1EWYC

Anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the interaction between the ferredoxin-NADP+ reductase and ferredoxin from the cyanobacterium Anabaena: looking for the elusive ferredoxin molecule.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ewyC00
2QIEB 3AV8A 3SFEB 1VDVA 2WP9B 1JROA 2QJLA 4US8A 1FFVA 2FBWB 2WU2B 4LTUA 1L6UA 4N59A 1WYGA 1RYJA 2ACZB 2MJ3A 1FM0D 2BT6A 4JWUC 3SR6A 2LEKA 4JWSC 3AE7B 3SFDB 2G1EA 1YQ4B 2WS3B 1FXAA 2L83A 2AX5A 2PIAA 2CJOA 1E0ZA 1FFUA 1XLNA 2BS4B 3AE5B 5EE0A 2CU3A 1OFFA 4YSXB 3W5UB 1RFKA 2E3TA 1JW9D 3PO0A 1B9RA 2WU5B 3ZYYX 1NENB 4YXDB 3NVWA 1N63A 3B2FA 2EKIA 1ZP0B 3VR8B 5H92C 1N5XA 3HRDD 1IUEA 4ZHOA 1ROEA 1NYRA 1JRPA 2K22A 1JWAD 1J7AA 1DOYA 1FO4A 4P6VF 1SIJA 3NRZA 3AE3B 5G5GA 1FRDA 2BS3B 2OHFA 1YQ3B 4YT0B 1OQQA 5EE3A 1WGKA 3VR9B 5G5HA 3AE9B 2WDRB 3B9JA 3KWLA 1DOIA 1VJKA 5MPOA 1L5PA 1ZUD2 3L4PA 4C7YA 3AEDB 2K9XA 3DWGC 1AYFA 2JX5A 2WDVB 3AMZA 3FC4A 5EE9A 1RWSA 2L52A 3CWIA 1L6VA 3ETRA 3P1MA 3P4RB 4YTPB 1OQRA 1VLBA 3ABVB 1JALA 1QLBB 2PKOA 1FMAD 1EWYC 2JQRB 3NVYA 1NI3A 2H88B 3P63A 2MJDA 2PVGC 3CIRB 1GAQB 3RPFC 4C80A 1E10A 3P4PB 1RM6C 1NYQA 1QOAA 3LB8C 2PVOD 3AEAB 4WQMA 1YJIA 2HTME 3LXFA 2BS2B 5AUIA 5C3JB 2DWQA 4JX1C 1NVID 3AEGB 1XLQA 2W3RA 1UWMA 1WWTA 3HUIA 3AE8B 3AEFB 4N6EB 1DOXA 1XLOA 3AM9A 1YJJA 2WQYB 1PUTA 1FRRA 3AH7A 2Q5WD 3VRBB 1SB3C 1N61A 1J7BA 1CJEA 4HRSA 1T3QA 1PFDA 2KMMA 3AEEB 3NVVA 2CJNA 1N5WA 1TKGA 3EUB2 1QF6A 3NS1A 4YTMB 3W9CB 1ZXIA 4ZHPA 1WXQA 4WWMA 1KF6B 1TJEA 2DBYA 2H89B 3AEBB 3AN1A 3FAHA 5C2TB 1F0ZA 2K5PA 3P4QB 3AE2B 5GXGB 3AE4B 1NEKB 1JWBD 1DGJA 4ITKA 1SF0A 1TKEA 1FIQA 4N58A 1AWDA 4FXCA 1I7HA 3BIID 1V97A 4HROA 3HVZA 3VRAB 1KRHA 1N62A 2M19A 5EE1A 5AUKA 1N60A 3AECB 3DWMA 1E9MA 1E6EB 1GPXA 1QOGA 1V8CA 1PDXA 4US9A 1CZPA 2W55A 4C7ZA 2MH7A 3AB5A 1R7SA 1FXIA 1QT9A 1KFYB 2WLBA 1TYGB 4YSYB 1TKYA 1WRIA 2N0SB 1J7CA 1E7PB 4ZOHC 3NVZA 1XLPA 2W3SA 2W54A 2B76B 1QOBA 2MJEA 1QOFA 3W5VB 3B2GA 1XO3A 4KX6B 4USAA 4YTNB 3WCQA 4YSZB 3AE1B 5H8YE 2WDQB 4A9AA 1A70A 1L0VB 2M56B 3P4SB 2KAJA 4IDIA 3AE6B 1JQ4A 2Y5CA 1ZOYB
chains in the Genus database with same CATH superfamily
4HPMB 2AEHA 2PMVA 2WP9B 2FUHB 2MJ3A 4JIOU 2ZNVB 1VZ8A 2GBRA 1FXAA 2WXKA 2LGDA 4RCOA 1WGDA 1HQRD 3PO0A 2OOBB 5CHVC 4YXDB 2IDYA 2BWFA 2DYOA 3EA6A 2NBUA 2KN5A 4JL9A 3GP7A 1FO4A 1RRBA 5EE3A 2XK5B 3RT3B 4C7YA 3AEDB 4HDQA 3KVFB 4MGKE 4GXBA 2V0GA 1PGAA 4H2AA 2JZPA 4MM3A 3VXWA 1UNSA 1AARA 3A9JB 1IBXA 2BKFA 2DX5B 1YD8U 3JVZX 3QK0A 5J18A 4RH6A 3M3JA 3V61A 1UWMA 2L3ZA 3PRZA 1XXGA 4F1SA 4HJKA 3BYTB 1WGRA 1UZXB 2LRWA 2LXCA 2CJNA 1TKGA 1OQYA 1V9JA 1RLFA 4AJYB 3ZNGC 2DBYA 4WAFA 1WF9A 2QEJC 2FUG1 3ZJUA 4LNOA 3ZNID 3BIID 4ARCA 4NJ6A 4PYZA 1N62A 3PTFC 2CHWA 3KUZA 3MHZA 5IA7A 1IYFA 1L0XB 2VH1A 1E7UA 2WLBA 2N9KA 4IM3A 2D10A 1XLPA 4NQLB 3ZIMA 1TZ1A 4NJ7A 4A9AA 3A1QA 4LNIA 1L0VB 3RNEC 3IAM1 2C7NB 3GE3C 1QKZA 3V60A 4GDKB 4XYCA 4G11A 3V3XA 3ZJVA 1R4MI 4KSKC 1GB4A 1D4BA 1MJDA 4WH4A 2EKIA 3URYA 4NNJB 4D2KA 4LJOB 1TY0A 1IUEA 3PT2B 3ZDMC 2ZW0A 1HXYD 4F8CB 2N9PC 2NS5A 4A3OA 1H4RA 3X23A 2Z0EB 2WDRB 4NAMA 5G2NA 4M02A 1AYFA 3AMZA 2KDEB 2RPVA 2INNE 1MFWA 2OEDA 2NVUI 2JQRB 1NI3A 3TSSA 5TSSA 3CF6E 1E10A 2IGDA 1NDDA 1M94A 2L00B 2IO3B 4IM0A 3RNBC 1Q1OA 2UYZB 1Y56A 2FCQA 3BZDB 4IC7B 2A5UA 4C4VA 1F77A 2PLPA 3VRBB 3N1YC 3PRPB 3Q2AC 2ZPNA 4K1RB 2KFKA 5E6JA 2KX3A 4JPSA 1XCQL 2D5GA 1TJEA 1K53A 2SAKA 3ZTCA 2JWZA 2VZKB 1ET9A 3U52E 3WAMA 4GDLB 2KACA 1WH3A 1FD6A 3DHHC 2ASQA 4MGYE 3UGBB 2K1FA 1FXIA 1SE2A 1TYGB 1BXTA 2N0SB 2RPQA 1HZ6A 2B76B 1T5XD 1AN8A 3B2GA 4YTNB 5H8YE 1XT9B 4W9DA 3OWEB 4FULA 2KAJA 1J0GA 2BGFA 1ZPSA 2QJLA 1FNVA 1L6UA 4W9HA 2MBBB 1GJZA 2KWDA 2WS3B 4KDIC 1HE8A 4C00A 1FFUA 2DZIA 3TMPB 2EELA 1G6JA 1WXMA 1MI0A 2V3PA 1JWAD 1J8CA 1LGRA 3VQIA 1P7EA 4KVGB 1CMXB 4JQWC 2LVOA 1VJKA 1TZOA 4TKNA 4A6QA 3RULA 4JLCA 2PKOA 2H88B 3WAOA 5FK9C 5L95C 4AP4C 5D2MB 4NAWB 2PJHA 3H7SA 4I6NB 1STEA 1MHHE 5BYRA 3QARA 2O6VD 4MJSB 3DBSA 3PHXB 3VVWB 2GLSA 3JSVB 1KLGD 2HE7A 2HDEA 5E6NA 1CJEA 2Z59B 4DHZB 2LVPA 4UDUC 3P2BA 3OJ4B 4YTMB 2L0TA 2LWPA 3EFUA 2N7EA 2H89B 1YJ1A 3Q3FA 4RNAA 2DZMA 4HJGE 1SE4A 3U7ZA 3PSEB 2I1JA 1N60A 2KC2A 3ZKJC 1LO5D 2AL6A 3Q69A 1MG4A 2JZ3B 2N7DA 4AQ7A 4TQ1A 2LUMA 1QOFA 4KX6B 1EF5A 1I4RA 1MHXA 3DBLI 2M56B 1H8CA 1EWCA 3DBHB 3AV8A 3TIXA 1GOZA 3APDA 3ZNZB 2XEWA 1V49A 1OGWA 1WRDB 2A4ZA 3Q8BA 4A55A 1E90A 3KUDB 4ZRKA 4ZHOA 4BVUC 2QILA 3IXSA 1UF0A 2NTSA 3NRZA 2M0AA 2WWZA 3VR9B 2M0XA 4TMAB 3A9JA 4AS1A 3TEZA 3R2TA 3BINA 2C5LC 1FCLA 2M17A 3MJWA 3IVFA 5L83A 3RPFC 4IKGA 3K9PB 2CR5A 1I4XA 1YJIA 4MELA 5AUIA 3PV1A 3HIZA 5LXHA 2BYVE 1TTNA 4NZLB 1QQRA 2Y3AA 4RGMA 2PE6B 3NVVA 4EOYA 1IPGA 3EUB2 3IT4B 3K9OB 2Y5BB 1E8WA 2ZEQA 3AEBB 3AE2B 2L32A 2GBKA 2MWSB 3QQ8B 4MSQB 4ZDVA 3N20C 4WIPA 5AZHA 1YN3A 2IJ0A 2D11A 2Z0DB 2LJ5A 4B95A 2MH7A 4XDDA 1J19A 1QT9A 2BYEA 1S3SG 3A4RA 4HK2A 4E71A 3MHSD 3NVZA 5BO4B 2AYOB 1WJNA 4IWOA 4EZKA 3AE6B 2O6VB 2G4SA 3EGRA 3SFEB 2L76A 3VH3B 4F7ZA 1CK1A 4LTUA 4W9JA 3Q3OC 3TUOA 2BYFA 1EU3A 3KQ4A 3DHIC 3W5UB 2E3TA 4WWOA 4ICVA 2FCMA 3ENEA 5G55A 3HRDD 3BVGA 4BKSA 2ON8A 4P6VF 3MTNB 2IYDB 4WJPA 1GG3A 5LXIB 2FCNA 3APFA 2C60A 3DWGC 3RI7C 2XNAC 2KYWA 4FN2A 2NBVB 3ABVB 2LVQA 3QA8A 1QLBB 1EWYC 3EC8A 4ZRPA 4C80A 2MBQA 2DAJA 2INDC 1V86A 1R4NI 2J42A 4LCDE 1SXTA 5IAAC 4B6WA 4MDKE 4HVBA 1XLQA 1V5OA 4B0EA 2CHXA 3FILB 2XN9C 4DHJD 1V6EA 3ZNHB 3O13A 5DPSA 1D5MC 1Z2MA 3RNAC 4MJSA 3QCAA 3RZFA 2I2YA 4GIVA 1EUVB 5IOIA 2KNBA 1WXQA 4HCNB 1R4MB 3NJTA 2RDGA 2KJ6A 2CKHB 3PZDA 5DCNA 1JWBD 1TKEA 1AWDA 4HPLB 1BMLC 2KKCA 1JWSD 3HVZA 3UIPB 4A8XC 4HPPA 4LJPB 