1EWYC

Anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Crystallographic studies of the interaction between the ferredoxin-NADP+ reductase and ferredoxin from the cyanobacterium Anabaena: looking for the elusive ferredoxin molecule.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ewyC00
2H88B 2AX5A 3AV8A 1QT9A 2EKIA 4WWMA 1TKGA 2MJ3A 1VDVA 3FC4A 3HUIA 1I7HA 1NVID 3VRBB 3W5UB 1CZPA 1N60A 2PIAA 1E0ZA 3DWGC 1AWDA 1SF0A 1ZXIA 3AM9A 3P4RB 1CJEA 1GAQB 2KMMA 2Q5WD 3VR8B 1V97A 3P63A 1J7CA 5H8YE 2WDVB 1E10A 3AE5B 1NEKB 1NYRA 4WQMA 5C3JB 1YJJA 4N58A 2PKOA 1IUEA 4YSYB 3AE1B 3AEAB 3NRZA 4P6VF 3LXFA 3AE4B 5EE9A 2KAJA 1GPXA 1XLNA 3AEGB 5EE3A 1FXIA 1WRIA 1WYGA 3ETRA 1XLOA 3NVZA 1R7SA 2CJNA 4LTUA 1JWAD 3P1MA 4C80A 2HTME 1ZP0B 2DBYA 1TKYA 1TKEA 3AECB 1SIJA 3BIID 3KWLA 1E9MA 3L4PA 3HRDD 1WXQA 1DGJA 1E6EB 2W3SA 2WS3B 3AE8B 1WWTA 1L6UA 1RWSA 2WU2B 2Y5CA 1JRPA 1KFYB 1OQQA 1RFKA 1XLPA 2BS4B 3B2GA 3VRAB 3AE6B 4YT0B 2OHFA 2JQRB 2WDQB 3AEFB 1EWYC 2M19A 3HVZA 4IDIA 1N5XA 2K9XA 2MJEA 4ITKA 2W54A 2WDRB 1J7BA 1N61A 4YTNB 1XLQA 2E3TA 3AE9B 1WGKA 2WU5B 4YTMB 1OQRA 4YSXB 1RYJA 1FFUA 3CIRB 3P4QB 3ZYYX 1FMAD 2ACZB 4A9AA 2M56B 4N59A 1T3QA 1FXAA 1ZOYB 2BS3B 3AMZA 4YSZB 2W3RA 3FAHA 1J7AA 1QOGA 2K5PA 4HROA 3W5VB 5C2TB 1JWBD 2WLBA 2L83A 1FRRA 1QOBA 2CJOA 2K22A 3AEDB 1DOYA 3DWMA 1YQ3B 1TYGB 3B9JA 4YTPB 3NVYA 1KRHA 4HRSA 2JX5A 2FBWB 2H89B 1DOXA 2PVOD 1AYFA 3ABVB 5AUKA 1QOFA 2N0SB 4ZHPA 1FFVA 1PUTA 2LEKA 3NVWA 4KX6B 2QJLA 3P4PB 1B9RA 1QF6A 5G5HA 1ROEA 2CU3A 2QIEB 4JWSC 4US8A 4ZOHC 4US9A 1YQ4B 3VR9B 3LB8C 2WQYB 1A70A 1E7PB 5G5GA 3SFDB 1NYQA 2MH7A 1QOAA 1SB3C 1N63A 3AE2B 1N62A 3AEEB 4YXDB 1PFDA 3AN1A 1L0VB 1XO3A 2BT6A 1JROA 3SR6A 1DOIA 1PDXA 4JWUC 5AUIA 1FO4A 2G1EA 1JQ4A 3W9CB 3PO0A 3B2FA 1UWMA 1RM6C 2L52A 5EE1A 1NENB 4ZHOA 2WP9B 4FXCA 1FIQA 3NVVA 5EE0A 5MPOA 1KF6B 5GXGB 5H92C 2B76B 4C7ZA 1FM0D 1VLBA 2MJDA 4USAA 3AE3B 3CWIA 2PVGC 2DWQA 1YJIA 3P4SB 4JX1C 1L5PA 4C7YA 1OFFA 1VJKA 1ZUD2 3SFEB 3AE7B 2BS2B 3EUB2 3AEBB 3RPFC 3AB5A 1JW9D 1QLBB 3AH7A 3WCQA 4N6EB 1NI3A 1N5WA 3NS1A 2W55A 1TJEA 1FRDA 1JALA 1L6VA 1V8CA 1F0ZA
chains in the Genus database with same CATH superfamily
2WX1A 1KOTA 2ZVNA 1NVID 1WMHA 3TEZA 3NZUA 3PSEB 5LNK1 3N30A 3NJTA 1YJJA 2BWES 1GUAB 4KIKB 3AE1B 2RPQA 2V4IB 3PREA 1JWMD 4ZRJA 1WRIA 1WGRA 5J2RA 3B2GA 1XQQA 4DDGD 3V6EB 1GC6A 2O6VA 4XDDA 1LFDA 2EELA 4OVZA 2WXOA 1N5XA 3A4SC 1NI2A 1KLGD 4GDLB 2NTTA 3P4QB 3ZJVA 1TS4A 2UWQA 5TSSA 3B1LX 4N59A 4RF1A 1MG8A 4JGHB 5BMIA 2JSVX 2PE6B 2QSDA 1J19A 3RZWC 4W9FA 3X23A 3BVMA 3DVGY 4ZYSA 2LMCA 4BZAA 4MGIE 2M8SA 3PRPB 1FFVA 4NAWA 2A5UA 1PUTA 3A1QA 1YX5B 1QQRA 3QQ8B 4AP4C 1GC7A 2G9HD 2L00B 2AQ3B 1AN8A 1MVKA 2SAKA 5DPRA 4DK5A 2BWFA 2KNBA 1HTOA 3U30A 4BBNF 1V9JA 4FXCA 5MPOA 4HPLB 5BMGA 2Z0EB 2KQ4X 4USAA 3DQVA 3PPAA 2Z59B 1VJKA 2IY1B 2BS2B 4ZDVA 1L4ZB 2KN4A 1UH6A 1WZ3A 4W9DA 1CZPA 4II3B 3DBLI 4TQ1A 4BKSA 4L1BA 1E10A 2R61A 1R4NI 2YEPF 2V0GA 4GGQA 5EE9A 2LGIA 4C56C 3ZO5B 3WAPA 1XXGA 1ET9A 3ZNGC 1SE9A 1TKEA 3WAMA 1TBEA 2LGYA 1K52A 3TIXA 4PYUA 2DYMA 3U8ZA 2N9EB 3W2DA 4TUUA 5E6JA 1ACCA 4K3CA 1WXVA 1T0RC 4OVVA 3AULA 2LHDA 3B08A 4YTMB 2R2OA 1RFAA 4IWPA 2M56B 1S1QB 3VH4B 4WWOA 2G45B 4AQ7A 2RMMA 1JRUA 3NOBA 2N0SB 3H1UA 1XT9B 2FNJB 2I1JA 3RI7C 1D5ZC 1C77A 4MGKE 5HI1A 3MHZA 4WAAA 3FILA 1HTQA 2X38A 2RDBC 3J9CA 3AE2B 4GMVA 1YX6B 2DX5B 1RM6C 4LCDE 1E5WA 3MFGA 4MSQB 3DVGX 2RD0A 2PE9A 4PS3A 3AU5A 3C0RB 4DXAB 3AH7A 3QARA 3N3KB 3HUIA 1QT9A 1MPEA 2WXIA 2KWVB 4HLEA 1V2YA 3MP9A 1ZE3D 3MC8A 1QILA 1WXSA 1V97A 4GDKA 3RZFA 3UGBB 4HPPA 4A55A 1F1HA 4LK0M 5FR3A 3U7ZA 2JT4B 3PTFC 1M4VA 2J0KA 2CJNA 4XWWA 3KWLA 1FNWA 1TS3A 4DBGA 3QJZA 1IGCA 3PZDA 4YT0B 2KDFB 4OZBA 3N1XC 1J8CA 3RNAC 4JE3B 2W54A 3ZGZA 3ZUNA 2KMCA 3ZYYX 4FA6A 1FMAD 4PK1A 1M94A 1FXAA 3H8HA 2UU7A 4XZ4A 3SU8X 1QOBA 3DWMA 3PHXB 1JWSD 2Y5BB 2I2YA 1VZ7A 3HM3A 2WGSA 1D4BA 3ZRFA 1WH3A 5G5HA 4GSWA 2DZKA 1P0RA 1CK1A 2JRIB 3SFDB 4NPNA 3EHVA 1JROA 1UUPA 1PDXA 1HQRD 2KFKA 2MBQA 4KGTA 1V6EA 2IO1B 2IDYA 2WYQA 3OJ3A 1VLBA 2L8JA 3OAWA 1UF0A 4OVUA 1E8YA 4EE2A 3AEDB 3VXWA 4LNNA 3R7RA 1VD2A 3HVDA 1P7FA 3IAM1 4WQMA 1SSNA 1P9DU 2BGFA 3NS8A 2PKOA 5D94A 4BKTA 5C3JB 4EZLA 2VRRB 4K7SA 3AEGB 5EE3A 2MSED 1FXIA 2KMAA 1XCTL 2BBCA 1ZP0B 2GB1A 5E6OA 4ANXA 1TY2A 1X1MA 3L4PA 3AE9B 3P2BA 2TSSA 1JCKB 4BOSC 5BYQA 4IDIA 3ENEA 3TEXA 1YOVB 2N4FA 3FKYA 3KW5B 2WU5B 4LNOA 2K8BA 1FFUA 3RNEC 4A9AA 3APFA 3VTWA 3EFUA 2D11A 4BOZB 4A20A 3BY4B 1JWBD 1HZ5A 1DOYA 1DOXA 2MX2A 1V1PB 2K8CA 4P16A 1B9RA 2MBEA 3JW0X 1E7PB 2HDEA 3PS6A 4RF0A 3DHGC 4TV3A 3ECIA 1E8ZA 2PTLA 1QKZA 1EU4A 5FK9C 1H8CA 5E6PA 2M17A 3V62A 5H92C 2K1FA 2AL6A 4C7ZA 1FD6A 4C4VB 3ZJUA 4PYZA 5C23A 5AEKB 1RRBA 4FJZA 2MJ3A 2IBIB 2K8HA 2IZVB 3EA6A 3P4RB 3LYYA 5E6NA 1LQBA 3RNCC 2ASQA 2LRWA 3V61A 3VHTC 3TCAA 2KLGA 4NNJB 2ZPYA 4WJNA 1Y8RC 4WURA 2AEHA 1WYGA 2V1YA 2JY6A 4AS1A 2J7QB 2D2QA 2N9PC 3ZNHB 4EFOA 1RFKA 3APDA 2DZMA 3VRAB 1WGHA 4OW0A 2OHFA 5AZHA 2WXHA 3T3OA 2M19A 2N1WA 4ASWC 2MP2A 3OG5A 3L54A 4ANVA 2C9WB 3C8YA 2RDGA 2LZ6A 3VTUA 2K5PA 3VUYA 4XC2A 3UF8A 1WGYA 4BFRA 4ZRPA 1YQ3B 4KIKA 3NZSA 2J0JA 1QOFA 2G3QB 3GP7A 1FNVA 2WXFA 1QF6A 2CU3A 2ONQA 1KLVA 1RAXA 1EF1A 5JHAA 2WQYB 1F52A 1SXTA 4HCPB 1RLFA 4WWNA 1V80A 1UNSA 2NVUI 3AN1A 2BTEA 4KKIA 4DHJB 1WE7A 2QHOA 2N7DA 3PO0A 4GDLA 1VR9A 3UI3A 5EE0A 4W9LA 2ZEQA 1LO5D 1V49A 2AYOB 1B1ZA 3CF6E 4KZCA 3DCGA 4JX1C 2KTRA 2JWZA 2IYDB 3AEBB 1JW9D 1QLBB 1NI3A 2IGDA 2Y5PA 3RNFC 1YN5A 2GLSA 2BYEA 3VRBB 5L83A 1ZXIA 1F77A 5JH5C 4QAYA 1XEEA 2N1VA 3O13A 2WDVB 5EDSA 3ZXRA 4YSYB 1NDDA 3V60A 4W9KA 3LXFA 1IBXB 3DBHB 3WIMA 