1EWTA

Crystal structure of metabotropic glutamate receptor subtype 1 ligand free form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
478
structure length
456
Chain Sequence
QRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of glutamate recognition by a dimeric metabotropic glutamate receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
total genus 144
structure length 456
sequence length 478
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewtA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewtA01
1EWKA 4MQEA 2IKSA 1DG9A 1YVUA 1SXGA 1NXTA 1GUBA 3T38A 1EWVA 4O1IA 1Z16A 4JAVC 5KI6A 2AYXA 2MYTA 3L6UA 3F73A 3CS3A 3QEMA 1FFWA 2E4VA 2FEPA 5GOTA 3DGEC 4W5NA 9ABPA 3BRQA 1PUXA 1OXKB 3GBVA 4FE7A 1D2AA 4O1HA 3T6KA 1Z18A 2J48A 1P2FA 2JK1A 3EULA 5FWYB 1W9HA 2FKAA 3LOPA 2L18A 3LUAA 3OM0A 3Q15C 6ABPA 1JH9A 1Z12A 8ABPA 1E6MA 2JBAB 3LUGA 3SG0A 3TO5A 3ROFA 3QX9A 4XARA 1JF8A 4EVQA 4YWHA 5JS1A 4WXMA 1T34A 3EAFA 2NT3A 4EY3A 5JNWA 1LJUA 1NXOA 4MS1B 4UHJA 5HM6A 2FVYA 3RVRA 2CD7A 2WJAA 2H0AA 2FMHA 2PKXA 4Z0NA 1XWWA 2E4YA 4W5QA 2QSJA 1YTUA 3KLOA 1RXIA 1Y1LA 4WUTA 5IEBA 3HXMA 2WB4A 4CBVA 2L19A 4JA2A 4KFCA 1LBHA 4G0PA 4HNQA 5EWMA 5F64A 3DGFC 4KZKA 3RVOA 1YK0A 3H1GA 4RK0A 4B09A 1ZAYA 5JNRA 3BILA 1MB0A 4PZ0A 4ETIA 1HEYA 3G85A 1KMIY 3C97A 2VK2A 3K9CA 3RVKA 4MQEB 5B3JC 7ABPA 3EODA 4Z9AA 2JRLA 1LJLA 4Q7EA 3MMNA 3I09A 4RU1A 3TMYA 3VNBA 1JLKA 4Z9BA 3TD9A 1A04A 3CFYA 2QU7A 3O21A 4HYEA 4ML3A 1JDNA 2L17A 2ID7A 2OQRA 3HEBA 1ISSA 2PLNA 2HQRA 1USIA 1JDPA 1Z15A 3GV0A 3N75A 3KYIB 2MYNA 3F6PA 3EGCA 4EVRA 4MS3A 3LUKA 2FLKA 3LUJA 2E4ZA 1RZRA 3D8UA 2JCGA 3QLUC 5ABPA 4OG2A 3SY8A 2LBPA 3HS3A 1ISRA 3URMA 1TMYA 1DZ3A 4RK1A 3T95A 4Q6WA 1XHEA 1KGSA 4MPTA 3N6VA 3KSMA 2PJUA 4RKRA 3HSYA 3H5OA 5TPZA 3CZCA 4GNRA 4NCAA 3RVJA 1BDJA 4ETNA 3OO0A 4F11A 3ILYA 5T3YA 3GA5A 1DC8A 3HZHA 3Q41A 4RXTA 3A10A 4P98A 3MM4A 1YS7A 4KRFA 1DC7A 3MA0A 4DADA 1D4ZA 1PEYA 2A9PA 1U2PA 1Z2EA 2FMKA 4WZZA 3DBIA 3IPCA 1QO0A 2HPHA 1F51E 4N41A 4HNSA 1ZGZA 1AB6A 1MIHA 1U8TA 4IILA 4QYMA 3RQIA 2BGGA 3LUFA 1DCMA 3BBLA 2FN9A 3P9YA 2F8SA 2FQXA 3ILHA 3TX6A 2JBAA 1E6KA 3H5WA 1WETA 3KCNA 4G97A 3JVIA 4F06A 2HJ9A 1USKA 3MIZA 1DBPA 3CG4A 5FBKA 1Z25A 3HVRA 2I6FA 4PICA 2PUDA 2VUIB 3HK2A 3OLWA 1E2BA 3W9SA 3JS5A 1YMUA 2QW1A 4G0XA 4LRQA 5IULC 2JVJA 2A9OA 2ZAYA 2A9QA 3O1JC 3RVNA 3Q7SA 1JWLA 1QQAA 1NATA 1VKRA 3NNNA 1Z2DA 5GQSA 4G0MA 4E7PA 4UHKA 1EAYA 5TQ0B 4RS3A 5T7BA 3I42A 3M9XA 1NXSA 1NXWA 4O5AA 4XLTA 1L5YA 1RPJA 2ZWMA 4YLEA 2FQWA 4D6XA 4ETMA 5IUJC 5IUKC 1IIBA 3BRSA 4E7OA 3H1EA 3K4HA 2MSWA 4LE1A 1M2EA 2NT4A 2CHEA 3GT7A 1Z13A 3SQNA 3O2QB 5D2CA 3HJFA 1YIOA 3UKJA 3NHZA 1ZDMA 4S05A 2FSPA 5IC5A 4RWEA 5KQMA 3KG2A 2ID9A 3JVDA 3F7NA 3N0RA 5JNVA 3Q9SA 2IPAB 4NQRA 1CEYA 1ABEA 4MS3B 3RVLA 1C0EA 1LBIA 3CTPA 4H3KB 2QVGA 2CWDA 4MR7B 4F12A 1D1QA 3GL9A 2XDYA 3IP6A 3DZDA 1ZY2A 2IPMA 2TMYA 3CG0A 3KS9A 1A0OA 4RXMA 1DRJA 4G0ZA 2FXIA 5DTEA 3C6QA 3OLZA 1DCFA 5KQPA 2IDMA 4LE0A 1P8AA 1GLGA 3NHMA 5CNMA 5BR1A 2V0NA 3IPAA 2W42A 1QO0D 4LX8A 5KWSA 3MYYA 3I45A 4L85A 3CU5A 4YCSA 4XASA 3KLNA 1ZN2A 4OTZA 5DKFA 2NZVG 3FDFA 4N0QA 1BA2A 2PAFA 5ED4A 4FE4A 3OO1A 2MYUA 1F4VA 1UDRA 3H6HA 1BAPA 5TQ0A 2QV0A 3OLXA 5HKOA 1KRXA 3Q7RA 2F8TA 4RXUA 4DQDA 1ZITA 2R47A 3O75A 1CYEA 1YK1A 3N0WA 1DJMA 4NICA 5EWLB 3GYBA 3CHYA 3SM9A 2WMYA 1RXEA 5FBHA 3S99A 1BVHA 3FMVA 3JPYA 4S04A 3EDCA 4KQ9A 3IP7A 1I3CA 3IDOA 4QYWA 3OQNA 3JY6A 4PE5B 4RSMA 4IMIB 3HO1A 3NBMA 1JFTA 1VLZA 1XHFA 4P1ZA 2FLWA 3QX8A 4FB4A 2GI4A 4G86A 5EWMB 2CHFA 5IEJA 2M1ZA 1GCGA 5CNIA 2RGYA 3DLBA 4W5OA 4H60A 3OQOA 1DP4A 2NZUG 1MAVA 1JL3A 4GPAA 3H6GA 3CNBA 1D1PA 6CHYA 4G0YA 1U0SY 3HUUA 3ROTA 2OENG 2WWVD 4D6YA 5CNKA 3NNSA 3SNKA 1J56A 3OQMA 5TPZD 4EVSA 1CHNA 1L5ZA 5HSGA 5JNSA 5TQ2B 4YP9A 1JX6A 2E4WA 2GWRA 3A0UA 3HV2A 4Z4HA 3LUHA 4MAAA 4MR8B 4N76A 1P6UA 3FFTA 2FEWB 4D74A 4W5RA 5TE9A 1E6LA 4RDCA 2QVCA 4YS6A 1Z17A 2PUEA 4LDZA 3H5IA 3FFWA 4G0QA 1W25A 2GKGA 1TJYA 4WWHA 5CHYA 5JS2A 4ZMSA 3MQ4A 2H3HA 2JB9A 3R0JA 5FWXB 1FQWA 2B1JA 3O1HB 2WRZA 1SXHA 3FGZA 5EWJB 3EQZA 4L4UA 4YO7A 4TN5A 3C3KA 4RZSA 2RJNA 3LMKA 3BREA 3OLVA 4MS4A 4ZMRA 1QP4A 3LTEA 4TLLB 2IPNA 5TQJA 4Z4EA 4KVFA 1QP0A 4RK4A 5JNUA 3OM1A 5TQ2A 3GWGA 3QLVC 4N0PA 4RKQA 3O74A 3VNAA 3CRNA 5DLEA 2X7XA 1QMPA 3GRCA 2PMCA 4KQCA 4TLMB 4G0OA 5JNTA 1RZRD 4KK4A 1JYFA 4RK7A 3CKMA 4IMJB 4JP1A 4EYQA 1KRWA 4Z4FA 1YS6A 4LZLA 1C4WA 4ZJPA 3F6CA 3LKVA 3O2SB 3EQ2A 4ZPJA 4KNYA 5KC9A 3OMWA 1K66A 4DN6A 3HDVA 3H5VA 4YGXB 5KQLA 3IP5A 4MR7A 1PNTA 4ZYLA 3N53A 5B3JA 1H9CA 2FMIA 4N47A 3KKEA 3GBPA 4MYRA 5EWJA 1D5WA 2FEKA 4EYKA 4YR7A 1VRVA 1JFVA 4YV7A 1SXIA 2NUBA 3IP9A 4MLCA 2HQBA 3QELA 1APBA 2JVIA 4MRMA 1NXPA 5FWYA 3HUTA 1LK0A 1BDIA 2R25B 2N9UA 2R48A 5EWLA 2DRIA 1S8NA 4EUKA 2LPMA 1QKKA 1JYEA 1R8JA 2HSGA 1Z26A 3KJXA 4MQFB 3UUGA 1VPWA 3H5TA 3B2NA 2FTKE 3LUDA 3T8YA 1ABFA 2YHBA 5IUNC 4EGSA 3RVMA 4Z4GA 3CLKA 4JB2A 4OLBA 4WXEA 1NTRA 3QEMB 1TM2A 4JOQA 4TMYA 4XFKA 1PEAA 3RH0A 2HQOA 3OMXA 2RDMA 1GCAA 5BRAA 4KREA 2A9RA 2WJWA 3TB6A 3E3MA 2LP4Y 4W5TA 4JB0A 4Y9TA 4Z99A 2WY2D 1GUDA 3M6MD 3SAJA 