2F 4ILKA 1Q2XA 4YP1A 5JLAA 1KSGA 3HWX1 5JQGB 3ITKA 2H2FA 3WB1A 4XR4A 1S02A 3PG5A 4WRRA 3RODA 2XECA 2PKQP 3FTPA 3DZBA 1JMKC 5A9SB 4F4FA 1GRCA 1WW3A 4BZXA 1XXHE 4ALKA 1LVGA 3C6QA 4X64B 3SKVA 4IJ6A 4DRXB 2PWPA 1GRRA 4IPTA 2FR8A 4UW9A 4KQHA 4U2KA 5BW4A 1WMFA 1XMQB 4AN1A 3KDSE 2QMHA 3HKCA 4DA7A 3QYAA 4ZOQI 4K2AA 1JYFA 4JYMA 4Q4CA 3K9FC 3KWFA 1FLDA 1R12A 1WP9A 1KQOA 3A7DA 5E8JA 3TRFA 2QT1A 2WTBA 3WQBA 4JLPA 2XEDA 4UBOA 2FMTA 2PX3A 2OUKA 3UUFA 2VJCA 3WGKA 3A2KA 3VTZA 1P19A 5CJPA 5B4UA 1J0EA 2X2OA 4MR7B 1FTSA 2ECOA 2JFQA 5AKYA 4MGKR 1NMYA 2G77B 4TLMB 1PNTA 4LHWA 4AURA 1OYYA 2X8JA 3IP6A 1R0SA 4CM4A 3UJNA 1R0YA 3MWEA 2PGLA 2B1QA 4IMJB 1OIXA 4UUNA 4AJHA 1GXSA 1YZFA 3W5CA 1OLOA 5AUPB 5JXIA 2EEZA 4RUKA 1JBEA 4BUJA 2ZPUA 2TYSB 5JXGA 2V7XA 2QUHA 3OZCA 2J5BA 5GJCA 5HEKA 2Y71A 1OZAA 1SUDA 1TF5A 2LBPA 1LBQA 2VZ8A 2P62A 2GO1A 4QHTA 2PGJA 1FTWA 1NUPA 2GEBA 2Z58A 3C15C 3G0DA 3GVXA 2ZIWB 3S55A 2AB0A 1NR5A 3DOJA 2DULA 2IGBA 4J0GA 3CB2A 4R1UA 4W6ZA 4V0QA 3TRDA 3DE6X 4C6TB 1G9XA 4AECA 4ITUA 4G4SP 2I1WA 2JIBA 3LZCA 4ZK2A 2O19A 1P6UA 4NX2A 4O3FA 3PDJA 3PU6A 2A9QA 4ZN6A 4FINA 1MW9X 4XJVA 5G0TA 3GRRA 3OX3A 5AM2A 3ZWNA 3FDFA 1ZOLA 4W99A 3G2JA 2OA0A 4U2FA 4EY3A 5KX5A 5ENZA 3CPEA 3VVBA 2P9HA 2Q1UA 3OJ0A 1J8QA 4L5IA 1FP4B 1VKJA 3N2GA 4LXTA 1LZLA 1VHLA 1VGRA 3EDYA 5EWMA 3BHNA 3O83A 2REBA 4M55A 3KEOA 5FWXA 3WBFA 2PDAA 4O2AA 1ATZA 1R9GA 3LQRA 3NYWA 1SQFA 1USGA 4CKXA 2XY4A 1OI3A 3R6GA 1XYYA 2B1IA 3AF6A 2BFFA 2RB5A 3WHIA 4KV7A 1JHOA 1J8MF 3ULKA 3E03A 1Y8CA 5HUQA 1XQXA 3TSZA 1Q7EA 3H2BA 3L4BA 1TU0A 2OP0A 2Y4NA 2XB2A 2VHCA 4KR6A 1EPUA 1CR4A 1DKOA 1YBVA 3PJFA 3QENA 1ZDMA 2HZ7A 1K8YB 3QV2A 4WT7A 1DHRA 2CK3D 5B64A 4JC0A 1J1ZA 2CNWD 