4HCNB 2KKCA 1JWAD 3TL5A 3N9YC 4C80A 2OJWA 3BIID 3CMMB 3JSVB 2WU2B 2SEBD 3TMPB 5CHWA 2MA9B 4ITKA 1EWCA 1J7BA 1WY8A 1WGKA 2KYWA 2LRUA 4D2KA 5CHVC 2LGDA 2JYEA 3R2TA 3ZIMA 2BS3B 5CHFA 4CQNA 2W3RA 4II2B 1F9JA 4RCOA 3R8BA 4FN2A 3DBRB 2BPSA 3NVWA 3Q8AA 2J53A 1TS5A 3W1SC 4EZJA 3VR9B 2L05A 2LHEA 4M0WB 4MEMA 1SB3C 2IGHA 2PW9A 2HTHA 2YLMA 1SE2A 2WXKA 4LDTB 2CKHB 3UQAA 1UWMA 3NZ3A 1OGWA 3UIOB 3KYCD 1MI0A 4OHJA 2JZZA 3Q3FA 2BYTA 4DHJD 1ESFA 1LXDA 1AW7A 4JPSA 3WCQA 2M4NA 1L6VA 4TSSA 1R4MB 3X0WA 3E9SA 1SF0A 1MG4A 2KMMA 4DQOC 5IAAC 3K9OB 3QA8A 3H7PB 3NRZA 5C1ZA 2KVZA 4ZRQA 1P3QU 2HJ1A 2NTSA 3QC8B 1K8RB 2JYTA 3KUDB 3ZNID 3JYUA 2GRIA 3KH0A 4HWIB 4KGSA 3PV1A 1KFYB 1T5XD 1I4HA 4DWFA 4EZKA 2JQRB 1KM7A 1C79A 2WXNA 3PZ7A 1IP9A 1WIAA 1WMHB 4CO7A 3W1YA 1ISNA 1VCBA 4E3CA 1P7EA 2KDIA 3IXSA 3KUZA 5LLIA 5D2MB 1C4CA 2BB5A 4WIPA 5D7GA 1QOGA 5GMVA 2WXGA 4WQOB 2BW2A 3O65B 3A33B 1FRRA 1HZ6A 2K22A 4KDLB 4XE0A 4YTPB 4HRSA 3ABVB 3H9DA 2O6VB 3IFWB 3R66C 3WALA 4KKJA 4DXGA 3RCZA 2REXA 4GXBA 1PGXA 4F7ZA 1WRDB 1DYQA 5IOIA 2BT6A 2CS4A 2LGSA 4W9HA 1SIFA 2KVRA 1WR1A 3TUOA 4ARIA 2W9NA 4IWOA 2D5GA 2MJDA 2WDTB 1YJIA 3RMKC 3P4SB 4E74A 3BVGA 5D3DA 3A1QB 4JIOU 2M0AA 2LWPA 1FRDA 4JWSC 2AX5A 5D3IB 2KANA 2FCMA 1I7HA 4IG7B 4S17A 1SE3A 2LJ5A 4FHJA 2Z8LA 1UGJA 3PRMB 2ICIA 1J7CA 2V3NA 4AOFA 1I35A 3AEAB 4BBNC 4W9EA 3AE4B 1N6ZA 3K9PB 2PEAA 2XNAC 1U4AA 3TJPA 4A8XC 3PHWB 3QCAA 2YVCA 1XLOA 1OEYA 3NVZA 3A9KB 2KLCA 1SIJA 1E9MA 2MLBA 2MBOA 2WHIA 1DGJA 3QX1A 2BS4B 4RFBA 2FCQA 1R4MI 4WJQA 1LM8B 2XEWA 2KWCA 2GI9A 3KYDD 3BZDB 1V1OA 1F2RC 4YSXB 4I6LB 3IG3A 5LXIB 2N9XA 1YN4A 1FCLA 1EO6A 5DCNA 3TEYA 3Q14C 4G0NB 4AJYB 4FBJB 4JLCA 2D3CA 3VQIA 2LXAA 4NJCA 1EU3A 2FBWB 3PGEA 1UBQA 3BWUD 1S3SG 3RNGC 1I4PA 1HA5A 2K6DB 4IUMB 4MGZE 2D3GA 2OJRA 2MRPA 3A4RA 1QOAA 3CSFA 1C4AA 3ZXVA 3PT2B 3U52E 1XO3A 1Y56A 1EUVB 3T9LA 4DHZE 1JQ4A 4RGNA 2K0PA 1SE4A 4NZLB 2JZPA 4FLHA 4MH0E 3AE3B 4GLSC 4C7YA 1YIWA 4HJKA 2MW5A 3MJWA 4N6EB 4XGAB 4ZOHC 3L0WB 4IWQA 3RN9C 1V1PA 3BINA 1N60A 3QWZB 3KVFB 4BKGA 3P63A 2LASA 2M0XA 3HHMA 3QK0A 3RFZB 3VDZA 5HKHA 2KJ6A 2IO0B 1GPXA 1BXTA 2ZJDA 4J3OD 3Q8BA 4RGTA 3DDCB 4OZAA 3VUXA 3JVZX 4NJ7A 2KC2A 1L7YA 3HRDD 2W3SA 4K3BA 1KLUD 1OQQA 2C7MB 5HHDG 4G50A 1WM3A 2KWDA 1Q5WB 3OJ4B 1EWYC 2GBMA 2K9XA 2KWUB 1MHXA 1WR6E 4WH4A 1N61A 3KQ4A 3VH3B 4GDKB 2L0TA 2ZPNA 1YJ1A 3FAHA 1J7AA 3IHPC 4KSLC 1BMLC 1E8XA 1HE8A 3ZTDA 3B0AA 1Q10A 2ZW0A 3QIJA 4K1RB 4WWPA 1C3TA 2LGXA 1AYFA 1KH0A 2WXMA 5AUKA 3PRZA 2KX0A 2N7EA 4KX6B 4L23A 3P4PB 1WXAA 4ZRIA 2KD0A 2FE8A 2QC8A 1PFDA 1XF5L 4HDQA 1T0YA 2FUG1 1GB4A 1C78A 2DZJA 3IVFA 4GOCA 4B95A 2L32A 2BYVE 1BUIC 3RYTA 1L0XB 2JU6X 4PS7A 2K6QA 4M01A 2FIDA 2CU1A 3N20C 2G4DB 2KDMA 2O2VB 3RPFC 1EM7A 2KACA 1WX7A 1VZ6A 4MDKE 3A9JB 2CR5A 2PIAA 4B6WA 3H7SA 4F1SA 1NYRA 1V86A 4P6VF 2LUMA 2NMQA 1UGMA 2HJ8A 1P98A 1LGRA 2KZRA 1WI0A 4EEWA 1WGDA 3BYYB 2WXQA 3GZNB 4RMAA 1L0YB 4H2AA 2DYOA 1I4GA 3ZNZB 2KTFA 3ZRCA 3I57A 3EC8A 1E6EB 4HKZE 1L6UA 3LDZE 1TIFA 3ZVVA 1ZKHA 3E56A 1WF9A 2KQ7A 3V3XA 4NAMA 3KUCB 3ONSA 2DHZA 4G3XB 4IKGA 2DYBA 4IM3A 1XLQA 1QZEA 3U7DA 1MJDA 3KLSX 1NBFC 5DPSA 4MJSB 1MHHE 5AZGA 2RDHA 4LJPB 2AL3A 3GB1A 4NQKE 4B0MA 4YWGG 4MM3A 1CMXB 3B9JA 4KZ0A 1H4RA 2KQSA 1IBXA 3ZJTA 4ZHPA 1VRAB 4URKA 3C19A 4Q2JA 4REZA 1D5XC 4DHZB 5IP4D 2KK8A 3I63C 1XCQL 1P1AA 1E8WA 1ET6A 4IW0A 1K51A 3V05A 4M8MA 5J18A 1YQ4B 3JSVA 5KHOA 1IGDA 1E7VA 1OEYJ 2FCSA 2J42A 5T8IA 2WXLA 1GG3A 3SR6A 1ZXHA 1FO4A 3B2FA 4MACA 2KFJA 2DENB 5GXGB 1GJZA 4C00A 1TZOA 2QMTA 1TT5B 1KJTA 4K7WA 4JL9A 3CWIA 4IM2A 3S2AA 3AE7B 3L13A 2FUHB 4LJOB 2BYFA 4FULA 3Q8FA 1WX9A 1TY0A 4A90A 3HIZA 1YD8U 2JPHA 3EGRA 2Q5WD 5H8YE 1UD7A 3AXCA 2UYZB 4N58A 2FCNA 3KWVA 4M0WA 2I38A 1ZW7A 1R7SA 3TSSA 3P1MA 4M02A 2LFIA 2N9LA 2MWSB 2IO3B 1GB1A 2ZCCA 3AE8B 1TGZB 2GBKA 4M8NA 3Q3NC 3BK2A 2D07B 4WAFA 2WX0A 4RM8A 2JXXA 1WFYA 2MBBB 2MJEA 1Z5SB 2XK5B 3ZW3A 2E3TA 2INPE 1YN3A 3OLMD 2L76A 2ACZB 2C5LC 2M1MA 3DBLB 4YSZB 4RM9A 3APCA 3I9V1 4R3DA 5C2TB 3W5VB 1JMLA 3V6CB 1R4NB 3H7PA 1PQSA 1PYWD 2X8XX 4XX5A 5DPWA 2NBWB 1ZDVA 2EMSA 2QIEB 4US8A 3WANA 3ML8A 4MELA 4HKQA 3LB8C 5HFYA 4J6IA 3T8MA 2NPTB 2AQ1B 5LXHA 4K7UA 3BYTB 3W9CB 1AARA 1NENB 1ZPSA 2WP9B 3ZTCA 2OOBB 4GU2A 5I4DA 3OWEB 4MSMB 1WJ4A 3EUB2 3AB5A 4KGRA 3IAS1 2ZNVC 4OZCA 4DDID 3W5UB 4ARCA 3DWGC 1AWDA 2CHZA 2C7HA 1WM2A 1D3ZA 2NBVB 2NR2A 1TTNA 1D6EC 3ZDMC 3MTNB 5JHBA 2HTME 1I4RA 3ZQ4A 1TKYA 3AECB 3Q2AC 2BKFA 5BO4B 1MFWA 1WXQA 3DPDA 2KTRB 5DPTA 1XLPA 2ZZPB 2PMVA 3Q6BA 4IM0A 3L17A 3L08A 5FKAC 2ZW1A 2LVOA 2HD5B 2WDQB 3HVZA 2WDRB 5KHQA 4YTNB 3LJ3A 3AI5A 3IBEA 1PGAA 4PS8A 1OQRA 3DVNV 2NS5A 3NG0A 1HEZE 1T3QA 5IO9A 2K25A 4NJ6A 4B0EA 3M95A 3DHHC 1YNTE 2D3AA 2L83A 2EKEC 2LI5A 2CJOA 1BT0A 3RNBC 4FJVB 3VTVA 3TBLD 3A9KA 3Q3OC 2KDBA 1WJ6A 5IN7A 3ML9A 2LUEA 1E90A 4ANWA 5G5GA 2MH7A 4ZYNA 2KJHB 5L95C 2Y3AA 3AEEB 4YXDB 3DBHI 3MC0B 2DNFA 4LNIA 4EOYA 3SDLC 4ZHOA 4WJOA 3NVVA 1KF6B 2I1KA 5CTRC 2V9HA 3AU4A 3Q8CA 1V5OA 1UWXA 1L4DB 2WXJA 1OFFA 3GE3C 4CYEA 1FCCC 1FPYA 2V3PA 3PLUA 2J0MA 1F0ZA 4AJWA 3FC4A 1SEBD 3N1ZC 3DVNU 3U2SC 1CJEA 2YEPB 3AE5B 1NEKB 1YQBA 4EUTA 1STEA 2NBUA 4RGMA 4HDOA 2KAJA 3GS2A 4LDTD 2JXTA 2KXJA 3DBSA 2XN9C 4EKUA 4NAWB 3DBRI 2D3BA 1G6JA 2RGFA 2C7NB 4US9A 2Y5CA 1JRPA 4TQ0A 2LJIA 3IT6B 4KVGB 3QAQA 5JXVA 3R3MA 3NHEB 4P7IA 5IKCM 4MH8A 2KC1A 1C4PA 2AWTA 1Q1OA 3WAOA 4CHKA 2MEKA 1ZOYB 4AWJA 2HE7A 4DXFA 2PPHA 2WLBA 2GMIC 2CHWA 2JVCA 4W9JA 2PVOD 2DAFA 2ZCBA 4B9KA 2G4SA 3H6NA 2QJLA 4ICVA 4ANUA 1ZGUB 4UDUC 2J4XA 3PVLA 1A5RA 2C60A 2KO3A 2QILA 3MHSD 5IA7A 4PT5A 2MQJA 1L0VB 1ENFA 1DOIA 4BVUC 5EE1A 3U4EG 1UBIA 1PGBA 