4F3TA 3KTOA 2PUFA 3E61A 2JVKA 4IGAA 5KQGA 1A2OA 4RV5A 1QP7A 3CZ5A 1SRRA 3D02A 1USGA 5IX8A 2MSLA 3O2JA 1ZVVA 4MS4B 2E4UA 2O20A 4RY9A 2P4UA 2MYPA 1JFSA 3RVPA 3N0XA 3QLUA 5TPWA 2PUCA 1TLFA 3JPWA 1EFAA 2QXYA 4Z4CA 3LKBA 4RY0A 2KYRA 4MR9B 1TVMA 5DGCA 1EHCA 3QLTA 1MB3A 4H3HB 4JASB 4MLDA 4EYGA 3QK7A 4MGEA 4OATA 1ZGGA 4MQFA 5CNJA 1M5TA 1DCKA 2YHAA 1DRKA 4LDAA 3LFTA 4WT7A 4MS1A 4N03A 3G1WA 2FN8A 3DLHA 2IYNA 1M2FA 1DBWA 1ZHHA 2GBPA 2FQYA 3OLYA 3UK0A 5DCLA 2Q5CA 1SD5A 4QICA 4MR8A 5IBQA 5KC8A 1ZH2A 3HCWA 1FFGA 3QEKA 1DBQA 4KV7A 1EWTA 2PL1A 3A0RB 1FFSA 2VYCA 1JHZA 2IOYA 1PHRA 4KPYA 3KHTA 3KYJB 4MR9A 1QNLA 2PUBA 1URPA 3HM9A 1M5UA 3M9WA 5FWXA 4Z4IA 2GX6A 3H5LA 1OXBB 2PL9A 1ZH4A 4IF4A 4YRZA 1ZESA 1RNLA 2QR3A 4PYRA 4RK6A 4PEVA 5BRJA 1AB5A 4RK5A 3H1FA 4QPJC 4EYOA 3MF4A 2B4AA 2P9HA 5C5EA 3Q7TA 3RVQA 1JBEA 4RY8A 2AYZA 2PUAA 1NXVA 4HNRA 4OBBA 4M88A 3I5AA 2VUHB 2QZJA 5C5CA 1NXXA 3QELB 2E4XA 2MSKA 4MRMB 4Q6BA 2M98A 2LIVA 3L49A 2R4QA 3JTEA 4XAQA 1U2QA 1MVOA 3LUCA 4XXHA 3A3KA 4LE2A 1QQBA 1FSPA 1B00A 1K68A 4KK3A 5HQJA 1PNRA 2FMFA 3HDGA 2IPLA 1NY5A 1P6QA 2L2QA 3C3WA 5TPWB 4NCBA 5I4CA 4NV3A 1YMVA 2LUOA 3O1IC 4KMRA 2PE5A 4OLAA 1BDHA 2RJOA 3FFXA 5E3JA 3RVSA 1U04A 3N8IA 4IRXA 5PNTA 3C3MA 2PUGA 5BQ3A 4F8JA 3QLVA 3EJWA 1QPZA 3NNDA 3H75A 2FW0A
chains in the Genus database with same CATH superfamily
1SKQA 3OOHA 4NBLA 1GUBA 2RK3A 5E6RB 5KNDD 2H3EA 3H2JA 4W6QA 1KK1A 4DM3A 3P5BA 4KH1A 3IUMA 3CPSA 3L4SO 5DLDA 2DBRA 4K8RB 4HMOA 4WCVA 4L7VA 3RTDA 5K01A 2H2AA 2FEPA 2ZTLA 4UQOA 1WZ2A 1K75A 4R4JA 3I2GA 2G1UA 5ER9A 4EKDA 1OXKB 5J5AA 2ZT8A 1D2AA 2YRWA 1JA9A 3LYUA 4AYXA 2IHUA 2BGRA 1Y63A 1P9LA 4NWIA 1CZKA 1J6UA 1ZIPA 3IBSA 3L1IA 3Q98A 4JVNA 5DU2A 3LBHA 4H7KA 5ITWA 3A05A 1E7SA 1QDLB 1UDCA 1UPTA 1MFPA 1JH9A 2YFYA 4J07A 3NEAA 3I5XA 1QAOA 1Z6PA 2ZB4A 4TS3A 4EA7A 2FK7A 3QVMA 4EUEA 1Y42X 2B0JA 2JDID 1SC9A 4EVQA 5C8ZA 4QT0A 1YZLA 4HHEA 3TSCA 2IODA 4M0UA 1AY0A 3B3AA 4RKYA 3CZQA 1PS0A 3BT7A 3FYUB 2MU1A 3EXEB 1ZM7A 4KP7A 3B1WA 3NYWA 4E2WA 3RJ9A 2C1ZA 1F38A 2Q4OA 1PL8A 3CLVA 3VR0A 1WMSA 5B30A 3AVWA 2QJFA 1Y1KE 4P3YA 1E2UA 4CF3A 4JXZA 1OTYA 3FX2A 3C85A 1G6OA 3INGA 1VJGA 3M7IA 1LBHA 2VTBA 1SUAA 3ZWCA 3KT0A 5FO1A 5JNRA 3MJRA 3N59A 4TQ9A 1P1IA 1UBEA 1HDRA 5AI9A 3WKBA 3RODA 1JDUA 4LDJA 1CR2A 1Z0UA 3T0FA 5B3JC 1SH7A 1QHYA 4CEHA 2ZULA 1UBSB 2O3JA 2ZG6A 1BX0A 2BCGY 3TBFA 1QG0A 1TKCA 2Y0EA 3NP7A 5EQTA 2CYBA 2QF7A 3TMYA 4BO8A 1FFBA 1R0KA 1JMKC 2H5IA 1PU2A 3AR4A 3UKOA 4V03A 2WIKA 2Y1OA 5FBVB 3DWGA 1G0NA 3QOYA 4U1RA 4Y18A 2YZGA 2MSNA 4ER3A 1Z15A 1XCJA 1PZXA 1OYWA 3ELWA 4TYMA 3F78A 5ALLA 1X94A 2G63A 1FDIA 1XR3A 2CLMB 1W59A 3L1JA 5KNBH 3FOZA 4QM7A 2CF6A 5JRJA 1G66A 3KKOA 4QQKA 5LLDA 1UWCA 4GNKA 4UUOA 2GESA 4K87A 2KWIA 1F6WA 3AR5A 1ZM9A 3C4QA 3P26A 3MUFA 4A8PA 3RSGA 3TRFA 1KGSA 5JAQA 3N6VA 2JIQA 1DAFA 1J21A 4LF6B 5I7RA 2NM0A 4P3PA 2EFDB 3PXBA 4GNRA 1XMXA 1TQ8A 2O52A 3ZTTA 2UXDB 1E1LA 4Y3UA 1SHLA 3JWEA 4WLUA 4UNQA 1X13A 3IHKA 4MVJG 1COWD 4UM5A 3RBAA 2FZLA 3LA8A 3R41A 1RXSA 3RRXA 2KLBA 3CBGA 1NUQA 2HK7A 2B5VA 1EUZA 4UD2A 4HWGA 3IPCA 1I3OA 4OHRA 5CVVA 2GCGA 1ZGZA 1ENZA 1P74A 2FJPA 1FLVA 2AOTA 1RCUA 4E2FA 2AE1A 3CN9A 4HD8A 2DTXA 4B31A 1E62A 3C45A 4FGKA 4Q4DA 1UBRS 4ZCLA 3GY0A 1KZYC 4KGXA 2PXAA 3K94A 4KYIB 4Y9RA 2G70A 2OV4A 3FPLA 1IOZA 5CDFA 4E3WA 3WGHA 3SHFA 5J1TB 4KXYA 4LVCA 1CR1A 3AQ4A 3CV3A 1NOKA 5DI9A 5EQDA 1CDOA 2JVJA 2VWPA 2P1DA 3DKKA 2VCEA 3TI9A 4IQ0A 1RPAA 3CKKA 3RWBA 2X2OA 4P5DA 5LXTF 5ITSA 1I6KA 3THXA 3KQWA 2VPIA 5E8JA 4LYFA 1HO3A 4Q4JB 1WIWA 3EQ6A 1F20A 4G1EB 3HDJA 3KNZA 3ZE8A 1OAKA 2BM0A 2JJ8A 1IYZA 3T5GA 2ESRA 1IIBA 1TEXA 1U31A 2IQ5A 1UT6A 3LZCA 3Q3CA 4CG0A 3K1JA 1WP9A 5K3EA 3ZKWB 1B74A 1H0SA 3COYA 4KE9A 2ZUEA 5I9NA 1DBVO 2XHEA 1YIOA 2F62A 1JHVA 1L5MA 1W8IA 2P65A 4S35A 3X0DA 2FV8A 4OHOA 1H2YA 2DTDA 1PJAA 2SKCA 2JI9A 1Z4OA 3IUNA 1XD2B 4ME6A 4YJGB 5AK3A 3V1MA 5BNWA 3ADCA 3ZS9A 3TTSA 3RCBA 1BFKA 4R1MA 3MGGA 4M4SA 1ZXXA 1YE8A 2BFEB 5AVOA 3W8EA 2ZRMA 5GJWC 4I9NA 2MWMA 1EGQA 1U28A 1U5BA 2BV3A 2YW2A 5GONA 1J9GA 1D1QA 1D0SA 1G8MA 2FPRA 3EYAA 4RXMA 4P7BA 4FMCB 3DDOA 5G0VA 3OLZA 5FD8A 1GXSA 1ULAA 2R8YA 1KMQA 3A1UA 3S8EA 4MAFA 3PFFA 5HZHA 5BR1A 3FOEC 2PYZA 1MNQA 1AKNA 4JX9A 4KO3S 3THYA 4MLPA 3FNBA 4DCCA 1MEOA 3IR7A 2I4RA 1VPLA 1Z56C 3OU6A 4K46A 4XASA 4QGAA 2Q27A 3L7AA 2BUAA 3ZOKA 1T9DA 4YXFA 2WSSA 2WAXA 2NUPB 2GXUA 4G2NA 4V1CI 2XBMA 3L7YA 3OAAA 1UEIA 3BGSA 2IYUA 3LC1O 2CNWA 3K9HA 3ED5A 2VEOA 3WRWA 3TIGA 4XVCA 2F8TA 1GPJA 3MSXA 4QDOA 1L5KA 3DQZA 1S89A 1H2AS 3OPYA 1ZITA 4IQFA 3SIWA 3VR5D 1BRTA 5CFPA 4X64B 4F86A 4QDXA 5LP6C 2LXNA 1O77A 1RQXA 4BB5A 1YF3A 4M49A 3JARB 1ZUNA 3KXPA 5DRTA 3D31A 1NG9A 3WLFA 4R7ZA 1K88A 4YMGA 4OD0A 1LD3A 3ENVA 3NEYA 4X6LA 3GARA 4QE3A 4HGNA 2ZZMA 3K09C 4BVLA 2N1BA 5CR9A 5H9VA 1VTKA 1HRDA 2XITA 4J03A 3U80A 3UVEA 5D5QA 1P9WA 1TUIA 4RSMA 3GLFB 1J5EB 2AN1A 5ADVA 4R40A 5K0LA 2OFPA 1RM0A 3CIFA 2H2WA 1X1RA 4MUGA 4XCVA 5L3SB 5L4NA 1E4VA 2RC6A 4MVJF 5EMLA 1OGYA 3SEFA 5EWMB 4EX6A 4R2IA 3Q3EA 2XX3A 1GL9B 5JI3E 2NADA 4DDWA 1HQKA 4MW0A 1U7UA 3DH0A 4KFTA 4NXNB 2QNIA 1ZNXA 2R6R1 3OT1A 2GD1O 