1EX9A

Crystal structure of the pseudomonas aeruginosa lipase complexed with rc-(rp,sp)-1,2-dioctylcarbamoyl-glycero-3-o-octylphosphonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
285
structure length
285
Chain Sequence
STYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAVLSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTONIZING LIPASE
publication title Crystal structure of pseudomonas aeruginosa lipase in the open conformation. The prototype for family I.1 of bacterial lipases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 114
structure length 285
sequence length 285
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ex9A00
1ISPA 4ZWNA 1GXSA 3R3YA 1E5TA 3KWFA 2BUAA 1J1IA 2XUDA 2QT9A 2FJ0A 2XUKA 1LPPA 1MAAA 4QDTA 2QRUA 1W4LA 1UK8A 1KU6A 1E8NA 5ALJA 1P0PA 3JYHA 3O9MA 1XQWA 5EGNA 1BEZA 1AUOA 2WTNA 4H18A 2C5FA 3BIXA 3O4IA 5CBKA 3EF3A 5IVKA 1MAHA 5LP1A 3VDXA 1OCEA 1TKRA 3DQZA 5CT6A 3VISA 1CUFA 1Y7IA 5HF5A 3WJ1A 1WCYA 1YB6A 5AKEA 1QIJA 5AM3A 4NZZA 4BP8A 3FBWA 1FFCA 5AK3A 1JJIA 2QJWA 1CUCA 1P0QA 2VATA 2FJPA 3ZV7A 4PW0A 4BCCA 3R3XA 2ZVDA 2RGUA 1ZD4A 5AO9A 4BTVA 1CUSA 4X97A 4EHBA 3C6YA 3I2HA 5JANA 3I2KA 4H7IA 2WFLB 3IULA 3RKSA 1QIMA 3DD5A 3PE6A 1GPKA 2H7XA 5CH8A 4FDMA 3T52A 2XDWA 2BJHA 4GDMA 1TK3A 3BXPA 3A6ZA 4UBKA 4B85A 1XZMA 1ODSA 3IUNA 2Q0XA 4Z49A 2OQIA 1CUDA 4BC1A 3GBSA 1A8SA 3I2GA 5KREA 3BL8A 3VJKA 4Q82A 3E0XA 1K8QA 3STTA 4X6YA 3U1TA 2VA9A 3D5EA 3A70A 2ZYHA 3G9UA 4B83A 1NU6A 2DHDA 5LLSA 5CXUA 4JYMA 5AI6A 1JJFA 3FAKA 3WWPA 4DMKA 2H7YA 4BDSA 1ACJA 3H1BA 1YCDA 4HRYA 3WYDA 3AIMA 4F5ZA 1A8UA 4JUIA 4F60A 2AJBA 2J3DA 1L7RA 2QJRA 1MPXA 1U4NA 5H3HA 1DTEA 3GELA 2I03A 4WCVA 4QDUA 1HPLA 1YR2A 5ALHA 1VKHA 1X2BA 1MU0A 2QR5A 5A71A 3C87A 2JGJA 5JD4A 5K3EA 3WI7A 2VJAA 4KJXA 1WHTA 1Q0ZA 1CPYA 4LXGA 1O6GA 2CKMA 2XT0A 5DNVA 1AQLA 1GZ7A 2Y6VA 2ZSIA 4W1QA 5FLKA 2OGTA 1YB7A 2GBCA 5AKZA 4PSUA 3WIOA 1QOZA 1QO7A 2JIDA 1EK2A 1THGA 2PKYX 2JGLA 5FPQA 1YAJA 1G4HA 5LKRA 