4I6PA 4F8CB 1OTRB 2GBRA 1L5PA 3P42A 2LVQA 2ZVOA 2O6VD 3Q69A 2IJ0A 3SEBA 4WWMA 4RH6A 2V3SA 4FADA 4W9CA 4MT5A 1GAQB 3M63B 4XWTA 1KTKA 2JF5A 1T0SC 1WE6A 3MJ5A 3VUWA 4A3PA 2IGGA 1FXTB 4MGYE 3URYA 3FILB 4KV2A 1WWTA 2RR9A 4W9GA 3RULA 1WSPA 2WWZA 2INDC 3UINB 4IC7B 1F2RI 2FAZA 2O2VA 2L7RA 2DAJA 3A9JA 2V4LA 2Z0DB 4GN1A 4RGOS 4HK2A 4L2YA 1I4XA 3DHIC 2L3ZA 3AMZA 4N9F4 1WYWB 5JZEB 5J17A 2KT7A 3WA0A 4ZRKA 3IT4B 1D5MC 4C4VA 2OEDA 1C76A 2QCZA 3I5JC 1JWUD 4A6QA 2VH1A 1A70A 4HEA1 1N63A 2DLBA 1N62A 3ZKJC 2IY0B 1YMHE 4LNFA 4BKSD 4JWUC 3N32A 1OQYA 3M3JA 1E7UA 1K53A 5G55A 2WXPA 1FIQA 1FNUA 4MJSA 3VFKA 4A3OA 1FM0D 2DWQA 3DOWA 1SJHD 2JZ3B 3Q3MC 1N5WA 3NS1A 2W55A 3QHTA 1UZXB 1V8CA 3AV8A 1TKGA 4W9IA 3L16A 2PLPA 2RPVA 3EFCA 4GIVA 1J0GA 3VR8B 4YL8A 2BQQA 1IUEA 3Q3JA 4BAXA 3HK0A 1SBBB 2EMTA 4LNKA 1XLNA 4KDIC 4IOIE 3UQBA 4M00A 4I6NB 2BB6A 1T6BX 2KJRA 1I42A 4G11A 1EF5A 3CSTA 2DZIA 1WGGA 2LD9A 2JUOA 2A4ZA 2MCNB 4E71A 3M62B 2GBNA 2GBJA 5CX3A 4X57B 1Q0WB 4XDCA 2KFKB 3CIRB 2KX3A 2K3UA 2WXRA 2BF8B 1FEHA 3VAWA 1V81A 3EECA 2NCNA 2VH2A 3GOEA 3NVYA 2JX5A 3SHQA 3R2IA 3SD5A 5AZFA 2INCC 4HXDA 1Z2MA 1ROEA 1GNUA 3RD2A 3PZ8A 4JQWC 4O1NA 3MC9A 3W1SA 3PLVA 1IPGA 2FIFA 2JRHA 2VZKB 1SJED 4AUQC 2IPKD 4HPMB 2XK5A 3Q8EA 4WJPA 3UIPB 2G1EA 4ICUA 2KOXA 2K39A 2BVCA 2L0FA 2N9KA 2J52A 3T3NA 2B76B 2LXCA 5BYSA 1VZ8A 1HXYD 3ZLZA 2PVGC 1C1YB 2E6XA 3SFEB 3VVWB 1ZDXA 2CHXA 1T0QC 5BYRA 2RSUA 2H88B 1WZ0A 2EKIA 2PJHA 1WXMA 1VDVA 3D32A 1E0ZA 1WX8A 3AM9A 3I3TB 4HVBA 3L10B 2WNMA 3R7QA 2QDFA 4LLGM 2MHJA 3ZDTA 3N1YC 2NPTA 3ETRA 1TZ1A 2QEJC 4LTUA 2DBYA 2W82A 3HM6X 2WS3B 1WJUA 1RWSA 4TKNA 1CQVA 3AE6B 4S0RA 4NY0A 4FHKA 1I4QA 3AEFB 2ON8A 2B3AA 4RNAA 2AQ2B 1L2NA 2LVPA 2GOWA 1RYJA 2JWUA 2N7JA 4P1CC 3TEWA 1GOZA 1SGHA 3RUIB 4HROA 1TS2A 1XD3B 2KN5A 1C9FA 1TYGB 1IYFA 1KRHA 4ACFA 3NY5A 2H89B 5G2NA 5D6JB 2XBBC 2LEKA 3BVZA 4FJYA 4K81A 2IO2B 5BMHA 2ZNVB 5FR6A 3NUHB 2INNE 4KSKC 1WJNA 3ALBA 2L1AA 1NYQA 2D10A 2KHWB 3GZNI 4HJGE 5AUIA 5TR5A 1V5TA 1UELA 2BKRB 2L52A 3RT3B 4MM3B 4XYCA 2VZKD 4GB9A 4NQLB 5HG2A 4TMAB 1K50A 1ZUD2 2MBHA 3GE8C 2KDEB 2MP2B 4P1BC 1TJEA 1JALA 2R2QA 3BK1A
chains in the Genus database with same CATH topology
1V1PA 2MJ3A 3FC4A 1NVID 1N60A 1SEBD 3EA6A 3P4RB 3LYYA 3U2SC 3TEZA 1CJEA 2YEPB 3P63A 5LNK1 3AE5B 1NEKB 1YJJA 3RFZB 1STEA 4RGMA 3AE1B 2V4IB 2KAJA 1GPXA 1BXTA 1JWMD 3GS2A 4J3OD 2JXTA 1WRIA 1WYGA 3Q8BA 4RGTA 4WURA 2XN9C 4OZAA 4AS1A 4NAWB 3HRDD 2W3SA 3B2GA 4US9A 2Y5CA 1JRPA 1KLUD 1OQQA 1RFKA 3VRAB 5HHDG 2LJIA 3IT6B 4XDDA 2EELA 4TQ0A 4OW0A 2OHFA 2KWDA 2WXHA 4OVZA 3T3OA 2WXOA 1EWYC 2M19A 1N5XA 2K9XA 1MHXA 4WH4A 5JXVA 1N61A 3KQ4A 4MH8A 1C4PA 1KLGD 4GDKB 4GDLB 2NTTA 3P4QB 3ZJVA 2MEKA 1TS4A 3C8YA 2RDGA 5TSSA 4N59A 1ZOYB 4RF1A 4DXFA 3FAHA 1J7AA 2JSVX 2K5PA 5BMIA 2QSDA 1BMLC 2WLBA 4ZRPA 1Q10A 1YQ3B 2ZW0A 3BVMA 4ZYSA 2LMCA 2PVOD 1AYFA 1KH0A 2WXMA 1QOFA 5AUKA 3GP7A 1FFVA 1PUTA 1FNVA 4KX6B 4L23A 2QJLA 3P4PB 2WXFA 1QF6A 2CU3A 2ONQA 1QQRA 4UDUC 2J4XA 2G9HD 2AQ3B 2WQYB 1AN8A 2QILA 1SXTA 1MVKA 2SAKA 2FE8A 1UNSA 4PT5A 1PFDA 3AN1A 1L0VB 2BTEA 1ENFA 1XF5L 1DOIA 4KKIA 2FUG1 1GB4A 3PO0A 1C78A 5EE1A 1VR9A 3U4EG 3UI3A 4FXCA 1PGBA 5EE0A 5MPOA 2L32A 1BUIC 1LO5D 1L0XB 5BMGA 2JU6X 2KQ4X 4USAA 1B1ZA 4JX1C 1L5PA 1VJKA 2KDMA 2BS2B 3RPFC 3AEBB 3P42A 1EM7A 1JW9D 1QLBB 2KACA 1VZ6A 1NI3A 2IGDA 2KN4A 1L4ZB 2Y5PA 3Q69A 2IJ0A 3SEBA 4WWMA 1YN5A 4RH6A 3VRBB 1CZPA 2PIAA 4MT5A 1ZXIA 1F77A 4TQ1A 1GAQB 1XEEA 4L1BA 3O13A 2WDVB 1E10A 1NYRA 2R61A 4YSYB 2YEPF 4P6VF 2LUMA 2NMQA 3LXFA 4XWTA 2LGIA 5EE9A 2V0GA 1IBXB 1KTKA 4C56C 1XXGA 3BYYB 2WXQA 1ET9A 1L0YB 4H2AA 1JWAD 3MJ5A 3N9YC 4C80A 2DYOA 1I4GA 1TKEA 2IGGA 3BIID 3URYA 3FILB 3I57A 4HKZE 1E6EB 1K52A 1WWTA 1L6UA 2WU2B 2SEBD 2DYMA 1WSPA 3E56A 3V3XA 4NAMA 3W2DA 4IKGA 4ITKA 5E6JA 1EWCA 1ACCA 1F2RI 1J7BA 1XLQA 1WGKA 2LHDA 4YTMB 4D2KA 4RGOS 3KLSX 2JYEA 4L2YA 3R2TA 1MHHE 2M56B 1I4XA 2RDHA 2BS3B 3AMZA 3GB1A 2W3RA 4CQNA 4AQ7A 2RMMA 4B0MA 4YWGG 3B9JA 4RCOA 3IT4B 1IBXA 1D5MC 3R8BA 4ZHPA 3ZJTA 2N0SB 1VRAB 2OEDA 4Q2JA 4REZA 1D5XC 3NVWA 3Q8AA 1C76A 1XCQL 1TS5A 2J53A 1D5ZC 1C77A 5HI1A 1ET6A 1JWUD 1K51A 3MHZA 3V05A 3FILA 1YQ4B 4A6QA 3VR9B 2LHEA 1IGDA 2X38A 1A70A 3J9CA 4HEA1 1SB3C 1N63A 2J42A 3AE2B 2DLBA 1N62A 5T8IA 1YMHE 2WXLA 2IGHA 2PW9A 3SR6A 1SE2A 1ZXHA 2WXKA 4JWUC 1K53A 1FO4A 3B2FA 4MACA 1UWMA 1RM6C 2WXPA 3NZ3A 1FIQA 3MFGA 1FNUA 5GXGB 1MI0A 1TZOA 2QMTA 1FM0D 4OHJA 3CWIA 2BYTA 2DWQA 1ESFA 1SJHD 3AE7B 1AW7A 4JPSA 3AH7A 3WCQA 1N5WA 3NS1A 2W55A 3Q8FA 1L6VA 1V8CA 3HUIA 1TY0A 4TSSA 3AV8A 4A90A 1QT9A 1TKGA 1MPEA 2WXIA 3E9SA 2PLPA 1SF0A 2RPVA 3EGRA 1ZE3D 3MP9A 2KMMA 2Q5WD 4DQOC 1QILA 3VR8B 1V97A 5H8YE 4N58A 1IUEA 1SBBB 3KWVA 3NRZA 4M0WA 4A55A 2I38A 1XLNA 4LK0M 5FR3A 3U7ZA 4IOIE 4ZRQA 2NTSA 1M4VA 2BB6A 2JYTA 1T6BX 1R7SA 2CJNA 3TSSA 3P1MA 4XWWA 2LFIA 2N9LA 3KWLA 1FNWA 1TS3A 2GRIA 1GB1A 3AE8B 4KGSA 1KFYB 1IGCA 1T5XD 3BK2A 1I4HA 4OZBA 4YT0B 2JQRB 4WAFA 1C79A 4JE3B 2MJEA 2WXNA 3PZ7A 2W54A 3ZGZA 4XDCA 2E3TA 2INPE 1YN3A 3CIRB 3ZYYX 1P7EA 2K3UA 1FMAD 2ACZB 3IXSA 2WXRA 3H8HA 1FXAA 1C4CA 2BB5A 4WIPA 5D7GA 4YSZB 1FEHA 1QOGA 2WXGA 3W5VB 3I9V1 4R3DA 5C2TB 2BW2A 1JMLA 1FRRA 1QOBA 1HZ6A 2K22A 3DWMA 4XE0A 4YTPB 3NVYA 4HRSA 2JX5A 1JWSD 3ABVB 2I2YA 3R2IA 1PYWD 1VZ7A 1D4BA 4KKJA 4DXGA 1ZDVA 5G5HA 1ROEA 2QIEB 4US8A 1PGXA 4ZOHC 3PZ8A 4O1NA 3W1SA 1CK1A 3LB8C 4HKQA 5HFYA 3SFDB 1DYQA 2VZKB 1SJED 2IPKD 2BT6A 2AQ1B 1JROA 1UUPA 1PDXA 3Q8EA 3BYTB 1HQRD 2G1EA 3W9CB 4KGTA 1NENB 1ZPSA 2IDYA 2WP9B 3TUOA 4ARIA 5I4DA 2N9KA 3OWEB 2J52A 3T3NA 2B76B 2D5GA 1VLBA 2MJDA 5BYSA 1VZ8A 1HXYD 2PVGC 1YJIA 3P4SB 2E6XA 