1EWYC

Anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Crystallographic studies of the interaction between the ferredoxin-NADP+ reductase and ferredoxin from the cyanobacterium Anabaena: looking for the elusive ferredoxin molecule.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ewyC00
1ZUD2 5MPOA 2CU3A 1SB3C 2FBWB 2BS4B 3ABVB 3AE9B 3DWGC 4USAA 5EE0A 3SFDB 3ZYYX 3AE5B 2WLBA 1J7BA 2L83A 2WP9B 2PKOA 4YTMB 2M56B 1SIJA 3P4RB 4JWUC 5EE3A 5H92C 1VLBA 4N58A 5AUIA 4YT0B 1JQ4A 1WRIA 5GXGB 1WYGA 1XLOA 3P63A 2W54A 2DWQA 1FO4A 1QLBB 1CJEA 3AN1A 1N5WA 4ZOHC 4C7YA 3VRBB 3W9CB 1NENB 3AEEB 3LB8C 1UWMA 3AV8A 3EUB2 3B2FA 3B9JA 1WGKA 1EWYC 1TYGB 1E0ZA 1ROEA 2G1EA 1GPXA 3HVZA 1QOAA 1L6UA 1JWAD 2CJOA 1RFKA 1TKYA 2PVOD 2WQYB 4WWMA 4US9A 5C2TB 1TJEA 3SFEB 1WWTA 2ACZB 2AX5A 2JX5A 2MJDA 1FM0D 4P6VF 3AE4B 2WDRB 1OQQA 1YJIA 3NVYA 3P4PB 1XLQA 1I7HA 3P4SB 1PUTA 1NYRA 1TKEA 3AB5A 3AE6B 3L4PA 2WU2B 2QIEB 2CJNA 3VR8B 4US8A 1L6VA 2E3TA 5C3JB 3AEAB 1NEKB 2K9XA 3B2GA 2BS2B 2MJ3A 4A9AA 4WQMA 2K5PA 1DGJA 5H8YE 5G5HA 1DOXA 2BS3B 1NVID 2WU5B 4IDIA 1E10A 3HUIA 1QT9A 3AE2B 3P4QB 1PFDA 1JALA 4C7ZA 4YTPB 4YSXB 2DBYA 2MH7A 1KRHA 1QOFA 1J7CA 1T3QA 2PIAA 2WDQB 3AMZA 3AM9A 1FFUA 4HROA 4LTUA 4YXDB 1V8CA 1DOYA 1J7AA 3P1MA 4HRSA 1L0VB 3AECB 1QOBA 3NS1A 1TKGA 1QOGA 3NVWA 1F0ZA 1RYJA 2N0SB 4YTNB 1XLPA 1KF6B 1VDVA 3W5UB 1RM6C 3AE1B 3NRZA 1XO3A 1OQRA 2M19A 2JQRB 1FXAA 2W3RA 3LXFA 1R7SA 2EKIA 1N63A 1E9MA 1N5XA 1E6EB 1E7PB 2BT6A 3PO0A 5EE1A 3AE8B 1YJJA 3AEGB 3AEBB 2OHFA 2KAJA 1SF0A 1ZOYB 2WS3B 3KWLA 4N59A 2L52A 1WXQA 2QJLA 3NVZA 4ITKA 3AEFB 3AEDB 3VRAB 1FRDA 1A70A 2MJEA 1FMAD 2LEKA 1QF6A 2KMMA 3CIRB 5EE9A 3RPFC 1XLNA 1AWDA 2Y5CA 2H89B 1CZPA 2PVGC 3AE3B 3BIID 1FFVA 1DOIA 1GAQB 1FXIA 1ZP0B 1YQ4B 1N61A 2W3SA 1FIQA 2B76B 1KFYB 1OFFA 1IUEA 1V97A 1NI3A 3FC4A 3FAHA 4FXCA 3AH7A 4JWSC 1VJKA 1FRRA 1PDXA 4C80A 4ZHPA 1JRPA 1NYQA 2Q5WD 3HRDD 3WCQA 3AE7B 1YQ3B 4JX1C 2WDVB 1ZXIA 3NVVA 3VR9B 3W5VB 4YSZB 1N62A 2HTME 2H88B 4ZHOA 3SR6A 1L5PA 1B9RA 5AUKA 1JW9D 4N6EB 3CWIA 1JROA 1RWSA 2K22A 1AYFA 1N60A 4KX6B 4YSYB 3ETRA 1JWBD 3DWMA 5G5GA 2W55A
chains in the Genus database with same CATH superfamily
3Q14C 4USAA 3WAMA 3U4EG 2KN5A 3IHPC 4M0WB 3RZWC 2BB6A 2WP9B 4YTMB 1SIJA 5EE3A 4AS1A 1TBEA 1I4QA 4BKSA 3I9V1 5D7GA 2DLBA 2MBEA 4LLGM 3RNAC 1E8WA 3AI5A 1GJZA 2R2QA 2DZKA 1ROEA 3RUIB 4DDGD 1N6ZA 1L0YB 4LK0M 2WDRB 3P4PB 2Z59B 3K9PB 4HKZE 4DXFA 4MH8A 3BY4B 4US8A 2E3TA 1KLGD 3EECA 4ARCA 3H8HA 4DHZE 2N9XA 2WU5B 4FHKA 4JQWC 2JRIB 4LDTD 3JSVB 1PFDA 4KKIA 3W1YA 3WAOA 1JWSD 2K8CA 1OQYA 1T3QA 3GE8C 4YXDB 1I4HA 4LJOB 3NJTA 2IO0B 1K52A 3NVWA 2N0SB 3QK0A 4TKNA 1FPYA 4WWNA 4P16A 2GB1A 2BT6A 5CHVC 2NR2A 4DWFA 1H8CA 2GBMA 1FRDA 2MRPA 3OJ4B 3PV1A 1XLNA 2ZNVC 4KGTA 4KZ0A 2KQ4X 4HK2A 3BK1A 4IG7B 2FUG1 3IG3A 4JPSA 1Q0WB 1HXYD 1Q10A 2ASQA 1WY8A 1GG3A 2LVPA 3TJPA 2D3GA 2LXCA 2CU3A 3ABVB 1SJHD 4XWTA 1JWUD 5C1ZA 5DPWA 2RSUA 1Z2MA 2PMVA 1T6BX 1YN4A 1TZOA 5JHBA 1EM7A 1UH6A 2UYZB 1WYGA 2J52A 1CJEA 3AN1A 4YL8A 4XDCA 3DQVA 1V1OA 2G4DB 1VCBA 2JUOA 2KK8A 3Q3MC 1H4RA 4BBNC 4US9A 3PGEA 4AJYB 5J18A 2JX5A 5GMVA 2VZKB 1AARA 3RD2A 3P4SB 2MBHA 2QEJC 3DVNV 4IM0A 3U7ZA 3PZDA 2D5GA 2BS3B 4TUUA 2C7HA 3M63B 3AE2B 2V4IB 1C9FA 4WJOA 2BWES 4GDKB 4HRSA 4ICVA 1PGXA 2XK5B 1XLPA 4NAWB 4HWIB 5DPSA 5IA7A 2XNAC 3C19A 4ANXA 2FAZA 3WAPA 2LGXA 2IO1B 1ZOYB 4W9DA 4C56C 1WZ3A 2FCNA 2KN4A 2LEKA 1LGRA 1AWDA 3A9JA 3UIPB 3ZKJC 2K8HA 3FAHA 1P7FA 2IDYA 4X57B 1VJKA 1PDXA 4PYUA 3IXSA 4MM3A 3C8YA 2JXTA 3ZJTA 2BVCA 3H6NA 1L4ZB 4BOZB 4KGRA 1SJED 4NNJB 2IO3B 3DWMA 3SD5A 4F8CB 1AN8A 3KYDD 1ZXHA 3PLUA 3BINA 4MSQB 4DK5A 4YT0B 2LGSA 2MX2A 2HD5B 1I4XA 1S3SG 4P1CC 3B1LX 4H2AA 2AQ3B 2PLPA 3TL5A 3ZTDA 1WH3A 3HK0A 4XE0A 1KJTA 1YJIA 4M01A 2Z0EB 3E9SA 3R3MA 1X1MA 4F1SA 1YX6B 4HCPB 1IBXB 1MFWA 3Q6BA 1C1YB 3TEWA 2LASA 2BYTA 3APDA 1QOGA 1XQQA 3RNBC 4AOFA 2Y5BB 4KSLC 1VDVA 3LXFA 2N9PC 2BKRB 2KAJA 4GXBA 4W9LA 2QJLA 1SE2A 1NBFC 2KFJA 4LDTB 3RT3B 2KTRA 1UWXA 4W9IA 1WSPA 3PVLA 2LZ6A 1V97A 3FC4A 1FRRA 1WXVA 4ZHPA 1STEA 2IJ0A 2MCNB 2FIDA 1YQ3B 2WDVB 2NVUI 3SR6A 4TQ0A 3L13A 3RCZA 1N60A 2J53A 4YSYB 4GB9A 3MHSD 2FNJB 2PKOA 1WZ0A 1Y8RC 3X0WA 4MGIE 2D3CA 2MWSB 3PS6A 2K1FA 1P7EA 3ZRFA 3J9CA 2VH1A 2KJ6A 3LJ3A 3B2FA 4BZAA 2PPHA 4K3BA 1K51A 2G3QB 1ZGUB 2PE9A 1C77A 2JF5A 2PVOD 2WQYB 1QQRA 4KIKA 4KZCA 4KDIC 2NTSA 1UNSA 4A8XC 1OQQA 3X23A 3N9YC 4HEA1 2BS2B 3APFA 3DPDA 4A9AA 5AEKB 4MGKE 1WGHA 3ZXRA 2G9HD 1T0RC 4C4VB 4HJKA 4URKA 2D10A 4LTUA 1TY0A 3AMZA 2JRHA 3UI3A 1PGAA 5AZFA 2Y5PA 3A9KB 4AWJA 4UDUC 2L3ZA 4S0RA 2VH2A 3TUOA 3RMKC 2ZNVB 2JQRB 2WXIA 1N63A 1GUAB 3PO0A 2GRIA 3N1YC 1C4CA 1TT5B 5LXHA 4EZLA 2KMMA 1CZPA 2PVGC 2WNMA 1D6EC 3RFZB 4S17A 1XF5L 1MJDA 4FA6A 4NJCA 4M8MA 3W5VB 3O65B 5E6OA 1E7UA 2HTME 1LFDA 3TCAA 2WXHA 3NG0A 4FJYA 2WXNA 1ZUD2 3ZNID 2BS4B 4K7UA 1V86A 3QWZB 4A90A 1OEYA 3HVDA 5DCNA 2N1VA 3H7PA 4W9CA 1WRIA 5E6NA 2ZPNA 2W54A 1WE7A 1N5WA 3MTNB 1F2RC 1WR6E 3ZW3A 5IO9A 3V6CB 3RPFC 4FN2A 2JZPA 3SFEB 1WWTA 1WX7A 3PT2B 5CHWA 2JZZA 3NVYA 1I4RA 3TIXA 1F77A 2PTLA 1J19A 2D11A 1SE3A 1HTOA 4M00A 4FJZA 4HKQA 4AQ7A 1GB1A 3A1QB 5CHFA 2LJIA 1RFAA 1WJNA 3RZFA 2KWVB 3DBRI 1KRHA 3L54A 2PIAA 3ZVVA 4L1BA 1V8CA 3QA8A 4NPNA 1TKGA 3URYA 3OG5A 2JU6X 4EUTA 3DBRB 3AE1B 1TGZB 2DHZA 3N30A 3LDZE 4FULA 2GBNA 5EE1A 5L95C 3AEBB 2C7NB 1CMXB 3T8MA 2L52A 1ACCA 4ITKA 3FILB 4WJNA 4IM2A 1QZEA 3GZNI 1SBBB 1WYWB 4FADA 3SU8X 4DHJB 4JE3B 2LUMA 4O1NA 5BO4B 4MDKE 3N20C 1IPGA 4OHJA 3ZGZA 2WHIA 4KX6B 1I42A 2MBOA 4RF1A 4BBNF 4IWQA 1K50A 4GDKA 3EFCA 2L00B 2JZ3B 3PZ7A 2XK5A 4KIKB 5JH5C 2ZPYA 4NAWA 5BMIA 