3ZHVA 4DL9A 2JKYA 4XSHA 2RB4A 3UWOA 5BR4A 1A5TA 2NUTA 4BLRA 1ISMA 1WLYA 2OC4A 4ZOEA 1PVDA 4N3NA 3TRIA 1XLVA 3WMFA 4D6YA 3QSYA 2O8EB 2J3JA 5LQSA 2OXIA 4EUNA 3NCHA 2QVYX 2HDHA 1C0KA 1CWUA 4RIHA 3IRUA 3REQA 4U6SA 4ESHA 1DX6A 4KAJA 1R8SA 4F1WA 2Z2ZA 2HZBA 3IE0A 4CLXA 1YDWA 1PDVA 4FGJA 4R2MA 5BV0A 3E9DA 3FFTA 3UEOA 1QAMA 2G08A 3NHWA 4CL2A 5K8LA 4UQPA 2XYQA 3KSBC 1Y1QA 1V6SA 2CMFA 2EQ5A 2VRBA 4UKDA 4A4DA 1LGYA 3AEYA 3M1IA 1P0QA 1CDZA 4YN3A 1RVV1 1TD1A 1L7PA 1L7DA 2HIAA 1N2SA 3COVA 2NU6A 4N7RA 3NVKI 1F3OA 3VHXB 4K05A 4KN6A 1E9VA 3L6OO 2J4CA 5LP6B 4HADA 4LSMA 4XVHA 1T8SA 1ZFNA 4H1WA 4ZMRA 4V0SA 3ENKA 4RHFA 5JZMA 1LRJA 3DVAB 4YCMA 4QXOA 1EIWA 5REQA 5TQJA 3ZJYA 3WAJA 1Z6QA 3L05A 1PZEA 3QYAA 1TZCA 2VZ9A 1AV6A 1NXQA 1YBVA 2D5AA 2XA2A 3R3WA 1TA9A 4EY4A 2W8BA 5DWVA 1M10A 4HDCA 3T35A 2VJLA 2G1JA 4AW9A 1SIUA 3MRXA 2UUPA 4J2HA 1IM2A 2QMUA 5A62A 1PW7A 2AEEA 2RARA 3P0EA 3BDAA 4PAWA 1PI3A 1JHRA 5JXWA 3EHEA 1I4LD 1B8VA 1SA0B 4KQ2A 2PS3A 2R79A 1FCJA 2OD2A 5IAOA 4ZXPA 5H5JA 2WQ6A 2RGGA 3GPLA 1EVYA 2HT6A 1U2DA 3H17A 2YFQA 2ZOSA 1KAMA 5E2BA 3IVAA 4IHJF 1WPQA 5BW8A 2YIMA 2OBMA 1I51A 1SIOA 1QCCA 1CJBA 3G9ZA 2OCYC 3IAEA 4X1OA 1PSDA 2FEKA 5BWOA 3I83A 3CB2A 1VRVA 4DMHA 5SY6A 3JASB 2YZ2A 4KWTA 4MLCA 4O4LA 4DCTA 3MJVA 3SZOA 1OWMA 1R0RE 2OCKA 2R00C 2PLFA 3IC5A 4X3OA 4R6XA 4D5GA 2Q8NA 3PFGA 4M8LA 4HFNA 4KQ6A 3AEZA 4Y67A 3H05A 3P5SA 3PWKA 3R7DA 3I0ZA 1UJ6A 1FUKA 5FKJA 4ALNA 3CSUA 2QUBA 1HDXA 1KE2A 4FYVA 2P5SA 3K30A 3ZHOA 1NE2A 4QU0A 3RFFA 2N3ZA 2F43B 5LOVB 1U1DA 4BCCA 1NW3A 4JR2A 2RGAA 3IO5A 2IYYA 3JQGB 4K9SA 3TI7A 4DCUA 4JB3A 4H7PA 4EF6A 3GVCA 4HB0A 3NTVA 1OT3A 4DT1A 4XDGA 2ZIWB 4DHWA 4GM1A 3LY7A 1ID8A 1HI9A 4L2IA 4BKOA 1A8PA 1G41A 3AUSA 3ESZA 3HACA 4FSXA 4NU6A 3WGKA 4B7UA 1ORIA 1NN0A 4JB0A 5ALQA 4DIFA 1OLOA 3ETGA 1I30A 2VDVE 3KTOA 2OSVA 3M5DA 2ZBEA 5AKJA 4B3DA 5KUTA 2A6PA 4OXKA 2JVKA 5KQGA 3AV3A 2VS1A 3KVRA 5K3FA 2NTJA 2VLBA 4Y6PA 1AM4D 1V1JA 4C2BA 1QYDA 2YNMC 4FEYA 5FUQA 1QHSA 1D2RA 5F23A 2D2EA 2Q3JA 2B8EA 2ICAA 4KPEC 2ONYA 3KEOA 3WLKX 2O8EA 2IYAA 4POAA 3R7BA 1O3YA 2R84A 2QG6A 1J7JA 4IDDA 1VFNA 4H27A 4U3JA 2HV9A 3ICVA 1TYDE 3QUSA 4IWYA 4Q1BA 4QASA 2BAGA 2VT7A 4QHSA 1ZJZA 2ZSUA 3QLTA 3MBOA 1A71A 4YUZA 1EG2A 1A7UA 5A3QA 3AJEA 2BN4A 4AD8A 4A5OA 1RZVA 5AESA 3JZMA 3G59A 3PQDA 3NHRA 4HDSA 4OQLA 5EIXA 5F73A 4G5FA 1OUMA 1A8HA 3LVQE 4UCFA 4Y6RA 2I4IA 1GRQA 3NT4A 4PZAA 4WJLA 1NHWA 1IDN1 2ECPA 2ZJBA 1S1CA 1RCFA 3FNFA 4R2HA 4B32A 5AHOA 3GUVA 2X2PA 4ZT6A 3EPHA 5BSEA 1KSJA 4D3DA 1MX1A 5I9MA 4MVJE 1QB8A 2CNNA 1E1CB 4OPMA 5KOJA 2C7OA 4K8OA 4WLNA 3AF1A 3L7BA 3TLMA 4P0PB 3HBAA 1CZNA 2DU8A 4DXAA 4F3NA 3SZ3A 3PICA 4PO8A 3Q2KA 4EEXA 3WYEA 621PA 1PR2A 2DULA 4REQA 2PL1A 1ZGJA 4WLVA 1Z9BA 1AQNA 2V6BA 1V1MA 2NYUA 3ADPA 1QNLA 1U4OA 1GDDA 3M9WA 4IJ5A 3PL1A 1ADGA 3R5TA 2V5UA 3FZYA 4L27A 1MH1A 3ZDEA 5LMZA 3V4RA 1IBMB 5AM2A 3J7AC 1LFAA 1EA5A 4AKTA 3FPFA 2ERYA 1YJAA 3N5KA 4YCJA 2AK3A 2PEZA 3IURA 3VAYA 3E48A 4R8VA 3QTTA 1UKZA 3NR2A 2PZBA 1M0TA 3BE6A 4OQXA 3FNRA 4JC0A 2IX3A 3SZLA 1NSYA 5EIFA 2YICA 3NIBA 1QG4A 1JG1A 2DFVA 4UHDA 2Z08A 3MTEA 3OM8A 5ALMA 2J7PD 1IPHA 4LCEA 4ENUA 5KOJB 5KYWB 1CRWG 2E18A 3UCFA 1Y5RA 1ZUWA 2XY4A 3DNFA 4MKZA 5TJ9A 4E09A 5FBWB 1J8MF 4FNOA 8LDHA 1AKEA 1YIAA 2V65A 1VLMA 1OAOA 4E32A 1NVGA 2G0TA 3AVYA 2B4KA 3O90A 1K7YA 3CZ9A 3OF5A 3G89A 1Q7CA 1U8YA 1WKBA 2QRGA 3KVOA 3M6XA 2YJ5A 3AT1A 4HVTA 3OQPA 5LDGA 1KE1A 3I58A 4A10A 1G20E 3IPYA 5HRAA 1JQLB 4DR4B 3BHMA 4TYPA 3ZIAD 4F60A 1WZUA 3E9NA 3S40A 4J1TC 3O3NB 4MO2A 1L8QA 3SEZA 1PNRA 3C3AA 5C81A 4UZFA 2VTDA 1IHUA 3U7JA 3TJZA 2C5HA 2Z4SA 5AK5A 3EDQA 3MJCA 2J0SA 1YAJA 3ZDRA 2LIPA 2VP6A 4MAMA 1UPAA 3Q72A 2Q6TA 2C3PA 5F9MA 3PVZA 1Z33A 3RNLA 5PNTA 3MZ0A 1YACA 3LXUX 3B7WA 2MMCA 4FDAA 2DBQA 1WJGA 2G0NA 5JH7B 1Q20A 1YCFA 4LHEA 3LLMA 3KKPA 4MQEA 2JLQA 1WXQA 3SJBA 3GVHA 1TYAE 5KYYA 1SXGA 3DNPA 2B83A 5BYAA 2PMEA 4NMWA 2QPTA 3DZBA 4L6IA 1I7DA 2EEZA 2J3DA 4AZ3B 3OT5A 3KQKA 1K8RA 3EQ8A 1WB5A 3T7SA 2ACEA 3CLTD 1JQDA 1LTKA 1PL6A 4FUQA 1IEXA 1T0IA 2Q3HA 3QEMA 4PQYA 2RC5A 3BHIA 3RBVA 3IVRA 1E63A 4Y0AA 5IU6A 1M2VA 5DT2A 1PP4A 3MWYW 5HJEA 1M9NA 4WSOA 4RA9A 3VNVA 3K9FC 1O54A 1Y5LA 1JG4A 1KFKB 3RC1A 3I2KA 2ZBDA 3VH2A 2GPSA 4F91B 4TTPA 2P8JA 3RSFA 2HRQA 3W5JA 5ALDA 1MJGA 2DQSA 2HNBA 4DQXA 2CJPA 1R8QA 3FDXA 1J4AA 3QX9A 1IK6A 5THXA 1SAYA 1KVSA 3BMOB 4Q9KA 3ZKAA 1GYRA 1T34A 2X1HA 3AEUB 3GG2A 2QLJA 4L15A 3H13A 1GEEA 1SQ6A 1MX9A 1TRKA 2MR6A 1UINA 3VFDA 1GR1A 1IJBA 4H6WA 3HI6A 4HH3C 4MRRA 4ZAXA 2GTPA 1DL5A 4ZDIA 1SFRA 1OZHA 1UKAA 3MQ2A 2XRMA 3B52X 1A9PA 5CT5A 5EQFA 1CY8A 3D5QA 3LCRA 4BY9E 3Q12A 1ZNQO 4Y6SA 2WYOA 1HR0B 5FYQA 1RRMA 2A4MA 2QLMA 4TROA 4HNGA 4KZKA 4B09A 1ZAYA 4BLWA 1U0TA 1MB0A 3PF9A 1A88A 2V54A 3P19A 2XDQA 4UE3S 4QTYA 4CLRA 3NB0A 4C4TA 1M33A 5BQOA 3DEYX 2OD9A 5JSZA 2BIFA 1IN8A 1C30A 1KNXA 1DAPA 1S8OA 1D9XA 2G4LA 4G8CA 2ZDHA 4QBTA 2QSUA 3WX0A 3TXXA 3MK31 5C35A 2R8BA 3QU9A 3D6MA 3M5PA 4FOOA 4EW3A 3CFYA 2NNWB 4QARA 3IUPA 1U0JA 2AYYA 1IVSA 1BWPA 4YAKA 1JHMA 3D54D 5DN9A 3GLFE 1ISSA 4I5GA 1CUSA 2ORED 3KJHA 2JGFA 3M89A 4FMDF 4CV1A 4PHHA 2EJVA 4LNUA 