3SFEB 3BVGA 5D3DA 3EUB2 3AB5A 1ZDXA 4KGRA 2M0AA 4EE2A 3IAS1 5BYRA 1FRDA 3AEDB 4JWSC 2H88B 2AX5A 5D3IB 2EKIA 4OZCA 1VDVA 1I7HA 3W5UB 4ARCA 1SE3A 2Z8LA 1UGJA 3DWGC 1AWDA 1E0ZA 3AM9A 2ICIA 3HVDA 1P7FA 1J7CA 2V3NA 3IAM1 2WNMA 4WQMA 1SSNA 5C3JB 2PKOA 3AEAB 4LLGM 3AE4B 3AEGB 5EE3A 2XNAC 1FXIA 3ETRA 1XCTL 2QEJC 1D6EC 4A8XC 1XLOA 3NVZA 2BBCA 4LTUA 2HTME 1ZP0B 1I4RA 2DBYA 1TKYA 2GB1A 2W82A 1SIJA 3AECB 3ZQ4A 1TY2A 1E9MA 3L4PA 1WXQA 1DGJA 3AE9B 2WS3B 1RWSA 1XLPA 2TSSA 2BS4B 2PMVA 5FKAC 1CQVA 2ZW1A 3AE6B 1JCKB 5BYQA 1I4QA 2WDQB 3AEFB 4RFBA 3HVZA 4IDIA 2ON8A 4RNAA 2WDRB 2AQ2B 4YTNB 3TEXA 2GI9A 3BZDB 1V1OA 1PGAA 2WU5B 1F2RC 1OQRA 4YSXB 1RYJA 1FFUA 1YN4A 1FCLA 2JWUA 4A9AA 1HEZE 1T3QA 2N7JA 3TEYA 3TEWA 1GOZA 4HROA 4B0EA 3VQIA 1JWBD 1TS2A 1YNTE 2L83A 4NJCA 1HZ5A 2CJOA 1DOYA 1EU3A 1C9FA 1TYGB 1KRHA 2FBWB 2H89B 1DOXA 1V1PB 3BWUD 2LEKA 3BVZA 4P16A 5BMHA 1B9RA 1I4PA 1HA5A 3NUHB 2INNE 1E7PB 5G5GA 2L1AA 1NYQA 2MH7A 1QOAA 1C4AA 2HDEA 4RF0A 2Y3AA 3AEEB 4YXDB 3MC0B 3U52E 1XO3A 1Y56A 4HJGE 5AUIA 1JQ4A 2L52A 2PTLA 4ZHOA 4MM3B 4RGNA 2K0PA 3NVVA 1SE4A 1QKZA 1EU4A 1KF6B 2VZKD 4NZLB 5FK9C 5H92C 2JZPA 4C7ZA 1FD6A 3AE3B 3Q8CA 5HG2A 1UWXA 3ZJUA 1L4DB 4TMAB 2WXJA 1K50A 4GLSC 1OFFA 4C7YA 1ZUD2 1FCCC 4N6EB 2V3PA 1TJEA 1JALA 3BK1A 1F0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H88 B;  2AX5 A;  3AV8 A;  1QT9 A;  2EKI A;  4WWM A;  1TKG A;  2MJ3 A;  1VDV A;  3FC4 A;  3HUI A;  1I7H A;  1NVI D;  3VRB B;  3W5U B;  1CZP A;  1N60 A;  2PIA A;  1E0Z A;  3DWG C;  1AWD A;  1SF0 A;  1ZXI A;  3AM9 A;  3P4R B;  1CJE A;  1GAQ B;  2KMM A;  2Q5W D;  3VR8 B;  1V97 A;  3P63 A;  1J7C A;  5H8Y E;  2WDV B;  1E10 A;  3AE5 B;  1NEK B;  1NYR A;  4WQM A;  5C3J B;  1YJJ A;  4N58 A;  2PKO A;  1IUE A;  4YSY B;  3AE1 B;  3AEA B;  3NRZ A;  4P6V F;  3LXF A;  3AE4 B;  5EE9 A;  2KAJ A;  1GPX A;  1XLN A;  3AEG B;  5EE3 A;  1FXI A;  1WRI A;  1WYG A;  3ETR A;  1XLO A;  3NVZ A;  1R7S A;  2CJN A;  4LTU A;  1JWA D;  3P1M A;  4C80 A;  2HTM E;  1ZP0 B;  2DBY A;  1TKY A;  1TKE A;  3AEC B;  1SIJ A;  3BII D;  3KWL A;  1E9M A;  3L4P A;  3HRD D;  1WXQ A;  1DGJ A;  1E6E B;  2W3S A;  2WS3 B;  3AE8 B;  1WWT A;  1L6U A;  1RWS A;  2WU2 B;  2Y5C A;  1JRP A;  1KFY B;  1OQQ A;  1RFK A;  1XLP A;  2BS4 B;  3B2G A;  3VRA B;  3AE6 B;  4YT0 B;  2OHF A;  2JQR B;  2WDQ B;  3AEF B;  1EWY C;  2M19 A;  3HVZ A;  4IDI A;  1N5X A;  2K9X A;  2MJE A;  4ITK A;  2W54 A;  2WDR B;  1J7B A;  1N61 A;  4YTN B;  1XLQ A;  2E3T A;  3AE9 B;  1WGK A;  2WU5 B;  4YTM B;  1OQR A;  4YSX B;  1RYJ A;  1FFU A;  3CIR B;  3P4Q B;  3ZYY X;  1FMA D;  2ACZ B;  4A9A A;  2M56 B;  4N59 A;  1T3Q A;  1FXA A;  1ZOY B;  2BS3 B;  3AMZ A;  4YSZ B;  2W3R A;  3FAH A;  1J7A A;  1QOG A;  2K5P A;  4HRO A;  3W5V B;  5C2T B;  1JWB D;  2WLB A;  2L83 A;  1FRR A;  1QOB A;  2CJO A;  2K22 A;  3AED B;  1DOY A;  3DWM A;  1YQ3 B;  1TYG B;  3B9J A;  4YTP B;  3NVY A;  1KRH A;  4HRS A;  2JX5 A;  2FBW B;  2H89 B;  1DOX A;  2PVO D;  1AYF A;  3ABV B;  5AUK A;  1QOF A;  2N0S B;  4ZHP A;  1FFV A;  1PUT A;  2LEK A;  3NVW A;  4KX6 B;  2QJL A;  3P4P B;  1B9R A;  1QF6 A;  5G5H A;  1ROE A;  2CU3 A;  2QIE B;  4JWS C;  4US8 A;  4ZOH C;  4US9 A;  1YQ4 B;  3VR9 B;  3LB8 C;  2WQY B;  1A70 A;  1E7P B;  5G5G A;  3SFD B;  1NYQ A;  2MH7 A;  1QOA A;  1SB3 C;  1N63 A;  3AE2 B;  1N62 A;  3AEE B;  4YXD B;  1PFD A;  3AN1 A;  1L0V B;  1XO3 A;  2BT6 A;  1JRO A;  3SR6 A;  1DOI A;  1PDX A;  4JWU C;  5AUI A;  1FO4 A;  2G1E A;  1JQ4 A;  3W9C B;  3PO0 A;  3B2F A;  1UWM A;  1RM6 C;  2L52 A;  5EE1 A;  1NEN B;  4ZHO A;  2WP9 B;  4FXC A;  1FIQ A;  3NVV A;  5EE0 A;  5MPO A;  1KF6 B;  5GXG B;  5H92 C;  2B76 B;  4C7Z A;  1FM0 D;  1VLB A;  2MJD A;  4USA A;  3AE3 B;  3CWI A;  2PVG C;  2DWQ A;  1YJI A;  3P4S B;  4JX1 C;  1L5P A;  4C7Y A;  1OFF A;  1VJK A;  1ZUD 2;  3SFE B;  3AE7 B;  2BS2 B;  3EUB 2;  3AEB B;  3RPF C;  3AB5 A;  1JW9 D;  1QLB B;  3AH7 A;  3WCQ A;  4N6E B;  1NI3 A;  1N5W A;  3NS1 A;  2W55 A;  1TJE A;  1FRD A;  1JAL A;  1L6V A;  1V8C A;  1F0Z A; 
#chains in the Genus database with same CATH topology
 2WX1 A;  1KOT A;  2ZVN A;  1NVI D;  1WMH A;  3TEZ A;  3NZU A;  3PSE B;  5LNK 1;  3N30 A;  3NJT A;  1YJJ A;  2BWE S;  1GUA B;  4KIK B;  3AE1 B;  2RPQ A;  2V4I B;  3PRE A;  1JWM D;  4ZRJ A;  1WRI A;  1WGR A;  5J2R A;  3B2G A;  1XQQ A;  4DDG D;  3V6E B;  1GC6 A;  2O6V A;  4XDD A;  1LFD A;  2EEL A;  4OVZ A;  2WXO A;  1N5X A;  3A4S C;  1NI2 A;  1KLG D;  4GDL B;  2NTT A;  3P4Q B;  3ZJV A;  1TS4 A;  2UWQ A;  5TSS A;  3B1L X;  4N59 A;  4RF1 A;  1MG8 A;  4JGH B;  5BMI A;  2JSV X;  2PE6 B;  2QSD A;  1J19 A;  3RZW C;  4W9F A;  3X23 A;  3BVM A;  3DVG Y;  4ZYS A;  2LMC A;  4BZA A;  4MGI E;  2M8S A;  3PRP B;  1FFV A;  4NAW A;  2A5U A;  1PUT A;  3A1Q A;  1YX5 B;  1QQR A;  3QQ8 B;  4AP4 C;  1GC7 A;  2G9H D;  2L00 B;  2AQ3 B;  1AN8 A;  1MVK A;  2SAK A;  5DPR A;  4DK5 A;  2BWF A;  2KNB A;  1HTO A;  3U30 A;  4BBN F;  1V9J A;  4FXC A;  5MPO A;  4HPL B;  5BMG A;  2Z0E B;  2KQ4 X;  4USA A;  3DQV A;  3PPA A;  2Z59 B;  1VJK A;  2IY1 B;  2BS2 B;  4ZDV A;  1L4Z B;  2KN4 A;  1UH6 A;  1WZ3 A;  4W9D A;  1CZP A;  4II3 B;  3DBL I;  4TQ1 A;  4BKS A;  4L1B A;  1E10 A;  2R61 A;  1R4N I;  2YEP F;  2V0G A;  4GGQ A;  5EE9 A;  2LGI A;  4C56 C;  3ZO5 B;  3WAP A;  1XXG A;  1ET9 A;  3ZNG C;  1SE9 A;  1TKE A;  3WAM A;  1TBE A;  2LGY A;  1K52 A;  3TIX A;  4PYU A;  2DYM A;  3U8Z A;  2N9E B;  3W2D A;  4TUU A;  5E6J A;  1ACC A;  4K3C A;  1WXV A;  1T0R C;  4OVV A;  3AUL A;  2LHD A;  3B08 A;  4YTM B;  2R2O A;  1RFA