4HAIA 2HA5A 3QMVA 4KAJA 1D07A 3E4DA 1R4ZA 2VEOA 5T4EA 3FSGD 4UBLA 4KYVA 4N8SA 3L1IA 3FVRA 4MYSA 3F97A 4QE3A 2RI6A 5HF8A 1IZ7A 3HYSA 5LZ8A 3SK0A 3A2MA 5LZ4A 4X94A 4BCBA 1N5MA 4Y2QA 4IQ4A 4BBZA 4J0JA 1CUVA 3M81A 5T4HA 2PUHA 2YYSA 1BEEA 3D0KA 4KR0A 4BCDA 4P93A 1IZ8A 2GZRA 4DNOA 5CH5A 1T2NA 4BDTA 3GZJA 1XLWA 5I9IA 4PSCA 4EZIA 3BE8A 3ESDA 4OSEA 2GZSA 4AO6A 2JGIA 1KU0A 1K6EA 1ZD3A 4H35A 3F8SA 1UOPA 2QUAA 5DTJA 3F96A 1SCQA 3FCYA 5HKBA 2VTVA 3V9AA 1XQVA 1ZGCA 5HF6A 4ZV7A 4W63A 4DMFA 1E3QA 1BRTA 4E11A 2WUFA 4BB0A 4GECA 2XB6A 4G4IA 3C45A 4CIAA 2XQKA 3ANSA 2WKWA 1EVQA 4WY5A 5JZSA 4OB8A 1RYYA 3OTQA 4B84A 1H2ZA 4WY8A 2B9VA 3M82A 2CMFA 1CUIA 2HU5A 1H2XA 3WL8A 3KWJA 1CUYA 2CUTA 3P2MA 4LHEA 3T4UA 3O4GA 5AM1A 2ACKA 1P0IA 3DCNA 4A23A 2WU3A 4BAGA 1XRLA 4Y2PA 3N0TA 1CLEA 1EXWA 1DWPA 2FX5A 1EHYA 3FCXA 5C81A 4U2BA 4Y2TA 3UUFA 1ACLA 5DLPA 1VA4A 1QIIA 2HA2A 3KDAA 4GBGA 1WM1A 4FMPA 2WIFA 2HHAA 2XUJA 3ICVA 1B6GA 3EQ9A 2WFZA 4JH0A 4OYLA 5CT4A 1UK9A 4Y2SA 4C6HA 5AHXA 2HFKA 4Y2YA 1YA8A 3WA6A 3ESAA 4KRYA 5JALA 2RIPA 1LNSA 5CW2A 1QLWA 5FPPA 2XQFA 7YASA 1X2EA 1K63A 4MWSA 1GPLA 3IUMA 5ALEA 4Q05A 3G0IA 5AICA 5C8VA 2OCGA 1MO2A 4OB6A 2WIDA 3K9BA 3FYUA 1Q0RA 1TCAA 2R11A 4X6UA 1R50A 5AH0A 1VXRA 1K4YA 2Z3WA 1CQZA 5AI9A 1WB6A 2EDAA 3I1IA 2IX9A 1QONA 5JIBA 1R9NA 3STVA 3FYTA 2XQGA 3I1YA 5KBYA 3STUA 2YH2A 1I6WA 3ED1A 4KE6A 2WJ6A 1YAHA 4EY4A 3CN9A 1G5FA 4QLOA 4YK7A 4G4JA 3HRHA 3CCBA 2C5GA 1DQYA 2DHEA 3C6ZA 1LBSA 2HRQA 5E4YA 3B3QA 5IVIA 2X8BA 5AKYA 3QPDA 1LGYA 3OOSA 4JNCA 1AX9A 4HTAA 1WPXA 1B41A 4W9RA 5DYYA 1VZ2A 5K5EA 1UKBA 4OU5A 4PNZA 1JU3A 2OCLA 3H1AA 3QPAA 4CCWA 4N5HX 4U2CA 1QZ3A 3I6YA 3QMMA 3WJ2A 4G9GA 4AO7A 3H2JA 1QFSA 3LP5A 4XX1A 4EUSA 3QVMA 2UZ0A 5AOBA 4RPCA 3WLAA 2DHCA 5JAOA 4DNFA 1CQWA 1CUZA 2VT7A 4I3FA 4QZVA 3BF7A 2WJ4A 1H2YA 4HRXA 5K3DA 3FVTA 2QKYA 4IH4A 1ETHA 1BE0A 1MX1A 3VJLA 1VE6A 2G63A 3K2IA 3F67A 2XUGA 5HK8A 2Y2VA 4MEBA 4J3JA 3DEAA 3AINA 1DINA 2OAGA 4OUKX 1GGVA 1UWCA 4G9EA 4XJVA 4UBOA 4X7BA 