3DEZA 1AKVA 4ZRMA 2G7ZA 5JYEA 1ZW1A 1K89A 4AUKA 1RZRA 3QLUC 4NYJQ 1PZGA 4TSRA 4G5OA 5AFSA 1VG9B 5EZYF 5ERYA 4LOHA 4UUAA 4MV0A 4PSUA 1YIDA 3PIIA 4ZTZB 1Z5PA 5EZSA 5DTQA 3W2IA 4YMTA 4K6GA 3O91A 4EY6A 1HYEA 1QU2A 2R97A 4CKEB 2WU1A 3BHJA 2H1WA 3CGGA 2OHGA 5FUYA 4NCAA 4PCVA 3AFOA 1GAEO 1WY5A 3QWIA 2LCQA 4IXDA 3ZBPA 1W5BA 1PWHA 3I92A 1LX6A 1T9BA 3JARA 3W5SA 5C2JB 4CIWA 5HZMA 1TF7A 4PO1A 4KRFA 2FPGB 1O5IA 1MAHA 2HCRA 5IKEA 5A6SB 3VJLA 4WGGA 4BFUA 1C1YA 4G0WA 2P6RA 3TIVA 3FCAA 4ERNA 4BIMA 2ZI6A 1V4NA 4ER0A 1NW9B 3RJZA 1P81A 3BE5A 3RPEA 3KPYA 2ZRHA 3D8RA 3JSAA 1C9EA 3NC4A 5A4AA 3LUFA 4WECA 4A2QA 1E0SA 1S7GA 3F8SA 1JE0A 3D4IA 2DUNA 3TX6A 3EXAA 2HJGA 4CR6A 4HEQA 3PHHA 1USKA 3MIZA 1KXZA 3CG4A 3OCZA 1T13A 4N0EA 3MD0A 4BP9A 3QXXA 4OHMA 3UICA 3AOEC 3IVGA 3A04A 5SYNA 4H0CA 5IYZF 3GPBA 2H1RA 4LNHA 4L8FA 4RHCA 4KIJA 2R2GA 3DG9A 1FVHA 3QE4A 5TRTA 4B87A 1FUYB 3K3PA 1L7VC 3PGJA 2DFDA 3D3EA 3WFIA 3NNNA 2WWXA 3PFKA 3ZD9A 3ZI0A 5JFOA 3KFLA 2DUWA 1TK3A 1IOVA 2QRNA 3FI0A 5FBLB 1HE5A 2GEBA 4G5YA 3BMCB 5EG5A 4BKMA 4ZCRA 1X8XA 3L3BA 1H9BA 3B48A 1XCLA 3MTJA 2ZDGA 1FQJA 4ROTA 5E6SB 1GTSA 2XGJA 1JDBB 3I4FA 2AA3A 3AR6A 3PNYA 3Q2IA 4MUAA 1SG0A 1VCMA 5FCDA 3R7WB 3K35A 5BP7A 4GPBA 2OT3B 1TEVA 1V71A 1H2BA 2A0YA 3A2LA 3EDMA 3BRWD 3GT7A 1J2YA 4PG7A 3TZKA 5K2OA 1TU4A 1RKBA 4P6VF 2QQGA 3N7TA 3LHIA 2ID9A 4KVZA 3WC4A 1RAAA 3PDUA 3W9BA 3D8BA 1WQ3A 3AM5A 4IIUA 2D06A 4YRAA 1NVMB 3QVXA 2ON6A 3IDZA 1K5GA 3T9AA 1FXWA 1ZCZA 1KI4A 2WG2A 4P2BA 5FOWA 3HCPA 5FOSA 2QBYA 4HWKA 2YWCA 4MRSA 1GRNA 2K5UA 3IT2A 2GBLA 2GFQA 4JU9A 2GCOA 4LGVA 2P35A 3R7SA 5JY6A 2C2OA 1U2DC 3NEJA 3ZQ4A 5J2TB 2W6ID 1V1RA 4WZBE 1TU0A 3WISA 5C9ZA 2IDMA 4OGKA 4RZQA 5KQPA 4PSAA 4FZRA 2C96A 1E5VA 2HK8A 3K8YA 4LI3X 4BKPA 3IFSA 3KQPA 4GMFA 4MPJA 3QF4A 4XYMA 2GRUA 4BNZA 1UT8A 1FE8A 1GZVA 4HMQA 5AW9A 2QG9A 4C0BA 5KWSA 4DR2B 4NEHB 2A59A 4BN5A 1H9AA 4YT2A 1FJ2A 2D1QA 1UDXA 1FW8A 3H8JA 1RYDA 3WYDA 4BLPA 1JSRA 4S2EA 1NP7A 3R5JA 4PBRA 5DEOA 5DNWA 3A4TA 3B6MA 4EJSB 1C7QA 3GPDG 3DSRA 2X77A 4XKJA 1TW2A 1N1DA 4FBMA 1NUSA 4UJ5A 5DNVA 2QE7A 1A7JA 3ET5A 4XYBA 3NXKA 5DW0A 1P4AA 2VXYA 3KKLA 3QVUA 5HTOA 1NVWQ 2XD4A 3CO5A 2CZQA 3N0WA 3ESQA 4HQOA 2ZR7A 2D5CA 3GNTA 2H31A 4AUMA 4ZFNA 1ZL2A 4Y2RA 4ZAYA 1A50B 4YLGA 3RHSA 1M8FA 2AD1A 4BYGA 3U4HA 2VJMB 2Q49A 3FPHA 5A3SA 2J3HA 4OUDA 1G5PA 1MGOA 1O0CA 3ENWA 2IS2A 2KPOA 5FT9A 4GRAA 3FGNA 3LXXA 1XLWA 2JFYA 2V6MA 4IMIB 3SVTA 3I6IA 4C4XA 4G5RA 1VLZA 4D4IA 2IK8A 1TAQA 1CJKC 3ZD6A 4JI1B 4FLEA 1EUCB 2W90A 3QX8A 4C1NA 4H9GA 5A03A 4HNTA 1N0WA 3T7EA 4PIMA 1PWXA 4EJSA 1U2RA 4TRMA 3DXFA 2RGYA 3D6HA 5AIAA 2BM9A 4DIEA 2OCIA 1DP4A 2ETXA 3V6MA 4LW8A 1K8YB 1JHDA 4GOOD 4M6WB 4GOLD 5CU7A 4MWCA 1U5CA 4P2GA 2JFPA 5GY7A 4JFRA 4EZIA 4OQYA 1KOJA 1R4MB 4BBPA 2R1VA 3Q85A 1UC5B 1U8XX 1RYZA 4ZQEA 2D13A 4G8DA 4Z4QA 1N7JA 3ZHXA 1TMGE 1ZOSA 2E4WA 3IP8A 2BM1A 1KI7A 2VDMB 3AL3A 4PC2A 4R2JA 1GVNB 1HMYA 3UFBA 5AVRA 5LYJF 1P6UA 2B25A 2F4NA 3BEOA 3ROXA 4OI4A 1EAMA 3TSWA 4RDCA 4R8LA 5G3ZA 5DMHA 4YS6A 5HF8A 3WRYA 1M5RA 3FVTA 2PUEA 3M4JA 2VRCD 3D3QA 3ZGLA 1XZGA 2O2XA 1D09A 4OV6B 4G0QA 3DLCA 2Y9MB 2I9KA 5KWVA 2FPMA 1MJGM 2VXCA 1K0FA 1OFUX 4JFAA 1XN4A 4PONA 2Y0PA 2WUFA 3LT0A 2IHZA 1SM4A 5ES3A 2WIJA 5B36A 5MHTA 3ND9A 4TZKA 4C3OB 3K0FB 1OH8A 1JFRA 1R9GA 4IOKA 4EA8A 1CR6A 3IUSA 3A1VA 4OQQA 1J0DA 2FSHA 4YRKA 4FXOA 1DLJA 4RGBA 5GZ3A 2O5EA 2OWDA 2JGJA 3KJNA 3B2EA 3FCCA 4MW7A 4OK5A 4TMWA 1Q11A 4UM9B 3K7EA 3M9LA 2ZZNA 1UBKS 3BTUA 2C8VA 4J90A 5H4GA 1E2GA 2O06A 1PFYA 5JDCC 1IHYA 3ZJ4A 3S29A 4DABA 1SBYA 5TVGA 3HRIA 5F78A 4FW8A 1T6YA 3LQRA 3AI2A 4WVLA 2I3ZA 1QFSA 1M74A 1X15A 5JZBA 3I6ZA 3K70D 1Q50A 2VDWB 1ZSNA 3IXLA 3THSA 5JRZA 1H9CA 3KALA 2IBMA 2NG1A 4B7CA 4G4GA 4W1QA 4YH1A 4H6XA 3IQFA 1LQ2A 3IQIX 4U7TB 1PEDA 4Y1RB 2JIOA 1SXIA 3HYSA 4IHQA 3FYUA 4G01B 4HBGA 1R1DA 4GYWA 4QUEA 1F9EA 1HL3A 4L22A 2OSBA 5F7OA 1LLCA 3U4DA 2WD7B 5K6RA 1NASA 3F1LA 2ZS8A 3BXZA 3PWTA 3WL5A 3VOAA 1T4MA 3I1FA 4DQLA 1QLHA 4MOWA 3AJDA 1JBKA 2XKBA 1G3IA 3C4VA 2GNAA 3PEVA 5DBGA 2QVZX 1KY3A 2XF2A 1QVWA 4J0DA 3DONA 3N2IA 2W37A 4AZSA 2ZIUB 2EL7A 5C7YA 4D3ZA 1LI7A 2UZ0A 1SULA 3CLKA 4PNPA 3ZGZA 4BFZA 5CK4A 2ZYAA 1ZIXA 2P4EA 1QHEA 4NCJA 3PUWA 4Z0PA 4Y2UA 3KUUA 1RHUA 4OSEA 3KT3A 4EGJA 3H2YA 3T1HB 3EF0A 4YDRA 1QO9A 4C3ZA 1P1KA 1OU4A 1UDAA 3IUYA 3USES 2RHMA 5B37A 1WCIA 3EH2A 1EE2A 3MAJA 1L7NA 2BRUC 4URYR 4GWLA 4JJGA 4EPXA 3BQNB 3E61A 4AP6A 5D3KA 3UMFA 1AQIA 1E1RD 2VRWA 2YNMA 3AGPA 3MJTA 4HO1X 3PC2A 3ZZ1A 4G89A 1GKLA 3BHNA 4Q12A 3V3TA 4PYJA 5A4IS 1YQTA 1I8TA 2YOHA 1ND5A 3BIWA 1ZVVA 2R7LA 2YR0A 3AEUA 5KYYB 2VP0A 4NH4A 4Q7JB 1BHO1 1YZGA 4EHDA 4F9GA 2DERA 3OU2A 3P9XA 3QLUA 1TGYA 1Q3KA 4Y2HA 4JI6B 3TCXB 3KJIA 1VL6A 5IDQA 3OF2A 5D8DA 2O8BA 1QQTA 1OFHA 4ZCTA 1T24A 3GFTA 4OIFA 5EUBA 3A7DA 4AJOA 5HJ5A 5JEEA 1VDMA 5KJFA 4D25A 1SELA 4JR1A 1NNI1 3FH0A 1PGJA 2XCLA 3N1UA 1US8B 4J16C 1ZUHA 1OXVA 3BB4A 4WBNB 4FMCF 1JN0A 2FSVC 3DBVO 3WV5A 4KFUA 1NRWA 5JNWA 5H3CA 3KWMA 1QHHA 2F3TA 3WL3A 2VDJA 1E2HA 3VU8A 4E88A 2IYNA 3KR1A 1JAYA 1SCKA 4MUYA 2FQYA 4W4TA 2IS1A 4DCJA 2RB5A 1Y5NA 1K3UB 2O1EA 1JIQA 1ZH2A 