A;  4IWP A;  2M56 B;  1S1Q B;  3VH4 B;  4WWO A;  2G45 B;  4AQ7 A;  2RMM A;  1JRU A;  3NOB A;  2N0S B;  3H1U A;  1XT9 B;  2FNJ B;  2I1J A;  3RI7 C;  1D5Z C;  1C77 A;  4MGK E;  5HI1 A;  3MHZ A;  4WAA A;  3FIL A;  1HTQ A;  2X38 A;  2RDB C;  3J9C A;  3AE2 B;  4GMV A;  1YX6 B;  2DX5 B;  1RM6 C;  4LCD E;  1E5W A;  3MFG A;  4MSQ B;  3DVG X;  2RD0 A;  2PE9 A;  4PS3 A;  3AU5 A;  3C0R B;  4DXA B;  3AH7 A;  3QAR A;  3N3K B;  3HUI A;  1QT9 A;  1MPE A;  2WXI A;  2KWV B;  4HLE A;  1V2Y A;  3MP9 A;  1ZE3 D;  3MC8 A;  1QIL A;  1WXS A;  1V97 A;  4GDK A;  3RZF A;  3UGB B;  4HPP A;  4A55 A;  1F1H A;  4LK0 M;  5FR3 A;  3U7Z A;  2JT4 B;  3PTF C;  1M4V A;  2J0K A;  2CJN A;  4XWW A;  3KWL A;  1FNW A;  1TS3 A;  4DBG A;  3QJZ A;  1IGC A;  3PZD A;  4YT0 B;  2KDF B;  4OZB A;  3N1X C;  1J8C A;  3RNA C;  4JE3 B;  2W54 A;  3ZGZ A;  3ZUN A;  2KMC A;  3ZYY X;  4FA6 A;  1FMA D;  4PK1 A;  1M94 A;  1FXA A;  3H8H A;  2UU7 A;  4XZ4 A;  3SU8 X;  1QOB A;  3DWM A;  3PHX B;  1JWS D;  2Y5B B;  2I2Y A;  1VZ7 A;  3HM3 A;  2WGS A;  1D4B A;  3ZRF A;  1WH3 A;  5G5H A;  4GSW A;  2DZK A;  1P0R A;  1CK1 A;  2JRI B;  3SFD B;  4NPN A;  3EHV A;  1JRO A;  1UUP A;  1PDX A;  1HQR D;  2KFK A;  2MBQ A;  4KGT A;  1V6E A;  2IO1 B;  2IDY A;  2WYQ A;  3OJ3 A;  1VLB A;  2L8J A;  3OAW A;  1UF0 A;  4OVU A;  1E8Y A;  4EE2 A;  3AED B;  3VXW A;  4LNN A;  3R7R A;  1VD2 A;  3HVD A;  1P7F A;  3IAM 1;  4WQM A;  1SSN A;  1P9D U;  2BGF A;  3NS8 A;  2PKO A;  5D94 A;  4BKT A;  5C3J B;  4EZL A;  2VRR B;  4K7S A;  3AEG B;  5EE3 A;  2MSE D;  1FXI A;  2KMA A;  1XCT L;  2BBC A;  1ZP0 B;  2GB1 A;  5E6O A;  4ANX A;  1TY2 A;  1X1M A;  3L4P A;  3AE9 B;  3P2B A;  2TSS A;  1JCK B;  4BOS C;  5BYQ A;  4IDI A;  3ENE A;  3TEX A;  1YOV B;  2N4F A;  3FKY A;  3KW5 B;  2WU5 B;  4LNO A;  2K8B A;  1FFU A;  3RNE C;  4A9A A;  3APF A;  3VTW A;  3EFU A;  2D11 A;  4BOZ B;  4A20 A;  3BY4 B;  1JWB D;  1HZ5 A;  1DOY A;  1DOX A;  2MX2 A;  1V1P B;  2K8C A;  4P16 A;  1B9R A;  2MBE A;  3JW0 X;  1E7P B;  2HDE A;  3PS6 A;  4RF0 A;  3DHG C;  4TV3 A;  3ECI A;  1E8Z A;  2PTL A;  1QKZ A;  1EU4 A;  5FK9 C;  1H8C A;  5E6P A;  2M17 A;  3V62 A;  5H92 C;  2K1F A;  2AL6 A;  4C7Z A;  1FD6 A;  4C4V B;  3ZJU A;  4PYZ A;  5C23 A;  5AEK B;  1RRB A;  4FJZ A;  2MJ3 A;  2IBI B;  2K8H A;  2IZV B;  3EA6 A;  3P4R B;  3LYY A;  5E6N A;  1LQB A;  3RNC C;  2ASQ A;  2LRW A;  3V61 A;  3VHT C;  3TCA A;  2KLG A;  4NNJ B;  2ZPY A;  4WJN A;  1Y8R C;  4WUR A;  2AEH A;  1WYG A;  2V1Y A;  2JY6 A;  4AS1 A;  2J7Q B;  2D2Q A;  2N9P C;  3ZNH B;  4EFO A;  1RFK A;  3APD A;  2DZM A;  3VRA B;  1WGH A;  4OW0 A;  2OHF A;  5AZH A;  2WXH A;  3T3O A;  2M19 A;  2N1W A;  4ASW C;  2MP2 A;  3OG5 A;  3L54 A;  4ANV A;  2C9W B;  3C8Y A;  2RDG A;  2LZ6 A;  3VTU A;  2K5P A;  3VUY A;  4XC2 A;  3UF8 A;  1WGY A;  4BFR A;  4ZRP A;  1YQ3 B;  4KIK A;  3NZS A;  2J0J A;  1QOF A;  2G3Q B;  3GP7 A;  1FNV A;  2WXF A;  1QF6 A;  2CU3 A;  2ONQ A;  1KLV A;  1RAX A;  1EF1 A;  5JHA A;  2WQY B;  1F52 A;  1SXT A;  4HCP B;  1RLF A;  4WWN A;  1V80 A;  1UNS A;  2NVU I;  3AN1 A;  2BTE A;  4KKI A;  4DHJ B;  1WE7 A;  2QHO A;  2N7D A;  3PO0 A;  4GDL A;  1VR9 A;  3UI3 A;  5EE0 A;  4W9L A;  2ZEQ A;  1LO5 D;  1V49 A;  2AYO B;  1B1Z A;  3CF6 E;  4KZC A;  3DCG A;  4JX1 C;  2KTR A;  2JWZ A;  2IYD B;  3AEB B;  1JW9 D;  1QLB B;  1NI3 A;  2IGD A;  2Y5P A;  3RNF C;  1YN5 A;  2GLS A;  2BYE A;  3VRB B;  5L83 A;  1ZXI A;  1F77 A;  5JH5 C;  4QAY A;  1XEE A;  2N1V A;  3O13 A;  2WDV B;  5EDS A;  3ZXR A;  4YSY B;  1NDD A;  3V60 A;  4W9K A;  3LXF A;  1IBX B;  3DBH B;  3WIM A;  4HCN B;  2KKC A;  1JWA D;  3TL5 A;  3N9Y C;  4C80 A;  2OJW A;  3BII D;  3CMM B;  3JSV B;  2WU2 B;  2SEB D;  3TMP B;  5CHW A;  2MA9 B;  4ITK A;  1EWC A;  1J7B A;  1WY8 A;  1WGK A;  2KYW A;  2LRU A;  4D2K A;  5CHV C;  2LGD A;  2JYE A;  3R2T A;  3ZIM A;  2BS3 B;  5CHF A;  4CQN A;  2W3R A;  4II2 B;  1F9J A;  4RCO A;  3R8B A;  4FN2 A;  3DBR B;  2BPS A;  3NVW A;  3Q8A A;  2J53 A;  1TS5 A;  3W1S C;  4EZJ A;  3VR9 B;  2L05 A;  2LHE A;  4M0W B;  4MEM A;  1SB3 C;  2IGH A;  2PW9 A;  2HTH A;  2YLM A;  1SE2 A;  2WXK A;  4LDT B;  2CKH B;  3UQA A;  1UWM A;  3NZ3 A;  1OGW A;  3UIO B;  3KYC D;  1MI0 A;  4OHJ A;  2JZZ A;  3Q3F A;  2BYT A;  4DHJ D;  1ESF A;  1LXD A;  1AW7 A;  4JPS A;  3WCQ A;  2M4N A;  1L6V A;  4TSS A;  1R4M B;  3X0W A;  3E9S A;  1SF0 A;  1MG4 A;  2KMM A;  4DQO C;  5IAA C;  3K9O B;  3QA8 A;  3H7P B;  3NRZ A;  5C1Z A;  2KVZ A;  4ZRQ A;  1P3Q U;  2HJ1 A;  2NTS A;  3QC8 B;  1K8R B;  2JYT A;  3KUD B;  3ZNI D;  3JYU A;  2GRI A;  3KH0 A;  4HWI B;  4KGS A;  3PV1 A;  1KFY B;  1T5X D;  1I4H A;  4DWF A;  4EZK A;  2JQR B;  1KM7 A;  1C79 A;  2WXN A;  3PZ7 A;  1IP9 A;  1WIA A;  1WMH B;  4CO7 A;  3W1Y A;  1ISN A;  1VCB A;  4E3C A;  1P7E A;  2KDI A;  3IXS A;  3KUZ A;  5LLI A;  5D2M B;  1C4C A;  2BB5 A;  4WIP A;  5D7G A;  1QOG A;  5GMV A;  2WXG A;  4WQO B;  2BW2 A;  3O65 B;  3A33 B;  1FRR A;  1HZ6 A;  2K22 A;  4KDL B;  4XE0 A;  4YTP B;  4HRS A;  3ABV B;  3H9D A;  2O6V B;  3IFW B;  3R66 C;  3WAL A;  4KKJ A;  4DXG A;  3RCZ A;  2REX A;  4GXB A;  1PGX A;  4F7Z A;  1WRD B;  1DYQ A;  5IOI A;  2BT6 A;  2CS4 A;  2LGS A;  4W9H A;  1SIF A;  2KVR A;  1WR1 A;  3TUO A;  4ARI A;  2W9N A;  4IWO A;  2D5G A;  2MJD A;  2WDT B;  1YJI A;  3RMK C;  3P4S B;  4E74 A;  3BVG A;  5D3D A;  3A1Q B;  4JIO U;  2M0A A;  2LWP A;  1FRD A;  4JWS C;  2AX5 A;  5D3I B;  2KAN A;  2FCM A;  1I7H A;  4IG7 B;  4S17 A;  1SE3 A;  2LJ5 A;  4FHJ A;  2Z8L A;  1UGJ A;  3PRM B;  2ICI