5C23A 1EWCA 4B0MA 4ZOHC 4XYCA 5HFYA 3PREA 4RGNA 1E0ZA 3MJ5A 2LMCA 4KGSA 3ENEA 2CJOA 2KX3A 2L05A 4RM9A 1F1HA 1TJEA 2AX5A 3N3KB 1YNTE 2V9HA 2AWTA 3B08A 5LNK1 1C3TA 2AQ2B 2N1WA 2M4NA 3R7RA 5C3JB 2WXGA 2YEPF 3RNCC 1SE9A 1E10A 4BKGA 5HG2A 4EE2A 4HXDA 2WXLA 3ML8A 4ZYSA 5L83A 2M0AA 2MA9B 1AW7A 1OTRB 2VRRB 2AEHA 1DOYA 1J7AA 2M8SA 3Q3JA 5T8IA 3W1SC 2DZIA 2M19A 1SIFA 1YJJA 2WS3B 5DPTA 2A5UA 3UINB 4G11A 3MC0B 3W2DA 4I6NB 2DAJA 5IN7A 2BPSA 2L7RA 3LYYA 1DOIA 3PHWB 4II3B 3HM3A 4HPPA 4ANWA 3U2SC 1QKZA 2OJRA 1WMHB 1LQBA 1V1PA 3H7PB 1HEZE 1N62A 2WXMA 4BKTA 2V4LA 1L5PA 1S1QB 2I2YA 1RWSA 2IYDB 1IBXA 1K8RB 3ZLZA 2PW9A 2DZMA 4PS7A 2XEWA 4I6LB 2K39A 4NAMA 2AL3A 2FBWB 1YOVB 3DWGC 2WX0A 1SSNA 1F9JA 3JYUA 2L83A 3FKYA 3P4RB 3I63C 1WM3A 2KWCA 4D2KA 2PE6B 4N58A 1C76A 2BB5A 5GXGB 5JHAA 3TEXA 1C78A 2KYWA 2ONQA 1YIWA 1UF0A 1UWMA 3L17A 3AULA 2QDFA 3SHQA 2JWZA 2REXA 1L6UA 3Q2AC 4E74A 3L0WB 2AL6A 2FIFA 4I6PA 4LNOA 4OVZA 1XT9B 2K9XA 2MJ3A 3TBLD 5G5HA 1TZ1A 1MI0A 3HUIA 1QT9A 2LFIA 1UGMA 5LXIB 1UELA 3EGRA 4GU2A 1QOFA 2ZZPB 1JCKB 2BKFA 1YX5B 4A6QA 1A5RA 4PYZA 2BGFA 2QHOA 5D94A 3W5UB 3B0AA 1XO3A 4W9KA 3DVGX 3CF6E 1HE8A 3ZJUA 1D3ZA 4A3PA 1UBIA 3BYTB 2KD0A 2JYTA 2BTEA 3KUDB 2M17A 3AE3B 4CO7A 4W9JA 4G0NB 2MLBA 1YQ4B 4J6IA 1YJ1A 3NUHB 3KYCD 1T0YA 4RGTA 3PZ8A 5AUKA 1F2RI 2J4XA 5D6JB 4C4VA 2FCSA 2JWUA 2QMTA 2EELA 3WALA 3VFKA 2GMIC 2KACA 3NOBA 2OJWA 3A9KA 1PQSA 1TS2A 4M02A 1JQ4A 5KHQA 5HHDG 4IWPA 4C7YA 3VHTC 1WM2A 3RULA 3LB8C 1E7VA 4M8NA 2I1KA 3WA0A 3RNGC 4YWGG 4DDID 2ACZB 1MPEA 4P6VF 3EC8A 1VD2A 3AE4B 2KLCA 2MBBB 2WXOA 2KC1A 2QSDA 1EF5A 3VR8B 4BFRA 2KOXA 4LNNA 5H8YE 4IOIE 3R2TA 3ZRCA 3ZIMA 4G50A 2MHJA 2KDIA 2ZVOA 2D3BA 4WURA 2K3UA 3AU5A 3ML9A 4CQNA 2KX0A 1JRUA 5TSSA 2L0TA 3ZO5B 3UGBB 2LI5A 1XEEA 2J7QB 3NS8A 4HJGE 3VUXA 2MEKA 1XCTL 3QX1A 2J0JA 1WE6A 3Q8FA 1E9MA 4FHJA 1WRDB 2KKCA 1V1PB 1FCCC 4TSSA 1FNUA 3PRPB 2Y5CA 3UQBA 3I3TB 2LGIA 1TS5A 1ZKHA 2NMQA 1T0QC 4KVGB 1VZ8A 1JRPA 5I4DA 4JGHB 4YSZB 4MELA 2FE8A 3A1QA 3N1XC 4GSWA 2N9LA 2KVZA 3CWIA 3Q3NC 3GOEA 4L2YA 3CSTA 3NZ3A 2GBKA 5D3DA 3SFDB 2O6VD 2K0PA 3OJ3A 4JWUC 2GOWA 2KZRA 3HM6X 5H92C 1FD6A 3VUWA 3VDZA 2DWQA 1YN3A 4XC2A 2YVCA 4EOYA 4REZA 3FILA 2CHZA 3CSFA 1V9JA 1WGKA 1EWYC 3APCA 4JLCA 2AYOB 1Q5WB 1XD3B 1J0GA 2YLMA 3P2BA 1J8CA 2QILA 3DBLI 3GP7A 4AJWA 1KOTA 5JXVA 3BVGA 4LJPB 1ZW7A 1TY2A 3IFWB 4OVVA 1UGJA 4RFBA 3DOWA 1I7HA 2RGFA 2JY6A 1TKEA 2WU2B 3DBLB 4WQMA 1DGJA 3PLVA 2X38A 4IW0A 2IGDA 4KKJA 1JALA 4GMVA 4HROA 1GC6A 4WIPA 2LHEA 2NBVB 4MEMA 4ACFA 1CQVA 2KXJA 1BUIC 1F0ZA 4II2B 1QILA 3D32A 3QARA 3H9DA 1TTNA 2W82A 1EU3A 3GE3C 4OZBA 4TQ1A 2MP2A 3AEGB 2HTHA 2OHFA 4MT5A 3VTUA 1ESFA 1XXGA 3ZDTA 2XBBC 2K25A 2XN9C 2LVQA 3WIMA 3BIID 3VVWB 1FXIA 1MG8A 1D5XC 4RH6A 3SDLC 3MHZA 4HDOA 4IM3A 1ZE3D 3ECIA 3AE7B 1WXMA 4NY0A 1B9RA 2E6XA 4DBGA 3H1UA 5J17A 2GI9A 3JW0X 5E6JA 1SB3C 2RDGA 5FK9C 3K9OB 4PS3A 1I4PA 3PSEB 4WAFA 1VR9A 2HJ8A 4MACA 1WXAA 1R4NI 2KANA 1QLBB 1MG4A 2J0MA 2ICIA 4NZLB 1GC7A 2N9KA 2KT7A 3AV8A 3KQ4A 3A33B 2CHXA 1EU4A 3RI7C 1R4NB 3Q8EA 2N7DA 3EFUA 1HA5A 4L23A 3L16A 1WMHA 2BYVE 4RF0A 1MVKA 4DXAB 1L6VA 1PGBA 2Y3AA 4A20A 2C9WB 1RAXA 2V3NA 4BAXA 3P42A 4C7ZA 3HHMA 4ZYNA 2LUEA 2BBCA 2KHWB 3T3OA 1SGHA 3MC9A 2WXRA 2V3SA 1QOBA 2IZVB 3NS1A 3V62A 3QC8B 3Q69A 4WWPA 4HLEA 1D4BA 1KF6B 5AZHA 2W3RA 2WGSA 2JVCA 2ZJDA 3ZNZB 2JPHA 3QCAA 3IAS1 3MP9A 3RN9C 1NI2A 2KDBA 4IKGA 4RGOS 2KDMA 2VZKD 3RNFC 4A3OA 5D2MB 4ZRQA 2H89B 1FFVA 3TMPB 5AZGA 1ZP0B 1E90A 2JYEA 1WJUA 2L76A 1KFYB 3PRMB 4FXCA 5FR6A 1V6EA 3WCQA 1MHXA 2LJ5A 1C4AA 2JT4B 2H88B 4ZHOA 3DHHC 1T5XD 1M4VA 4W9FA 4ZRKA 2LGYA 5G5GA 3OAWA 2KNBA 1V80A 3AE9B 1YN5A 3ZYYX 3AE5B 1J7BA 3VXWA 2M56B 2HJ1A 3U52E 2B3AA 3AXCA 1YMHE 4K81A 4ZRIA 3ZQ4A 4HCNB 3U8ZA 2N7EA 3VRBB 2NBWB 3UIOB 3R66C 3MFGA 3BYYB 2LWPA 2L1AA 1TYGB 4ANUA 2DZJA 4ZDVA 2FCMA 2MW5A 2EMSA 1WGYA 2Z8LA 4Q2JA 2O6VB 4BKSD 1PUTA 1P98A 1VZ7A 3AB5A 2INPE 2CJNA 3RYTA 3UF8A 3N32A 1IYFA 4OW0A 1DOXA 3R2IA 1V81A 4WJPA 2MP2B 3Q8CA 4YSXB 3AM9A 1FFUA 3QHTA 4AUQC 3IVFA 3KVFB 2IPKD 2QCZA 1FEHA 5BYQA 3N1ZC 2G45B 4FLHA 2IY0B 2DENB 2FUHB 4PK1A 3KWLA 2JSVX 3NVZA 4MH0E 1P0RA 1WFYA 1QF6A 2Z0DB 4EKUA 2RDHA 3AU4A 2LVOA 3VUYA 2KWUB 3IT6B 4C80A 4A55A 4RNAA 2Q5WD 3HRDD 3M95A 4OZAA 2IBIB 3PRZA 3VTVA 1WX9A 3C0RB 2K22A 3ZDMC 5TR5A 3ETRA 3SEBA 1WI0A 2W55A 2K6DB 2L8JA 1SXTA 3QJZA 1E5WA 1F52A 5KHOA 1L0XB 3NHEB 1ET6A 2KLGA 4ICUA 4MSMB 2NTTA 1TIFA 2WX1A 1OEYJ 2WXFA 4RCOA 3DBHI 2K6QA 4KSKC 1TS3A 1KH0A 4ZRPA 2KFKB 2ZCCA 1JWAD 3DBHB 2LHDA 4NQLB 4WWMA 3O13A 4W9HA 2KVRA 3DHIC 2INCC 1XCQL 2CS4A 4LCDE 2DAFA 1LM8B 2O2VB 1P1AA 2OEDA 3ZXVA 1L4DB 1WX8A 4DXGA 1NVID 4MGZE 4WQOB 3P4QB 4GLSC 1BXTA 4MJSB 2KO3A 1K53A 5DPRA 4CHKA 3Q8BA 1FNVA 1RM6C 1OQRA 4IWOA 2GBJA 1WIAA 2WXPA 2DYBA 3V05A 4LNFA 1WJ4A 1FMAD 4DQOC 4ASWC 1T0SC 1BT0A 1GAQB 4GDLA 4NJ6A 5IKCM 1FIQA 4TV3A 1YQBA 4MGYE 2MQJA 1HZ5A 3IBEA 2BW2A 2JXXA 2INDC 2SAKA 3T9LA 2D07B 5BYSA 3HIZA 3W1SA 1GNUA 4F7ZA 4NQKE 1GOZA 2MSED 3Q3FA 1I35A 2V0GA 4ARIA 1PYWD 1UUPA 2CKHB 2R61A 1GB4A 4GIVA 2IO2B 3PTFC 1FO4A 2C60A 1IGCA 4QAYA 3W9CB 3AEEB 3EUB2 5JZEB 2D2QA 1ZPSA 1ET9A 3DHGC 5G55A 1HTQA 1VZ6A 2N7JA 1GPXA 5C2TB 3KLSX 1SE4A 4XX5A 2MJDA 2UWQA 1D5MC 2RDBC 1FM0D 2HDEA 1XLQA 2ZEQA 3L4PA 3KH0A 1RRBA 3B2GA 3M62B 4RGMA 2K5PA 2NCNA 1C4PA 2A4ZA 2RR9A 2BWFA 4XWWA 2MH7A 1J7CA 3A4RA 2IY1B 1M94A 1NDDA 4K1RB 4CYEA 1FCLA 2C7MB 4PT5A 5LLIA 1OGWA 4HPLB 1VRAB 3NRZA 2WXJA 1N5XA 3BZDB 1I4GA 1SEBD 2SEBD 4WJQA 3GB1A 1A70A 1D5ZC 2CR5A 4LNIA 4PS8A 2DYOA 3CIRB 4GGQA 5EE9A 3KW5B 3V6EB 2WXKA 1N61A 4OZCA 1BMLC 2W3SA 1JMLA 3PHXB 2KJRA 1TS4A 2RMMA 4WAAA 