4NWIA 4YJFA 4UHBA 1IG3A 1JFRA 3UMSA 4PZ9A 1Y6GA 4DV0B 1N2SA 1TUEA 2XOXA 1HFKA 5FQNA 5ADWA 2UXDB 3ENWA 2C3OA 4PXYA 1L1EA 2RAFA 2FRVA 3TAUA 3TB4A 4B85A 5BMOA 1C0PA 4PTZA 1R7RA 4YRJA 2YFYA 3N8NA 2W2QA 3H97A 4MYSA 4TKUB 1RYZA 3LP8A 2FUNB 4BPRA 3PC6A 3MQ2A 4D74A 1YBHA 1MA0A 3IV7A 4TV9B 4X54A 4BNUA 2BKAA 2O8FB 3OQIB 4L27A 4PRZA 4B32A 3BRSA 4CHTA 1GL9B 4ZYLA 1CV2A 3Q98A 4DCVA 4PNPA 1AB6A 2B7LA 3QX7A 4PO9A 3ZDQA 2IPLA 3R9XB 1N0UA 3HACA 4YP5A 1MO2A 1P4JA 5CVDA 4OIFA 2X7JA 5U9CA 4F5EA 4L07A 2FZEA 3GVCA 1YMUA 2IUTA 3K09C 1C30B 1EJ6A 3DFKA 3E3AA 3HXLA 4MLDA 1VXRA 5CT9A 3ZE8A 4ZT2A 4ZCTA 1E1LA 3M7IA 1IXYA 1XVVA 2DYKA 3JYPA 4NFYA 4RTOA 1UKCA 3CF4G 4IIEA 3RVOA 1CIVA 1E2FA 3WYNA 3UPUA 1R1DA 2R8XA 4MV6A 4POAA 1P81A 2E37A 3P9KA 6Q21A 3O0TA 3HS3A 1KPGA 1S2GA 4CN8A 4PVCA 1Y4ZA 2AC4A 5FUYA 4B2YA 4FDVA 1MJGA 1XWIA 1DJMA 1QH8A 1SIBE 2FE1A 6AT1A 4LZAA 2XIQA 4GECA 2IYVA 1YR1A 3UHFA 3UC5A 1E9SA 3VR4H 4G81A 5DGDA 5BQ3A 4W9RA 2YVLA 4WKCA 1M66A 3WGYA 2B35A 3LGXA 2QA5A 3A70A 1FNBA 5KCZA 1V25A 1Z34A 3VU3A 1A8PA 4F4DA 2CMDA 2LGJA 1NF8A 2NUAB 5IUJC 4N3GA 4IW3B 2NZYA 5AK3A 3UMRA 4YFYA 3P20A 5JOQA 3JYNA 4M7WA 3RJZA 5BSMA 5GOTA 4H0CA 5JSKA 1RKQA 4FX2A 2ZJYA 3ORHA 5IXSA 2X9LA 3EEBA 3ETDA 2QLMA 3ZYZA 4OMCA 2PMBA 1B4DA 3CN7A 2AHOA 3JQGA 5SZKB 3H2YA 4KQ6A 3AWIA 2YWHA 1PQ4A 4LZPA 2DGDA 1ZUNB 3WHLA 3G9UA 3HR4A 3RF7A 1YKSA 2OAGA 3ZHSA 2WA2A 1I5RA 3L6RA 1QP8A 4OHRA 3EC7A 3CW2A 1RLTA 3KJIA 1U3TA 3TQQA 4JI2B 5E4JA 2VHZA 5A6SB 1BU8A 3QVSA 4JELA 2PZKA 3Q6IA 3QLVA 5AXAA 2BFOA 1KBOA 3DVAA 5E9QA 5CT6A 3WJAA 3PDCA 1YDFA 1Z74A 4IDQA 1N0HA 4ISCA 4DWVA 4ZHSA 3HJHA 2Q1WA 2I5PO 2Y9MB 4UKDA 3K9HA 4TS9A 4YA6A 1EXVA 2C04A 4R3WA 3CSDA 2EJCA 5D5PA 1QJCA