2KLGA 2L1AA 3NUHB 1LFDA 2UU7A 4KV2A 2PE9A 1C4CA 4RGNA 4GSWA 4LDTD 1V1OA 3L10B 2JSVX 3AE1B 3H6NA 1TS3A 1D6EC 3TCAA 3GB1A 3ZW3A 4US8A 1WYWB 4WJOA 1JWMD 2JRIB 1F1HA 4IG7B 5D7GA 3DBHI 2ZCBA 2MBHA 2JUOA 4Q2JA 1SSNA 1OEYA 1C9FA 1J7AA 4BZAA 3U30A 1HEZE 2GBNA 2LHDA 2ZJDA 3L54A 3IFWB 3V6CB 4IUMB 1DOIA 1ZUD2 4NJCA 3Q8CA 2DZKA 1ZGUB 3ETRA 2HJ1A 1C4PA 1QOAA 1YX6B 3KUCB 4P16A 3N1XC 3N3KB 5IKCM 3LXFA 5J17A 1T0YA 4E74A 2WXRA 2IBIB 1UBIA 5D3DA 1VD2A 1XLOA 2AQ2B 1SIFA 2RMMA 2DZJA 2RSUA 2MCNB 2MHJA 3PHWB 1YIWA 4ANXA 4XZ4A 2ZCCA 3U4EG 2X38A 3U2SC 1SE9A 2G4DB 3R3MA 1FXTB 3LYYA 2MEKA 1AW7A 3V05A 1R7SA 3X0WA 1WRIA 4AJWA 4NY0A 1E7PB 3C19A 4YSZB 3VTUA 3L17A 5IP4D 1T0RC 1A70A 3H8HA 2Y5CA 1ZOYB 1B1ZA 1VDVA 4HKZE 4GOCA 1M4VA 2M1MA 3MJ5A 4JWUC 1HTQA 1ZXHA 3J9CA 2PIAA 1UH6A 1V2YA 1VRAB 2KMCA 3I57A 4X57B 2GOWA 1NYRA 1WX8A 4S17A 2AL3A 3C8YA 1I4QA 1LQBA 2YEPF 1PYWD 1WI0A 2WGSA 2BS3B 1OQQA 5HG2A 4ZRIA 2KMAA 3ZTDA 3SD5A 1ZKHA 2WXNA 1TS2A 1WXVA 2N9XA 4HXDA 3VUWA 4YTPB 1VLBA 2JXTA 4KZ0A 3KH0A 2GB1A 2DNFA 4J6IA 4W9IA 2BBCA 4PYUA 3IHPC 4WQMA 2BKRB 2HTME 2BS2B 3GZNI 3N32A 3NZ3A 5D3IB 3UF8A 5HHDG 1CQVA 2J0KA 3T3OA 2MP2A 4DXFA 1YNTE 1TGZB 2K39A 3DBLB 1EM7A 1EU4A 2N1WA 1Q5WB 2CU1A 3H7PB 2CHZA 4KIKA 5FKAC 3W9CB 4LNFA 5HFYA 2WXMA 3IT6B 1BUIC 1KLUD 2N4FA 4ZRJA 2WX1A 1WGGA 3WANA 4W9CA 4FXCA 4NQKE 4KGRA 2QC8A 1C78A 2LMCA 2WXQA 4FA6A 1E9MA 1VCBA 1SBBB 1V8CA 2D3CA 4IM2A 4US9A 4C7ZA 2BW2A 2L8JA 2KWUB 2WXOA 3MC0B 4TV3A 2JF5A 5BYSA 3AU5A 4WAAA 4BBNC 1TIFA 1HZ5A 1JQ4A 1LM8B 3Q8FA 1WM2A 1KLVA 2M8SA 2KXJA 3SR6A 1I42A 4HEA1 2MQJA 3UQAA 1C77A 1JWUD 4CQNA 5J2RA 4E3CA 3VHTC 4YWGG 4CHKA 3Q14C 1WR6E 2K22A 2LGSA 4EEWA 2V3SA 2OHFA 1GB1A 1YOVB 2K0PA 3R8BA 2DLBA 4DWFA 1YN5A 2ZZPB 4DK5A 3P4RB 3ML9A 4EKUA 1D3ZA 2MJDA 4GLSC 3W1SC 3L13A 1WM3A 2KWCA 5D94A 3VFKA 4L1BA 2BPSA 3UIOB 1KH0A 4OZCA 2IO2B 4GN1A 2L05A 1PUTA 3TEYA 2GBJA 3NS1A 2V9HA 1ZXIA 1T0QC 3N30A 3LJ3A 4RM9A 3H1UA 5AZFA 2BTEA 2L7RA 4HROA 3U8ZA 2GI9A 1QOGA 3RNCC 1FCCC 2HD5B 1L4DB 3PREA 2W54A 4M8NA 1IBXB 4BOZB 3M95A 3DOWA 2FBWB 2OJWA 4JWSC 2FNJB 5JHBA 1K52A 2MLBA 2KDFB 4ZRQA 4G3XB 1NBFC 3L0WB 5DPWA 1N63A 1E5WA 3VR8B 1GC6A 1E8ZA 2KD0A 1WMHA 3WALA 2MW5A 2J0MA 1DOYA 3M62B 3V62A 2K3UA 3ZO5B 1WSPA 3SU8X 4AWJA 2KFKB 3VH4B 1L5PA 3L4PA 4IWPA 2JX5A 2WDVB 2YLMA 3QX1A 3NHEB 3EFCA 1K50A 2KN4A 3AXCA 1TBEA 1RM6C 2RGFA 2IO1B 4GU2A 1WMHB 2N1VA 1N6ZA 1SGHA 4ZYNA 2O2VB 3TEXA 3ZRFA 4W9GA 5CTRC 4WJQA 2VH2A 3ZVVA 4TUUA 4MEMA 1DOXA 3AM9A 3TJPA 1KOTA 4FHKA 3SEBA 4TSSA 3ALBA 3DVGX 1KF6B 2IY1B 3A4SC 3P4QB 1PGXA 5JZEB 3L08A 3AI5A 1V97A 1WY8A 2C7HA 3VRAB 4MH0E 1ZDXA 4KGTA 5AZGA 4R3DA 4ASWC 1RAXA 2I1KA 3VUYA 1ENFA 1PDXA 2W55A 4OZBA 2RR9A 2JVCA 2KWVB 3BK1A 5IN7A 1UGMA 1WX9A 5C3JB 1XO3A 2K8CA 1WIAA 4WWMA 3A1QB 4P1CC 2CS4A 2QIEB 4JGHB 4BKTA 3I3TB 1L7YA 3RD2A 3SFDB 1D5XC 5DPTA 1PGBA 2J0JA 1E0ZA 1XLNA 5EE0A 1OFFA 2MX2A 4LNNA 3T3NA 1X1MA 1I35A 3NVWA 4I6PA 2GRIA 3ZLZA 4ANVA 3CMMB 3H9DA 5BMGA 2FIDA 1YQ3B 2FIFA 1GUAB 1L4ZB 2K9XA 2WXFA 2TSSA 2O6VA 2G9HD 3QJZA 2LI5A 2JYEA 4BKSD 4WWNA 1T6BX 4QAYA 4HDOA 3L16A 5CHWA 2KC1A 2LZ6A 2PVOD 2ZVNA 2G3QB 2KJHB 5TR5A 4MM3B 4PS7A 4DDID 4FHJA 2JRHA 4W9LA 2J7QB 2KTRA 3MP9A 2HJ8A 4MACA 3ML8A 2G45B 5JXVA 1J7BA 5JH5C 3SHQA 2BQQA 2XK5A 3W2DA 2W9NA 1YX5B 1GNUA 2IZVB 1S1QB 3H7PA 3MC8A 2KOXA 1HTOA 3NZUA 4XWTA 2INCC 4W9FA 5IO9A 2BWES 2ZPYA 2N9EB 4XDCA 4URKA 4M8MA 4L2YA 1JMLA 4LDTB 4PT5A 2MJEA 2DAFA 2WDQB 2YVCA 3PPAA 3PS6A 4FJVB 2M4NA 4XE0A 3RNGC 1V5TA 3EHVA 1JROA 2ACZB 2NR2A 2BF8B 3WIMA 4C4VB 3C0RB 2BS4B 3AE5B 2CU3A 2DENB 2KQ4X 3DVNU 1RFKA 1VZ7A 1WJUA 4GDKA 2WU5B 1VZ6A 4BBNF 1ZP0B 1ROEA 1KJTA 2KO3A 2LRUA 3PVLA 1FEHA 2K6DB 4DHJB 4EZJA 2QHOA 3T9LA 2D3AA 2BVCA 3BVMA 5G5HA 1Q10A 3ZXVA 3EECA 4NPNA 1WE7A 2KK8A 2LGYA 3PLVA 1OQRA 2KX0A 4M0WB 3P63A 3M63B 3RUIB 4DDGD 5LLIA 4JE3B 3AEAB 1DYQA 1JCKB 3VAWA 4IWQA 1F52A 2K8HA 1XEEA 3S2AA 4ICUA 2O2VA 4M01A 4FADA 3AEFB 3FKYA 1WZ3A 4PS3A 2LJIA 1WE6A 2ONQA 4IW0A 4HRSA 2OJRA 1EO6A 2BB5A 1OEYJ 3FAHA 2K5PA 4MT5A 1WJ6A 1FIQA 3UINB 2RD0A 4YL8A 3KW5B 2LGXA 1I4PA 2L0FA 3VTWA 1GPXA 4ANUA 4ACFA 2JWUA 2NCNA 5CHFA 1BT0A 5DPRA 3B08A 4WWPA 2KQSA 1XCTL 1UELA 1FFVA 2IPKD 4W9KA 3Q8AA 2BB6A 3U7DA 4RFBA 1MVKA 1ACCA 1UUPA 2K25A 4XX5A 1WX7A 1PQSA 3IBEA 4XC2A 2RDBC 1R4NB 4BOSC 1UD7A 4EE2A 1QILA 1SIJA 1C79A 3Q8EA 4A90A 4HKQA 1U4AA 3KLSX 4RF1A 4M00A 3ZJTA 3OLMD 2LFIA 3DQVA 4K7WA 4LLGM 4XGAB 4BKGA 2L52A 3RN9C 4HLEA 4FJYA 1JALA 1WJ4A 3R7RA 4OVVA 2WNMA 3LB8C 2LASA 2W82A 4AUQC 1NVID 3B1LX 4DBGA 3AEGB 2W3RA 3BVZA 1NI2A 2J52A 2NBWB 2KTFA 1FNUA 1YJJA 1N61A 1T3QA 1PFDA 1N5WA 3R2IA 4REZA 4EZLA 1F0ZA 2KLCA 2WDTB 3O65B 4MSMB 2JYTA 1TS5A 5GXGB 1L0YB 1RFAA 4N58A 2KFJA 5C23A 1TY2A 5CX3A 1KRHA 2M19A 5EE1A 3AECB 4MH8A 3HM6X 3Q3MC 2J4XA 2INPE 3AB5A 4RGTA 4YSYB 2PW9A 1TKYA 2Y5PA 3W1YA 2C9WB 3I63C 2R2QA 1IGDA 3JYUA 3ZUNA 2AWTA 3E56A 5FR6A 3QWZB 4LK0M 1SEBD 1WGHA 5JHAA 2X8XX 2JU6X 3QHTA 4MGIE 2WYQA 3WA0A 2G1EA 4K3CA 1V1PB 3BYYB 4J3OD 4YSXB 3B0AA 3QC8B 3ZYYX 3HHMA 3MFGA 5E6OA 3UI3A 2KDBA 3ZRCA 1N5XA 1E8XA 2NPTA 3HVDA 4EFOA 3OJ3A 1WFYA 1UBQA 1ET6A 4WURA 2PEAA 4ANWA 1C3TA 3RMKC 2K6QA 4YT0B 3PGEA 1WGKA 4II3B 2WXHA 3KWLA 3DHGC 3PRMB 3CSTA 3CSFA 1XF5L 3FC4A 2RDHA 3PZ8A 2JT4B 2AQ3B 1YQBA 3NVYA 4W9EA 2PVGC 3VTVA 3PLUA 4AOFA 4EUTA 2EMSA 3AE8B 5D6JB 3ECIA 2GMIC 3PZ7A 3AULA 3W1SA 1K51A 2IGGA 4I6LB 2WXPA 4ARIA 2IO0B 5EDSA 3DDCB 3HM3A 3BWUD 2VZKD 5KHQA 2JXXA 4NAWA 2I38A 5HKHA 1P98A 3APCA 2E6XA 5AUKA 1P1AA 2MA9B 2SEBD 3E9SA 4PK1A 2YEPB 4OVUA 1K8RB 2W3SA 4DHZE 1QOBA 2KZRA 5E6PA 1MG8A 3R7QA 4IDIA 1C76A 3ZQ4A 4N59A 1RYJA 1IP9A 1FM0D 3ZDTA 