1EO6A 3OWEB 5CTRC 3VH4B 4JX1C 1ZXIA 4WWOA 1DYQA 1WR1A 2KMCA 2ZW1A 4N6EB 2IGHA 2M1MA 2KC2A 3QIJA 4EFOA 1C79A 2W9NA 3QAQA 1V49A 4XZ4A 2WLBA 3ALBA 1U4AA 4E71A 5AUIA 4BOSC 2X8XX 2BF8B 5FR3A 1XLOA 2EMTA 3KUZA 1ZDXA 1NENB 4RMAA 3DCGA 4C00A 3KWVA 3E56A 3HVZA 1QOAA 4DHJD 4AP4C 1UD7A 2ZW0A 3OLMD 3DBSA 1WF9A 5CX3A 2GBRA 2LRWA 1FNWA 3TEYA 3TEZA 1ENFA 1FXTB 2DYMA 2NPTA 2TSSA 2ON8A 2WYQA 2K8BA 2RPVA 4NJ7A 5BMGA 4B0EA 3ZTCA 1L7YA 4K7WA 1KLVA 1P3QU 3GS2A 3WANA 3AECB 1E8XA 1Y56A 2C5LC 1RYJA 4GDLB 4B6WA 3VQIA 1HQRD 1P9DU 1V2YA 1E7PB 3L08A 3BVZA 4N59A 5FKAC 1IP9A 1IGDA 3NY5A 1WXQA 1L2NA 3AEDB 4J3OD 3VRAB 3ZNHB 2KDFB 2I38A 5EDSA 2BQQA 2N9EB 2O6VA 4EZKA 2AQ1B 1OFFA 1IUEA 4W9GA 2J0KA 4JWSC 3ZNGC 2KQ7A 3I5JC 3I57A 3VR9B 2OOBB 5BMHA 3UQAA 4ANVA 3U7DA 2ZVNA 1KM7A 5MPOA 2BYFA 4XGAB 2NS5A 3PPAA 4P7IA 3JVZX 4BVUC 1E8ZA 2LGDA 4IC7B 1CK1A 4EZJA 5G2NA 1WGRA 2FCQA 2L32A 3DVNU 2CU1A 3B9JA 3H7SA 5J2RA 4M0WA 2G1EA 1G6JA 1V5TA 1ISNA 1RFKA 3CMMB 4TMAB 4ZRJA 3A9JB 4LNKA 2INNE 1WJ6A 4IUMB 5IAAC 2KWDA 1NYRA 3AE6B 2QIEB 1KTKA 1V5OA 3R8BA 1KLUD 4MM3B 3ZUNA 3BVMA 2LD9A 2M0XA 3TSSA 4FJVB 4YTPB 5IOIA 2DBYA 3V60A 4KDLB 2WDQB 1UBQA 3P1MA 2CHWA 4W9EA 1Q1OA 3U30A 2D3AA 2QC8A 1WGDA 4N9F4 1FXAA 1R7SA 2EKIA 5IP4D 1E6EB 3JSVA 5E6PA 3IAM1 2RD0A 2WDTB 1SF0A 2V1YA 4JL9A 3AEFB 2KFKA 2MJEA 2DX5B 4KV2A 2V3PA 3MC8A 2B76B 2O2VA 5HKHA 1JWMD 1UZXB 2J42A 2MBQA 1MHHE 2R2OA 4P1BC 2PEAA 4XDDA 3NVVA 3A4SC 4HPMB 3VTWA 2KTFA 2IGGA 4FBJB 4MJSA 2GLSA 4HDQA 1RLFA 1JWBD 2NBUA 3T3NA 4HVBA 1Z5SB 4DHZB 5EE0A 2WWZA 1B1ZA 2LRUA 2LXAA 2N4FA 1VLBA 1HZ6A 4K7SA 3IT4B 3P63A 2HE7A 4JIOU 3V61A 2PJHA 2NPTB 1EUVB 3VAWA 1LO5D 1YD8U 1TKYA 2YEPB 2BYEA 2KTRB 3EA6A 3V3XA 3S2AA 4R3DA 2DNFA 2UU7A 2KDEB 3AEAB 1NEKB 4B9KA 3QQ8B 3EHVA 1LXDA 3BK2A 3VH3B 1E8YA 4IDIA 4OVUA 2RPQA 2KMAA 1EF1A 2G4SA 4GOCA 3Q8AA 3DVGY 3Q3OC 3MJWA 3L10B 5HI1A 3R7QA 1L0VB 2EKEC 2WXQA 4EEWA 1R4MI 4YTNB 1WXSA 3NZUA 3BWUD 3GZNB 4WH4A 3M3JA 5D3IB 2KQSA 3AE8B 4GN1A 1R4MB 4E3CA 3ONSA 3RNEC 3NZSA 1ZDVA 3DDCB 4G3XB 1NI3A 2I1JA 2ZCBA 3AH7A 2KJHB 1NYQA 3ZJVA 4K3CA 3KUCB 4B95A 1JW9D 1JROA 4RM8A 1WGGA 2L0FA 1AYFA 5BYRA
chains in the Genus database with same CATH topology
1ZUD2 4USAA 2BS4B 3NZ3A 5D3DA 3U4EG 3SFDB 2BB6A 2K0PA 2WP9B 4A90A 4YTMB 2V0GA 1SIJA 3HVDA 1PYWD 4JWUC 5EE3A 4AS1A 4ARIA 1I4QA 1UUPA 5H92C 3I9V1 2R61A 1GB4A 1WRIA 1FD6A 5D7GA 2DLBA 2W54A 2DWQA 1FO4A 1YN3A 4LLGM 1N5WA 1IGCA 1F2RC 4REZA 3W9CB 3FILA 3AEEB 3EUB2 1WGKA 1EWYC 1ROEA 1ZPSA 1ET9A 2QILA 1VZ6A 2N7JA 3RPFC 2JZPA 1GPXA 3GP7A 3SFEB 5C2TB 3KLSX 5JXVA 1WWTA 1SE4A 3BVGA 2MJDA 1TY2A 1D5MC 1FM0D 1L0YB 4LK0M 2WDRB 3NVYA 1I4RA 1UGJA 2HDEA 3P4PB 1XLQA 4RFBA 1F77A 1I7HA 2PTLA 1TKEA 4HKZE 3L4PA 4DXFA 2WU2B 4MH8A 4US8A 2E3TA 1KLGD 1SE3A 3B2GA 4RGMA 4ARCA 3H8HA 2K5PA 4WQMA 1DGJA 4HKQA 4AQ7A 2WU5B 1GB1A 2LJIA 2X38A 1C4PA 2IGDA 4XWWA 4KKJA 1PFDA 1JALA 4KKIA 1JWSD 2MH7A 1KRHA 1J7CA 1T3QA 2PIAA 4HROA 4L1BA 4WIPA 2LHEA 1I4HA 1V8CA 4YXDB 1FCLA 1CQVA 4PT5A 1TKGA 3URYA 1K52A 1BUIC 3NVWA 1F0ZA 2N0SB 2JU6X 1QILA 1VRAB 3AE1B 3NRZA 4P16A 2W82A 2WXJA 1EU3A 2GB1A 1N5XA 2BT6A 5EE1A 4OZBA 4TQ1A 3AEGB 3AEBB 2OHFA 4MT5A 3BZDB 1ESFA 1I4GA 2L52A 1SEBD 1ACCA 1XXGA 4ITKA 3FILB 2SEBD 3GB1A 1A70A 1D5ZC 1FRDA 2DYOA 3CIRB 5EE9A 1XLNA 2XN9C 4KGTA 3BIID 1SBBB 1FXIA 2KQ4X 2WXKA 1N61A 3BK1A 1BMLC 1D5XC 2W3SA 4OZCA 1JMLA 4RH6A 4JE3B 2LUMA 2FUG1 3MHZA 4JPSA 2RMMA 1TS4A 3OWEB 1ZE3D 1HXYD 4O1NA 1Q10A 3AE7B 4JX1C 1ZXIA 1DYQA 2ZW1A 1B9RA 2E6XA 4N6EB 2IGHA 4OHJA 3ZGZA 4KX6B 2GI9A 4RF1A 1K50A 1C79A 5E6JA 2CU3A 1SB3C 2RDGA 3ABVB 5FK9C 1SJHD 3PZ7A 1I4PA 2WLBA 1JWUD 4XWTA 4WAFA 1VR9A 4MACA 2PMVA 1T6BX 1YN4A 5AUIA 5BMIA 1TZOA 1EM7A 5FR3A 1EWCA 1XLOA 1WYGA 2J52A 4B0MA 1QLBB 1CJEA 3AN1A 4ZOHC 2ICIA 4NZLB 1ZDXA 2N9KA 4XDCA 1NENB 5HFYA 1V1OA 3AV8A 4RGNA 3KQ4A 1E0ZA 3MJ5A 2LMCA 4KGSA 3KWVA 3E56A 3HVZA 1EU4A 1QOAA 3Q8EA 2CJOA 4US9A 1HA5A 4L23A 1TJEA 2ZW0A 2JX5A 2AX5A 2VZKB 1YNTE 5LNK1 4RF0A 3P4SB 1MVKA 2AQ2B 2QEJC 1FNWA 1L6VA 1PGBA 5C3JB 2Y3AA 3U7ZA 3TEYA 2WXGA 2YEPF 3TEZA 1ENFA 2DYMA 2TSSA 2D5GA 2BS3B 2ON8A 1E10A 5HG2A 4EE2A 2V3NA 2WXLA 3AE2B 4ZYSA 2V4IB 2RPVA 3P42A 4C7ZA 5BMGA 4B0EA 2M0AA 1C9FA 1AW7A 2BBCA 4GDKB 3T3OA 1DOYA 1J7AA 2WXRA 3GS2A 4HRSA 3AECB 1QOBA 1Y56A 3NS1A 1RYJA 3Q69A 4GDLB 1PGXA 3VQIA 1XLPA 1D4BA 1KF6B 1HQRD 4NAWB 5T8IA 2M19A 2W3RA 2XNAC 1E7PB 1YJJA 3BVZA 4N59A 5FKAC 1IGDA 1ZOYB 2WS3B 3IAS1 3MP9A 1WXQA 3AEDB 4C56C 4J3OD 3MC0B 3VRAB 3W2DA 4IKGA 2KN4A 2LEKA 2KDMA 2VZKD 4RGOS 2I38A 4ZRQA 1AWDA 2H89B 1FFVA 3LYYA 1DOIA 1ZP0B 2AQ1B 2JYEA 1KFYB 1OFFA 1IUEA 3FAHA 3U2SC 1P7FA 4FXCA 2IDYA 1QKZA 4JWSC 1VJKA 1PDXA 3IXSA 3WCQA 1MHXA 3I57A 3VR9B 1V1PA 2JXTA 1C4AA 1HEZE 1N62A 2H88B 2WXMA 1L5PA 3C8YA 4ZHOA 1L4ZB 5BMHA 1T5XD 2I2YA 4KGRA 1RWSA 1IBXA 1SJED 1M4VA 2PW9A 3DWMA 5G5GA 5MPOA 4NAMA 2FBWB 3AE9B 1AN8A 1YN5A 3DWGC 3ZYYX 1SSNA 3AE5B 1ZXHA 1J7BA 2L83A 2M56B 3P4RB 4D2KA 3U52E 1CK1A 1YMHE 4N58A 3ZQ4A 1C76A 4YT0B 2BB5A 5GXGB 3TEXA 1I4XA 1C78A 2ONQA 3VRBB 2L32A 4H2AA 3MFGA 3BYYB 2AQ3B 2PLPA 1UWMA 3B9JA 2L1AA 1TYGB 4M0WA 2G1EA 1L6UA 4XE0A 1RFKA 4TMAB 2Z8LA 4Q2JA 1YJIA 2INNE 1PUTA 2KWDA 4OVZA 1NYRA 1VZ7A 3AE6B 3AB5A 2INPE 3E9SA 2QIEB 2CJNA 1KTKA 2K9XA 3R8BA 1KLUD 2MJ3A 4OW0A 4MM3B 5G5HA 1DOXA 3R2IA 3BVMA 1MI0A 3HUIA 1QT9A 2LFIA 3TSSA 3EGRA 1IBXB 3Q8CA 4YTPB 4YSXB 2DBYA 1QOFA 1JCKB 2WDQB 3AM9A 1FFUA 3TEWA 2BYTA 3P1MA 4A6QA 2IPKD 1QOGA 1FEHA 5BYQA 1VDVA 3W5UB 1XO3A 1FXAA 3LXFA 1R7SA 2EKIA 1E6EB 3IAM1 2KAJA 1SF0A 3KWLA 2JSVX 3ZJUA 3NVZA 2QJLA 1SE2A 3AEFB 3BYTB 2JYTA 2BTEA 2MJEA 1QF6A 1UWXA 2V3PA 1WSPA 3AE3B 2RDHA 