2C9CA 4KITB 1JEYA 1FFGA 4Z0TA 5FF9A 3VPFA 4RLFA 4KMOA 5JJ5A 1EQ2A 3ES9A 3NLLA 2OBLA 2VPWA 3DBHA 2D1RA 2CXXA 3V42A 3EXFB 4MUIA 1ZXLA 2WZDA 3SE7A 4C01A 3KYJB 4HDMB 3TKAA 4E1AA 4ES6A 4P4NA 4ZYTA 1OT5A 2WJVA 3FHCB 3OE5A 3R76A 3TZ6A 2Z3VA 2FX2A 3W4IA 2GA9A 1Q2XA 4RD2A 2ECFA 1IY9A 3CWZA 4KR9A 1PGQA 4DSZA 3CCFA 1Y8AA 1EH5A 1GZ6A 2DECA 2OGZA 5JD6A 3BQMB 4I9FA 1VLLA 5LIRA 1L4BA 2O5VA 1V9CA 3WNBA 1JAIA 4QPJC 2UVPB 1A2QA 3OQ1A 1QHHB 2NVBA 1BYIA 2P9HA 3KZKA 1MA3A 2EWVA 3GWZA 5JQGB 4NONA 4PO3X 1J42A 3WL8A 1IEWA 3KTDA 4LBYA 1AZSC 5IT9A 1K7XB 3S2EA 2AIRA 2HTEA 4ARCA 4LSGA 1HT1E 3DW1X 4JJ4A 3WGLA 4OHKA 4AF7A 4IDHA 4DJJA 3DZFA 2MSKA 3FJYA 3M6WA 1KYIA 3VC7A 5KJEA 2P4QA 3T9FA 2JPDA 4B9AA 5HM6A 5ILGA 2I2XB 2R4QA 3CH4B 3DVSX 3OC6A 2C97A 3R3VA 1AGNA 1Y7LA 1RWWA 2WYHA 3S3TA 2V7QD 4C0KA 5EMHA 5KPDA 3Q7EA 1P2BA 1MW9X 4WKNA 1FSPA 1YZ3A 4XCQA 3ZJUA 3G0HA 3H9GA 3IOBA 3NU1A 3HDGA 1QGDA 4IJKA 4M53A 2PQMA 2X42A 4ND2A 1C5KA 2WHPA 3H84A 4NYJR 2I3AA 3S2UA 3AETA 3ZGNA 1BWSA 3GDOA 4KMRA 4OQZA 1JUDA 1JG6A 3OTWA 4Q9AA 5FLEX 2WTAA 3UOAB 4CUKA 1DIGA 3LHKA 1ST2A 1WD7A 4F9EA 2CHUA 5EE5B 1MU0A 3VSAA 3QFFA 4YMVA 1KO4A 3FNHA 5A71A 2FPIA 2ZSFA 4DMMA 3W2EA 4F5WA 4F8JA 2CFOA 2IQIA 3EJWA 4NFSA 3G6WA 3DTVB 4NBRA 5CH3A 2ASVA 3BXEA 2IZZA 2BMAA 2ZWVA 1RABA 3KCQA 3VVMA 1Y0BA 5B6PA 3UPDA 7GPBA 3Q5GA 5LOVF 5KKAA 3ZCXA 1FDWA 3ZE1B 4MB6A 3AXTA 3CVVA 1XZFA 2V6JA 5EHZA 2HADA 4XD7D 5KI6A 3VAZA 2AYXA 1XQ1A 2CUKA 5KX5B 1J06A 5FOXA 4CKYA 1C0PA 3KAKA 2E4VA 1KDYA 3RHZA 2WTUA 9ABPA 4CF7A 1CLEA 1CUFA 1GG9A 4BP3A 3DCJA 3CRMA 2BGIA 3GBVA 3PC4A 1HE1C 4LEIA 4GL2A 3EGVA 1AXEA 1K6IA 1Y9ZA 2AR7A 3OPXA 5GMOA 2J48A 3T6KA 4NLLA 1ZGCA 3M5WA 4K3VA 1TJ3A 4GS5A 4L5CA 4MROA 1Z39A 4ZTBA 3C39A 3A6HA 3EXHC 3IEIA 1BHQ1 1XDZA 2OBFA 2PTHA 3N87A 3QEJA 4WXHA 6NULA 3EZFA 1HKUA 4JEMA 2YY6A 4P82A 4AAYA 4UVGA 5EP4A 2X41A 1FB5A 2RKWA 4I8DA 4M2LA 1OZGA 4BQPA 5HHTA 4BO9A 2QIOA 3BXPA 2OXFA 2AG8A 4NCIA 1N0IA 1DXOA 2Y77A 4R01A 1ZP6A 1AMOA 1WMFA 4XEUA 1DT3A 2QIPA 4BZWA 4EELA 2Q5EA 4WKOA 2H0AA 1CB0A 4HH4A 2PU5A 2IUTA 3TPCA 3I52A 3KQVA 2DBZA 2ZVDA 4G1VA 3P0FA 3R9KA 4R81A 4CCSA 1FJHA 3RVOA 4A92A 3FCXA 4NZYA 3W5IA 3WY9A 4OLJA 1NUPA 1OPRA 1ZJ4A 3DZIA 3C97A 3RFVA 1M72A 4XVRA 5EYPB 3RKSA 4WERA 1QZZA 2JRLA 1YBAA 2ECQA 3QF4B 4MRPA 2EBUA 3UKDA 4C76A 3CTMA 2OFFA 4EO7A 3LPLA 3WIEA 4EABA 5KTYA 3L41A 5FR2A 3E8SA 1A04A 3GD5A 5JMOA 3SXUB 3FZGA 4RAQA 3GT3A 4O6VA 2NVUB 1H4SA 4W1SA 3IKMB 5AW0A 4M37A 4WKCA 3TJMA 4FHGA 5CBKA 2Q2QA 5LYJB 4ZZ2A 4ILEA 2ZWPA 2NYAA 3NG1A 2GZDA 5KS2A 4IEFB 2QBYB 1SC3A 2HEGA 2V97A 3NOOA 1COZA 3EBPA 5ENVA 2JCVA 2ISSD 1JILA 2JAOA 3N8DA 5DCWA 3ROGA 5MGBA 4K6MA 1KMCA 3E8XA 3VU9B 4GZ6A 4OJTA 2P1ZA 3URMA 1RQNA 2GK7A 4J7UA 2JFXA 4TXMA 3AO0B 4Q7LA 4W8GA 4L95C 2CBZA 3VU0A 1KHHA 4NZ9A 1L5NA 4A0SA 2EF1A 1NGSA 2VFAA 3C16C 1Z4JA 2BBSA 2H7CA 5DE3A 2HAEA 3DDHA 1Q16A 5CP8A 1R4MA 1SBCA 2VSQA 3FVQA 3ILYA 5BSVA 1DC8A 4YQZA 1QXSA 4BGEA 5HQ3A 2VHYA 4NNJA 3E9ZA 2OO5C 4BVEA 1Z73A 2PD6A 4TRRA 3S2FA 3HUDA 1R8XA 2PRIA 2VT6A 1FMTA 3HM2A 3PNKA 1BCRA 4KKVA 4D26A 2VHXA 1A27A 1A5BB 1TO2E 5EJMA 1FUEA 1AHIA 2FFBA 4CXMA 1GZ5A 3JR7A 4ZVLA 2PIDA 3FWYA 1H93A 4QT4A 3VR4D 1DKNA 2R66A 4LBZA 5JDIA 3RTGA 1U2TA 3F9IA 3L93A 2X1MA 4XTRA 2B5OA 3L43A 5HKAA 2FEMA 3HB9A 1VPVA 1LBQA 1NJ2A 2E4AA 5F76A 4CKWA 2W2MA 1JEQA 2OKCA 2WP0A 4M7OA 4UBMA 1KQ3A 4QBKA 4YALA 2OV3A 3TNDA 2C7QA 1KJYA 2IE8A 2Z8YA 3O6VA 1U3VA 4B48A 5BN5A 1IUNA 1DRUA 2I7CA 4KDCA 5AWFC 4E5DA 2CFIA 2QX8A 4FKMA 1NI3A 4JYZA 5JCOC 2DLNA 4MZXA 3I3OA 4FXPA 4I55F 4FR0A 3NIFB 4PY2A 1ZC4A 1NVDA 2IVZA 3RV4A 4AF6A 1OWNA 4NMHA 1CERA 1XF1A 2XEXA 2OB2A 3KBBA 2LWIA 1P2DA 1SPBS 5ALZA 2IZ0A 4EB3A 1PW5A 2I1QA 2AX3A 1MPTA 2X8AA 4OX9Y 2IBSA 4MV7A 1QIEA 2PWAA 2DQYA 2VHVA 5J2TF 2MSCB 2NZ2A 3DBLB 4NENA 3CVJA 4TQGA 3PHJA 4P5EA 1I6LA 1NL3A 2EGUA 4Q3OA 4RF5A 1X3LA 1F2TB 1SCDA 3NHZA 4PPYA 4U39A 4TTIA 3F90A 2FSPA 3SEAA 4FCTA 1QYXA 4R8KA 3A9UA 3RF7A 4ALLA 4KPGA 3N0RA 3D8NA 1X9IA 4HRXA 4BNKA 3OCCA 3R3YA 4ZVMA 4DSAA 4QBGB 5KNCH 1CEYA 2W6OA 1GQOA 3ZDDA 1XNHA 2VP4A 1L7XA 1T2EA 5GONB 2FPOA 3GW8A 1LBIA 2XMGA 1Y8RA 5K8TA 1O94D 5I7AA 2BFBB 4QDJA 2KMLA 3KEMA 2XDYA 2XUQA 3OOWA 4EG8A 4HZUA 3CG0A 3KS9A 2PGXA 13PKA 4R1OA 4YRPA 3TW0A 1TD9A 1RKUA 3T1OA 4IMPA 1OR8A 3L8HA 2XRZA 3L8GA 1IRXA 1G8HA 5CB4A 1DO8A 2B2CA 3MMXA 1FVFA 2PS9A 2OCDA 3G68A 4BFCA 1T5OA 1T8UA 4IDBA 5JWOA 2HDWA 3BZWA 3RLIA 1KJNA 4DDUA 3UBTA 5AH0A 1GGJA 4KB5A 3HUFA 5KKNB 4LQDA 4G5QA 4NHEA 1EFKA 1R0BA 4M9XA 5E7MA 1U7TA 3FHTA 4J1SA 3LWDA 1A72A 4IUCS 4GKJB 4N5IX 2IIPA 1BH2A 2KSQA 1F2UB 3F5FA 4WN3A 5EIBD 3GFRA 4DQDA 1ZCFA 5JSUA 3ZWXA 1JQ3A 3W7AA 2I6QA 2OZKA 4WJKB 1A4IA 7ADHA 3HTXA 1IE3A 3RROA 4INZA 1ZOPA 2GZ1A 4QFCA 4YJ3B 1A9SA 2GHRA 4L07A 1RXEA 2GK4A 3LGXA 3S99A 2QQFA 3STYA 5KQRA 2XMDA 4KO8A 1VSQA 3KR0A 4LJSA 4IVQA 4BS9A 2HA7A 2DR0A 3MTDA 2ATIA 2B36A 4LHYA 3LKZA 2H11A 1NI5A 3U1TA 1I14A 2IOFA 4JJIA 4Y1RA 3JY6A 1R74A 1RDFA 4QUGA 1GIAA 3H2SA 1D8TA 4NCXA 3ZWQA 3U5TA 2A9JA 3TVYA 3EVTA 4ZCPA 1N2HA 2XXJA 3OZSA 4JITA 5B7GA 2XMRA 5FTKA 5TARA 2AXPA 2M1ZA 3EZ2A 4W8OA 4B8WA 3DMPA 5D6OA 4B82A 3DLBA 