1ZW7A 3AE7B 1V80A 1QZEA 1P3QU 3OAWA 5HI1A 2AX5A 2CJOA 4P1BC 4WJNA 1F2RI 1JW9D 4S0RA 1B9RA 5T8IA 3IAS1 5H92C 2V4IB 4A3PA 2MP2B 4XWWA 2FCSA 3NS8A 1TT5B 1F9JA 3VDZA 4OHJA 3ONSA 3AE9B 2WXJA 2JY6A 2JPHA 4GDLA 2WX0A 1ZE3D 5EE9A 4K3BA 3CWIA 3P1MA 1WZ0A 1P7FA 1YN4A 3LDZE 4P7IA 3A9KA 1P0RA 3NG0A 3CIRB 1GAQB 5KHOA 2UWQA 1FNWA 1NYQA 2D3GA 1XQQA 3Q3JA 4GMVA 1V81A 2DWQA 3KYDD 1IGCA 3P42A 3QIJA 5I4DA 4K81A 1WWTA 3D32A 3TL5A 1C1YB 4L23A 1V1PA 3TBLD 1JRUA 2WQYB 3DBRB 5BMIA 2LUEA 2Q5WD 4WQOB 1SB3C 3DBRI 4FLHA 4K7UA 2K8BA 4OZAA 4LNKA 5C2TB 1E8YA 3AN1A 1Y8RC 3NOBA 1NEKB 2MBOA 2KQ7A 4ITKA 1SF0A 4OVZA 4G0NB 2D3BA 5BYQA 1ISNA 3OG5A 4A20A 3DWMA 2EKEC 4DXAB 4FJZA 3RCZA 4BAXA 4G50A 2FE8A 1KFYB 5BMHA 2QSDA 1J7CA 2NTTA 1GC7A 1I4GA 3W5VB 4B0MA 2DHZA 2NPTB 4USAA 3V6EB 4PS8A 1UGJA 2WXIA 2R2OA 1F2RC 1WYGA 2BT6A 2LEKA 3I5JC 1L2NA 2L83A 3JSVA 4RMAA 2WXGA 2LGIA 2R61A 2C7MB 2N7JA 1WR1A 4KDLB 2EMTA 4KZCA 3UQBA 2KANA 3Q6BA 4KSLC 1XD3B 4HWIB 2JZZA 3AE3B 1FRDA 2KT7A 2IGHA 3NZSA 4DXGA 1WXAA 1RWSA 1L6VA 2LXAA 2D07B 2XBBC 1MPEA 1C4AA 2QMTA 3RYTA 3DVGY 3A33B 4CO7A 4JX1C 2REXA 2KDIA 3GS2A 2GBMA 3MC9A 3RZWC 4N6EB 1I4HA 1A5RA 2DYBA 4B9KA 4BFRA 1TS4A 2B3AA 3AH7A 3DVNV 2LHEA 1WGYA 4DQOC 3N9YC 2ICIA 2V4LA 3WAPA 3QAQA 3AU4A 4ZHPA 1T0SC 2V3NA 2KVRA 3AE4B 4RM8A 2ZVOA 2J53A 4OW0A 3KWVA 3I9V1 3RFZB 4N9F4 5LNK1 3TEWA 1KM7A 1CZPA 4KKIA 2LD9A 2QDFA 5AEKB 3BY4B 2KTRB 4C56C 2BYTA 4ZOHC 3R66C 4K7SA 1P9DU 3WCQA 1OTRB 4GB9A 4CYEA 3Q3NC 1VR9A 3BK2A 3P4SB 2D2QA 4MGZE 2WU2B 3IG3A 1YQ4B 2VRRB 3ZGZA 3GE8C 1NENB 2ZNVC 3B2FA 4O1NA 3HK0A 5C1ZA 2PPHA 3FILA 5GMVA 4ZYSA 1JRPA 4RF0A 3SDLC 1HA5A 2KDMA 3ZXRA 2KHWB 2N9LA 3KYCD 4RGOS 5G5GA 3DPDA 1SE3A 3B9JA 5MPOA 4HCPB 1LXDA 5FR3A 2V1YA 1FMAD 1EF1A 2WHIA 2IY0B 1Q0WB 3P4PB 3VUXA 1D5ZC 2DYMA 3DCGA 1WXSA 3A9KB 3HUIA 4FBJB 2MSED 1FRRA 2ZW1A 2MBEA 1SJHD 2KMMA 3AEEB 2HTHA 4II2B 1YMHE 1QF6A 3NY5A 2KVZA 1Z5SB 1ESFA 2NMQA 1E7VA 3GZNB 1DGJA 2MRPA 1FPYA 4M0WA 2WXLA 1I7HA 4KGSA 2Z8LA 3T8MA 1SJED 2FAZA 1E6EB 2AQ1B 4KKJA 1ZDVA 3RNFC 1UWXA 2KJRA 4IOIE 4GGQA 2QCZA 3GOEA 1KTKA 4KIKB 4TQ0A 3N1ZC 2PTLA 3JW0X
chains in the Genus database with same CATH topology
1SEBD 3EGRA 2PMVA 2WP9B 3SFEB 2FBWB 1CK1A 4LTUA 2MJ3A 2JU6X 4JWSC 3TUOA 1VZ8A 2G1EA 1K52A 1V1PB 1EU3A 1FXAA 3BYYB 2WXKA 4J3OD 4YSXB 3KQ4A 4RCOA 4ZRQA 3W5UB 1HQRD 2E3TA 3PO0A 3ZYYX 4YXDB 3MFGA 1N63A 3UI3A 3VR8B 2IDYA 1N5XA 2DYOA 3BVGA 3HRDD 3EA6A 3HVDA 2ON8A 1DOYA 1FO4A 3GP7A 4P6VF 1ET6A 4WURA 2K3UA 4YT0B 1WSPA 5EE3A 1WGKA 2WXHA 3KWLA 1L5PA 3L4PA 4C7YA 3AEDB 3DWGC 1XF5L 2JX5A 2WDVB 3FC4A 2V0GA 2RDHA 2XNAC 1PGAA 3ABVB 4H2AA 2JZPA 1QLBB 3PZ8A 2AQ3B 1UNSA 1EWYC 3NVYA 1K50A 2KN4A 2PVGC 4ZRPA 4C80A 1IBXA 1RM6C 2J42A 1SXTA 4RH6A 3TEXA 1XLQA 4B0EA 1UWMA 3AE8B 3FILB 1XXGA 2XN9C 3O13A 3PZ7A 1DOXA 3W1SA 1D5MC 3BYTB 3AM9A 1K51A 2IGGA 2WXPA 3SEBA 2I2YA 4ARIA 2CJNA 4TSSA 1TKGA 3BWUD 1WXQA 2VZKD 1KF6B 2DBYA 2RDGA 4WAFA 2QEJC 3P4QB 1PGXA 2FUG1 2I38A 1JWBD 3ZJUA 1TKEA 1AWDA 1BMLC 3BIID 1V97A 1JWSD 2E6XA 3HVZA 4ARCA 3VRAB 1N62A 5AUKA 3MHZA 4A8XC 1ZDXA 2SEBD 4KGTA 3E9SA 4R3DA 2YEPB 1L0XB 1ENFA 1PDXA 2W55A 4OZBA 2L1AA 3NUHB 2WLBA 2N9KA 1C4CA 3BK1A 4RGNA 1XLPA 2W3SA 1V1OA 1QOBA 5C3JB 1XO3A 2JSVX 3AE1B 4A9AA 1L0VB 3IAM1 1TS3A 1D6EC 4IDIA 4WWMA 1C76A 2QIEB 3GB1A 3ZQ4A 4US8A 1QKZA 4N59A 1RYJA 4GDKB 1FM0D 1JWMD 3V3XA 3ZJVA 3AE7B 3SFDB 1D5XC 1GB4A 5HI1A 2AX5A 1PGBA 2CJOA 1E0ZA 1XLNA 5EE0A 1OFFA 1F2RI 5D7GA 1JW9D 3T3NA 1B9RA 1D4BA 5T8IA 3NVWA 4WH4A 2EKIA 3IAS1 3URYA 4Q2JA 5H92C 2V4IB 4D2KA 1TY0A 1IUEA 2ZW0A 4XWWA 1SSNA 1HXYD 1C9FA 1J7AA 2GRIA 1HEZE 2LHDA 5BMGA 1YQ3B 4OHJA 3AE9B 2WDRB 2WXJA 4NAMA 1DOIA 1ZUD2 1L4ZB 4NJCA 2K9XA 1ZE3D 2WXFA 1AYFA 2TSSA 3AMZA 2G9HD 3Q8CA 5EE9A 3CWIA 3P1MA 1P7FA 1YN4A 2RPVA 2INNE 3ETRA 2OEDA 2JYEA 1C4PA 2JQRB 1T6BX 1NI3A 3TSSA 3CIRB 1GAQB 5TSSA 1E10A 1FNWA 1NYQA 1QOAA 2PVOD 4P16A 2IGDA 3LXFA 4MM3B 2WXRA 2DWQA 1IGCA 3P42A 5I4DA 5D3DA 1WWTA 1Y56A 3MP9A 3BZDB 4MACA 4L23A 1XLOA 1V1PA 2AQ2B 2WQYB 5BMIA 1F77A 2PLPA 2RMMA 2Q5WD 3VRBB 1SB3C 5JXVA 1J7BA 5E6JA 3W2DA 4OZAA 4JPSA 1XCQL 2D5GA 5C2TB 1TJEA 1K53A 3AN1A 2SAKA 1NEKB 4ITKA 1SF0A 4OVZA 2X38A 3U4EG 3U2SC 4XWTA 5BYQA 2VZKB 1ET9A 3DWMA 3U52E 4GDLB 2KACA 3LYYA 1FD6A 2MEKA 1AW7A 3V05A 1R7SA 4XDCA 1FXIA 1SE2A 1KFYB 2FE8A 1TYGB 5BMHA 1BXTA 2QSDA 1WRIA 4L2YA 2N0SB 1J7CA 1E7PB 1JMLA 2NTTA 1I4GA 1HZ6A 4PT5A 2B76B 2MJEA 3W5VB 1T5XD 1AN8A 3B2GA 4B0MA 4USAA 4YTNB 4YSZB 5H8YE 2WDQB 1A70A 3OWEB 2KAJA 3H8HA 1UGJA 2Y5CA 4XE0A 1ZOYB 1B1ZA 2WXIA 1ZPSA 1VDVA 1F2RC 1JROA 2QJLA 4HKZE 1FNVA 1L6UA 1M4VA 1WYGA 2ACZB 3MJ5A 2BT6A 4JWUC 2LEKA 2KWDA 1ZXHA 2WS3B 3J9CA 2L83A 2PIAA 1FFUA 2BS4B 3AE5B 2WXGA 2CU3A 2KQ4X 2LGIA 2R61A 1RFKA 1VZ7A 1VRAB 2N7JA 3I57A 2WU5B 1VZ6A 1ZP0B 2EELA 1MI0A 1ROEA 1NYRA 2V3PA 1JWAD 1FEHA 3C8YA 1I4QA 2YEPF 1PYWD 3AE3B 3VQIA 1FRDA 2BS3B 1P7EA 1OQQA 3BVMA 5HG2A 5G5HA 1Q10A 4A6QA 1VJKA 1TZOA 2IGHA 2WXNA 4DXGA 1TS2A 1RWSA 1L6VA 4YTPB 1OQRA 1VLBA 2PKOA 2JXTA 2GB1A 2H88B 3P63A 5FK9C 1MPEA 2BBCA 1C4AA 4NAWB 4JE3B 2QMTA 3AEAB 1DYQA 4WQMA 2HTME 1STEA 2BS2B 1JCKB 1MHHE 3NZ3A 5D3IB 5BYRA 4JX1C 5HHDG 1CQVA 1XEEA 3GS2A 3T3OA 3AEFB 4DXFA 4N6EB 1I4HA 1KLGD 1YNTE 2LJIA 1TS4A 3AH7A 2HDEA 1EM7A 1EU4A 2ONQA 2LHEA 1CJEA 4DQOC 3N9YC 4HRSA 2ICIA 4UDUC 5FKAC 2BB5A 4YTMB 3W9CB 4ZHPA 5HFYA 2WXMA 3IT6B 1BUIC 2H89B 1KLUD 3FAHA 4RNAA 2K5PA 2V3NA 3AE4B 4MT5A 4HJGE 1SE4A 2J53A 4OW0A 1FIQA 3U7ZA 4FXCA 3KWVA 4KGRA 3I9V1 3RFZB 1C78A 1N60A 2LMCA 1I4PA 2WXQA 1E9MA 1GPXA 5LNK1 3TEWA 1LO5D 1SBBB 1V8CA 3Q69A 4US9A 1CZPA 4C7ZA 4KKIA 2BW2A 2JWUA 4C56C 4AQ7A 2WXOA 