1YQ4B 2B76B 3NUHB 1V97A 3FC4A 1JWMD 2J42A 3IT6B 1FRRA 4A55A 4C80A 1STEA 2IJ0A 4RNAA 4ZHPA 2Q5WD 3HRDD 4OZAA 1MHHE 4XDDA 1YQ3B 2WDVB 3NVVA 4RGTA 3PZ8A 3SR6A 4TQ0A 2IGGA 1F2RI 5AUKA 2J4XA 2K22A 2JWUA 1N60A 2J53A 4YSYB 3ETRA 3SEBA 1JWBD 2EELA 2QMTA 3T3NA 2W55A 2KACA 1SXTA 5EE0A 1B1ZA 1TS2A 2PKOA 1L0XB 1VLBA 1ET6A 1HZ6A 1JQ4A 1P7EA 2NTTA 3J9CA 3IT4B 3P63A 2WXFA 5HHDG 4RCOA 4C7YA 1TS3A 3LB8C 1KH0A 3B2FA 1K51A 1C77A 4ZRPA 1LO5D 1JWAD 2PVOD 1QQRA 1TKYA 2LHDA 2WQYB 2YEPB 4WWMA 4YWGG 3O13A 2ACZB 1MPEA 3EA6A 2NTSA 4P6VF 1UNSA 3V3XA 3AE4B 4A8XC 2WXOA 1OQQA 1XCQL 4R3DA 3N9YC 4HEA1 2QSDA 3VR8B 2OEDA 3AEAB 1NEKB 1L4DB 2BS2B 4A9AA 3BK2A 5H8YE 4IOIE 4DXGA 3R2TA 1NVID 4IDIA 3P4QB 4GLSC 1BXTA 2G9HD 4WURA 2K3UA 4CQNA 3Q8AA 5TSSA 4LTUA 1TY0A 3AMZA 3UI3A 1PGAA 1XEEA 1K53A 5HI1A 1L0VB 2Y5PA 4HJGE 2WXQA 2MEKA 1XCTL 4YTNB 4UDUC 3Q8BA 3ZJTA 3BWUD 1FNVA 1RM6C 3TUOA 4WH4A 1OQRA 2JQRB 2WXIA 5D3IB 1N63A 3Q8FA 1E9MA 3PO0A 3AE8B 2GRIA 1C4CA 1V1PB 1FCCC 2WXPA 4TSSA 1FNUA 3V05A 1FMAD 4DQOC 2KMMA 2Y5CA 1CZPA 2PVGC 1ZDVA 1GAQB 1D6EC 2WNMA 3RFZB 2LGIA 1TS5A 1FIQA 2NMQA 1NI3A 1XF5L 3AH7A 1VZ8A 4NJCA 1JRPA 1NYQA 3ZJVA 1HZ5A 5I4DA 3W5VB 4YSZB 2FE8A 2BW2A 2HTME 2N9LA 5BYSA 1JW9D 2SAKA 3CWIA 1JROA 2WXHA 3W1SA 1AYFA 5BYRA 1GOZA 4L2YA 2WXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUD 2;  5MPO A;  2CU3 A;  1SB3 C;  2FBW B;  2BS4 B;  3ABV B;  3AE9 B;  3DWG C;  4USA A;  5EE0 A;  3SFD B;  3ZYY X;  3AE5 B;  2WLB A;  1J7B A;  2L83 A;  2WP9 B;  2PKO A;  4YTM B;  2M56 B;  1SIJ A;  3P4R B;  4JWU C;  5EE3 A;  5H92 C;  1VLB A;  4N58 A;  5AUI A;  4YT0 B;  1JQ4 A;  1WRI A;  5GXG B;  1WYG A;  1XLO A;  3P63 A;  2W54 A;  2DWQ A;  1FO4 A;  1QLB B;  1CJE A;  3AN1 A;  1N5W A;  4ZOH C;  4C7Y A;  3VRB B;  3W9C B;  1NEN B;  3AEE B;  3LB8 C;  1UWM A;  3AV8 A;  3EUB 2;  3B2F A;  3B9J A;  1WGK A;  1EWY C;  1TYG B;  1E0Z A;  1ROE A;  2G1E A;  1GPX A;  3HVZ A;  1QOA A;  1L6U A;  1JWA D;  2CJO A;  1RFK A;  1TKY A;  2PVO D;  2WQY B;  4WWM A;  4US9 A;  5C2T B;  1TJE A;  3SFE B;  1WWT A;  2ACZ B;  2AX5 A;  2JX5 A;  2MJD A;  1FM0 D;  4P6V F;  3AE4 B;  2WDR B;  1OQQ A;  1YJI A;  3NVY A;  3P4P B;  1XLQ A;  1I7H A;  3P4S B;  1PUT A;  1NYR A;  1TKE A;  3AB5 A;  3AE6 B;  3L4P A;  2WU2 B;  2QIE B;  2CJN A;  3VR8 B;  4US8 A;  1L6V A;  2E3T A;  5C3J B;  3AEA B;  1NEK B;  2K9X A;  3B2G A;  2BS2 B;  2MJ3 A;  4A9A A;  4WQM A;  2K5P A;  1DGJ A;  5H8Y E;  5G5H A;  1DOX A;  2BS3 B;  1NVI D;  2WU5 B;  4IDI A;  1E10 A;  3HUI A;  1QT9 A;  3AE2 B;  3P4Q B;  1PFD A;  1JAL A;  4C7Z A;  4YTP B;  4YSX B;  2DBY A;  2MH7 A;  1KRH A;  1QOF A;  1J7C A;  1T3Q A;  2PIA A;  2WDQ B;  3AMZ A;  3AM9 A;  1FFU A;  4HRO A;  4LTU A;  4YXD B;  1V8C A;  1DOY A;  1J7A A;  3P1M A;  4HRS A;  1L0V B;  3AEC B;  1QOB A;  3NS1 A;  1TKG A;  1QOG A;  3NVW A;  1F0Z A;  1RYJ A;  2N0S B;  4YTN B;  1XLP A;  1KF6 B;  1VDV A;  3W5U B;  1RM6 C;  3AE1 B;  3NRZ A;  1XO3 A;  1OQR A;  2M19 A;  2JQR B;  1FXA A;  2W3R A;  3LXF A;  1R7S A;  2EKI A;  1N63 A;  1E9M A;  1N5X A;  1E6E B;  1E7P B;  2BT6 A;  3PO0 A;  5EE1 A;  3AE8 B;  1YJJ A;  3AEG B;  3AEB B;  2OHF A;  2KAJ A;  1SF0 A;  1ZOY B;  2WS3 B;  3KWL A;  4N59 A;  2L52 A;  1WXQ A;  2QJL A;  3NVZ A;  4ITK A;  3AEF B;  3AED B;  3VRA B;  1FRD A;  1A70 A;  2MJE A;  1FMA D;  2LEK A;  1QF6 A;  2KMM A;  3CIR B;  5EE9 A;  3RPF C;  1XLN A;  1AWD A;  2Y5C A;  2H89 B;  1CZP A;  2PVG C;  3AE3 B;  3BII D;  1FFV A;  1DOI A;  1GAQ B;  1FXI A;  1ZP0 B;  1YQ4 B;  1N61 A;  2W3S A;  1FIQ A;  2B76 B;  1KFY B;  1OFF A;  1IUE A;  1V97 A;  1NI3 A;  3FC4 A;  3FAH A;  4FXC A;  3AH7 A;  4JWS C;  1VJK A;  1FRR A;  1PDX A;  4C80 A;  4ZHP A;  1JRP A;  1NYQ A;  2Q5W D;  3HRD D;  3WCQ A;  3AE7 B;  1YQ3 B;  4JX1 C;  2WDV B;  1ZXI A;  3NVV A;  3VR9 B;  3W5V B;  4YSZ B;  1N62 A;  2HTM E;  2H88 B;  4ZHO A;  3SR6 A;  1L5P A;  1B9R A;  5AUK A;  1JW9 D;  4N6E B;  3CWI A;  1JRO A;  1RWS A;  2K22 A;  1AYF A;  1N60 A;  4KX6 B;  4YSY B;  3ETR A;  1JWB D;  3DWM A;  5G5G A;  2W55 A; 
#chains in the Genus database with same CATH topology
 3Q14 C;  4USA A;  3WAM A;  3U4E G;  2KN5 A;  3IHP C;  4M0W B;  3RZW C;  2BB6 A;  2WP9 B;  4YTM B;  1SIJ A;  5EE3 A;  4AS1 A;  1TBE A;  1I4Q A;  4BKS A;  3I9V 1;  5D7G A;  2DLB A;  2MBE A;  4LLG M;  3RNA C;  1E8W A;  3AI5 A;  1GJZ A;  2R2Q A;  2DZK A;  1ROE A;  3RUI B;  4DDG D;  1N6Z A;  1L0Y B;  4LK0 M;  2WDR B;  3P4P B;  2Z59 B;  3K9P B;  4HKZ E;  4DXF A;  4MH8 A;  3BY4 B;  4US8 A;  2E3T A;  1KLG D;  3EEC A;  4ARC A;  3H8H A;  4DHZ E;  2N9X A;  2WU5 B;  4FHK A;  4JQW C;  2JRI B;  4LDT D;  3JSV B;  1PFD A;  4KKI A;  3W1Y A;  3WAO A;  1JWS D;  2K8C A;  1OQY A;  1T3Q A;  3GE8 C;  4YXD B;  1I4H A;  4LJO B;  3NJT A;  2IO0 B;  1K52 A;  3NVW A;  2N0S B;  3QK0 A;  4TKN A;  1FPY A;  4WWN A;  4P16 A;  2GB1 A;  2BT6 A;  5CHV C;  2NR2 A;  4DWF A;  1H8C A;  2GBM A;  1FRD A;  2MRP A;  3OJ4 B;  3PV1 A;  1XLN A;  2ZNV C;  4KGT A;  4KZ0 A;  2KQ4 X;  4HK2 A;  3BK1 A;  4IG7 B;  2FUG 1;  3IG3 A;  4JPS A;  1Q0W B;  1HXY D;  1Q10 A;  2ASQ A;  1WY8 A;  1GG3 A;  2LVP A;  3TJP A;  2D3G A;  2LXC A;  2CU3 A;  3ABV B;  1SJH D;  4XWT A;  1JWU D;  5C1Z A;  5DPW A;  2RSU A;  1Z2M A;  2PMV A;  1T6B X;  1YN4 A;  1TZO A;  5JHB A;  1EM7 A;  1UH6 A;  2UYZ B;  1WYG A;  2J52 A;  1CJE A;  3AN1 A;  4YL8 A;  4XDC A;  3DQV A;  1V1O A;  2G4D B;  1VCB A;  2JUO A;  2KK8 A;  3Q3M C;  1H4R A;  4BBN C;  4US9 A;  3PGE A;  4AJY B;  5J18 A;  2JX5 A;  5GMV A;  2VZK B;  1AAR A;  3RD2 A;  3P4S B;  2MBH A;  2QEJ C;  3DVN