3KP1A 4N7MA 4MMYB 3L1KA 4G1BA 3HYNA 4UQLA 1KKLA 2F6RA 3HP7A 4IINA 2J7KA 4G36A 2C9MA 5C34B 1F4PA 1RRCA 2FH5B 3ROTA 2NACA 1F5SA 1PGOA 2IEAA 2OENG 5CNKA 4A1FA 3CA8A 2ZRDA 1P3JA 1ANKA 1SBHA 1XELA 2CDNA 2N47A 3LT5A 3QPWA 1VP9A 1LA2A 4FYPA 5GVRA 3MTBA 1ZYUA 4H1HA 3A31A 2HSZA 4LRUA 4LTMA 2WSYB 4YCLA 2C3UA 2QMQA 1I3LA 5CPBA 1EDDA 1FK8A 2ATEA 1E8DA 2ZJ3A 4I9HA 1MGPA 3LFUA 3P9PA 3NVDA 1EM6A 2GLTA 3UUEA 4CM8B 2VAXA 4X95A 2FSUA 2GD6A 4Y8VA 1WW3A 3EE6A 2AUMA 1I36A 1D04A 4G4JA 1C30B 1XLUA 1NMZA 2W6ZA 1EVQA 4PANA 1OA1A 5A5GA 1MAUA 1BJTA 4ACAA 1T9ZA 5DYNA 3H4VA 4HI0E 1QR2A 3QUCA 1K6EA 1FDUA 2GR9A 1E2LA 2QRZA 3T0GA 2ODEA 3DDCA 4RABA 5ARCA 4YXWA 3TLYA 3UAVA 3UT5B 3TLGB 3W05A 5H3HA 4EITA 1OI3A 2GD0A 3P2MA 1INLA 4Y2TA 3FDZA 3QOFA 4AQYB 4U8HA 1ZRNA 4G4SP 4DWJA 4EHJA 3AG5A 1UOPA 1H85A 2CK3A 3RAEC 4BJ6A 3OOYA 4QGGA 3C6BA 3M3HA 3QPDA 1WUKS 1GGMA 1JYFA 4RK7A 5DYTA 5K4GA 2XCIA 1IXSB 4XE5A 1V1RB 3RS2A 1N8SA 4R8MA 3WB1A 5IS2A 2WU4A 5AI0A 2BEWA 3LQYA 4AQ7A 3KZVA 1VG0B 1E79A 3PL5A 4FJ1A 1K66A 4URVR 1KKUA 3W2GA 5TGDA 3TM4A 3TK1A 2Q21A 1Y7HA 1T10A 4E12A 1FFYA 2NVOA 1BW9A 1YI1A 3HY6A 3B1FA 3V2HA 2G82A 3SJUA 2J59A 1X7YB 1W30A 4NDAA 1QHIA 3GZNA 3MS2A 1BEZA 2ZYGA 5SY4A 2FEXA 3TW4A 1NN3A 5G1OA 4WFQA 3LS2A 2VNSA 3ZHQA 1ARZA 4CLDA 3IGFA 3B51X 3QELA 2DMRA 3NHKA 3L8ZA 3GIDA 1NF3A 1SEPA 3PD7A 3PR2B 1U11A 4E15A 2UXBB 4TWZA 1TUGA 1U7XA 1YFJA 4DLRA 4NCHA 1C9JA 1VZ3A 4DDHA 4QOFA 4EUKA 2ZIXB 2AG1A 4MK4A 5FBQB 4EA6A 4WBNF 4NG5A 4OO3A 4ZAZA 3TIFA 1EFRA 3KB8A 1HPLA 3HWRA 2OGWA 3H5TA 5H0IA 1VPWA 1BVRA 3HVKA 2FTKE 2UYOA 3OEYA 4D42A 5JLJA 5KDDA 3KT8A 2I2AA 5IUNC 4F6LA 3FMPB 4DEXA 4TL6A 2Z5VA 4UNSA 1NLZA 5ENZA 4TV8B 2IYOA 1TM2A 4LOKA 3TD6A 5E2AA 2RDMA 4QX6A 1A4RA 3Q88A 5AI8A 3OFKA 4B80A 3FOFC 4FOPA 4QQNA 4BWVA 3OIVA 4RPHA 1WD5A 4MVYA 3DV0B 1YQWA 2G77B 5K8CA 4W5TA 2OCAA 4ZYUA 4Z1MA 3UB3A 1N3LA 5JFGA 2P68A 3PS9A 3QM1A 1E6UA 2AI3A 1Z6YA 1PV2A 5ALYA 3QUQA 3W5VA 3TXAA 4BFSA 3MIIA 1RXWA 3ASUA 3I2HA 3MD9A 4XGNA 1H6CA 3HXTA 4TKUA 1GGEA 2E4UA 2O20A 3ADOA 3LY8A 4II2A 4RY9A 1XVIA 4DLNA 5IT5A 2QMYA 2EAUA 4ZAFA 4O3FA 4CKCA 5F2KA 4I5FA 4PQGA 2XUPA 1UEJA 3A9RA 4RC9A 3A3OA 1N7IA 2PKEA 1F0NA 1ID1A 2VHJA 3ESAA 4JJEA 5F1OA 1TVMA 3DLTA 4DJDC 2PWYA 2EP7A 4N5LA 5K1ZA 2A1TS 1UQUA 5SZIA 1BU8A 1KAEA 5BT8A 2D6FA 2Y27A 2ZIFA 2YS6A 1DRWA 3OIUA 1QMGA 5T64A 3UJNA 3L0YA 4RTSA 3EW7A 4OH1A 3C8ZA 3RKRA 1AHHA 1M5TA 5HF9A 3LBAA 2JEYA 4KR0A 3RS4A 3S1LA 3AM3A 4HV4A 5JAHA 4M98A 4B6GA 3R4CA 4ND5A 1JSZA 3O7WA 5B3LA 2VJQA 2AG5A 4JLNA 3GD7A 4FM9A 4IKPA 2B6NA 5ALWA 2SKEA 1B41A 1U0HC 2Q9UA 4DBZA 5LQNA 3ICOA 4DNFA 3DZHA 4QBHA 1PTJC 5CX4A 4RD4A 1MG5A 1LXCA 2KB0A 4MR8A 4R1QA 4DJEC 4CLOA 1KS9A 2EX1A 1Q0LA 3QXCA 3OA0A 1BO6A 1YB2A 4KIGA 1EWTA 4OX9B 2FN3A 1NJGA 1JHZA 4YK7A 1N9GA 5I6DA 3CPJB 5JS7A 2RHCA 2WOOA 2BDUA 4I9UA 4DV0B 1KYWA 4YHHB 2X9LA 3HU5A 3EAQA 3QITA 4OSPA 4Q15A 5LJIA 3UCEA 1CUDA 1V3VA 3V8VA 4EKYA 1TT5A 4FFBB 3UAOA 1OXBB 1SEVA 4CLRB 3IR6A 4YUXA 1ONBA 2PDAA 2ZUWA 4MV6A 1ZESA 3SK0A 2A5LA 2ZCUA 3QJ5A 1C2YA 1S4QA 4GPTA 5IBRA 3VNSA 5BRJA 4OHPA 1Z82A 4JUIA 1QV6A 2P5UA 4WFIA 3QVGB 2ZB7A 1TCUA 1XK6A 2ZW9A 1I0LA 2EZ8A 2NO4A 1IJKA 7AT1A 2CLIB 3JYPA 2ECOA 3DXZA 3TEMA 4FHFA 1NXVA 1T5SA 4HNRA 2FGJA 3NGXA 3MEQA 2JGRA 1PRYA 2A5JA 2IEGA 2VUHB 4UTZA 5GTDA 4I9GA 4KN5A 3ZX4A 2EZ4A 3QELB 2VUTA 3WRXC 2D0IA 3VR4A 1KZ9A 5HKBA 9GPBA 3ABIA 1X7HA 3V4SA 1U9JA 4D1YA 5ITVA 2DP4E 5BW5A 5K3CA 5KNBD 3RYCA 1NW8A 5K45A 1P7YA 1SVOA 1VLHA 2F43A 2O0LA 3EHDA 3JRXA 3QBTA 5FUBA 1XZQA 1NNLA 2GYUA 4ZOCA 2ZQZA 2QTVB 2YH2A 4DA8A 1KOFA 1MHPA 3ZV4A 2UYQA 3VPSA 4LXTA 1XX6A 4NRDA 1QYVA 2R6GA 4X8OA 2RH4A 4YLYA 8ADHA 1O94C 4FR2A 5KREA 3V2IA 1Z2AA 1XROA 1W96A 1NZJA 2YJTD 3KHKA 3L7MA 1RBYA 1MC1A 1MJ5A 1YR2A 2WAAA 3EZYA 3NAGA 3N8IA 2RGWA 2AFIE 3P9RA 4IL5A 4N01A 4O2RA 5K3AA 5A7FA 1M6VA 4NULA 1OROA 2IHKA 4RIEA 5IKOA 1NU8A 5UKDA 2E0IA 1DG9A 1OLXB 1SVUA 4EOGA 4QATA 5KO2A 4IR7A 2DLDA 2XWBF 5AOCA 3D43A 5CFQA 3SKYA 2P6UA 4WKPA 1TK2A 1XRNA 4MWEA 3UMCA 3JRWA 2X4DA 4QZVA 2IY7A 1T1JA 4GSYA 2RGNC 3TLZA 4MKRA 2YZ7A 1FZTA 3LA6A 2AUNA 1IMOA 1A9TA 2G8LA 1E1MA 3ZXIA 3BRQA 4Q9IA 2VSFA 4BV8A 4ZT5A 5AW4A 1V5GA 1M1YA 1XEAA 4YJFB 4WXYB 3TL3A 1Z18A 1U9IC 2JK1A 4N5DA 4YFYA 2B0CA 3ZY6A 4CM3A 5SV2A 1GA6A 3VJRA 3FB4A 2YMQA 1MENA 3B6KA 3PPIA 4UPDA 1H4VB 3QYFA 4M9ZA 4UNIA 5DGDA 5E4YA 3AHFA 4UARA 3ZJ5A 4J0JA 1DAIA 4HYQA 1JGTA 3AG6A 1GUAA 2C4MA 3DCIA 3HVHA 4FT4A 1WU8A 4JBNA 1GM5A 1OC4A 1WSWA 3WYGA 1AD2A 2ILTA 4HXEB 5FLKA 4KWCA 1M2KA 1YZUA 4UXJA 5D87A 3SIRA 4LZNA 1YQXA 3DTYA 2BT4A 1FSZA 1RQ7A 4NV1A 4UUNA 4ZI2A 5CCBA 2CD7A 4ERXA 4TVOA 1DCTA 3QVGA 5HFAA 1K27A 5HWSA 2E4YA 1K8ZB 2Q3EA 2Z2IA 2ZUBA 3BSFA 4FNGA 1KDZA 4BX3A 3O3CA 3RRMA 3AILA 1PJ2A 4I4TF 4IX9A 1B93A 1DC6A 3QVLA 3N7AA 2F1IA 2ACKA 4HP8A 2MCFA 1Y9AA 2O5CA 5FB3A 2JW5A 4BATA 2Y93A 3RS5A 3KEGA 1HC7A 2JLRA 1SZPA 2QL5A 3G85A 4BJHB 1JBQA 5CDHA 1M34E 2FZVA 1XA0A 5CJJA 5FTJA 4MQEB 4RHUA 2J67A 4AY4A 4XGQA 2C83A 1FMJA 1ESMA 2XH8A 3DB2A 1CDDA 4XX0B 2AWOA 5JDCA 3UJBA 1G18A 4EL0A 2HC9A 4AN0A 1AK2A 2YX1A 3GLHB 1UKVY 2COKA 2QU7A 1CF9A 1TQDA 2B4QA 2C1XA 2W58A 