3MC0B 4TQ1A 4ZOHC 2BYTA 5BYSA 2LUMA 1QOFA 4KX6B 3WCQA 1I4RA 1MHXA 2M56B 1HZ5A 1XCTL 1VR9A 1EWCA 3BK2A 3P4SB 1JQ4A 3AV8A 3Q8FA 1FFVA 2WU2B 2IPKD 1GOZA 3Q8AA 3SR6A 4HEA1 1YQ4B 2BB6A 3ZGZA 1C77A 4RFBA 1JWUD 1MVKA 1ACCA 4CQNA 1UUPA 3Q8BA 4A55A 1NENB 3B2FA 4O1NA 4YWGG 4ZHOA 3FILA 4ZYSA 1JRPA 2K22A 2QILA 1HA5A 2KDMA 3IXSA 4RF0A 4EE2A 1QILA 2N9LA 1SIJA 2NTSA 4RGOS 1C79A 3NRZA 5G5GA 2M0AA 2OHFA 3Q8EA 4A90A 1GB1A 3VR9B 4HKQA 2K0PA 1SE3A 3B9JA 4TMAB 3R8BA 2DLBA 3KLSX 5MPOA 4RF1A 3ZJTA 4AS1A 1YN5A 2LFIA 4LLGM 3R2TA 5FR3A 3TEZA 2L52A 3P4RB 1JALA 1FCLA 1FMAD 2MJDA 3RPFC 4IKGA 2WNMA 4GLSC 3P4PB 3LB8C 1D5ZC 1I4XA 2DYMA 2W82A 1YJIA 5AUIA 4L1BA 1NVID 3AEGB 2W3RA 4NZLB 3BVZA 3HUIA 1QQRA 1KH0A 2J52A 4OZCA 1FNUA 2Y3AA 4RGMA 1YJJA 1PUTA 1FRRA 1N61A 2ZW1A 1T3QA 1PFDA 1SJHD 2KMMA 3AEEB 3NVVA 3TEYA 1N5WA 1YMHE 3EUB2 3R2IA 3NS1A 4REZA 1QF6A 1ZXIA 3IT4B 3AEBB 1F0ZA 1ESFA 1TS5A 2NMQA 2JYTA 1L0YB 2L32A 3AE2B 5GXGB 2BTEA 1DGJA 4N58A 4M0WA 2WXLA 1I7HA 4KGSA 1TY2A 4HROA 2Z8LA 1KRHA 1SJED 2M19A 5EE1A 3AECB 1E6EB 2GI9A 4WIPA 1QOGA 1YN3A 2IJ0A 1FCCC 2AQ1B 4KKJA 4MH8A 1ZDVA 2J4XA 1UWXA 2INPE 2MH7A 3AB5A 4RGTA 4XDDA 1QT9A 4IOIE 4YSYB 2PW9A 1TKYA 1L4DB 2Y5PA 3NVZA 1KTKA 2W54A 1IGDA 4TQ0A 1IBXB 2PTLA 3E56A 3AE6B 4LK0M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIE B;  3AV8 A;  3SFE B;  1VDV A;  2WP9 B;  1JRO A;  2QJL A;  4US8 A;  1FFV A;  2FBW B;  2WU2 B;  4LTU A;  1L6U A;  4N59 A;  1WYG A;  1RYJ A;  2ACZ B;  2MJ3 A;  1FM0 D;  2BT6 A;  4JWU C;  3SR6 A;  2LEK A;  4JWS C;  3AE7 B;  3SFD B;  2G1E A;  1YQ4 B;  2WS3 B;  1FXA A;  2L83 A;  2AX5 A;  2PIA A;  2CJO A;  1E0Z A;  1FFU A;  1XLN A;  2BS4 B;  3AE5 B;  5EE0 A;  2CU3 A;  1OFF A;  4YSX B;  3W5U B;  1RFK A;  2E3T A;  1JW9 D;  3PO0 A;  1B9R A;  2WU5 B;  3ZYY X;  1NEN B;  4YXD B;  3NVW A;  1N63 A;  3B2F A;  2EKI A;  1ZP0 B;  3VR8 B;  5H92 C;  1N5X A;  3HRD D;  1IUE A;  4ZHO A;  1ROE A;  1NYR A;  1JRP A;  2K22 A;  1JWA D;  1J7A A;  1DOY A;  1FO4 A;  4P6V F;  1SIJ A;  3NRZ A;  3AE3 B;  5G5G A;  1FRD A;  2BS3 B;  2OHF A;  1YQ3 B;  4YT0 B;  1OQQ A;  5EE3 A;  1WGK A;  3VR9 B;  5G5H A;  3AE9 B;  2WDR B;  3B9J A;  3KWL A;  1DOI A;  1VJK A;  5MPO A;  1L5P A;  1ZUD 2;  3L4P A;  4C7Y A;  3AED B;  2K9X A;  3DWG C;  1AYF A;  2JX5 A;  2WDV B;  3AMZ A;  3FC4 A;  5EE9 A;  1RWS A;  2L52 A;  3CWI A;  1L6V A;  3ETR A;  3P1M A;  3P4R B;  4YTP B;  1OQR A;  1VLB A;  3ABV B;  1JAL A;  1QLB B;  2PKO A;  1FMA D;  1EWY C;  2JQR B;  3NVY A;  1NI3 A;  2H88 B;  3P63 A;  2MJD A;  2PVG C;  3CIR B;  1GAQ B;  3RPF C;  4C80 A;  1E10 A;  3P4P B;  1RM6 C;  1NYQ A;  1QOA A;  3LB8 C;  2PVO D;  3AEA B;  4WQM A;  1YJI A;  2HTM E;  3LXF A;  2BS2 B;  5AUI A;  5C3J B;  2DWQ A;  4JX1 C;  1NVI D;  3AEG B;  1XLQ A;  2W3R A;  1UWM A;  1WWT A;  3HUI A;  3AE8 B;  3AEF B;  4N6E B;  1DOX A;  1XLO A;  3AM9 A;  1YJJ A;  2WQY B;  1PUT A;  1FRR A;  3AH7 A;  2Q5W D;  3VRB B;  1SB3 C;  1N61 A;  1J7B A;  1CJE A;  4HRS A;  1T3Q A;  1PFD A;  2KMM A;  3AEE B;  3NVV A;  2CJN A;  1N5W A;  1TKG A;  3EUB 2;  1QF6 A;  3NS1 A;  4YTM B;  3W9C B;  1ZXI A;  4ZHP A;  1WXQ A;  4WWM A;  1KF6 B;  1TJE A;  2DBY A;  2H89 B;  3AEB B;  3AN1 A;  3FAH A;  5C2T B;  1F0Z A;  2K5P A;  3P4Q B;  3AE2 B;  5GXG B;  3AE4 B;  1NEK B;  1JWB D;  1DGJ A;  4ITK A;  1SF0 A;  1TKE A;  1FIQ A;  4N58 A;  1AWD A;  4FXC A;  1I7H A;  3BII D;  1V97 A;  4HRO A;  3HVZ A;  3VRA B;  1KRH A;  1N62 A;  2M19 A;  5EE1 A;  5AUK A;  1N60 A;  3AEC B;  3DWM A;  1E9M A;  1E6E B;  1GPX A;  1QOG A;  1V8C A;  1PDX A;  4US9 A;  1CZP A;  2W55 A;  4C7Z A;  2MH7 A;  3AB5 A;  1R7S A;  1FXI A;  1QT9 A;  1KFY B;  2WLB A;  1TYG B;  4YSY B;  1TKY A;  1WRI A;  2N0S B;  1J7C A;  1E7P B;  4ZOH C;  3NVZ A;  1XLP A;  2W3S A;  2W54 A;  2B76 B;  1QOB A;  2MJE A;  1QOF A;  3W5V B;  3B2G A;  1XO3 A;  4KX6 B;  4USA A;  4YTN B;  3WCQ A;  4YSZ B;  3AE1 B;  5H8Y E;  2WDQ B;  4A9A A;  1A70 A;  1L0V B;  2M56 B;  3P4S B;  2KAJ A;  4IDI A;  3AE6 B;  1JQ4 A;  2Y5C A;  1ZOY B; 
#chains in the Genus database with same CATH topology
 4HPM B;  2AEH A;  2PMV A;  2WP9 B;  2FUH B;  2MJ3 A;  4JIO U;  2ZNV B;  1VZ8 A;  2GBR A;  1FXA A;  2WXK A;  2LGD A;  4RCO A;  1WGD A;  1HQR D;  3PO0 A;  2OOB B;  5CHV C;  4YXD B;  2IDY A;  2BWF A;  2DYO A;  3EA6 A;  2NBU A;  2KN5 A;  4JL9 A;  3GP7 A;  1FO4 A;  1RRB A;  5EE3 A;  2XK5 B;  3RT3 B;  4C7Y A;  3AED B;  4HDQ A;  3KVF B;  4MGK E;  4GXB A;  2V0G A;  1PGA A;  4H2A A;  2JZP A;  4MM3 A;  3VXW A;  1UNS A;  1AAR A;  3A9J B;  1IBX A;  2BKF A;  2DX5 B;  1YD8 U;  3JVZ X;  3QK0 A;  5J18 A;  4RH6 A;  3M3J A;  3V61 A;  1UWM A;  2L3Z A;  3PRZ A;  1XXG A;  4F1S A;  4HJK A;  3BYT B;  1WGR A;  1UZX B;  2LRW A;  2LXC A;  2CJN A;  1TKG A;  1OQY A;  1V9J A;  1RLF A;  4AJY B;  3ZNG C;  2DBY A;  4WAF A;  1WF9 A;  2QEJ C;  2FUG 1;  3ZJU A;  4LNO A;  3ZNI D;  3BII D;  4ARC A;  4NJ6 A;  4PYZ A;  1N62 A;  3PTF C;  2CHW A;  3KUZ A;  3MHZ A;  5IA7 A;  1IYF A;  1L0X B;  2VH1 A;  1E7U A;  2WLB A;  2N9K A;  4IM3 A;  2D10 A;  1XLP A;  4NQL B;  3ZIM A;  1TZ1 A;  4NJ7 A;  4A9A A;  3A1Q A;  4LNI A;  1L0V B;  3RNE C;  3IAM 1;  2C7N B;  3GE3 C;  1QKZ A;  3V60 A;  4GDK B;  4XYC A;  4G11 A;  3V3X A;  3ZJV A;  1R4M I;  4KSK C;  1GB4 A;  1D4B A;  1MJD A;  4WH4 A;  2EKI A;  3URY A;  4NNJ B;  4D2K A;  4LJO B;  1TY0 A;  1IUE A;  3PT2 B;  3ZDM C;  2ZW0 A;  1HXY D;  4F8C B;  2N9P C;  2NS5 A;  4A3O A;  1H4R A;  3X23 A;  2Z0E B;  2WDR B;  4NAM A;  5G2N A;  4M02 A;  1AYF A;  3AMZ A;  2KDE B;  2RPV A;  2INN E;  1MFW A;  