V;  4IM0 A;  3U7Z A;  3PZD A;  2D5G A;  2BS3 B;  4TUU A;  2C7H A;  3M63 B;  3AE2 B;  2V4I B;  1C9F A;  4WJO A;  2BWE S;  4GDK B;  4HRS A;  4ICV A;  1PGX A;  2XK5 B;  1XLP A;  4NAW B;  4HWI B;  5DPS A;  5IA7 A;  2XNA C;  3C19 A;  4ANX A;  2FAZ A;  3WAP A;  2LGX A;  2IO1 B;  1ZOY B;  4W9D A;  4C56 C;  1WZ3 A;  2FCN A;  2KN4 A;  2LEK A;  1LGR A;  1AWD A;  3A9J A;  3UIP B;  3ZKJ C;  2K8H A;  3FAH A;  1P7F A;  2IDY A;  4X57 B;  1VJK A;  1PDX A;  4PYU A;  3IXS A;  4MM3 A;  3C8Y A;  2JXT A;  3ZJT A;  2BVC A;  3H6N A;  1L4Z B;  4BOZ B;  4KGR A;  1SJE D;  4NNJ B;  2IO3 B;  3DWM A;  3SD5 A;  4F8C B;  1AN8 A;  3KYD D;  1ZXH A;  3PLU A;  3BIN A;  4MSQ B;  4DK5 A;  4YT0 B;  2LGS A;  2MX2 A;  2HD5 B;  1I4X A;  1S3S G;  4P1C C;  3B1L X;  4H2A A;  2AQ3 B;  2PLP A;  3TL5 A;  3ZTD A;  1WH3 A;  3HK0 A;  4XE0 A;  1KJT A;  1YJI A;  4M01 A;  2Z0E B;  3E9S A;  3R3M A;  1X1M A;  4F1S A;  1YX6 B;  4HCP B;  1IBX B;  1MFW A;  3Q6B A;  1C1Y B;  3TEW A;  2LAS A;  2BYT A;  3APD A;  1QOG A;  1XQQ A;  3RNB C;  4AOF A;  2Y5B B;  4KSL C;  1VDV A;  3LXF A;  2N9P C;  2BKR B;  2KAJ A;  4GXB A;  4W9L A;  2QJL A;  1SE2 A;  1NBF C;  2KFJ A;  4LDT B;  3RT3 B;  2KTR A;  1UWX A;  4W9I A;  1WSP A;  3PVL A;  2LZ6 A;  1V97 A;  3FC4 A;  1FRR A;  1WXV A;  4ZHP A;  1STE A;  2IJ0 A;  2MCN B;  2FID A;  1YQ3 B;  2WDV B;  2NVU I;  3SR6 A;  4TQ0 A;  3L13 A;  3RCZ A;  1N60 A;  2J53 A;  4YSY B;  4GB9 A;  3MHS D;  2FNJ B;  2PKO A;  1WZ0 A;  1Y8R C;  3X0W A;  4MGI E;  2D3C A;  2MWS B;  3PS6 A;  2K1F A;  1P7E A;  3ZRF A;  3J9C A;  2VH1 A;  2KJ6 A;  3LJ3 A;  3B2F A;  4BZA A;  2PPH A;  4K3B A;  1K51 A;  2G3Q B;  1ZGU B;  2PE9 A;  1C77 A;  2JF5 A;  2PVO D;  2WQY B;  1QQR A;  4KIK A;  4KZC A;  4KDI C;  2NTS A;  1UNS A;  4A8X C;  1OQQ A;  3X23 A;  3N9Y C;  4HEA 1;  2BS2 B;  3APF A;  3DPD A;  4A9A A;  5AEK B;  4MGK E;  1WGH A;  3ZXR A;  2G9H D;  1T0R C;  4C4V B;  4HJK A;  4URK A;  2D10 A;  4LTU A;  1TY0 A;  3AMZ A;  2JRH A;  3UI3 A;  1PGA A;  5AZF A;  2Y5P A;  3A9K B;  4AWJ A;  4UDU C;  2L3Z A;  4S0R A;  2VH2 A;  3TUO A;  3RMK C;  2ZNV B;  2JQR B;  2WXI A;  1N63 A;  1GUA B;  3PO0 A;  2GRI A;  3N1Y C;  1C4C A;  1TT5 B;  5LXH A;  4EZL A;  2KMM A;  1CZP A;  2PVG C;  2WNM A;  1D6E C;  3RFZ B;  4S17 A;  1XF5 L;  1MJD A;  4FA6 A;  4NJC A;  4M8M A;  3W5V B;  3O65 B;  5E6O A;  1E7U A;  2HTM E;  1LFD A;  3TCA A;  2WXH A;  3NG0 A;  4FJY A;  2WXN A;  1ZUD 2;  3ZNI D;  2BS4 B;  4K7U A;  1V86 A;  3QWZ B;  4A90 A;  1OEY A;  3HVD A;  5DCN A;  2N1V A;  3H7P A;  4W9C A;  1WRI A;  5E6N A;  2ZPN A;  2W54 A;  1WE7 A;  1N5W A;  3MTN B;  1F2R C;  1WR6 E;  3ZW3 A;  5IO9 A;  3V6C B;  3RPF C;  4FN2 A;  2JZP A;  3SFE B;  1WWT A;  1WX7 A;  3PT2 B;  5CHW A;  2JZZ A;  3NVY A;  1I4R A;  3TIX A;  1F77 A;  2PTL A;  1J19 A;  2D11 A;  1SE3 A;  1HTO A;  4M00 A;  4FJZ A;  4HKQ A;  4AQ7 A;  1GB1 A;  3A1Q B;  5CHF A;  2LJI A;  1RFA A;  1WJN A;  3RZF A;  2KWV B;  3DBR I;  1KRH A;  3L54 A;  2PIA A;  3ZVV A;  4L1B A;  1V8C A;  3QA8 A;  4NPN A;  1TKG A;  3URY A;  3OG5 A;  2JU6 X;  4EUT A;  3DBR B;  3AE1 B;  1TGZ B;  2DHZ A;  3N30 A;  3LDZ E;  4FUL A;  2GBN A;  5EE1 A;  5L95 C;  3AEB B;  2C7N B;  1CMX B;  3T8M A;  2L52 A;  1ACC A;  4ITK A;  3FIL B;  4WJN A;  4IM2 A;  1QZE A;  3GZN I;  1SBB B;  1WYW B;  4FAD A;  3SU8 X;  4DHJ B;  4JE3 B;  2LUM A;  4O1N A;  5BO4 B;  4MDK E;  3N20 C;  1IPG A;  4OHJ A;  3ZGZ A;  2WHI A;  4KX6 B;  1I42 A;  2MBO A;  4RF1 A;  4BBN F;  4IWQ A;  1K50 A;  4GDK A;  3EFC A;  2L00 B;  2JZ3 B;  3PZ7 A;  2XK5 A;  4KIK B;  5JH5 C;  2ZPY A;  4NAW A;  5BMI A;  5C23 A;  1EWC A;  4B0M A;  4ZOH C;  4XYC A;  5HFY A;  3PRE A;  4RGN A;  1E0Z A;  3MJ5 A;  2LMC A;  4KGS A;  3ENE A;  2CJO A;  2KX3 A;  2L05 A;  4RM9 A;  1F1H A;  1TJE A;  2AX5 A;  3N3K B;  1YNT E;  2V9H A;  2AWT A;  3B08 A;  5LNK 1;  1C3T A;  2AQ2 B;  2N1W A;  2M4N A;  3R7R A;  5C3J B;  2WXG A;  2YEP F;  3RNC C;  1SE9 A;  1E10 A;  4BKG A;  5HG2 A;  4EE2 A;  4HXD A;  2WXL A;  3ML8 A;  4ZYS A;  5L83 A;  2M0A A;  2MA9 B;  1AW7 A;  1OTR B;  2VRR B;  2AEH A;  1DOY A;  1J7A A;  2M8S A;  3Q3J A;  5T8I A;  3W1S C;  2DZI A;  2M19 A;  1SIF A;  1YJJ A;  2WS3 B;  5DPT A;  2A5U A;  3UIN B;  4G11 A;  3MC0 B;  3W2D A;  4I6N B;  2DAJ A;  5IN7 A;  2BPS A;  2L7R A;  3LYY A;  1DOI A;  3PHW B;  4II3 B;  3HM3 A;  4HPP A;  4ANW A;  3U2S C;  1QKZ A;  2OJR A;  1WMH B;  1LQB A;  1V1P A;  3H7P B;  1HEZ E;  1N62 A;  2WXM A;  4BKT A;  2V4L A;  1L5P A;  1S1Q B;  2I2Y A;  1RWS A;  2IYD B;  1IBX A;  1K8R B;  3ZLZ A;  2PW9 A;  2DZM A;  4PS7 A;  2XEW A;  4I6L B;  2K39 A;  4NAM A;  2AL3 A;  2FBW B;  1YOV B;  3DWG C;  2WX0 A;  1SSN A;  1F9J A;  3JYU A;  2L83 A;  3FKY A;  3P4R B;  3I63 C;  1WM3 A;  2KWC A;  4D2K A;  2PE6 B;  4N58 A;  1C76 A;  2BB5 A;  5GXG B;  5JHA A;  3TEX A;  1C78 A;  2KYW A;  2ONQ A;  1YIW A;  1UF0 A;  1UWM A;  3L17 A;  3AUL A;  2QDF A;  3SHQ A;  2JWZ A;  2REX A;  1L6U A;  3Q2A C;  4E74 A;  3L0W B;  2AL6 A;  2FIF A;  4I6P A;  4LNO A;  4OVZ A;  1XT9 B;  2K9X A;  2MJ3 A;  3TBL D;  5G5H A;  1TZ1 A;  1MI0 A;  3HUI A;  1QT9 A;  2LFI A;  1UGM A;  5LXI B;  1UEL A;  3EGR A;  4GU2 A;  1QOF A;  2ZZP B;  1JCK B;  2BKF A;  1YX5 B;  4A6Q A;  1A5R A;  4PYZ A;  2BGF A;  2QHO A;  5D94 A;  3W5U B;  3B0A A;  1XO3 A;  4W9K A;  3DVG X;  3CF6 E;  1HE8 A;  3ZJU A;  1D3Z A;  4A3P A;  1UBI A;  3BYT B;  2KD0 A;  2JYT A;  2BTE A;  3KUD B;  2M17 A;  3AE3 B;  4CO7 A;  4W9J A;  4G0N B;  2MLB A;  1YQ4 B;  4J6I A;  1YJ1 A;  3NUH B;  3KYC D;  1T0Y A;  4RGT A;  3PZ8 A;  