A;  1J7C A;  2V3N A;  4AOF A;  1I35 A;  3AEA B;  4BBN C;  4W9E A;  3AE4 B;  1N6Z A;  3K9P B;  2PEA A;  2XNA C;  1U4A A;  3TJP A;  4A8X C;  3PHW B;  3QCA A;  2YVC A;  1XLO A;  1OEY A;  3NVZ A;  3A9K B;  2KLC A;  1SIJ A;  1E9M A;  2MLB A;  2MBO A;  2WHI A;  1DGJ A;  3QX1 A;  2BS4 B;  4RFB A;  2FCQ A;  1R4M I;  4WJQ A;  1LM8 B;  2XEW A;  2KWC A;  2GI9 A;  3KYD D;  3BZD B;  1V1O A;  1F2R C;  4YSX B;  4I6L B;  3IG3 A;  5LXI B;  2N9X A;  1YN4 A;  1FCL A;  1EO6 A;  5DCN A;  3TEY A;  3Q14 C;  4G0N B;  4AJY B;  4FBJ B;  4JLC A;  2D3C A;  3VQI A;  2LXA A;  4NJC A;  1EU3 A;  2FBW B;  3PGE A;  1UBQ A;  3BWU D;  1S3S G;  3RNG C;  1I4P A;  1HA5 A;  2K6D B;  4IUM B;  4MGZ E;  2D3G A;  2OJR A;  2MRP A;  3A4R A;  1QOA A;  3CSF A;  1C4A A;  3ZXV A;  3PT2 B;  3U52 E;  1XO3 A;  1Y56 A;  1EUV B;  3T9L A;  4DHZ E;  1JQ4 A;  4RGN A;  2K0P A;  1SE4 A;  4NZL B;  2JZP A;  4FLH A;  4MH0 E;  3AE3 B;  4GLS C;  4C7Y A;  1YIW A;  4HJK A;  2MW5 A;  3MJW A;  4N6E B;  4XGA B;  4ZOH C;  3L0W B;  4IWQ A;  3RN9 C;  1V1P A;  3BIN A;  1N60 A;  3QWZ B;  3KVF B;  4BKG A;  3P63 A;  2LAS A;  2M0X A;  3HHM A;  3QK0 A;  3RFZ B;  3VDZ A;  5HKH A;  2KJ6 A;  2IO0 B;  1GPX A;  1BXT A;  2ZJD A;  4J3O D;  3Q8B A;  4RGT A;  3DDC B;  4OZA A;  3VUX A;  3JVZ X;  4NJ7 A;  2KC2 A;  1L7Y A;  3HRD D;  2W3S A;  4K3B A;  1KLU D;  1OQQ A;  2C7M B;  5HHD G;  4G50 A;  1WM3 A;  2KWD A;  1Q5W B;  3OJ4 B;  1EWY C;  2GBM A;  2K9X A;  2KWU B;  1MHX A;  1WR6 E;  4WH4 A;  1N61 A;  3KQ4 A;  3VH3 B;  4GDK B;  2L0T A;  2ZPN A;  1YJ1 A;  3FAH A;  1J7A A;  3IHP C;  4KSL C;  1BML C;  1E8X A;  1HE8 A;  3ZTD A;  3B0A A;  1Q10 A;  2ZW0 A;  3QIJ A;  4K1R B;  4WWP A;  1C3T A;  2LGX A;  1AYF A;  1KH0 A;  2WXM A;  5AUK A;  3PRZ A;  2KX0 A;  2N7E A;  4KX6 B;  4L23 A;  3P4P B;  1WXA A;  4ZRI A;  2KD0 A;  2FE8 A;  2QC8 A;  1PFD A;  1XF5 L;  4HDQ A;  1T0Y A;  2FUG 1;  1GB4 A;  1C78 A;  2DZJ A;  3IVF A;  4GOC A;  4B95 A;  2L32 A;  2BYV E;  1BUI C;  3RYT A;  1L0X B;  2JU6 X;  4PS7 A;  2K6Q A;  4M01 A;  2FID A;  2CU1 A;  3N20 C;  2G4D B;  2KDM A;  2O2V B;  3RPF C;  1EM7 A;  2KAC A;  1WX7 A;  1VZ6 A;  4MDK E;  3A9J B;  2CR5 A;  2PIA A;  4B6W A;  3H7S A;  4F1S A;  1NYR A;  1V86 A;  4P6V F;  2LUM A;  2NMQ A;  1UGM A;  2HJ8 A;  1P98 A;  1LGR A;  2KZR A;  1WI0 A;  4EEW A;  1WGD A;  3BYY B;  2WXQ A;  3GZN B;  4RMA A;  1L0Y B;  4H2A A;  2DYO A;  1I4G A;  3ZNZ B;  2KTF A;  3ZRC A;  3I57 A;  3EC8 A;  1E6E B;  4HKZ E;  1L6U A;  3LDZ E;  1TIF A;  3ZVV A;  1ZKH A;  3E56 A;  1WF9 A;  2KQ7 A;  3V3X A;  4NAM A;  3KUC B;  3ONS A;  2DHZ A;  4G3X B;  4IKG A;  2DYB A;  4IM3 A;  1XLQ A;  1QZE A;  3U7D A;  1MJD A;  3KLS X;  1NBF C;  5DPS A;  4MJS B;  1MHH E;  5AZG A;  2RDH A;  4LJP B;  2AL3 A;  3GB1 A;  4NQK E;  4B0M A;  4YWG G;  4MM3 A;  1CMX B;  3B9J A;  4KZ0 A;  1H4R A;  2KQS A;  1IBX A;  3ZJT A;  4ZHP A;  1VRA B;  4URK A;  3C19 A;  4Q2J A;  4REZ A;  1D5X C;  4DHZ B;  5IP4 D;  2KK8 A;  3I63 C;  1XCQ L;  1P1A A;  1E8W A;  1ET6 A;  4IW0 A;  1K51 A;  3V05 A;  4M8M A;  5J18 A;  1YQ4 B;  3JSV A;  5KHO A;  1IGD A;  1E7V A;  1OEY J;  2FCS A;  2J42 A;  5T8I A;  2WXL A;  1GG3 A;  3SR6 A;  1ZXH A;  1FO4 A;  3B2F A;  4MAC A;  2KFJ A;  2DEN B;  5GXG B;  1GJZ A;  4C00 A;  1TZO A;  2QMT A;  1TT5 B;  1KJT A;  4K7W A;  4JL9 A;  3CWI A;  4IM2 A;  3S2A A;  3AE7 B;  3L13 A;  2FUH B;  4LJO B;  2BYF A;  4FUL A;  3Q8F A;  1WX9 A;  1TY0 A;  4A90 A;  3HIZ A;  1YD8 U;  2JPH A;  3EGR A;  2Q5W D;  5H8Y E;  1UD7 A;  3AXC A;  2UYZ B;  4N58 A;  2FCN A;  3KWV A;  4M0W A;  2I38 A;  1ZW7 A;  1R7S A;  3TSS A;  3P1M A;  4M02 A;  2LFI A;  2N9L A;  2MWS B;  2IO3 B;  1GB1 A;  2ZCC A;  3AE8 B;  1TGZ B;  2GBK A;  4M8N A;  3Q3N C;  3BK2 A;  2D07 B;  4WAF A;  2WX0 A;  4RM8 A;  2JXX A;  1WFY A;  2MBB B;  2MJE A;  1Z5S B;  2XK5 B;  3ZW3 A;  2E3T A;  2INP E;  1YN3 A;  3OLM D;  2L76 A;  2ACZ B;  2C5L C;  2M1M A;  3DBL B;  4YSZ B;  4RM9 A;  3APC A;  3I9V 1;  4R3D A;  5C2T B;  3W5V B;  1JML A;  3V6C B;  1R4N B;  3H7P A;  1PQS A;  1PYW D;  2X8X X;  4XX5 A;  5DPW A;  2NBW B;  1ZDV A;  2EMS A;  2QIE B;  4US8 A;  3WAN A;  3ML8 A;  4MEL A;  4HKQ A;  3LB8 C;  5HFY A;  4J6I A;  3T8M A;  2NPT B;  2AQ1 B;  5LXH A;  4K7U A;  3BYT B;  3W9C B;  1AAR A;  1NEN B;  1ZPS A;  2WP9 B;  3ZTC A;  2OOB B;  4GU2 A;  5I4D A;  3OWE B;  4MSM B;  1WJ4 A;  3EUB 2;  3AB5 A;  4KGR A;  3IAS 1;  2ZNV C;  4OZC A;  4DDI D;  3W5U B;  4ARC A;  3DWG C;  1AWD A;  2CHZ A;  2C7H A;  1WM2 A;  1D3Z A;  2NBV B;  2NR2 A;  1TTN A;  1D6E C;  3ZDM C;  3MTN B;  5JHB A;  2HTM E;  1I4R A;  3ZQ4 A;  1TKY A;  3AEC B;  3Q2A C;  2BKF A;  5BO4 B;  1MFW A;  1WXQ A;  3DPD A;  2KTR B;  5DPT A;  1XLP A;  2ZZP B;  2PMV A;  3Q6B A;  4IM0 A;  3L17 A;  3L08 A;  5FKA C;  2ZW1 A;  2LVO A;  2HD5 B;  2WDQ B;  3HVZ A;  2WDR B;  5KHQ A;  4YTN B;  3LJ3 A;  3AI5 A;  3IBE A;  1PGA A;  4PS8 A;  1OQR A;  3DVN V;  2NS5 A;  3NG0 A;  1HEZ E;  1T3Q A;  5IO9 A;  2K25 A;  4NJ6 A;  4B0E A;  3M95 A;  3DHH C;  1YNT E;  2D3A A;  2L83 A;  2EKE C;  2LI5 A;  2CJO A;  1BT0 A;  3RNB C;  4FJV B;  3VTV A;  3TBL D;  3A9K A;  3Q3O C;  2KDB A;  1WJ6 A;  5IN7 A;  3ML9 A;  2LUE A;  1E90 A;  4ANW A;  5G5G A;  2MH7 A;  4ZYN A;  2KJH B;  5L95 C;  2Y3A A;  3AEE B;  4YXD B;  3DBH I;  3MC0 B;  2DNF A;  4LNI A;  4EOY A;  3SDL C;  4ZHO A;  4WJO A;  3NVV A;  1KF6 B;  2I1K A;  5CTR C;  2V9H A;  3AU4 A;  3Q8C A;  1V5O A;  1UWX A;  1L4D B;  2WXJ A;  1OFF A;  3GE3 C;  4CYE A;  1FCC C;  1FPY A;  2V3P A;  3PLU A;  2J0M A;  1F0Z A;  4AJW A;  3FC4 A;  