3B5EA 1BN6A 2XQIA 2WHQA 1MTZA 1AZWA 3D2AA 5AM2A 5CT9A 1F0NA 1CIJA 2PSFA 3BDVA 2H9YA 4J0DA 5HCUA 1F0PA 2Y6UA 4X85A 4G8DA 3R0VA 1PJAA 4DNQA 5A2GA 5JASA 1R1DA 4EY6A 1TRHA 3AFIA 2V98A 4MWTA 3ZLTA 4AN1A 3QZUA 1MNQA 1UXOA 3E1GA 3A2NA 4PF1A 2WIKA 4LIPD 2C58A 3D2CA 4Y2JA 5EHXA 3D2BA 2HRRA 3G0DA 4KRXA 3ZPXA 4BVKA 2PSJA 3IBTA 1BCRA 1DU4A 1QGED 1CUJA 2XMBA 1XZDA 3PUHA 2BCEA 1U2EA 3FLAA 4C01A 1Q83A 2WTMA 4H7KA 2WHPA 5HF9A 1ZI6A 4J03A 2QM0A 3OM8A 4BZZA 1E8MA 2VF2A 1F8UA 3HC7A 1EINA 4H7DA 2WJ3A 4M0FA 2I3DA 1CUUA 1DQZA 1HLGA 5LZ2A 2VJCA 4M0EA 1FJ2A 3WKDA 4BVLA 4J0IA 4LXHA 2JGFA 5LZ9A 5AIBA 3H0CA 3QITA 2B4KA 3DLTA 2XLCA 4UUQA 5ALPA 2W6CX 1EDDA 5AI8A 3W06A 2ORYA 1IUPA 1JU4A 1USWA 3HABA 4XIIA 4FLEA 3EQ8A 2JGKA 3NGMA 3PDCA 3FLBA 5AKHA 5FV4A 5ALGA 4X91A 4L0CA 3AILA 4OU4A 2DCMA 5D3ZA 5AM0A 4FBLA 4L72A 4WJLA 2B61A 4FBMA 4H77A 3JW8A 5ALXA 5A7FA 4HXEB 3KOOA 3I6MA 2PM8A 1SCKA 2ZSHA 4BZWA 4UHFA 1ODTC 2WUEA 5AKGA 1QIFA 3DS8A 3WK7A 5LZ5A 2ZJFA 4X71A 5LIPA 5A62A 3I2IA 3DKRA 2O2HA 4MXDA 3ZLUA 1FSSA 4ZXFA 4RE5A 4WDQA 1N5RA 4PV7A 5AKKA 2PUJA 1QIDA 1XQXA 1VLQA 5C7YA 3H2KA 4OD0A 4Y2UA 1UFOA 3B12A 1AURA 1ZI8A 2OQVA 4MYDA 2W22A 3QPCA 1UOQA 5FDFA 1UK6A 5HKAA 1QTIA 1VZ3A 1XKTA 2Y2UA 4AN0A 3UMJA 1YA4A 5LZ7A 2HA6A 4CG1A 2OG1A 1QTRA 4QWMA 2X76A 1CFJA 4GXNA 3WMRA 3AJAA 2WIJA 4DSZA 2BKLA 5K3FA 1A7UA 3MGAA 5DNWA 5HFAA 3ZLVA 4CI9A 2B20A 4AZ0A 6YASA 1EK1A 4OPMA 3BF8A 4WFIA 2DQYA 5ALFA 4GEGA 4FLFA 2JF0A 2WG1A 3CXUA 1X70A 3G9TA 1WB5A 3RLIA 1MJ5A 1GQSA 3R41A 4KAAA 4AMYA 1S8OA 1WOMA 2V96A 4EA6A 4FNGA 1LPBB 3BDIA 3WL5A 5DYWA 4X3CA 1IVYA 3QMWA 4FWBA 4A5SA 1G42A 4B80A 4Y2VA 2YASA 4DLNA 4K5QA 1ZJ4A 3WWDA 2AJDA 5JATA 1GKKA 1C7JA 2HADA 4INZA 5FP0A 4C89A 1CVLA 3DYIA 4LXIA 4TVKA 2BUCA 3WK5A 3STXA 2VSQA 4P9NA 4N5IX 2WHRA 1OILA 1CUEA 1G66A 4FLMA 4X00A 4LYDA 3TEJA 3C70A 1FFEA 1L7AA 5ISMA 1W52X 3F98A 3RK4A 3H17A 5LYYA 3O95A 2DQZA 4S0XA 3STWA 4K6GA 3AIOA 2AXEA 3LIPA 5ALLA 4BAZA 1Y7HA 2BAGA 4DYHA 1VXOA 5AKIA 3PICA 5IVHA 5JD5A 