5AUK A;  1F2R I;  2J4X A;  5D6J B;  4C4V A;  2FCS A;  2JWU A;  2QMT A;  2EEL A;  3WAL A;  3VFK A;  2GMI C;  2KAC A;  3NOB A;  2OJW A;  3A9K A;  1PQS A;  1TS2 A;  4M02 A;  1JQ4 A;  5KHQ A;  5HHD G;  4IWP A;  4C7Y A;  3VHT C;  1WM2 A;  3RUL A;  3LB8 C;  1E7V A;  4M8N A;  2I1K A;  3WA0 A;  3RNG C;  4YWG G;  4DDI D;  2ACZ B;  1MPE A;  4P6V F;  3EC8 A;  1VD2 A;  3AE4 B;  2KLC A;  2MBB B;  2WXO A;  2KC1 A;  2QSD A;  1EF5 A;  3VR8 B;  4BFR A;  2KOX A;  4LNN A;  5H8Y E;  4IOI E;  3R2T A;  3ZRC A;  3ZIM A;  4G50 A;  2MHJ A;  2KDI A;  2ZVO A;  2D3B A;  4WUR A;  2K3U A;  3AU5 A;  3ML9 A;  4CQN A;  2KX0 A;  1JRU A;  5TSS A;  2L0T A;  3ZO5 B;  3UGB B;  2LI5 A;  1XEE A;  2J7Q B;  3NS8 A;  4HJG E;  3VUX A;  2MEK A;  1XCT L;  3QX1 A;  2J0J A;  1WE6 A;  3Q8F A;  1E9M A;  4FHJ A;  1WRD B;  2KKC A;  1V1P B;  1FCC C;  4TSS A;  1FNU A;  3PRP B;  2Y5C A;  3UQB A;  3I3T B;  2LGI A;  1TS5 A;  1ZKH A;  2NMQ A;  1T0Q C;  4KVG B;  1VZ8 A;  1JRP A;  5I4D A;  4JGH B;  4YSZ B;  4MEL A;  2FE8 A;  3A1Q A;  3N1X C;  4GSW A;  2N9L A;  2KVZ A;  3CWI A;  3Q3N C;  3GOE A;  4L2Y A;  3CST A;  3NZ3 A;  2GBK A;  5D3D A;  3SFD B;  2O6V D;  2K0P A;  3OJ3 A;  4JWU C;  2GOW A;  2KZR A;  3HM6 X;  5H92 C;  1FD6 A;  3VUW A;  3VDZ A;  2DWQ A;  1YN3 A;  4XC2 A;  2YVC A;  4EOY A;  4REZ A;  3FIL A;  2CHZ A;  3CSF A;  1V9J A;  1WGK A;  1EWY C;  3APC A;  4JLC A;  2AYO B;  1Q5W B;  1XD3 B;  1J0G A;  2YLM A;  3P2B A;  1J8C A;  2QIL A;  3DBL I;  3GP7 A;  4AJW A;  1KOT A;  5JXV A;  3BVG A;  4LJP B;  1ZW7 A;  1TY2 A;  3IFW B;  4OVV A;  1UGJ A;  4RFB A;  3DOW A;  1I7H A;  2RGF A;  2JY6 A;  1TKE A;  2WU2 B;  3DBL B;  4WQM A;  1DGJ A;  3PLV A;  2X38 A;  4IW0 A;  2IGD A;  4KKJ A;  1JAL A;  4GMV A;  4HRO A;  1GC6 A;  4WIP A;  2LHE A;  2NBV B;  4MEM A;  4ACF A;  1CQV A;  2KXJ A;  1BUI C;  1F0Z A;  4II2 B;  1QIL A;  3D32 A;  3QAR A;  3H9D A;  1TTN A;  2W82 A;  1EU3 A;  3GE3 C;  4OZB A;  4TQ1 A;  2MP2 A;  3AEG B;  2HTH A;  2OHF A;  4MT5 A;  3VTU A;  1ESF A;  1XXG A;  3ZDT A;  2XBB C;  2K25 A;  2XN9 C;  2LVQ A;  3WIM A;  3BII D;  3VVW B;  1FXI A;  1MG8 A;  1D5X C;  4RH6 A;  3SDL C;  3MHZ A;  4HDO A;  4IM3 A;  1ZE3 D;  3ECI A;  3AE7 B;  1WXM A;  4NY0 A;  1B9R A;  2E6X A;  4DBG A;  3H1U A;  5J17 A;  2GI9 A;  3JW0 X;  5E6J A;  1SB3 C;  2RDG A;  5FK9 C;  3K9O B;  4PS3 A;  1I4P A;  3PSE B;  4WAF A;  1VR9 A;  2HJ8 A;  4MAC A;  1WXA A;  1R4N I;  2KAN A;  1QLB B;  1MG4 A;  2J0M A;  2ICI A;  4NZL B;  1GC7 A;  2N9K A;  2KT7 A;  3AV8 A;  3KQ4 A;  3A33 B;  2CHX A;  1EU4 A;  3RI7 C;  1R4N B;  3Q8E A;  2N7D A;  3EFU A;  1HA5 A;  4L23 A;  3L16 A;  1WMH A;  2BYV E;  4RF0 A;  1MVK A;  4DXA B;  1L6V A;  1PGB A;  2Y3A A;  4A20 A;  2C9W B;  1RAX A;  2V3N A;  4BAX A;  3P42 A;  4C7Z A;  3HHM A;  4ZYN A;  2LUE A;  2BBC A;  2KHW B;  3T3O A;  1SGH A;  3MC9 A;  2WXR A;  2V3S A;  1QOB A;  2IZV B;  3NS1 A;  3V62 A;  3QC8 B;  3Q69 A;  4WWP A;  4HLE A;  1D4B A;  1KF6 B;  5AZH A;  2W3R A;  2WGS A;  2JVC A;  2ZJD A;  3ZNZ B;  2JPH A;  3QCA A;  3IAS 1;  3MP9 A;  3RN9 C;  1NI2 A;  2KDB A;  4IKG A;  4RGO S;  2KDM A;  2VZK D;  3RNF C;  4A3O A;  5D2M B;  4ZRQ A;  2H89 B;  1FFV A;  3TMP B;  5AZG A;  1ZP0 B;  1E90 A;  2JYE A;  1WJU A;  2L76 A;  1KFY B;  3PRM B;  4FXC A;  5FR6 A;  1V6E A;  3WCQ A;  1MHX A;  2LJ5 A;  1C4A A;  2JT4 B;  2H88 B;  4ZHO A;  3DHH C;  1T5X D;  1M4V A;  4W9F A;  4ZRK A;  2LGY A;  5G5G A;  3OAW A;  2KNB A;  1V80 A;  3AE9 B;  1YN5 A;  3ZYY X;  3AE5 B;  1J7B A;  3VXW A;  2M56 B;  2HJ1 A;  3U52 E;  2B3A A;  3AXC A;  1YMH E;  4K81 A;  4ZRI A;  3ZQ4 A;  4HCN B;  3U8Z A;  2N7E A;  3VRB B;  2NBW B;  3UIO B;  3R66 C;  3MFG A;  3BYY B;  2LWP A;  2L1A A;  1TYG B;  4ANU A;  2DZJ A;  4ZDV A;  2FCM A;  2MW5 A;  2EMS A;  1WGY A;  2Z8L A;  4Q2J A;  2O6V B;  4BKS D;  1PUT A;  1P98 A;  1VZ7 A;  3AB5 A;  2INP E;  2CJN A;  3RYT A;  3UF8 A;  3N32 A;  1IYF A;  4OW0 A;  1DOX A;  3R2I A;  1V81 A;  4WJP A;  2MP2 B;  3Q8C A;  4YSX B;  3AM9 A;  1FFU A;  3QHT A;  4AUQ C;  3IVF A;  3KVF B;  2IPK D;  2QCZ A;  1FEH A;  5BYQ A;  3N1Z C;  2G45 B;  4FLH A;  2IY0 B;  2DEN B;  2FUH B;  4PK1 A;  3KWL A;  2JSV X;  3NVZ A;  4MH0 E;  1P0R A;  1WFY A;  1QF6 A;  2Z0D B;  4EKU A;  2RDH A;  3AU4 A;  2LVO A;  3VUY A;  2KWU B;  3IT6 B;  4C80 A;  4A55 A;  4RNA A;  2Q5W D;  3HRD D;  3M95 A;  4OZA A;  2IBI B;  3PRZ A;  3VTV A;  1WX9 A;  3C0R B;  2K22 A;  3ZDM C;  5TR5 A;  3ETR A;  3SEB A;  1WI0 A;  2W55 A;  2K6D B;  2L8J A;  1SXT A;  3QJZ A;  1E5W A;  1F52 A;  5KHO A;  1L0X B;  3NHE B;  1ET6 A;  2KLG A;  4ICU A;  4MSM B;  2NTT A;  1TIF A;  2WX1 A;  1OEY J;  2WXF A;  4RCO A;  3DBH I;  2K6Q A;  4KSK C;  1TS3 A;  1KH0 A;  4ZRP A;  2KFK B;  2ZCC A;  1JWA D;  3DBH B;  2LHD A;  4NQL B;  4WWM A;  3O13 A;  4W9H A;  2KVR A;  3DHI C;  2INC C;  1XCQ L;  2CS4 A;  4LCD E;  2DAF A;  1LM8 B;  2O2V B;  1P1A A;  2OED A;  3ZXV A;  1L4D B;  1WX8 A;  4DXG A;  1NVI D;  4MGZ E;  4WQO B;  3P4Q B;  4GLS C;  1BXT A;  4MJS B;  2KO3 A;  1K53 A;  5DPR A;  4CHK A;  3Q8B A;  1FNV A;  1RM6 C;  1OQR A;  4IWO A;  2GBJ A;  1WIA A;  2WXP A;  2DYB A;  3V05 A;  4LNF A;  1WJ4 A;  1FMA D;  4DQO C;  4ASW C;  1T0S C;  1BT0 A;  1GAQ B;  4GDL A;  4NJ6 A;  5IKC M;  1FIQ A;  4TV3 A;  1YQB A;  4MGY E;  2MQJ A;  1HZ5 A;  3IBE A;  2BW2 A;  2JXX A;  2IND C;  2SAK A;  3T9L A;  2D07 B;  5BYS A;  3HIZ A;  3W1S A;  1GNU A;  4F7Z A;  4NQK E;  1GOZ A;  2MSE D;  3Q3F A;  1I35 A;  2V0G A;  4ARI A;  1PYW D;  1UUP A;  2CKH B;  2R61 A;  1GB4 A;  4GIV A;  2IO2 B;  3PTF C;  