1SEB D;  3N1Z C;  3DVN U;  3U2S C;  1CJE A;  2YEP B;  3AE5 B;  1NEK B;  1YQB A;  4EUT A;  1STE A;  2NBU A;  4RGM A;  4HDO A;  2KAJ A;  3GS2 A;  4LDT D;  2JXT A;  2KXJ A;  3DBS A;  2XN9 C;  4EKU A;  4NAW B;  3DBR I;  2D3B A;  1G6J A;  2RGF A;  2C7N B;  4US9 A;  2Y5C A;  1JRP A;  4TQ0 A;  2LJI A;  3IT6 B;  4KVG B;  3QAQ A;  5JXV A;  3R3M A;  3NHE B;  4P7I A;  5IKC M;  4MH8 A;  2KC1 A;  1C4P A;  2AWT A;  1Q1O A;  3WAO A;  4CHK A;  2MEK A;  1ZOY B;  4AWJ A;  2HE7 A;  4DXF A;  2PPH A;  2WLB A;  2GMI C;  2CHW A;  2JVC A;  4W9J A;  2PVO D;  2DAF A;  2ZCB A;  4B9K A;  2G4S A;  3H6N A;  2QJL A;  4ICV A;  4ANU A;  1ZGU B;  4UDU C;  2J4X A;  3PVL A;  1A5R A;  2C60 A;  2KO3 A;  2QIL A;  3MHS D;  5IA7 A;  4PT5 A;  2MQJ A;  1L0V B;  1ENF A;  1DOI A;  4BVU C;  5EE1 A;  3U4E G;  1UBI A;  1PGB A;  4I6P A;  4F8C B;  1OTR B;  2GBR A;  1L5P A;  3P42 A;  2LVQ A;  2ZVO A;  2O6V D;  3Q69 A;  2IJ0 A;  3SEB A;  4WWM A;  4RH6 A;  2V3S A;  4FAD A;  4W9C A;  4MT5 A;  1GAQ B;  3M63 B;  4XWT A;  1KTK A;  2JF5 A;  1T0S C;  1WE6 A;  3MJ5 A;  3VUW A;  4A3P A;  2IGG A;  1FXT B;  4MGY E;  3URY A;  3FIL B;  4KV2 A;  1WWT A;  2RR9 A;  4W9G A;  3RUL A;  1WSP A;  2WWZ A;  2IND C;  3UIN B;  4IC7 B;  1F2R I;  2FAZ A;  2O2V A;  2L7R A;  2DAJ A;  3A9J A;  2V4L A;  2Z0D B;  4GN1 A;  4RGO S;  4HK2 A;  4L2Y A;  1I4X A;  3DHI C;  2L3Z A;  3AMZ A;  4N9F 4;  1WYW B;  5JZE B;  5J17 A;  2KT7 A;  3WA0 A;  4ZRK A;  3IT4 B;  1D5M C;  4C4V A;  2OED A;  1C76 A;  2QCZ A;  3I5J C;  1JWU D;  4A6Q A;  2VH1 A;  1A70 A;  4HEA 1;  1N63 A;  2DLB A;  1N62 A;  3ZKJ C;  2IY0 B;  1YMH E;  4LNF A;  4BKS D;  4JWU C;  3N32 A;  1OQY A;  3M3J A;  1E7U A;  1K53 A;  5G55 A;  2WXP A;  1FIQ A;  1FNU A;  4MJS A;  3VFK A;  4A3O A;  1FM0 D;  2DWQ A;  3DOW A;  1SJH D;  2JZ3 B;  3Q3M C;  1N5W A;  3NS1 A;  2W55 A;  3QHT A;  1UZX B;  1V8C A;  3AV8 A;  1TKG A;  4W9I A;  3L16 A;  2PLP A;  2RPV A;  3EFC A;  4GIV A;  1J0G A;  3VR8 B;  4YL8 A;  2BQQ A;  1IUE A;  3Q3J A;  4BAX A;  3HK0 A;  1SBB B;  2EMT A;  4LNK A;  1XLN A;  4KDI C;  4IOI E;  3UQB A;  4M00 A;  4I6N B;  2BB6 A;  1T6B X;  2KJR A;  1I42 A;  4G11 A;  1EF5 A;  3CST A;  2DZI A;  1WGG A;  2LD9 A;  2JUO A;  2A4Z A;  2MCN B;  4E71 A;  3M62 B;  2GBN A;  2GBJ A;  5CX3 A;  4X57 B;  1Q0W B;  4XDC A;  2KFK B;  3CIR B;  2KX3 A;  2K3U A;  2WXR A;  2BF8 B;  1FEH A;  3VAW A;  1V81 A;  3EEC A;  2NCN A;  2VH2 A;  3GOE A;  3NVY A;  2JX5 A;  3SHQ A;  3R2I A;  3SD5 A;  5AZF A;  2INC C;  4HXD A;  1Z2M A;  1ROE A;  1GNU A;  3RD2 A;  3PZ8 A;  4JQW C;  4O1N A;  3MC9 A;  3W1S A;  3PLV A;  1IPG A;  2FIF A;  2JRH A;  2VZK B;  1SJE D;  4AUQ C;  2IPK D;  4HPM B;  2XK5 A;  3Q8E A;  4WJP A;  3UIP B;  2G1E A;  4ICU A;  2KOX A;  2K39 A;  2BVC A;  2L0F A;  2N9K A;  2J52 A;  3T3N A;  2B76 B;  2LXC A;  5BYS A;  1VZ8 A;  1HXY D;  3ZLZ A;  2PVG C;  1C1Y B;  2E6X A;  3SFE B;  3VVW B;  1ZDX A;  2CHX A;  1T0Q C;  5BYR A;  2RSU A;  2H88 B;  1WZ0 A;  2EKI A;  2PJH A;  1WXM A;  1VDV A;  3D32 A;  1E0Z A;  1WX8 A;  3AM9 A;  3I3T B;  4HVB A;  3L10 B;  2WNM A;  3R7Q A;  2QDF A;  4LLG M;  2MHJ A;  3ZDT A;  3N1Y C;  2NPT A;  3ETR A;  1TZ1 A;  2QEJ C;  4LTU A;  2DBY A;  2W82 A;  3HM6 X;  2WS3 B;  1WJU A;  1RWS A;  4TKN A;  1CQV A;  3AE6 B;  4S0R A;  4NY0 A;  4FHK A;  1I4Q A;  3AEF B;  2ON8 A;  2B3A A;  4RNA A;  2AQ2 B;  1L2N A;  2LVP A;  2GOW A;  1RYJ A;  2JWU A;  2N7J A;  4P1C C;  3TEW A;  1GOZ A;  1SGH A;  3RUI B;  4HRO A;  1TS2 A;  1XD3 B;  2KN5 A;  1C9F A;  1TYG B;  1IYF A;  1KRH A;  4ACF A;  3NY5 A;  2H89 B;  5G2N A;  5D6J B;  2XBB C;  2LEK A;  3BVZ A;  4FJY A;  4K81 A;  2IO2 B;  5BMH A;  2ZNV B;  5FR6 A;  3NUH B;  2INN E;  4KSK C;  1WJN A;  3ALB A;  2L1A A;  1NYQ A;  2D10 A;  2KHW B;  3GZN I;  4HJG E;  5AUI A;  5TR5 A;  1V5T A;  1UEL A;  2BKR B;  2L52 A;  3RT3 B;  4MM3 B;  4XYC A;  2VZK D;  4GB9 A;  4NQL B;  5HG2 A;  4TMA B;  1K50 A;  1ZUD 2;  2MBH A;  3GE8 C;  2KDE B;  2MP2 B;  4P1B C;  1TJE A;  1JAL A;  2R2Q A;  3BK1 A; 
#chains in the Genus database with same CATH homology
 1V1P A;  2MJ3 A;  3FC4 A;  1NVI D;  1N60 A;  1SEB D;  3EA6 A;  3P4R B;  3LYY A;  3U2S C;  3TEZ A;  1CJE A;  2YEP B;  3P63 A;  5LNK 1;  3AE5 B;  1NEK B;  1YJJ A;  3RFZ B;  1STE A;  4RGM A;  3AE1 B;  2V4I B;  2KAJ A;  1GPX A;  1BXT A;  1JWM D;  3GS2 A;  4J3O D;  2JXT A;  1WRI A;  1WYG A;  3Q8B A;  4RGT A;  4WUR A;  2XN9 C;  4OZA A;  4AS1 A;  4NAW B;  3HRD D;  2W3S A;  3B2G A;  4US9 A;  2Y5C A;  1JRP A;  1KLU D;  1OQQ A;  1RFK A;  3VRA B;  5HHD G;  2LJI A;  3IT6 B;  4XDD A;  2EEL A;  4TQ0 A;  4OW0 A;  2OHF A;  2KWD A;  2WXH A;  4OVZ A;  3T3O A;  2WXO A;  1EWY C;  2M19 A;  1N5X A;  2K9X A;  1MHX A;  4WH4 A;  5JXV A;  1N61 A;  3KQ4 A;  4MH8 A;  1C4P A;  1KLG D;  4GDK B;  4GDL B;  2NTT A;  3P4Q B;  3ZJV A;  2MEK A;  1TS4 A;  3C8Y A;  2RDG A;  5TSS A;  4N59 A;  1ZOY B;  4RF1 A;  4DXF A;  3FAH A;  1J7A A;  2JSV X;  2K5P A;  5BMI A;  2QSD A;  1BML C;  2WLB A;  4ZRP A;  1Q10 A;  1YQ3 B;  2ZW0 A;  3BVM A;  4ZYS A;  2LMC A;  2PVO D;  1AYF A;  1KH0 A;  2WXM A;  1QOF A;  5AUK A;  3GP7 A;  1FFV A;  1PUT A;  1FNV A;  4KX6 B;  4L23 A;  2QJL A;  3P4P B;  2WXF A;  1QF6 A;  2CU3 A;  2ONQ A;  1QQR A;  4UDU C;  2J4X A;  2G9H D;  2AQ3 B;  2WQY B;  1AN8 A;  2QIL A;  1SXT A;  1MVK A;  2SAK A;  2FE8 A;  1UNS A;  4PT5 A;  1PFD A;  3AN1 A;  1L0V B;  2BTE A;  1ENF A;  1XF5 L;  1DOI A;  4KKI A;  2FUG 1;  1GB4 A;  3PO0 A;  1C78 A;  5EE1 A;  1VR9 A;  3U4E G;  3UI3 A;  4FXC A;  1PGB A;  5EE0 A;  5MPO A;  2L32 A;  