1X8KA 2WJ3A 2ZTMA 4KTTE 1C8KA 1SUIA 2NSHA 4HUJA 4JI0B 3C43A 1SOUA 2AH5A 4RWZA 4CFYA 5F7XA 4O25A 4MICA 3UQYS 4BNWA 1OLUB 1XTTA 1LDYA 3MWJA 3N2EA 3K6JA 1X80A 2ZJOA 4LJKA 1B7GO 2VYQA 4PN7A 3T1TA 4UOEA 4YBZA 2G9VA 4Q3AA 4WBXC 1E2IA 1JQBA 1C4KA 4Y6OA 4QFMA 4B74A 2V0GA 2FE4A 3T95A 4CKWB 3CZAA 3E58A 1S5PA 2FMXA 1E3LA 1XVLA 4KSYA 4DB4A 4FS8A 2POCA 3L01A 4FGLA 1FBNA 5A0FA 1E3QA 3HSYA 2I4OA 2RG7A 1W0CA 3Q7PA 4YB8A 5BSTA 2B37A 3U7EB 1UBHS 1RI1A 2OHXA 4BLSA 4DWVA 1JTEA 4RM3A 1CUCA 3PQCA 3VR5H 4RXTA 4A6DA 5LIPA 4NZMA 3S70A 3ZIAA 2IV2X 3N74A 1PEYA 3MJEA 1XZAA 1Y34E 5JHHB 3DBIA 3KU4A 5BMVF 3A6DA 2Q3MA 4HPWA 4M38A 1YWGO 4NS4A 4MTCA 3NHLA 4URZR 1F1BA 4C6TB 1YSCA 5ALHA 5H80A 3UCXA 1B8PA 3DAHA 3X2EA 2Q1XA 4BEWA 1EUQA 2C5AA 3AF3A 2GBGA 1WETA 3DTVD 4F06A 1OWOA 2CNOA 3JAWA 4IJWA 3OFSA 1POXA 3B1VA 4JH0A 1J1ZA 3L8CA 5KYTA 2XNSA 2WIGA 1D8AA 1EP9A 1AK9A 4JJZA 3H11B 4A3SA 1MJNA 4DLZA 4RL6A 3VJMA 2GN8A 2WQZA 2X8WA 1RRPA 4MJLA 4YYZA 1AUVA 2ZJ0A 3LD9A 5ALIA 2WSLA 2CVQA 4X20A 4DANA 4O4IB 4Y6LA 5FNZA 2YXDA 1PCXA 1VXRA 4PLFA 1Q7TA 1UJCA 5B1SA 1J2RA 4QUAA 2HR1A 3L07A 1G2IA 2HWUA 3HC7A 1GXSB 1XMSA 4FGSA 3IMGA 5CCDA 1JI0A 2NIPA 3GFVA 2ZIGA 1PIWA 3K4HA 2MSWA 3ELYA 4IDFA 4HFMA 4U0JA 4B47A 4BNIA 1R2QA 1QIDA 1IWBB 1ZM2A 2OHOA 4CTMA 3F0TA 2AZTA 3W3AH 4I1OA 4YRQA 5DP2A 4CYMA 3CEJA 1PT5A 3QMPA 4RVHA 5H9WA 5JNVA 3UTDA 4DTIA 2ODNA 4EVIA 1YS1X 2JI4A 1TM1E 4HX5A 2ZRFA 4PG4A 1E8MA 3BE8A 1GNTA 2OC9A 5FWAA 1XALA 2RMKA 4YCAA 3DNMA 4ZAGA 3RVLA 2E7ZA 1X38A 1D2EA 1XZDA 1QFXA 3S7TA 4DCPA 4OKNA 1ZK0A 3SE0A 1T26A 2KM1A 2WK1A 3FFAA 2C7RA 2CF5A 4EI9A 2CJFA 4HEA6 4CTNA 4QOSA 5JJCA 4M0DA 4Z7QB 3IP3A 2QW8A 1X7YA 1ZH0A 2FETA 3D4PA 2UYCA 2Z9CA 1DKMA 2DSNA 4K26A 4XOIA 4B73A 1TYCA 3IKTA 3AFNA 1CJSA 3FCSB 1MABB 1NYRA 3PTZA 4LQLA 1OFGA 4BJ5A 4YCSA 5GJCA 1TT7A 5CB6A 2QROA 2BMWA 3GFBA 2W2TA 2ZU0C 1SHUX 3OX4A 4OTZA 4P32A 3HBNA 4EO4A 3K9BA 2C42A 3I2FA 4IBOA 3H6HA 4M8SA 2QV0A 1QH0A 1WXHA 2IYRA 4RTRA 2JGEA 5JZSA 4N6GA 1MUUA 1PJBA 1LUAA 4E03A 3EJ6A 3ZDBA 5ALKA 2A0UA 1YE3A 1YB5A 1DAHA 2NZYA 1GU0A 4ICIA 5BV7A 1PG5A 3SM9A 3E7PA 1R9MA 4E4YA 4ZCIA 1VCNA 3OJXA 3NJ8A 5DNEA 3ETEA 2RGRA 5KTPA 5TV2A 1W49A 1WUTA 1IL0A 5SZKB 4H7FA 2EG5A 5ALSA 3IEMA 3PPWA 1GFZA 2ZRIA 3ICCA 2JJMA 4YFVA 2O1SA 3JASA 4PE5B 3QX3A 3GJ0A 4B0PA 1FRFS 4TV8F 4BIIA 3HO1A 1L5QA 3IO3A 5E2IA 2FSIA 4RZHA 3VR6D 3KQQA 4H1TA 4DNQA 2RK6A 3JQBA 4DSUA 1KEEA 2NPIA 3PA8A 4ZZIA 4DDMA 3PGXA 3BF7A 1EHYA 2OFWA 4BNHA 1HNNA 1EGAA 3B8HA 1AU9A 4U7WA 4C6HA 4XDZA 3PD0A 1W88B 3BXXA 1P1BA 3IMKA 2Y05A 3HBMA 1HLGA 4RPLA 2X5XA 4HGQA 5GV8A 3KRTA 2IP2A 4FFPA 5E4TA 3ESXA 3ESYA 5FTMA 3B9PA 3A6EA 2W2KA 5LUBA 4GYKA 5JNSA 1P4HA 2W8BB 1RM3A 4OHFA 3F96A 3R5SA 3TSAA 2ONZA 2XOEA 2TRSB 4G23A 5CB0A 4DR6B 3DDWA 1H65A 1KO1A 4Q3BA 1GSOA 5LU9A 2Y1EA 1SXJB 2CW5A 1D2CA 5EJAA 2WB2A 2OPHA 5HPYB 1C3XA 3IIKA 3BL5A 4OQPA 3HJNA 4LJRA 2WC1A 4LC1A 3L84A 1K5PA 5DM60 4PC3A 3K9QO 4RPGA 5GIPE 2BSQA 4BE7B 1F5NA 4JELA 4IQ4A 1BW9B 3NKFA 1DUSA 1YRQA 3LVRE 1IATA 2FFAA 7MHTA 4GW3A 2F3SA 2AD5A 4DJTA 5IYZB 2QTVA 4LRSB 2RJNA 5JCJD 3UG7A 3UA3A 4CE6A 5FP0A 1C9NA 4EG5A 1YNSA 4NAHA 3UFXB 1DC3A 2FUEA 3IAXA 5CA0A 2GSWA 3M4XA 2GZHA 1PJLA 1OFIA 4KXMA 1F60A 1YQQA 3MBKA 1VI6A 4PXAA 1GAXA 2VSXA 2NN3C 4BUZA 5FOVA 4MUXA 1FTYA 3RSQA 5AI5A 1EYZA 4N0PA 4D9NA 1G9XA 1QMPA 1SOMA 4X6YA 1OVGA 3GQVA 4E94A 1WVGA 2A0XA 3GJ4A 1DO2A 1GN8A 1WDMA 3A14A 4NS1A 1JAXA 3HL4A 5CT4A 2Q7XA 3TFWA 3U61B 3ZCSA 1XDSA 4KOEC 3V1LA 3IVXA 1ADBA 4DSNA 1LDEA 5K05A 4CM9D 1Q84A 2CLHB 3C3EA 1RQPA 4DN6A 1A7KA 4QQRA 4C0QC 3BH6A 5KQLA 4DXDA 1NQOA 4GG1A 4RVOA 2F00A 1DQRA 1IZ0A 2ZE7A 3GRKA 3N53A 4OXNA 3QOXA 4BGIA 2P77A 4E5YA 4N47A 3K0AA 4D46A 4W8HA 3GBPA 4H1UA 4R51A 5KYXA 3CX4A 1KIFA 1Z5NA 1OPXA 3HFGA 4P92A 1UFKA 1UFRA 4KRXA 2OUIA 1OHHA 3GYGA 5E8RA 2JLVA 2WTXA 3IP9A 3HHPA 4AKHA 4MHTA 4HVCA 2OKGA 1OSNA 2QTBA 5IN4A 2JD1A 4L5YA 4HG2A 3O8DA 1U7OA 3HUTA 2LDXA 2PGAA 2RBGA 3U4QB 4PV7A 4R0NA 4YJ3A 2IYTA 4B1FA 2RAVA 3ZOZA 4MJ7A 3H3XA 4R2KA 2P7IA 3PFCA 5DP1A 5B1DA 2ZRCA 2IDJA 4CIBA 3DOEA 3RU7A 3UWPA 4AVYA 5LM3A 1NJ8A 3N9IA 1CW2B 2B20A 3CWCA 1UP6A 1VZ2A 2L42A 2YZNA 3I3SR 3AY6A 3N76A 1JFLA 1E61A 5IKMA 1QH9A 1JSXA 1SZCA 4DRZA 2W4IA 1QUEA 5LSAA 2HWXA 3JQQA 2HQOA 2LKCA 3FLEA 3ZH2A 2PS0A 3UYLA 5EE9A 3DAOA 4D99A 1LBEA 1BS9A 3BEDA 2Z6QA 5DCYA 1PT6A 1W36B 4O29A 3K2QA 3B85A 3W6UA 4A0HA 1OLXA 4J2TA 3WJAA 1P4RA 2FRDC 4R16A 4F3TA 1ZI9A 4WBSA 2Y8EA 1FRQA 2B1RA 2QE7D 2C3OA 4DJ5X 4B4UA 6PFKA 1IUKA 1A5SB 4UTNA 2OFXA 2JCBA 1JVNA 1KDVA 5DM2A 5TEWA 1XNRB 3KKKA 4WX2B 1EK6A 4RELA 2QX7A 1ZN7A 4XIIA 1U0GA 3VYSB 5GZ1A 3WNQA 1ZN9A 1T9GS 5TMBA 4CEJB 1N33B 1EEXB 1O2DA 4XWOA 4V39A 1T25A 1M1YB 4YJFA 3V7FA 3SVLA 2VDUE 1JRLA 1V47A 3D3WA 3WMEA 2GYYA 5IVHA 1NJ1A 1P8JA 1KK3A 2WNSA 4RY0A 2QDKA 2QLTA 4HWTA 3WKEA 3DUWA 2LCFA 2QHXA 3KTAB 3OCWA 2I99A 5JVDF 4JASB 4MLDA 4V0QA 3L2OB 3UYKA 1TYEB 1M7HA 4JOCA 3VMMA 4RMGA 4M9RA 1SGWA 1DX9A 4ZKDA 1DDIA 3OLQA 1C1DB 5T8KC 2MTBA 2C2BA 3T9EA 2A5YB 1MOQA 1E9BA 4G9GA 1X87A 3A6LA 2QG4A 1L1FA 1E9SA 8ATCA 2G6BA 1E4OA 3F9CA 3M34A 5GONF 1M2OA 2TSYB 4PGHA 4F6RB 3SHQA 2QM7A 