1FO4 A;  2C60 A;  1IGC A;  4QAY A;  3W9C B;  3AEE B;  3EUB 2;  5JZE B;  2D2Q A;  1ZPS A;  1ET9 A;  3DHG C;  5G55 A;  1HTQ A;  1VZ6 A;  2N7J A;  1GPX A;  5C2T B;  3KLS X;  1SE4 A;  4XX5 A;  2MJD A;  2UWQ A;  1D5M C;  2RDB C;  1FM0 D;  2HDE A;  1XLQ A;  2ZEQ A;  3L4P A;  3KH0 A;  1RRB A;  3B2G A;  3M62 B;  4RGM A;  2K5P A;  2NCN A;  1C4P A;  2A4Z A;  2RR9 A;  2BWF A;  4XWW A;  2MH7 A;  1J7C A;  3A4R A;  2IY1 B;  1M94 A;  1NDD A;  4K1R B;  4CYE A;  1FCL A;  2C7M B;  4PT5 A;  5LLI A;  1OGW A;  4HPL B;  1VRA B;  3NRZ A;  2WXJ A;  1N5X A;  3BZD B;  1I4G A;  1SEB D;  2SEB D;  4WJQ A;  3GB1 A;  1A70 A;  1D5Z C;  2CR5 A;  4LNI A;  4PS8 A;  2DYO A;  3CIR B;  4GGQ A;  5EE9 A;  3KW5 B;  3V6E B;  2WXK A;  1N61 A;  4OZC A;  1BML C;  2W3S A;  1JML A;  3PHX B;  2KJR A;  1TS4 A;  2RMM A;  4WAA A;  1EO6 A;  3OWE B;  5CTR C;  3VH4 B;  4JX1 C;  1ZXI A;  4WWO A;  1DYQ A;  1WR1 A;  2KMC A;  2ZW1 A;  4N6E B;  2IGH A;  2M1M A;  2KC2 A;  3QIJ A;  4EFO A;  1C79 A;  2W9N A;  3QAQ A;  1V49 A;  4XZ4 A;  2WLB A;  3ALB A;  1U4A A;  4E71 A;  5AUI A;  4BOS C;  2X8X X;  2BF8 B;  5FR3 A;  1XLO A;  2EMT A;  3KUZ A;  1ZDX A;  1NEN B;  4RMA A;  3DCG A;  4C00 A;  3KWV A;  3E56 A;  3HVZ A;  1QOA A;  4DHJ D;  4AP4 C;  1UD7 A;  2ZW0 A;  3OLM D;  3DBS A;  1WF9 A;  5CX3 A;  2GBR A;  2LRW A;  1FNW A;  3TEY A;  3TEZ A;  1ENF A;  1FXT B;  2DYM A;  2NPT A;  2TSS A;  2ON8 A;  2WYQ A;  2K8B A;  2RPV A;  4NJ7 A;  5BMG A;  4B0E A;  3ZTC A;  1L7Y A;  4K7W A;  1KLV A;  1P3Q U;  3GS2 A;  3WAN A;  3AEC B;  1E8X A;  1Y56 A;  2C5L C;  1RYJ A;  4GDL B;  4B6W A;  3VQI A;  1HQR D;  1P9D U;  1V2Y A;  1E7P B;  3L08 A;  3BVZ A;  4N59 A;  5FKA C;  1IP9 A;  1IGD A;  3NY5 A;  1WXQ A;  1L2N A;  3AED B;  4J3O D;  3VRA B;  3ZNH B;  2KDF B;  2I38 A;  5EDS A;  2BQQ A;  2N9E B;  2O6V A;  4EZK A;  2AQ1 B;  1OFF A;  1IUE A;  4W9G A;  2J0K A;  4JWS C;  3ZNG C;  2KQ7 A;  3I5J C;  3I57 A;  3VR9 B;  2OOB B;  5BMH A;  3UQA A;  4ANV A;  3U7D A;  2ZVN A;  1KM7 A;  5MPO A;  2BYF A;  4XGA B;  2NS5 A;  3PPA A;  4P7I A;  3JVZ X;  4BVU C;  1E8Z A;  2LGD A;  4IC7 B;  1CK1 A;  4EZJ A;  5G2N A;  1WGR A;  2FCQ A;  2L32 A;  3DVN U;  2CU1 A;  3B9J A;  3H7S A;  5J2R A;  4M0W A;  2G1E A;  1G6J A;  1V5T A;  1ISN A;  1RFK A;  3CMM B;  4TMA B;  4ZRJ A;  3A9J B;  4LNK A;  2INN E;  1WJ6 A;  4IUM B;  5IAA C;  2KWD A;  1NYR A;  3AE6 B;  2QIE B;  1KTK A;  1V5O A;  3R8B A;  1KLU D;  4MM3 B;  3ZUN A;  3BVM A;  2LD9 A;  2M0X A;  3TSS A;  4FJV B;  4YTP B;  5IOI A;  2DBY A;  3V60 A;  4KDL B;  2WDQ B;  1UBQ A;  3P1M A;  2CHW A;  4W9E A;  1Q1O A;  3U30 A;  2D3A A;  2QC8 A;  1WGD A;  4N9F 4;  1FXA A;  1R7S A;  2EKI A;  5IP4 D;  1E6E B;  3JSV A;  5E6P A;  3IAM 1;  2RD0 A;  2WDT B;  1SF0 A;  2V1Y A;  4JL9 A;  3AEF B;  2KFK A;  2MJE A;  2DX5 B;  4KV2 A;  2V3P A;  3MC8 A;  2B76 B;  2O2V A;  5HKH A;  1JWM D;  1UZX B;  2J42 A;  2MBQ A;  1MHH E;  2R2O A;  4P1B C;  2PEA A;  4XDD A;  3NVV A;  3A4S C;  4HPM B;  3VTW A;  2KTF A;  2IGG A;  4FBJ B;  4MJS A;  2GLS A;  4HDQ A;  1RLF A;  1JWB D;  2NBU A;  3T3N A;  4HVB A;  1Z5S B;  4DHZ B;  5EE0 A;  2WWZ A;  1B1Z A;  2LRU A;  2LXA A;  2N4F A;  1VLB A;  1HZ6 A;  4K7S A;  3IT4 B;  3P63 A;  2HE7 A;  4JIO U;  3V61 A;  2PJH A;  2NPT B;  1EUV B;  3VAW A;  1LO5 D;  1YD8 U;  1TKY A;  2YEP B;  2BYE A;  2KTR B;  3EA6 A;  3V3X A;  3S2A A;  4R3D A;  2DNF A;  2UU7 A;  2KDE B;  3AEA B;  1NEK B;  4B9K A;  3QQ8 B;  3EHV A;  1LXD A;  3BK2 A;  3VH3 B;  1E8Y A;  4IDI A;  4OVU A;  2RPQ A;  2KMA A;  1EF1 A;  2G4S A;  4GOC A;  3Q8A A;  3DVG Y;  3Q3O C;  3MJW A;  3L10 B;  5HI1 A;  3R7Q A;  1L0V B;  2EKE C;  2WXQ A;  4EEW A;  1R4M I;  4YTN B;  1WXS A;  3NZU A;  3BWU D;  3GZN B;  4WH4 A;  3M3J A;  5D3I B;  2KQS A;  3AE8 B;  4GN1 A;  1R4M B;  4E3C A;  3ONS A;  3RNE C;  3NZS A;  1ZDV A;  3DDC B;  4G3X B;  1NI3 A;  2I1J A;  2ZCB A;  3AH7 A;  2KJH B;  1NYQ A;  3ZJV A;  4K3C A;  3KUC B;  4B95 A;  1JW9 D;  1JRO A;  4RM8 A;  1WGG A;  2L0F A;  1AYF A;  5BYR A; 
#chains in the Genus database with same CATH homology
 1ZUD 2;  4USA A;  2BS4 B;  3NZ3 A;  5D3D A;  3U4E G;  3SFD B;  2BB6 A;  2K0P A;  2WP9 B;  4A90 A;  4YTM B;  2V0G A;  1SIJ A;  3HVD A;  1PYW D;  4JWU C;  5EE3 A;  4AS1 A;  4ARI A;  1I4Q A;  1UUP A;  5H92 C;  3I9V 1;  2R61 A;  1GB4 A;  1WRI A;  1FD6 A;  5D7G A;  2DLB A;  2W54 A;  2DWQ A;  1FO4 A;  1YN3 A;  4LLG M;  1N5W A;  1IGC A;  1F2R C;  4REZ A;  3W9C B;  3FIL A;  3AEE B;  3EUB 2;  1WGK A;  1EWY C;  1ROE A;  1ZPS A;  1ET9 A;  2QIL A;  1VZ6 A;  2N7J A;  3RPF C;  2JZP A;  1GPX A;  3GP7 A;  3SFE B;  5C2T B;  3KLS X;  5JXV A;  1WWT A;  1SE4 A;  3BVG A;  2MJD A;  1TY2 A;  1D5M C;  1FM0 D;  1L0Y B;  4LK0 M;  2WDR B;  3NVY A;  1I4R A;  1UGJ A;  2HDE A;  3P4P B;  1XLQ A;  4RFB A;  1F77 A;  1I7H A;  2PTL A;  1TKE A;  4HKZ E;  3L4P A;  4DXF A;  2WU2 B;  4MH8 A;  4US8 A;  2E3T A;  1KLG D;  1SE3 A;  3B2G A;  4RGM A;  4ARC A;  3H8H A;  2K5P A;  4WQM A;  1DGJ A;  4HKQ A;  4AQ7 A;  2WU5 B;  1GB1 A;  2LJI A;  2X38 A;  1C4P A;  2IGD A;  4XWW A;  4KKJ A;  1PFD A;  1JAL A;  4KKI A;  1JWS D;  2MH7 A;  1KRH A;  1J7C A;  1T3Q A;  2PIA A;  4HRO A;  4L1B A;  4WIP A;  2LHE A;  1I4H A;  1V8C A;  4YXD B;  1FCL A;  1CQV A;  4PT5 A;  1TKG A;  3URY A;  1K52 A;  1BUI C;  3NVW A;  1F0Z A;  2N0S B;  2JU6 X;  1QIL A;  1VRA B;  3AE1 B;  3NRZ A;  4P16 A;  2W82 A;  2WXJ A;  1EU3 A;  2GB1 A;  1N5X A;  2BT6 A;  5EE1 A;  4OZB A;  4TQ1 A;  3AEG B;  3AEB B;  2OHF A;  4MT5 A;  3BZD B;  1ESF A;  1I4G A;  2L52 A;  1SEB D;  