2OED A;  2NVU I;  2JQR B;  1NI3 A;  3TSS A;  5TSS A;  3CF6 E;  1E10 A;  2IGD A;  1NDD A;  1M94 A;  2L00 B;  2IO3 B;  4IM0 A;  3RNB C;  1Q1O A;  2UYZ B;  1Y56 A;  2FCQ A;  3BZD B;  4IC7 B;  2A5U A;  4C4V A;  1F77 A;  2PLP A;  3VRB B;  3N1Y C;  3PRP B;  3Q2A C;  2ZPN A;  4K1R B;  2KFK A;  5E6J A;  2KX3 A;  4JPS A;  1XCQ L;  2D5G A;  1TJE A;  1K53 A;  2SAK A;  3ZTC A;  2JWZ A;  2VZK B;  1ET9 A;  3U52 E;  3WAM A;  4GDL B;  2KAC A;  1WH3 A;  1FD6 A;  3DHH C;  2ASQ A;  4MGY E;  3UGB B;  2K1F A;  1FXI A;  1SE2 A;  1TYG B;  1BXT A;  2N0S B;  2RPQ A;  1HZ6 A;  2B76 B;  1T5X D;  1AN8 A;  3B2G A;  4YTN B;  5H8Y E;  1XT9 B;  4W9D A;  3OWE B;  4FUL A;  2KAJ A;  1J0G A;  2BGF A;  1ZPS A;  2QJL A;  1FNV A;  1L6U A;  4W9H A;  2MBB B;  1GJZ A;  2KWD A;  2WS3 B;  4KDI C;  1HE8 A;  4C00 A;  1FFU A;  2DZI A;  3TMP B;  2EEL A;  1G6J A;  1WXM A;  1MI0 A;  2V3P A;  1JWA D;  1J8C A;  1LGR A;  3VQI A;  1P7E A;  4KVG B;  1CMX B;  4JQW C;  2LVO A;  1VJK A;  1TZO A;  4TKN A;  4A6Q A;  3RUL A;  4JLC A;  2PKO A;  2H88 B;  3WAO A;  5FK9 C;  5L95 C;  4AP4 C;  5D2M B;  4NAW B;  2PJH A;  3H7S A;  4I6N B;  1STE A;  1MHH E;  5BYR A;  3QAR A;  2O6V D;  4MJS B;  3DBS A;  3PHX B;  3VVW B;  2GLS A;  3JSV B;  1KLG D;  2HE7 A;  2HDE A;  5E6N A;  1CJE A;  2Z59 B;  4DHZ B;  2LVP A;  4UDU C;  3P2B A;  3OJ4 B;  4YTM B;  2L0T A;  2LWP A;  3EFU A;  2N7E A;  2H89 B;  1YJ1 A;  3Q3F A;  4RNA A;  2DZM A;  4HJG E;  1SE4 A;  3U7Z A;  3PSE B;  2I1J A;  1N60 A;  2KC2 A;  3ZKJ C;  1LO5 D;  2AL6 A;  3Q69 A;  1MG4 A;  2JZ3 B;  2N7D A;  4AQ7 A;  4TQ1 A;  2LUM A;  1QOF A;  4KX6 B;  1EF5 A;  1I4R A;  1MHX A;  3DBL I;  2M56 B;  1H8C A;  1EWC A;  3DBH B;  3AV8 A;  3TIX A;  1GOZ A;  3APD A;  3ZNZ B;  2XEW A;  1V49 A;  1OGW A;  1WRD B;  2A4Z A;  3Q8B A;  4A55 A;  1E90 A;  3KUD B;  4ZRK A;  4ZHO A;  4BVU C;  2QIL A;  3IXS A;  1UF0 A;  2NTS A;  3NRZ A;  2M0A A;  2WWZ A;  3VR9 B;  2M0X A;  4TMA B;  3A9J A;  4AS1 A;  3TEZ A;  3R2T A;  3BIN A;  2C5L C;  1FCL A;  2M17 A;  3MJW A;  3IVF A;  5L83 A;  3RPF C;  4IKG A;  3K9P B;  2CR5 A;  1I4X A;  1YJI A;  4MEL A;  5AUI A;  3PV1 A;  3HIZ A;  5LXH A;  2BYV E;  1TTN A;  4NZL B;  1QQR A;  2Y3A A;  4RGM A;  2PE6 B;  3NVV A;  4EOY A;  1IPG A;  3EUB 2;  3IT4 B;  3K9O B;  2Y5B B;  1E8W A;  2ZEQ A;  3AEB B;  3AE2 B;  2L32 A;  2GBK A;  2MWS B;  3QQ8 B;  4MSQ B;  4ZDV A;  3N20 C;  4WIP A;  5AZH A;  1YN3 A;  2IJ0 A;  2D11 A;  2Z0D B;  2LJ5 A;  4B95 A;  2MH7 A;  4XDD A;  1J19 A;  1QT9 A;  2BYE A;  1S3S G;  3A4R A;  4HK2 A;  4E71 A;  3MHS D;  3NVZ A;  5BO4 B;  2AYO B;  1WJN A;  4IWO A;  4EZK A;  3AE6 B;  2O6V B;  2G4S A;  3EGR A;  3SFE B;  2L76 A;  3VH3 B;  4F7Z A;  1CK1 A;  4LTU A;  4W9J A;  3Q3O C;  3TUO A;  2BYF A;  1EU3 A;  3KQ4 A;  3DHI C;  3W5U B;  2E3T A;  4WWO A;  4ICV A;  2FCM A;  3ENE A;  5G55 A;  3HRD D;  3BVG A;  4BKS A;  2ON8 A;  4P6V F;  3MTN B;  2IYD B;  4WJP A;  1GG3 A;  5LXI B;  2FCN A;  3APF A;  2C60 A;  3DWG C;  3RI7 C;  2XNA C;  2KYW A;  4FN2 A;  2NBV B;  3ABV B;  2LVQ A;  3QA8 A;  1QLB B;  1EWY C;  3EC8 A;  4ZRP A;  4C80 A;  2MBQ A;  2DAJ A;  2IND C;  1V86 A;  1R4N I;  2J42 A;  4LCD E;  1SXT A;  5IAA C;  4B6W A;  4MDK E;  4HVB A;  1XLQ A;  1V5O A;  4B0E A;  2CHX A;  3FIL B;  2XN9 C;  4DHJ D;  1V6E A;  3ZNH B;  3O13 A;  5DPS A;  1D5M C;  1Z2M A;  3RNA C;  4MJS A;  3QCA A;  3RZF A;  2I2Y A;  4GIV A;  1EUV B;  5IOI A;  2KNB A;  1WXQ A;  4HCN B;  1R4M B;  3NJT A;  2RDG A;  2KJ6 A;  2CKH B;  3PZD A;  5DCN A;  1JWB D;  1TKE A;  1AWD A;  4HPL B;  1BML C;  2KKC A;  1JWS D;  3HVZ A;  3UIP B;  4A8X C;  4HPP A;  4LJP B;  2KLG A;  2L1A A;  3NUH B;  1LFD A;  2UU7 A;  4KV2 A;  2PE9 A;  1C4C A;  4RGN A;  4GSW A;  4LDT D;  1V1O A;  3L10 B;  2JSV X;  3AE1 B;  3H6N A;  1TS3 A;  1D6E C;  3TCA A;  3GB1 A;  3ZW3 A;  4US8 A;  1WYW B;  4WJO A;  1JWM D;  2JRI B;  1F1H A;  4IG7 B;  5D7G A;  3DBH I;  2ZCB A;  2MBH A;  2JUO A;  4Q2J A;  1SSN A;  1OEY A;  1C9F A;  1J7A A;  4BZA A;  3U30 A;  1HEZ E;  2GBN A;  2LHD A;  2ZJD A;  3L54 A;  3IFW B;  3V6C B;  4IUM B;  1DOI A;  1ZUD 2;  4NJC A;  3Q8C A;  2DZK A;  1ZGU B;  3ETR A;  2HJ1 A;  1C4P A;  1QOA A;  1YX6 B;  3KUC B;  4P16 A;  3N1X C;  3N3K B;  5IKC M;  3LXF A;  5J17 A;  1T0Y A;  4E74 A;  2WXR A;  2IBI B;  1UBI A;  5D3D A;  1VD2 A;  1XLO A;  2AQ2 B;  1SIF A;  2RMM A;  2DZJ A;  2RSU A;  2MCN B;  2MHJ A;  3PHW B;  1YIW A;  4ANX A;  4XZ4 A;  2ZCC A;  3U4E G;  2X38 A;  3U2S C;  1SE9 A;  2G4D B;  3R3M A;  1FXT B;  3LYY A;  2MEK A;  1AW7 A;  3V05 A;  1R7S A;  3X0W A;  1WRI A;  4AJW A;  4NY0 A;  1E7P B;  3C19 A;  4YSZ B;  3VTU A;  3L17 A;  5IP4 D;  1T0R C;  1A70 A;  3H8H A;  2Y5C A;  1ZOY B;  1B1Z A;  1VDV A;  4HKZ E;  4GOC A;  1M4V A;  2M1M A;  3MJ5 A;  4JWU C;  1HTQ A;  1ZXH A;  3J9C A;  2PIA A;  1UH6 A;  1V2Y A;  1VRA B;  2KMC A;  3I57 A;  4X57 B;  2GOW A;  1NYR A;  1WX8 A;  4S17 A;  2AL3 A;  3C8Y A;  1I4Q A;  1LQB A;  2YEP F;  1PYW D;  1WI0 A;  2WGS A;  2BS3 B;  1OQQ A;  5HG2 A;  4ZRI A;  2KMA A;  3ZTD A;  3SD5 A;  1ZKH A;  2WXN A;  1TS2 A;  1WXV A;  2N9X A;  4HXD A;  3VUW A;  4YTP B;  1VLB A;  2JXT A;  4KZ0 A;  3KH0 A;  2GB1 A;  2DNF A;  4J6I A;  4W9I A;  2BBC A;  4PYU A;  3IHP C;  4WQM A;  2BKR B;  2HTM E;  2BS2 B;  3GZN I;  3N32 A;  3NZ3 A;  5D3I B;  3UF8 A;  5HHD G;  1CQV A;  2J0K A;  3T3O A;  2MP2 A;  4DXF A;  1YNT E;  1TGZ B;  2K39 A;  3DBL B;  1EM7 A;  1EU4 A;  2N1W A;  1Q5W B;  2CU1 A;  3H7P B;  2CHZ A;  4KIK A;  5FKA C;  3W9C B;  4LNF A;  5HFY A;  2WXM A;  3IT6 B;  1BUI C;  