2BUBA 3H2HA 3E3AA 4CCYA 3C8DA 4NS4A 1QJ4A 4K6KA 2WUDA 1MX9A 5EIAA 3AUKA 2PVSA 2WUGA 5D7BA 4J0GA 3CN7A 2PSHA 5EHQA 4J0HA 3IURA 5FXMA 4HXGA 4UHCA 2WU4A 4KE9A 1CUGA 4E46A 1PV1A 1CUAA 3V1NA 2P8SA 3LCRA 4QEKA 3ESBA 5I7UA 2OGSA 1ZIYA 5C8XA 1L7QA 4BRSA 4LYEA 1N8SA 3HACA 5ALVA 3SWWA 2O7VA 2QUBA 4PQEA 1BROA 3FYUC 1BN7A 3Q8WA 4ROTA 1CEXA 5FOQA 1M33A 2XUIA 2CB9A 3QM1A 2ES4A 2XUFA 3PF9A 3R3UA 2Z3ZA 1JJBA 5IKXA 3WYNA 4FTWA 5AP9A 3H18A 5AM4A 3OG9A 1SOMA 4ZGBA 1QE3A 4DNPA 2HU7A 2X5XA 3DL7A 4HVTA 2AJLI 2O2IA 2V9ZA 5AK6A 2Z5GA 3GUUA 5HK9A 2QS9A 2QVBA 4QNNA 5HFNA 1UT6A 4BP9A 5EHZA 3D3NA 2ZYRA 4RNCA 1SCIA 2GYUA 3WWOA 4KACA 2GYVA 3W04A 1A88A 3N2ZB 4RE6A 4EY7A 3RM3A 1DX4A 1HBJA 3TGLA 1UKAA 2Y1KA 5JD6A 1W6RA 3DKKA 3PI6A 2RONA 4U2DA 5D3KA 4OB7A 4ZRDA 5CH3A 3I28A 2PSEA 3H04A 3V1MA 1ORVA 1ORWA 2XMDA 3FYUB 4M0MA 2XMRA 4GHWA 5A7GA 2Z8ZA 2WG2A 2HA7A 5EIEA 5DTIA 2WILA 3EIOA 4ZV9A 3FSGA 3MUNA 1QO9A 2OCKA 1RWQA 4PSDA 4BAUA 2G4LA 4D9JA 1ZGBA 3UUEA 3ANTA 1CUHA 3MUOA 3WL7A 4DSAA 3GA7A 4KAFA 4BYMA 4C4YA 1EDEA 4G1FA 5E4TA 2PBLA 5AK4A 3G0BA 3ZWQA 3SX4A 3IVMA 1XFDA 5CT8A 2D5LA 1A8QA 5BV7A 5F4ZA 1F6WA 4XVCA 3G7NA 5ESRA 4Q1VA 1LZKA 4C4ZA 2V97A 4C87A 3WZMA 5AJHA 4B6GA 1CUXA 1ODCA 5ALTA 3WWCA 4WFKA 4FOLA 3PFCA 3KSRA 2PL5A 5AOCA 3HI4A 1DT5A 5AKJA 1NU8A 1XZJA 3G9XA 3C43A 4Q3KA 4B0PA 5FUMA 2WQZA 5E2IA 5K3BA 3D59A 1GPNA 3DYVA 3KD2A 3ICWA 1LBTA 1TQHA 3PF8A 1MT3A 2WSLA 3WKEA 3WKAA 4Q3LA 1J07A 4J7AA 2XI4A 4H7JA 2H1IA 5ALOA 2JGEA 4W1SA 1LPSA 2G5TA 3IDAA 1QIHA 3DNMA 4MJ3A 5ALZA 2DFPA 4Y2XA 5BOVA 1TAHA 3D7RA 3IIIA 4C88A 4QDZA 3WKCA 1EI9A 3WIBA 4F21A 1HQDA 2XE4A 1E89A 3LIIA 4CFSA 3U0VA 1XZFA 5ALSA 3QBJA 3R3WA 4TPKA 5BWCA 3NWOA 4DTCA 4Y9SA 4AO8A 1LPNA 3DL4A 1MN6A 2JGMA 1GT6A 3W9BA 2XUPA 1VOTA 2WFLA 4LKOA 1W1IA 2CZQA 4X6XA 4K6HA 1Y37A 3IB3A 4MQLA 1OXMA 5ALRA 4BE4A 2RHTA 5K3CA 3WL6A 1DWQA 3RARA 5D6OA 5AOAA 1E8DA 1AGYA 4QWWA 1YS1X 4ZREA 2FUKA 4JEIA 4YPVA 2O2GA 1NX9A 3YASA 2XMZA 2ZJ6A 2C7BA 1UOOA 4IH9A 3WZLA 5JAUA 4Q3OA 