1ACC A;  1XXG A;  4ITK A;  3FIL B;  2SEB D;  3GB1 A;  1A70 A;  1D5Z C;  1FRD A;  2DYO A;  3CIR B;  5EE9 A;  1XLN A;  2XN9 C;  4KGT A;  3BII D;  1SBB B;  1FXI A;  2KQ4 X;  2WXK A;  1N61 A;  3BK1 A;  1BML C;  1D5X C;  2W3S A;  4OZC A;  1JML A;  4RH6 A;  4JE3 B;  2LUM A;  2FUG 1;  3MHZ A;  4JPS A;  2RMM A;  1TS4 A;  3OWE B;  1ZE3 D;  1HXY D;  4O1N A;  1Q10 A;  3AE7 B;  4JX1 C;  1ZXI A;  1DYQ A;  2ZW1 A;  1B9R A;  2E6X A;  4N6E B;  2IGH A;  4OHJ A;  3ZGZ A;  4KX6 B;  2GI9 A;  4RF1 A;  1K50 A;  1C79 A;  5E6J A;  2CU3 A;  1SB3 C;  2RDG A;  3ABV B;  5FK9 C;  1SJH D;  3PZ7 A;  1I4P A;  2WLB A;  1JWU D;  4XWT A;  4WAF A;  1VR9 A;  4MAC A;  2PMV A;  1T6B X;  1YN4 A;  5AUI A;  5BMI A;  1TZO A;  1EM7 A;  5FR3 A;  1EWC A;  1XLO A;  1WYG A;  2J52 A;  4B0M A;  1QLB B;  1CJE A;  3AN1 A;  4ZOH C;  2ICI A;  4NZL B;  1ZDX A;  2N9K A;  4XDC A;  1NEN B;  5HFY A;  1V1O A;  3AV8 A;  4RGN A;  3KQ4 A;  1E0Z A;  3MJ5 A;  2LMC A;  4KGS A;  3KWV A;  3E56 A;  3HVZ A;  1EU4 A;  1QOA A;  3Q8E A;  2CJO A;  4US9 A;  1HA5 A;  4L23 A;  1TJE A;  2ZW0 A;  2JX5 A;  2AX5 A;  2VZK B;  1YNT E;  5LNK 1;  4RF0 A;  3P4S B;  1MVK A;  2AQ2 B;  2QEJ C;  1FNW A;  1L6V A;  1PGB A;  5C3J B;  2Y3A A;  3U7Z A;  3TEY A;  2WXG A;  2YEP F;  3TEZ A;  1ENF A;  2DYM A;  2TSS A;  2D5G A;  2BS3 B;  2ON8 A;  1E10 A;  5HG2 A;  4EE2 A;  2V3N A;  2WXL A;  3AE2 B;  4ZYS A;  2V4I B;  2RPV A;  3P42 A;  4C7Z A;  5BMG A;  4B0E A;  2M0A A;  1C9F A;  1AW7 A;  2BBC A;  4GDK B;  3T3O A;  1DOY A;  1J7A A;  2WXR A;  3GS2 A;  4HRS A;  3AEC B;  1QOB A;  1Y56 A;  3NS1 A;  1RYJ A;  3Q69 A;  4GDL B;  1PGX A;  3VQI A;  1XLP A;  1D4B A;  1KF6 B;  1HQR D;  4NAW B;  5T8I A;  2M19 A;  2W3R A;  2XNA C;  1E7P B;  1YJJ A;  3BVZ A;  4N59 A;  5FKA C;  1IGD A;  1ZOY B;  2WS3 B;  3IAS 1;  3MP9 A;  1WXQ A;  3AED B;  4C56 C;  4J3O D;  3MC0 B;  3VRA B;  3W2D A;  4IKG A;  2KN4 A;  2LEK A;  2KDM A;  2VZK D;  4RGO S;  2I38 A;  4ZRQ A;  1AWD A;  2H89 B;  1FFV A;  3LYY A;  1DOI A;  1ZP0 B;  2AQ1 B;  2JYE A;  1KFY B;  1OFF A;  1IUE A;  3FAH A;  3U2S C;  1P7F A;  4FXC A;  2IDY A;  1QKZ A;  4JWS C;  1VJK A;  1PDX A;  3IXS A;  3WCQ A;  1MHX A;  3I57 A;  3VR9 B;  1V1P A;  2JXT A;  1C4A A;  1HEZ E;  1N62 A;  2H88 B;  2WXM A;  1L5P A;  3C8Y A;  4ZHO A;  1L4Z B;  5BMH A;  1T5X D;  2I2Y A;  4KGR A;  1RWS A;  1IBX A;  1SJE D;  1M4V A;  2PW9 A;  3DWM A;  5G5G A;  5MPO A;  4NAM A;  2FBW B;  3AE9 B;  1AN8 A;  1YN5 A;  3DWG C;  3ZYY X;  1SSN A;  3AE5 B;  1ZXH A;  1J7B A;  2L83 A;  2M56 B;  3P4R B;  4D2K A;  3U52 E;  1CK1 A;  1YMH E;  4N58 A;  3ZQ4 A;  1C76 A;  4YT0 B;  2BB5 A;  5GXG B;  3TEX A;  1I4X A;  1C78 A;  2ONQ A;  3VRB B;  2L32 A;  4H2A A;  3MFG A;  3BYY B;  2AQ3 B;  2PLP A;  1UWM A;  3B9J A;  2L1A A;  1TYG B;  4M0W A;  2G1E A;  1L6U A;  4XE0 A;  1RFK A;  4TMA B;  2Z8L A;  4Q2J A;  1YJI A;  2INN E;  1PUT A;  2KWD A;  4OVZ A;  1NYR A;  1VZ7 A;  3AE6 B;  3AB5 A;  2INP E;  3E9S A;  2QIE B;  2CJN A;  1KTK A;  2K9X A;  3R8B A;  1KLU D;  2MJ3 A;  4OW0 A;  4MM3 B;  5G5H A;  1DOX A;  3R2I A;  3BVM A;  1MI0 A;  3HUI A;  1QT9 A;  2LFI A;  3TSS A;  3EGR A;  1IBX B;  3Q8C A;  4YTP B;  4YSX B;  2DBY A;  1QOF A;  1JCK B;  2WDQ B;  3AM9 A;  1FFU A;  3TEW A;  2BYT A;  3P1M A;  4A6Q A;  2IPK D;  1QOG A;  1FEH A;  5BYQ A;  1VDV A;  3W5U B;  1XO3 A;  1FXA A;  3LXF A;  1R7S A;  2EKI A;  1E6E B;  3IAM 1;  2KAJ A;  1SF0 A;  3KWL A;  2JSV X;  3ZJU A;  3NVZ A;  2QJL A;  1SE2 A;  3AEF B;  3BYT B;  2JYT A;  2BTE A;  2MJE A;  1QF6 A;  1UWX A;  2V3P A;  1WSP A;  3AE3 B;  2RDH A;  1YQ4 B;  2B76 B;  3NUH B;  1V97 A;  3FC4 A;  1JWM D;  2J42 A;  3IT6 B;  1FRR A;  4A55 A;  4C80 A;  1STE A;  2IJ0 A;  4RNA A;  4ZHP A;  2Q5W D;  3HRD D;  4OZA A;  1MHH E;  4XDD A;  1YQ3 B;  2WDV B;  3NVV A;  4RGT A;  3PZ8 A;  3SR6 A;  4TQ0 A;  2IGG A;  1F2R I;  5AUK A;  2J4X A;  2K22 A;  2JWU A;  1N60 A;  2J53 A;  4YSY B;  3ETR A;  3SEB A;  1JWB D;  2EEL A;  2QMT A;  3T3N A;  2W55 A;  2KAC A;  1SXT A;  5EE0 A;  1B1Z A;  1TS2 A;  2PKO A;  1L0X B;  1VLB A;  1ET6 A;  1HZ6 A;  1JQ4 A;  1P7E A;  2NTT A;  3J9C A;  3IT4 B;  3P63 A;  2WXF A;  5HHD G;  4RCO A;  4C7Y A;  1TS3 A;  3LB8 C;  1KH0 A;  3B2F A;  1K51 A;  1C77 A;  4ZRP A;  1LO5 D;  1JWA D;  2PVO D;  1QQR A;  1TKY A;  2LHD A;  2WQY B;  2YEP B;  4WWM A;  4YWG G;  3O13 A;  2ACZ B;  1MPE A;  3EA6 A;  2NTS A;  4P6V F;  1UNS A;  3V3X A;  3AE4 B;  4A8X C;  2WXO A;  1OQQ A;  1XCQ L;  4R3D A;  3N9Y C;  4HEA 1;  2QSD A;  3VR8 B;  2OED A;  3AEA B;  1NEK B;  1L4D B;  2BS2 B;  4A9A A;  3BK2 A;  5H8Y E;  4IOI E;  4DXG A;  3R2T A;  1NVI D;  4IDI A;  3P4Q B;  4GLS C;  1BXT A;  2G9H D;  4WUR A;  2K3U A;  4CQN A;  3Q8A A;  5TSS A;  4LTU A;  1TY0 A;  3AMZ A;  3UI3 A;  1PGA A;  1XEE A;  1K53 A;  5HI1 A;  1L0V B;  2Y5P A;  4HJG E;  2WXQ A;  2MEK A;  1XCT L;  4YTN B;  4UDU C;  3Q8B A;  3ZJT A;  3BWU D;  1FNV A;  1RM6 C;  3TUO A;  4WH4 A;  1OQR A;  2JQR B;  2WXI A;  5D3I B;  1N63 A;  3Q8F A;  1E9M A;  3PO0 A;  3AE8 B;  2GRI A;  1C4C A;  1V1P B;  1FCC C;  2WXP A;  4TSS A;  1FNU A;  3V05 A;  1FMA D;  4DQO C;  2KMM A;  2Y5C A;  1CZP A;  2PVG C;  1ZDV A;  1GAQ B;  1D6E C;  2WNM A;  3RFZ B;  2LGI A;  1TS5 A;  1FIQ A;  2NMQ A;  1NI3 A;  1XF5 L;  3AH7 A;  1VZ8 A;  4NJC A;  1JRP A;  1NYQ A;  3ZJV A;  1HZ5 A;  5I4D A;  3W5V B;  4YSZ B;  2FE8 A;  2BW2 A;  2HTM E;  2N9L A;  5BYS A;  1JW9 D;  2SAK A;  3CWI A;  1JRO A;  2WXH A;  3W1S A;  1AYF A;  5BYR A;  1GOZ A;  4L2Y A;  2WXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...