1KLU D;  2N4F A;  4ZRJ A;  2WX1 A;  1WGG A;  3WAN A;  4W9C A;  4FXC A;  4NQK E;  4KGR A;  2QC8 A;  1C78 A;  2LMC A;  2WXQ A;  4FA6 A;  1E9M A;  1VCB A;  1SBB B;  1V8C A;  2D3C A;  4IM2 A;  4US9 A;  4C7Z A;  2BW2 A;  2L8J A;  2KWU B;  2WXO A;  3MC0 B;  4TV3 A;  2JF5 A;  5BYS A;  3AU5 A;  4WAA A;  4BBN C;  1TIF A;  1HZ5 A;  1JQ4 A;  1LM8 B;  3Q8F A;  1WM2 A;  1KLV A;  2M8S A;  2KXJ A;  3SR6 A;  1I42 A;  4HEA 1;  2MQJ A;  3UQA A;  1C77 A;  1JWU D;  4CQN A;  5J2R A;  4E3C A;  3VHT C;  4YWG G;  4CHK A;  3Q14 C;  1WR6 E;  2K22 A;  2LGS A;  4EEW A;  2V3S A;  2OHF A;  1GB1 A;  1YOV B;  2K0P A;  3R8B A;  2DLB A;  4DWF A;  1YN5 A;  2ZZP B;  4DK5 A;  3P4R B;  3ML9 A;  4EKU A;  1D3Z A;  2MJD A;  4GLS C;  3W1S C;  3L13 A;  1WM3 A;  2KWC A;  5D94 A;  3VFK A;  4L1B A;  2BPS A;  3UIO B;  1KH0 A;  4OZC A;  2IO2 B;  4GN1 A;  2L05 A;  1PUT A;  3TEY A;  2GBJ A;  3NS1 A;  2V9H A;  1ZXI A;  1T0Q C;  3N30 A;  3LJ3 A;  4RM9 A;  3H1U A;  5AZF A;  2BTE A;  2L7R A;  4HRO A;  3U8Z A;  2GI9 A;  1QOG A;  3RNC C;  1FCC C;  2HD5 B;  1L4D B;  3PRE A;  2W54 A;  4M8N A;  1IBX B;  4BOZ B;  3M95 A;  3DOW A;  2FBW B;  2OJW A;  4JWS C;  2FNJ B;  5JHB A;  1K52 A;  2MLB A;  2KDF B;  4ZRQ A;  4G3X B;  1NBF C;  3L0W B;  5DPW A;  1N63 A;  1E5W A;  3VR8 B;  1GC6 A;  1E8Z A;  2KD0 A;  1WMH A;  3WAL A;  2MW5 A;  2J0M A;  1DOY A;  3M62 B;  3V62 A;  2K3U A;  3ZO5 B;  1WSP A;  3SU8 X;  4AWJ A;  2KFK B;  3VH4 B;  1L5P A;  3L4P A;  4IWP A;  2JX5 A;  2WDV B;  2YLM A;  3QX1 A;  3NHE B;  3EFC A;  1K50 A;  2KN4 A;  3AXC A;  1TBE A;  1RM6 C;  2RGF A;  2IO1 B;  4GU2 A;  1WMH B;  2N1V A;  1N6Z A;  1SGH A;  4ZYN A;  2O2V B;  3TEX A;  3ZRF A;  4W9G A;  5CTR C;  4WJQ A;  2VH2 A;  3ZVV A;  4TUU A;  4MEM A;  1DOX A;  3AM9 A;  3TJP A;  1KOT A;  4FHK A;  3SEB A;  4TSS A;  3ALB A;  3DVG X;  1KF6 B;  2IY1 B;  3A4S C;  3P4Q B;  1PGX A;  5JZE B;  3L08 A;  3AI5 A;  1V97 A;  1WY8 A;  2C7H A;  3VRA B;  4MH0 E;  1ZDX A;  4KGT A;  5AZG A;  4R3D A;  4ASW C;  1RAX A;  2I1K A;  3VUY A;  1ENF A;  1PDX A;  2W55 A;  4OZB A;  2RR9 A;  2JVC A;  2KWV B;  3BK1 A;  5IN7 A;  1UGM A;  1WX9 A;  5C3J B;  1XO3 A;  2K8C A;  1WIA A;  4WWM A;  3A1Q B;  4P1C C;  2CS4 A;  2QIE B;  4JGH B;  4BKT A;  3I3T B;  1L7Y A;  3RD2 A;  3SFD B;  1D5X C;  5DPT A;  1PGB A;  2J0J A;  1E0Z A;  1XLN A;  5EE0 A;  1OFF A;  2MX2 A;  4LNN A;  3T3N A;  1X1M A;  1I35 A;  3NVW A;  4I6P A;  2GRI A;  3ZLZ A;  4ANV A;  3CMM B;  3H9D A;  5BMG A;  2FID A;  1YQ3 B;  2FIF A;  1GUA B;  1L4Z B;  2K9X A;  2WXF A;  2TSS A;  2O6V A;  2G9H D;  3QJZ A;  2LI5 A;  2JYE A;  4BKS D;  4WWN A;  1T6B X;  4QAY A;  4HDO A;  3L16 A;  5CHW A;  2KC1 A;  2LZ6 A;  2PVO D;  2ZVN A;  2G3Q B;  2KJH B;  5TR5 A;  4MM3 B;  4PS7 A;  4DDI D;  4FHJ A;  2JRH A;  4W9L A;  2J7Q B;  2KTR A;  3MP9 A;  2HJ8 A;  4MAC A;  3ML8 A;  2G45 B;  5JXV A;  1J7B A;  5JH5 C;  3SHQ A;  2BQQ A;  2XK5 A;  3W2D A;  2W9N A;  1YX5 B;  1GNU A;  2IZV B;  1S1Q B;  3H7P A;  3MC8 A;  2KOX A;  1HTO A;  3NZU A;  4XWT A;  2INC C;  4W9F A;  5IO9 A;  2BWE S;  2ZPY A;  2N9E B;  4XDC A;  4URK A;  4M8M A;  4L2Y A;  1JML A;  4LDT B;  4PT5 A;  2MJE A;  2DAF A;  2WDQ B;  2YVC A;  3PPA A;  3PS6 A;  4FJV B;  2M4N A;  4XE0 A;  3RNG C;  1V5T A;  3EHV A;  1JRO A;  2ACZ B;  2NR2 A;  2BF8 B;  3WIM A;  4C4V B;  3C0R B;  2BS4 B;  3AE5 B;  2CU3 A;  2DEN B;  2KQ4 X;  3DVN U;  1RFK A;  1VZ7 A;  1WJU A;  4GDK A;  2WU5 B;  1VZ6 A;  4BBN F;  1ZP0 B;  1ROE A;  1KJT A;  2KO3 A;  2LRU A;  3PVL A;  1FEH A;  2K6D B;  4DHJ B;  4EZJ A;  2QHO A;  3T9L A;  2D3A A;  2BVC A;  3BVM A;  5G5H A;  1Q10 A;  3ZXV A;  3EEC A;  4NPN A;  1WE7 A;  2KK8 A;  2LGY A;  3PLV A;  1OQR A;  2KX0 A;  4M0W B;  3P63 A;  3M63 B;  3RUI B;  4DDG D;  5LLI A;  4JE3 B;  3AEA B;  1DYQ A;  1JCK B;  3VAW A;  4IWQ A;  1F52 A;  2K8H A;  1XEE A;  3S2A A;  4ICU A;  2O2V A;  4M01 A;  4FAD A;  3AEF B;  3FKY A;  1WZ3 A;  4PS3 A;  2LJI A;  1WE6 A;  2ONQ A;  4IW0 A;  4HRS A;  2OJR A;  1EO6 A;  2BB5 A;  1OEY J;  3FAH A;  2K5P A;  4MT5 A;  1WJ6 A;  1FIQ A;  3UIN B;  2RD0 A;  4YL8 A;  3KW5 B;  2LGX A;  1I4P A;  2L0F A;  3VTW A;  1GPX A;  4ANU A;  4ACF A;  2JWU A;  2NCN A;  5CHF A;  1BT0 A;  5DPR A;  3B08 A;  4WWP A;  2KQS A;  1XCT L;  1UEL A;  1FFV A;  2IPK D;  4W9K A;  3Q8A A;  2BB6 A;  3U7D A;  4RFB A;  1MVK A;  1ACC A;  1UUP A;  2K25 A;  4XX5 A;  1WX7 A;  1PQS A;  3IBE A;  4XC2 A;  2RDB C;  1R4N B;  4BOS C;  1UD7 A;  4EE2 A;  1QIL A;  1SIJ A;  1C79 A;  3Q8E A;  4A90 A;  4HKQ A;  1U4A A;  3KLS X;  4RF1 A;  4M00 A;  3ZJT A;  3OLM D;  2LFI A;  3DQV A;  4K7W A;  4LLG M;  4XGA B;  4BKG A;  2L52 A;  3RN9 C;  4HLE A;  4FJY A;  1JAL A;  1WJ4 A;  3R7R A;  4OVV A;  2WNM A;  3LB8 C;  2LAS A;  2W82 A;  4AUQ C;  1NVI D;  3B1L X;  4DBG A;  3AEG B;  2W3R A;  3BVZ A;  1NI2 A;  2J52 A;  2NBW B;  2KTF A;  1FNU A;  1YJJ A;  1N61 A;  1T3Q A;  1PFD A;  1N5W A;  3R2I A;  4REZ A;  4EZL A;  1F0Z A;  2KLC A;  2WDT B;  3O65 B;  4MSM B;  2JYT A;  1TS5 A;  5GXG B;  1L0Y B;  1RFA A;  4N58 A;  2KFJ A;  5C23 A;  1TY2 A;  5CX3 A;  1KRH A;  2M19 A;  5EE1 A;  3AEC B;  4MH8 A;  3HM6 X;  3Q3M C;  2J4X A;  2INP E;  3AB5 A;  4RGT A;  4YSY B;  2PW9 A;  1TKY A;  2Y5P A;  3W1Y A;  2C9W B;  3I63 C;  2R2Q A;  1IGD A;  3JYU A;  3ZUN A;  2AWT A;  3E56 A;  5FR6 A;  3QWZ B;  4LK0 M;  1SEB D;  1WGH A;  5JHA A;  2X8X X;  2JU6 X;  3QHT A;  4MGI E;  2WYQ A;  3WA0 A;  2G1E A;  4K3C A;  1V1P B;  3BYY B;  4J3O D;  4YSX B;  3B0A A;  3QC8 B;  3ZYY X;  3HHM A;  3MFG A;  5E6O A;  3UI3 A;  2KDB A;  