1NYLA 4O4HB 1RP1A 4HZGA 2NUAB 1JE1A 1O89A 1IULA 1V3QE 3H99A 3FUXA 4UE6A 2O2GA 3HCBA 4NXMB 1ZNYA 2OESA 3GHYA 2YYAA 3ID6C 4IHJB 2DKOA 2YVQA 1YRWA 3MWGA 4XWYA 5CURA 4RTQA 3RVBA 3LW7A 4NF2A 5LQJA 4MR9A 4YDQA 3GCGA 2J9XB 3CLRD 3PNSA 1CNEA 2FX5A 2I22A 1L4UA 2PR2A 4R1TA 2F3UA 1UQRA 3DFZA 1U3UA 1ECLA 3E4CA 4MUKA 3RTBA 2IJGX 2OZEA 3U17A 4AKEA 5BN4A 3T54A 3OP1A 1ORDA 2EJTA 2HUNA 3I39X 4ZQCB 3ZHYA 4PEVA 4A2WA 3O26A 3QU4A 1MZPA 2QSYA 4U9IS 5KAMA 3V4VB 3AUFA 4OA8A 5I4IA 3MF4A 1TJPB 3BD7A 2G80A 1JKFA 1OFTA 1Y37A 3PLRA 1FP4B 4MIOA 3LT1A 3AK4A 4ZGBA 3IAHA 3JYLA 1RXUA 1AUOA 2DYKA 4F6RA 2H7VA 3TF5A 1T4GA 4JDPA 4HAIA 3FWKA 3LZDA 1V48A 5BMVB 4J75A 3OURA 2ZSAA 4B76A 3OHMA 4GT1A 4ZVOA 4BLQA 4CLEA 3OJWA 4CKBB 3TIXB 3TQFA 2YXBA 4R69A 1ATZA 4K03A 4ZQGA 1KFCB 4ZANA 4UTRA 3K8QA 3P94A 1QHGA 1YR6A 3AX6A 3UW1A 1N6OA 3AWDA 1G3RA 4L16A 3E2PA 1PQYA 4ITRC 3L0CA 4OBEA 3CRW1 2HMAA 1JEDA 2PYDA 4G81A 1ADFA 2BBTA 4K9MA 3MGCA 3ZEIA 1ZVMA 3ZHSA 4EECA 5MFPA 1A8QA 1MOZA 1CUXA 1J0XO 1P2TA 2CXTA 3C98A 2GRJA 5LYYA 2AKEA 3CWQA 2CJXA 3MG9A 3QY9A 4ND7A 1ZM3A 2R1TB 4NV3A 4BMPB 3DP7A 5KX5F 1XQ6A 5CRIA 3ITEA 4YAIA 4O5OA 2YHIA 1U04A 5HGXA 3CVYA 2I71A 4RLHA 4HTFB 3C3MA 3IX7A 4UAGA 3ZN2A 3BMNA 3FOWA 1Q0TA 2V1UA 2CN1A 3LQ2A 4Y1GA 1HYQA 1NQUA 4ESVA 3H75A 4JY7A 3GDHA 1KJWA 3H11A 1DADA 1F8XA 3LP5A 3RC7A 1JT9A 3BWDD 1ZL0A 5KTOA 4GMXA 3C3DA 2AW5A 1I24A 4FNMA 4DYDA 2EDCA 3L6UA 3T4EA 2UYYA 4NYIQ 3VZSA 3ZXSA 1QF7A 3DHVA 3AF4A 4MUEA 1B4DA 1O03A 2IUEA 3FI9A 3L0PA 3AESB 3IDFA 4RORA 4TX1A 3ZV6A 2HI0A 4XUDA 1UIRA 1NVXQ 2I4MA 5EVCA 2F1RA 1QIGA 2WUVA 2R7NA 3PQ3A 4QUDA 3PSAA 1K4KA 1YZQA 1ODLA 1WW8A 3TOCA 3GLIE 1U3GA 2Z6UA 1V9LA 2RKBA 4MP6A 2DZDA 2GM9A 1OLSA 3MXOA 4F2GA 1RAEA 2J3LA 3G2PA 1Y1SA 4MXDA 4KE6A 4YWHA 3WLMA 1L5FA 4M99A 3SYKA 4QNMA 3LC2O 1PJCA 3MQFA 2I6TA 1ZOLA 2V3CC 1CJTC 3K9LA 3WHIA 4D96A 1YQGA 2FDXA 2OYRA 2CNKA 3ZJTA 3H19A 1Q77A 1ZVKA 2XDWA 5G1PA 4REOA 2PKXA 1W1WA 3MTQA 1XZLA 2ID4A 4NC9A 1LWOA 2JDIA 4AJEA 3HXMA 2P0AA 4TKZA 3L0DA 4XSVA 4YJHB 1BYUA 4JA2A 4JUAA 3SI7A 5JMWA 2JLYA 5C1BA 1CF4A 4RK0A 1N0HA 3WIDA 2NO5A 3NIDB 4ETIA 3VSEA 3O4FA 2RIPA 3ACBA 1PZFA 3ESDA 2OXCA 2JRCA 4HDMA 1CVRA 1NUUA 1Q74A 2A9VA 2BF7A 2Q0SA 3HB0A 4Q1VA 2IU3A 1W36C 1DUVG 3JAMA 1GKYA 2QRKA 1TZKA 5CDTA 1M2HA 1XTBA 5BSGA 4K1LA 1AXRA 3A1TA 3GFSA 5B2EA 1NZFA 2C88A 3TE6A 1I9GA 2WILA 1EX6A 2Q4DA 3WNCA 2HMTA 2FPKA 1YU6A 3FYCA 4MA5A 4JP3A 2WUEA 3T7IA 1E18A 4MI9A 1V11B 1ZLYA 3N75A 4HLUA 5KNDA 4ZDWA 3SJCA 5JQGA 5KVVA 2VRCA 2RGCA 1CQIB 1VBKA 3IVCA 2EKLA 1YL7A 2GHQA 2PT5A 3DE1X 4MEAA 3EIHA 4UE2A 4X63A 3H2IA 1N1EA 4TUYB 2O3UA 2PJUA 4GC5A 4TLAA 3RV3A 3ZE9A 3UANA 4ND3A 3SBOA 5C4IA 1KYZA 3CZCA 5FO0A 1OQAA 2XNKA 2VO1A 4WESB 1NKVA 2I8CA 4MGZR 1E69A 4P35A 5LXTB 4UBNA 1T0BA 2A84A 4W6ZA 2VG8A 3UJDA 3VGPA 3G5LA 3Q41A 1HG0A 1E5XA 1DPFA 1NT4A 2J4DA 2OMKA 2P6PA 1IOWA 1DC7A 1KYTA 4P80A 1TRHA 4AS2A 3A58B 2ODQA 2JIMA 1GT91 3R74A 3ZY5A 4CCWA 3NXSA 5CIWA 1FXWF 1X19A 2WT9A 4CM4A 3KSAC 4E21A 4JUBA 5P21A 1DQZA 3MSCA 5EE1A 3GFPA 5LB4A 2BH2A 1VM6A 1DZIA 1R4NA 3UWKA 1DCMA 4GX2A 4RMJA 4BFLA 3P9YA 2BFNA 3D2BA 3GFGA 4R1SA 4D92A 2QR5A 1IBSA 4DNPA 1WLSA 2DCMA 3F3YA 1P44A 1JALA 4GWKA 2GJAA 3C8MA 2VC2B 4X7PA 3AR8A 3EZNA 4Z1MD 3QY0A 3W4KA 2BTEA 3V80A 3ZDAA 5C7IO 3I30X 2RBKA 3N5CA 3NDRA 5EZYA 5HKKA 3U09A 3GLFA 4LJ6A 1E60A 1H66A 2A9QA 1NQWA 1HDCA 1VKRA 4IV5A 4G0MA 3ETCA 2CCGA 4QQFA 5DGHA 2AX4A 1GVHA 3QWBA 3SQOA 3ZZUA 3T7RA 3TBKA 4TYWA 1NW6A 3CPHA 1DDGA 3I42A 1YS9A 4MKHA 1D6JA 2PUHA 2YW9A 5IUJC 1K97A 2P3LA 3BA1A 4MKXA 3HU1A 4H3VA 1MTZA 3C3JA 1F0YA 1LK7A 1TADA 3TL2A 2YYZA 3WFJA 1X7DA 1VCOA 3FGOA 3T0IA 3DKPA 3TR0A 4J6EA 2B2NA 3U4GA 5K8IA 4GIBA 4K9NA 4QBIA 4RWEA 1KI1A 3RGGA 3HN6A 3F7NA 3JVDA 3TS1A 2ZSHA 4N12A 1IZ7A 3EGIA 2LDBA 2OHIA 5CYGA 3TOXA 1T8PA 1EHIA 3UB2A 2X19A 1VBFA 4C7VA 1U9YA 3HNRA 2R85A 1D4OA 4B43A 1DJLA 3WNZA 1ZWLA 4HDNB 1YR9A 2ATCA 1R37A 1VRWA 2H1CA 4RVCA 3SF8A 2B6HA 3K6SB 2PMBA 3DZDA 4ZV7A 1WTAA 2V3VA 1Z7BA 1UPCA 2VDNB 2WZCA 1QFZA 1THZA 5K20A 4INPA 2JFFA 4TV9B 3WL6A 3O94A 2XNDA 5AW5A 1Q1QA 3IPAA 3Q3GE 4G4SO 3KOZA 3INRA 4Y9DA 2C3MA 1UM9A 5ISMA 2QXUA 1FDTA 2Q1UA 3I45A 3IIEA 4TT3A 3LM8A 4HK4A 4RFVA 1M1ZA 1NMYA 2BDEA 1YO6A 4L4ZA 1M2VB 2GVZC 3E9QA 3THOA 3ETJA 1GQFA 1H2XA 2PKWA 2Q41A 4X0EA 3OO1A 5D3QA 3VU9A 4YYEA 3NW9A 1UDBA 1X9GA 2V6GA 3MOSA 5KCMA 2G3YA 3V9AA 3FVVA 2PSFA 2IGBA 3RSLA 1ZK4A 3PC7A 3DE3X 5EFOA 4D9CA 3UPTA 2Y67A 5F1KA 4OU4A 1C9MA 3TLAA 3H2BA 1ZONA 5D86A 1U2SA 2ZZKA 3C87A 4S0ZA 3ZUGA 4D8XA 5KSZA 2ODWA 4EGFA 3L5KA 3GJ5A 4EG6A 3R24A 1BVHA 1TQ6A 1WZCA 3TVDA 3S44A 3DF9A 2WWIA 3PC8A 4QPDA 5EJ7A 4BRSA 3U4AA 2DPYA 4ZWNA 1NDQA 1XXHA 4B83A 4IIYA 1LLFA 4RY2A 1M2GA 1X77A 5AR1A 5A0VA 3TQHA 4P83A 2PYIA 1JFTA 2DQ4A 3GZ4A 4O2BF 4CF6A 2B5WA 2B7BA 3R6DA 4G86A 2CHFA 2QK4A 3JTMA 1OFUA 4OHYA 3H6KA 2H7XA 2IIVA 2W2OA 1NUHA 3JAWB 4I19A 4M1WA 3CUYA 4YNBA 1L1QA 2P9QA 3H6GA 5CX1B 1IOLA 2O48X 2PVCA 4IHKA 4DM4A 5HK9A 3AC0A 3EISA 4A1OA 3OETA 3U31A 4ENVA 5BVHA 4QNNA 5CITA 4UTOA 3T5PA 3RRJA 1OU0A 3BJZA 2ZRAA 3L1HA 3HNPA 1CQJA 2GYWA 4MUNA 4RW0A 1V41E 3CUSA 2JATA 4PAQA 3LYHA