1BUI C;  1LO5 D;  1L0X B;  5BMG A;  2JU6 X;  2KQ4 X;  4USA A;  1B1Z A;  4JX1 C;  1L5P A;  1VJK A;  2KDM A;  2BS2 B;  3RPF C;  3AEB B;  3P42 A;  1EM7 A;  1JW9 D;  1QLB B;  2KAC A;  1VZ6 A;  1NI3 A;  2IGD A;  2KN4 A;  1L4Z B;  2Y5P A;  3Q69 A;  2IJ0 A;  3SEB A;  4WWM A;  1YN5 A;  4RH6 A;  3VRB B;  1CZP A;  2PIA A;  4MT5 A;  1ZXI A;  1F77 A;  4TQ1 A;  1GAQ B;  1XEE A;  4L1B A;  3O13 A;  2WDV B;  1E10 A;  1NYR A;  2R61 A;  4YSY B;  2YEP F;  4P6V F;  2LUM A;  2NMQ A;  3LXF A;  4XWT A;  2LGI A;  5EE9 A;  2V0G A;  1IBX B;  1KTK A;  4C56 C;  1XXG A;  3BYY B;  2WXQ A;  1ET9 A;  1L0Y B;  4H2A A;  1JWA D;  3MJ5 A;  3N9Y C;  4C80 A;  2DYO A;  1I4G A;  1TKE A;  2IGG A;  3BII D;  3URY A;  3FIL B;  3I57 A;  4HKZ E;  1E6E B;  1K52 A;  1WWT A;  1L6U A;  2WU2 B;  2SEB D;  2DYM A;  1WSP A;  3E56 A;  3V3X A;  4NAM A;  3W2D A;  4IKG A;  4ITK A;  5E6J A;  1EWC A;  1ACC A;  1F2R I;  1J7B A;  1XLQ A;  1WGK A;  2LHD A;  4YTM B;  4D2K A;  4RGO S;  3KLS X;  2JYE A;  4L2Y A;  3R2T A;  1MHH E;  2M56 B;  1I4X A;  2RDH A;  2BS3 B;  3AMZ A;  3GB1 A;  2W3R A;  4CQN A;  4AQ7 A;  2RMM A;  4B0M A;  4YWG G;  3B9J A;  4RCO A;  3IT4 B;  1IBX A;  1D5M C;  3R8B A;  4ZHP A;  3ZJT A;  2N0S B;  1VRA B;  2OED A;  4Q2J A;  4REZ A;  1D5X C;  3NVW A;  3Q8A A;  1C76 A;  1XCQ L;  1TS5 A;  2J53 A;  1D5Z C;  1C77 A;  5HI1 A;  1ET6 A;  1JWU D;  1K51 A;  3MHZ A;  3V05 A;  3FIL A;  1YQ4 B;  4A6Q A;  3VR9 B;  2LHE A;  1IGD A;  2X38 A;  1A70 A;  3J9C A;  4HEA 1;  1SB3 C;  1N63 A;  2J42 A;  3AE2 B;  2DLB A;  1N62 A;  5T8I A;  1YMH E;  2WXL A;  2IGH A;  2PW9 A;  3SR6 A;  1SE2 A;  1ZXH A;  2WXK A;  4JWU C;  1K53 A;  1FO4 A;  3B2F A;  4MAC A;  1UWM A;  1RM6 C;  2WXP A;  3NZ3 A;  1FIQ A;  3MFG A;  1FNU A;  5GXG B;  1MI0 A;  1TZO A;  2QMT A;  1FM0 D;  4OHJ A;  3CWI A;  2BYT A;  2DWQ A;  1ESF A;  1SJH D;  3AE7 B;  1AW7 A;  4JPS A;  3AH7 A;  3WCQ A;  1N5W A;  3NS1 A;  2W55 A;  3Q8F A;  1L6V A;  1V8C A;  3HUI A;  1TY0 A;  4TSS A;  3AV8 A;  4A90 A;  1QT9 A;  1TKG A;  1MPE A;  2WXI A;  3E9S A;  2PLP A;  1SF0 A;  2RPV A;  3EGR A;  1ZE3 D;  3MP9 A;  2KMM A;  2Q5W D;  4DQO C;  1QIL A;  3VR8 B;  1V97 A;  5H8Y E;  4N58 A;  1IUE A;  1SBB B;  3KWV A;  3NRZ A;  4M0W A;  4A55 A;  2I38 A;  1XLN A;  4LK0 M;  5FR3 A;  3U7Z A;  4IOI E;  4ZRQ A;  2NTS A;  1M4V A;  2BB6 A;  2JYT A;  1T6B X;  1R7S A;  2CJN A;  3TSS A;  3P1M A;  4XWW A;  2LFI A;  2N9L A;  3KWL A;  1FNW A;  1TS3 A;  2GRI A;  1GB1 A;  3AE8 B;  4KGS A;  1KFY B;  1IGC A;  1T5X D;  3BK2 A;  1I4H A;  4OZB A;  4YT0 B;  2JQR B;  4WAF A;  1C79 A;  4JE3 B;  2MJE A;  2WXN A;  3PZ7 A;  2W54 A;  3ZGZ A;  4XDC A;  2E3T A;  2INP E;  1YN3 A;  3CIR B;  3ZYY X;  1P7E A;  2K3U A;  1FMA D;  2ACZ B;  3IXS A;  2WXR A;  3H8H A;  1FXA A;  1C4C A;  2BB5 A;  4WIP A;  5D7G A;  4YSZ B;  1FEH A;  1QOG A;  2WXG A;  3W5V B;  3I9V 1;  4R3D A;  5C2T B;  2BW2 A;  1JML A;  1FRR A;  1QOB A;  1HZ6 A;  2K22 A;  3DWM A;  4XE0 A;  4YTP B;  3NVY A;  4HRS A;  2JX5 A;  1JWS D;  3ABV B;  2I2Y A;  3R2I A;  1PYW D;  1VZ7 A;  1D4B A;  4KKJ A;  4DXG A;  1ZDV A;  5G5H A;  1ROE A;  2QIE B;  4US8 A;  1PGX A;  4ZOH C;  3PZ8 A;  4O1N A;  3W1S A;  1CK1 A;  3LB8 C;  4HKQ A;  5HFY A;  3SFD B;  1DYQ A;  2VZK B;  1SJE D;  2IPK D;  2BT6 A;  2AQ1 B;  1JRO A;  1UUP A;  1PDX A;  3Q8E A;  3BYT B;  1HQR D;  2G1E A;  3W9C B;  4KGT A;  1NEN B;  1ZPS A;  2IDY A;  2WP9 B;  3TUO A;  4ARI A;  5I4D A;  2N9K A;  3OWE B;  2J52 A;  3T3N A;  2B76 B;  2D5G A;  1VLB A;  2MJD A;  5BYS A;  1VZ8 A;  1HXY D;  2PVG C;  1YJI A;  3P4S B;  2E6X A;  3SFE B;  3BVG A;  5D3D A;  3EUB 2;  3AB5 A;  1ZDX A;  4KGR A;  2M0A A;  4EE2 A;  3IAS 1;  5BYR A;  1FRD A;  3AED B;  4JWS C;  2H88 B;  2AX5 A;  5D3I B;  2EKI A;  4OZC A;  1VDV A;  1I7H A;  3W5U B;  4ARC A;  1SE3 A;  2Z8L A;  1UGJ A;  3DWG C;  1AWD A;  1E0Z A;  3AM9 A;  2ICI A;  3HVD A;  1P7F A;  1J7C A;  2V3N A;  3IAM 1;  2WNM A;  4WQM A;  1SSN A;  5C3J B;  2PKO A;  3AEA B;  4LLG M;  3AE4 B;  3AEG B;  5EE3 A;  2XNA C;  1FXI A;  3ETR A;  1XCT L;  2QEJ C;  1D6E C;  4A8X C;  1XLO A;  3NVZ A;  2BBC A;  4LTU A;  2HTM E;  1ZP0 B;  1I4R A;  2DBY A;  1TKY A;  2GB1 A;  2W82 A;  1SIJ A;  3AEC B;  3ZQ4 A;  1TY2 A;  1E9M A;  3L4P A;  1WXQ A;  1DGJ A;  3AE9 B;  2WS3 B;  1RWS A;  1XLP A;  2TSS A;  2BS4 B;  2PMV A;  5FKA C;  1CQV A;  2ZW1 A;  3AE6 B;  1JCK B;  5BYQ A;  1I4Q A;  2WDQ B;  3AEF B;  4RFB A;  3HVZ A;  4IDI A;  2ON8 A;  4RNA A;  2WDR B;  2AQ2 B;  4YTN B;  3TEX A;  2GI9 A;  3BZD B;  1V1O A;  1PGA A;  2WU5 B;  1F2R C;  1OQR A;  4YSX B;  1RYJ A;  1FFU A;  1YN4 A;  1FCL A;  2JWU A;  4A9A A;  1HEZ E;  1T3Q A;  2N7J A;  3TEY A;  3TEW A;  1GOZ A;  4HRO A;  4B0E A;  3VQI A;  1JWB D;  1TS2 A;  1YNT E;  2L83 A;  4NJC A;  1HZ5 A;  2CJO A;  1DOY A;  1EU3 A;  1C9F A;  1TYG B;  1KRH A;  2FBW B;  2H89 B;  1DOX A;  1V1P B;  3BWU D;  2LEK A;  3BVZ A;  4P16 A;  5BMH A;  1B9R A;  1I4P A;  1HA5 A;  3NUH B;  2INN E;  1E7P B;  5G5G A;  2L1A A;  1NYQ A;  2MH7 A;  1QOA A;  1C4A A;  2HDE A;  4RF0 A;  2Y3A A;  3AEE B;  4YXD B;  3MC0 B;  3U52 E;  1XO3 A;  1Y56 A;  4HJG E;  5AUI A;  1JQ4 A;  2L52 A;  2PTL A;  4ZHO A;  4MM3 B;  4RGN A;  2K0P A;  3NVV A;  1SE4 A;  1QKZ A;  1EU4 A;  1KF6 B;  2VZK D;  4NZL B;  5FK9 C;  5H92 C;  2JZP A;  4C7Z A;  1FD6 A;  3AE3 B;  3Q8C A;  5HG2 A;  1UWX A;  3ZJU A;  1L4D B;  4TMA B;  2WXJ A;  1K50 A;  4GLS C;  1OFF A;  4C7Y A;  1ZUD 2;  1FCC C;  4N6E B;  2V3P A;  1TJE A;  1JAL A;  3BK1 A;  1F0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...