3ZRC A;  1N5X A;  1E8X A;  2NPT A;  3HVD A;  4EFO A;  3OJ3 A;  1WFY A;  1UBQ A;  1ET6 A;  4WUR A;  2PEA A;  4ANW A;  1C3T A;  3RMK C;  2K6Q A;  4YT0 B;  3PGE A;  1WGK A;  4II3 B;  2WXH A;  3KWL A;  3DHG C;  3PRM B;  3CST A;  3CSF A;  1XF5 L;  3FC4 A;  2RDH A;  3PZ8 A;  2JT4 B;  2AQ3 B;  1YQB A;  3NVY A;  4W9E A;  2PVG C;  3VTV A;  3PLU A;  4AOF A;  4EUT A;  2EMS A;  3AE8 B;  5D6J B;  3ECI A;  2GMI C;  3PZ7 A;  3AUL A;  3W1S A;  1K51 A;  2IGG A;  4I6L B;  2WXP A;  4ARI A;  2IO0 B;  5EDS A;  3DDC B;  3HM3 A;  3BWU D;  2VZK D;  5KHQ A;  2JXX A;  4NAW A;  2I38 A;  5HKH A;  1P98 A;  3APC A;  2E6X A;  5AUK A;  1P1A A;  2MA9 B;  2SEB D;  3E9S A;  4PK1 A;  2YEP B;  4OVU A;  1K8R B;  2W3S A;  4DHZ E;  1QOB A;  2KZR A;  5E6P A;  1MG8 A;  3R7Q A;  4IDI A;  1C76 A;  3ZQ4 A;  4N59 A;  1RYJ A;  1IP9 A;  1FM0 D;  3ZDT A;  1ZW7 A;  3AE7 B;  1V80 A;  1QZE A;  1P3Q U;  3OAW A;  5HI1 A;  2AX5 A;  2CJO A;  4P1B C;  4WJN A;  1F2R I;  1JW9 D;  4S0R A;  1B9R A;  5T8I A;  3IAS 1;  5H92 C;  2V4I B;  4A3P A;  2MP2 B;  4XWW A;  2FCS A;  3NS8 A;  1TT5 B;  1F9J A;  3VDZ A;  4OHJ A;  3ONS A;  3AE9 B;  2WXJ A;  2JY6 A;  2JPH A;  4GDL A;  2WX0 A;  1ZE3 D;  5EE9 A;  4K3B A;  3CWI A;  3P1M A;  1WZ0 A;  1P7F A;  1YN4 A;  3LDZ E;  4P7I A;  3A9K A;  1P0R A;  3NG0 A;  3CIR B;  1GAQ B;  5KHO A;  2UWQ A;  1FNW A;  1NYQ A;  2D3G A;  1XQQ A;  3Q3J A;  4GMV A;  1V81 A;  2DWQ A;  3KYD D;  1IGC A;  3P42 A;  3QIJ A;  5I4D A;  4K81 A;  1WWT A;  3D32 A;  3TL5 A;  1C1Y B;  4L23 A;  1V1P A;  3TBL D;  1JRU A;  2WQY B;  3DBR B;  5BMI A;  2LUE A;  2Q5W D;  4WQO B;  1SB3 C;  3DBR I;  4FLH A;  4K7U A;  2K8B A;  4OZA A;  4LNK A;  5C2T B;  1E8Y A;  3AN1 A;  1Y8R C;  3NOB A;  1NEK B;  2MBO A;  2KQ7 A;  4ITK A;  1SF0 A;  4OVZ A;  4G0N B;  2D3B A;  5BYQ A;  1ISN A;  3OG5 A;  4A20 A;  3DWM A;  2EKE C;  4DXA B;  4FJZ A;  3RCZ A;  4BAX A;  4G50 A;  2FE8 A;  1KFY B;  5BMH A;  2QSD A;  1J7C A;  2NTT A;  1GC7 A;  1I4G A;  3W5V B;  4B0M A;  2DHZ A;  2NPT B;  4USA A;  3V6E B;  4PS8 A;  1UGJ A;  2WXI A;  2R2O A;  1F2R C;  1WYG A;  2BT6 A;  2LEK A;  3I5J C;  1L2N A;  2L83 A;  3JSV A;  4RMA A;  2WXG A;  2LGI A;  2R61 A;  2C7M B;  2N7J A;  1WR1 A;  4KDL B;  2EMT A;  4KZC A;  3UQB A;  2KAN A;  3Q6B A;  4KSL C;  1XD3 B;  4HWI B;  2JZZ A;  3AE3 B;  1FRD A;  2KT7 A;  2IGH A;  3NZS A;  4DXG A;  1WXA A;  1RWS A;  1L6V A;  2LXA A;  2D07 B;  2XBB C;  1MPE A;  1C4A A;  2QMT A;  3RYT A;  3DVG Y;  3A33 B;  4CO7 A;  4JX1 C;  2REX A;  2KDI A;  3GS2 A;  2GBM A;  3MC9 A;  3RZW C;  4N6E B;  1I4H A;  1A5R A;  2DYB A;  4B9K A;  4BFR A;  1TS4 A;  2B3A A;  3AH7 A;  3DVN V;  2LHE A;  1WGY A;  4DQO C;  3N9Y C;  2ICI A;  2V4L A;  3WAP A;  3QAQ A;  3AU4 A;  4ZHP A;  1T0S C;  2V3N A;  2KVR A;  3AE4 B;  4RM8 A;  2ZVO A;  2J53 A;  4OW0 A;  3KWV A;  3I9V 1;  3RFZ B;  4N9F 4;  5LNK 1;  3TEW A;  1KM7 A;  1CZP A;  4KKI A;  2LD9 A;  2QDF A;  5AEK B;  3BY4 B;  2KTR B;  4C56 C;  2BYT A;  4ZOH C;  3R66 C;  4K7S A;  1P9D U;  3WCQ A;  1OTR B;  4GB9 A;  4CYE A;  3Q3N C;  1VR9 A;  3BK2 A;  3P4S B;  2D2Q A;  4MGZ E;  2WU2 B;  3IG3 A;  1YQ4 B;  2VRR B;  3ZGZ A;  3GE8 C;  1NEN B;  2ZNV C;  3B2F A;  4O1N A;  3HK0 A;  5C1Z A;  2PPH A;  3FIL A;  5GMV A;  4ZYS A;  1JRP A;  4RF0 A;  3SDL C;  1HA5 A;  2KDM A;  3ZXR A;  2KHW B;  2N9L A;  3KYC D;  4RGO S;  5G5G A;  3DPD A;  1SE3 A;  3B9J A;  5MPO A;  4HCP B;  1LXD A;  5FR3 A;  2V1Y A;  1FMA D;  1EF1 A;  2WHI A;  2IY0 B;  1Q0W B;  3P4P B;  3VUX A;  1D5Z C;  2DYM A;  3DCG A;  1WXS A;  3A9K B;  3HUI A;  4FBJ B;  2MSE D;  1FRR A;  2ZW1 A;  2MBE A;  1SJH D;  2KMM A;  3AEE B;  2HTH A;  4II2 B;  1YMH E;  1QF6 A;  3NY5 A;  2KVZ A;  1Z5S B;  1ESF A;  2NMQ A;  1E7V A;  3GZN B;  1DGJ A;  2MRP A;  1FPY A;  4M0W A;  2WXL A;  1I7H A;  4KGS A;  2Z8L A;  3T8M A;  1SJE D;  2FAZ A;  1E6E B;  2AQ1 B;  4KKJ A;  1ZDV A;  3RNF C;  1UWX A;  2KJR A;  4IOI E;  4GGQ A;  2QCZ A;  3GOE A;  1KTK A;  4KIK B;  4TQ0 A;  3N1Z C;  2PTL A;  3JW0 X; 
#chains in the Genus database with same CATH homology
 1SEB D;  3EGR A;  2PMV A;  2WP9 B;  3SFE B;  2FBW B;  1CK1 A;  4LTU A;  2MJ3 A;  2JU6 X;  4JWS C;  3TUO A;  1VZ8 A;  2G1E A;  1K52 A;  1V1P B;  1EU3 A;  1FXA A;  3BYY B;  2WXK A;  4J3O D;  4YSX B;  3KQ4 A;  4RCO A;  4ZRQ A;  3W5U B;  1HQR D;  2E3T A;  3PO0 A;  3ZYY X;  4YXD B;  3MFG A;  1N63 A;  3UI3 A;  3VR8 B;  2IDY A;  1N5X A;  2DYO A;  3BVG A;  3HRD D;  3EA6 A;  3HVD A;  2ON8 A;  1DOY A;  1FO4 A;  3GP7 A;  4P6V F;  1ET6 A;  4WUR A;  2K3U A;  4YT0 B;  1WSP A;  5EE3 A;  1WGK A;  2WXH A;  3KWL A;  1L5P A;  3L4P A;  4C7Y A;  3AED B;  3DWG C;  1XF5 L;  2JX5 A;  2WDV B;  3FC4 A;  2V0G A;  2RDH A;  2XNA C;  1PGA A;  3ABV B;  4H2A A;  2JZP A;  1QLB B;  3PZ8 A;  2AQ3 B;  1UNS A;  1EWY C;  3NVY A;  1K50 A;  2KN4 A;  2PVG C;  4ZRP A;  4C80 A;  1IBX A;  1RM6 C;  2J42 A;  1SXT A;  4RH6 A;  3TEX A;  1XLQ A;  4B0E A;  1UWM A;  3AE8 B;  3FIL B;  1XXG A;  2XN9 C;  3O13 A;  3PZ7 A;  1DOX A;  3W1S A;  1D5M C;  3BYT B;  3AM9 A;  1K51 A;  2IGG A;  2WXP A;  3SEB A;  2I2Y A;  4ARI A;  2CJN A;  4TSS A;  1TKG A;  3BWU D;  1WXQ A;  2VZK D;  1KF6 B;  2DBY A;  2RDG A;  4WAF A;  2QEJ C;  3P4Q B;  1PGX A;  2FUG 1;  2I38 A;  1JWB D;  3ZJU A;  1TKE A;  1AWD A;  1BML C;  3BII D;  1V97 A;  1JWS D;  2E6X A;  3HVZ A;  4ARC A;  3VRA B;  1N62 A;  5AUK A;  3MHZ A;  4A8X C;  1ZDX A;  2SEB D;  4KGT A;  3E9S A;  4R3D A;  2YEP B;  1L0X B;  1ENF A;  1PDX A;  2W55 A;  4OZB A;  2L1A A;  3NUH B;  2WLB A;  2N9K A;  1C4C A;  3BK1 A;  4RGN A;  1XLP A;  2W3S A;  1V1O A;  1QOB A;  5C3J B;  1XO3 A;  2JSV X;  3AE1 B;  4A9A A;  1L0V B;  3IAM 1;  1TS3 A;  1D6E C;  4IDI A;  4WWM A;  1C76 A;  2QIE B;  3GB1 A;  3ZQ4 A;  4US8 A;  1QKZ A;  4N59 A;  1RYJ A;  4GDK B;  1FM0 D;  1JWM D;  3V3X A;  3ZJV A;  3AE7 B;  3SFD B;  1D5X C;  1GB4 A;  5HI1 A;  2AX5 A;  1PGB A;  2CJO A;  1E0Z A;  1XLN A;  5EE0 A;  1OFF A;  1F2R I;  5D7G A;  1JW9 D;  3T3N A;  1B9R A;  1D4B A;  5T8I A;  3NVW A;  4WH4 A;  2EKI A;  3IAS 1;  3URY A;  4Q2J A;  5H92 C;  2V4I B;  4D2K A;  1TY0 A;  1IUE A;  2ZW0 A;  4XWW A;  1SSN A;  1HXY D;  1C9F A;  1J7A A;  2GRI A;  1HEZ E;  2LHD A;  5BMG A;  1YQ3 B;  4OHJ A;  3AE9 B;  2WDR B;  2WXJ A;  4NAM A;  1DOI A;  1ZUD 2;  1L4Z B;  4NJC A;  2K9X A;  1ZE3 D;  2WXF A;  1AYF A;  2TSS A;  3AMZ A;  2G9H D;  3Q8C A;  5EE9 A;  3CWI A;  3P1M A;  1P7F A;  1YN4 A;  2RPV A;  2INN E;  3ETR A;  2OED A;  2JYE A;  1C4P A;  2JQR B;  1T6B X;  1NI3 A;  3TSS A;  3CIR B;  1GAQ B;  5TSS A;  1E10 A;  1FNW A;  1NYQ A;  1QOA A;  2PVO D;  4P16 A;  2IGD A;  3LXF A;  4MM3 B;  2WXR A;  2DWQ A;  1IGC A;  3P42 A;  5I4D A;  5D3D A;  1WWT A;  1Y56 A;  3MP9 A;  3BZD B;  4MAC A;  4L23 A;  1XLO A;  1V1P A;  2AQ2 B;  2WQY B;  5BMI A;  1F77 A;  2PLP A;  2RMM A;  2Q5W D;  3VRB B;  1SB3 C;  5JXV A;  1J7B A;  5E6J A;  3W2D A;  4OZA A;  4JPS A;  1XCQ L;  2D5G A;  5C2T B;  1TJE A;  1K53 A;  3AN1 A;  2SAK A;  1NEK B;  4ITK A;  1SF0 A;  4OVZ A;  2X38 A;  3U4E G;  3U2S C;  4XWT A;  5BYQ A;  2VZK B;  1ET9 A;  3DWM A;  3U52 E;  4GDL B;  2KAC A;  3LYY A;  1FD6 A;  2MEK A;  1AW7 A;  3V05 A;  1R7S A;  4XDC A;  1FXI A;  1SE2 A;  1KFY B;  2FE8 A;  1TYG B;  5BMH A;  1BXT A;  2QSD A;  1WRI A;  4L2Y A;  2N0S B;  1J7C A;  1E7P B;  1JML A;  2NTT A;  1I4G A;  1HZ6 A;  4PT5 A;  2B76 B;  2MJE A;  3W5V B;  1T5X D;  1AN8 A;  3B2G A;  4B0M A;  4USA A;  4YTN B;  4YSZ B;  5H8Y E;  2WDQ B;  1A70 A;  3OWE B;  2KAJ A;  3H8H A;  1UGJ A;  2Y5C A;  4XE0 A;  1ZOY B;  1B1Z A;  2WXI A;  1ZPS A;  1VDV A;  1F2R C;  1JRO A;  2QJL A;  4HKZ E;  1FNV A;  1L6U A;  1M4V A;  1WYG A;  2ACZ B;  3MJ5 A;  2BT6 A;  4JWU C;  2LEK A;  2KWD A;  1ZXH A;  2WS3 B;  3J9C A;  2L83 A;  2PIA A;  1FFU A;  2BS4 B;  3AE5 B;  2WXG A;  2CU3 A;  2KQ4 X;  2LGI A;  2R61 A;  1RFK A;  1VZ7 A;  1VRA B;  2N7J A;  3I57 A;  2WU5 B;  1VZ6 A;  1ZP0 B;  2EEL A;  1MI0 A;  1ROE A;  1NYR A;  2V3P A;  1JWA D;  1FEH A;  3C8Y A;  1I4Q A;  2YEP F;  1PYW D;  3AE3 B;  3VQI A;  1FRD A;  2BS3 B;  1P7E A;  1OQQ A;  3BVM A;  5HG2 A;  5G5H A;  1Q10 A;  4A6Q A;  1VJK A;  1TZO A;  2IGH A;  2WXN A;  4DXG A;  1TS2 A;  1RWS A;  1L6V A;  4YTP B;  1OQR A;  1VLB A;  2PKO A;  2JXT A;  2GB1 A;  2H88 B;  3P63 A;  5FK9 C;  1MPE A;  2BBC A;  1C4A A;  4NAW B;  4JE3 B;  2QMT A;  3AEA B;  1DYQ A;  4WQM A;  2HTM E;  1STE A;  2BS2 B;  1JCK B;  1MHH E;  3NZ3 A;  5D3I B;  5BYR A;  4JX1 C;  5HHD G;  1CQV A;  1XEE A;  3GS2 A;  3T3O A;  3AEF B;  4DXF A;  4N6E B;  1I4H A;  1KLG D;  1YNT E;  2LJI A;  1TS4 A;  3AH7 A;  2HDE A;  1EM7 A;  1EU4 A;  2ONQ A;  2LHE A;  1CJE A;  4DQO C;  3N9Y C;  4HRS A;  2ICI A;  4UDU C;  5FKA C;  2BB5 A;  4YTM B;  3W9C B;  4ZHP A;  5HFY A;  2WXM A;  3IT6 B;  1BUI C;  2H89 B;  1KLU D;  3FAH A;  4RNA A;  2K5P A;  2V3N A;  3AE4 B;  4MT5 A;  4HJG E;  1SE4 A;  2J53 A;  4OW0 A;  1FIQ A;  3U7Z A;  4FXC A;  3KWV A;  4KGR A;  3I9V 1;  3RFZ B;  1C78 A;  1N60 A;  2LMC A;  1I4P A;  2WXQ A;  1E9M A;  1GPX A;  5LNK 1;  3TEW A;  1LO5 D;  1SBB B;  1V8C A;  3Q69 A;  4US9 A;  1CZP A;  4C7Z A;  4KKI A;  2BW2 A;  2JWU A;  4C56 C;  4AQ7 A;  2WXO A;  3MC0 B;  4TQ1 A;  4ZOH C;  2BYT A;  5BYS A;  2LUM A;  1QOF A;  4KX6 B;  3WCQ A;  1I4R A;  1MHX A;  2M56 B;  1HZ5 A;  1XCT L;  1VR9 A;  1EWC A;  3BK2 A;  3P4S B;  1JQ4 A;  3AV8 A;  3Q8F A;  1FFV A;  2WU2 B;  2IPK D;  1GOZ A;  3Q8A A;  3SR6 A;  4HEA 1;  1YQ4 B;  2BB6 A;  3ZGZ A;  1C77 A;  4RFB A;  1JWU D;  1MVK A;  1ACC A;  4CQN A;  1UUP A;  3Q8B A;  4A55 A;  1NEN B;  3B2F A;  4O1N A;  4YWG G;  4ZHO A;  3FIL A;  4ZYS A;  1JRP A;  2K22 A;  2QIL A;  1HA5 A;  2KDM A;  3IXS A;  4RF0 A;  4EE2 A;  1QIL A;  2N9L A;  1SIJ A;  2NTS A;  4RGO S;  1C79 A;  3NRZ A;  5G5G A;  2M0A A;  2OHF A;  3Q8E A;  4A90 A;  1GB1 A;  3VR9 B;  4HKQ A;  2K0P A;  1SE3 A;  3B9J A;  4TMA B;  3R8B A;  2DLB A;  3KLS X;  5MPO A;  4RF1 A;  3ZJT A;  4AS1 A;  1YN5 A;  2LFI A;  4LLG M;  3R2T A;  5FR3 A;  3TEZ A;  2L52 A;  3P4R B;  1JAL A;  1FCL A;  1FMA D;  2MJD A;  3RPF C;  4IKG A;  2WNM A;  4GLS C;  3P4P B;  3LB8 C;  1D5Z C;  1I4X A;  2DYM A;  2W82 A;  1YJI A;  5AUI A;  4L1B A;  1NVI D;  3AEG B;  2W3R A;  4NZL B;  3BVZ A;  3HUI A;  1QQR A;  1KH0 A;  2J52 A;  4OZC A;  1FNU A;  2Y3A A;  4RGM A;  1YJJ A;  1PUT A;  1FRR A;  1N61 A;  2ZW1 A;  1T3Q A;  1PFD A;  1SJH D;  2KMM A;  3AEE B;  3NVV A;  3TEY A;  1N5W A;  1YMH E;  3EUB 2;  3R2I A;  3NS1 A;  4REZ A;  1QF6 A;  1ZXI A;  3IT4 B;  3AEB B;  1F0Z A;  1ESF A;  1TS5 A;  2NMQ A;  2JYT A;  1L0Y B;  2L32 A;  3AE2 B;  5GXG B;  2BTE A;  1DGJ A;  4N58 A;  4M0W A;  2WXL A;  1I7H A;  4KGS A;  1TY2 A;  4HRO A;  2Z8L A;  1KRH A;  1SJE D;  2M19 A;  5EE1 A;  3AEC B;  1E6E B;  2GI9 A;  4WIP A;  1QOG A;  1YN3 A;  2IJ0 A;  1FCC C;  2AQ1 B;  4KKJ A;  4MH8 A;  1ZDV A;  2J4X A;  1UWX A;  2INP E;  2MH7 A;  3AB5 A;  4RGT A;  4XDD A;  1QT9 A;  4IOI E;  4YSY B;  2PW9 A;  1TKY A;  1L4D B;  2Y5P A;  3NVZ A;  1KTK A;  2W54 A;  1IGD A;  4TQ0 A;  1IBX B;  2PTL A;  3E56 A;  3AE6 B;  4LK0 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...