2WHPB 2VJBA 1BS9A 5ALNA 1E66A 3WKBA 1UKCA 5C8ZA 2HIHA 3H2GA 1J06A 1PFQA 5T4FA 4BC0A 5CMLA 1XRPA 1UZAA 4RGYA 4XWGA 4L3WA 2C0PA 1CUWA 3VKFA 4L9AA 2PPLA 4B9AA 5ALKA 4UPDA 1N1MA 2J3QA 5AM5A 2DSNA 3G9ZA 4TGLA 5HQ3A 1XQYA 4CG2A 5EI5A 2JEYA 4X95A 1BCSA 2EDCA 3CCCA 5DWDA 1XZAA 3NUZA 4EB0A 3AZQA 5JAPA 2AJCA 5AI0A 4UBJA 4UHDA 3F9CA 4OYYA 4CIBA 2IITA 5JARA 5CXXA 3O0DA 4UHHA 2PSDA 4P08A 5T4BA 3FWHA 4UBIA 1IUOA 2GBGA 3DDUA 3D4LA 1EH5A 4G5XA 4IO0A 4H0CA 2LIPA 4UBMA 1U65A 2WFMA 2ZYIA 3OURA 5AKXA 2JEZA 4GW3A 4X90A 4FHZA 3JWEA 3EQ7A 4AXBA 3MVEA 5ALDA 3FNBA 1XKLA 2AJ8A 3WK6A 4G4GA 2YXPX 1XZKA 5FRDA 1ZIXA 1JI3A 1H22A 2VAVA 5AIAA 5HQ3B 1QIGA 3TRDA 4AB1A 5HZGA 1HDEA 1EB9A 2BFNA 4X92A 4UHBA 4UFNA 2XMGA 1R3DA 3DOIA 2HA0A 1HL7A 3G8YA 3V1KA 3ESCA 3L1HA 4U2GA 3S2ZA 3PFBA 4N8DA 2QOEA 4O08A 4YX9A 5CT5A 1P0MA 4W1PA 2HL6A 3BIWA 4EBBA 5E4JA 1DT3A 1SC9A 3AZOA 1XROA 1ZD2P 3QYJA 2OAEA 5DJ5A 5IVDA 1EDBA 1CV2A 1ZICA 3W05A 2XLBA 2ZJ7A 4G8BA 1R9MA 4HXFB 1QIKA 5EFZA 3V48A 3G0GA 1AC5A 4DM7A 4N8EA 1R88A 5CURA 5K3FB 5I8PA 2C0QA 5JZBA 1MNAA 4E14A 4C4XA 4UHEA 5AK5A 1H23A 1FFAA 4P92A 1TCBA 3Q0TA 4OCZA 2BGRA 3M3DA 3LLCA 2J4FA 2O7RA 2NW6A 1RP1A 2PU7A 3HJUA 4I4CA 3G0CA 1EX9A 1GKLA 1QFMA 2HU8A 3HLKA 1XRQA 5CTAA 3DOHA 4YASA 1DX6A 3C5WP 3C8HA 1XZLA 2PX6A 5ALYA 1MX5A 2VT6A 1CRLA 4U2EA 4BRZA 1HKHA 4KE8A 4A16A 2I3ZA 4Q34A 4MQMA 3X3HA 2D0DA 5AKLA 1WPRA 2WIGA 4UFPA 2CEKA 3C5VA 1FFDA 4E15A 2BGNA 2ONCA 3VXKA 2G5PA 4IH1A 3WA7A 4H7HA 4GWLA 4UBNA 1O6FA 4X93A 1T4MA 5ALUA 2Z8XA 4KEAA 3VVMA 4DGQA 3HXKA 2HDWA 4ARAA 3VVLA 1J2EA 2GYWA 4WDRA 3C6XA 3O4HA 1CUBA 3VJMA 1Z68A 1ZOIA 2XUHA 2XMSA 2VJDA 5JAHA 1JMYA 4GLBA 1XZIA 2VAXA 3WK8A 1LLFA 4BVJA 4J0KA 4Y2RA 3IUQA 1LPAB 1VJ5A 2QMQA 1BU8A 3SC2A 2K2QB 2XUAA 1IMJA 5DYTA 4F0JA 4FNMA 4DMCA 1CR6A 2QTBA 1W76A 3OC0A 3WK9A 5ALIA 4CCYB 4UFOA 3ZI7A 1JT2A 2RAUA 2HM7A 3V1LA 3STYA 3G02A 1YSCA 2EEPA 5AI5A 1THTA 4QDXA 1LPMA 4FFVA 5ALMA 4H7FA 4JYPA 2C4HA 2WG0A 3H2IA 2WLSA 2OPHA 1SFRA 5YASA 1XRRA 1XZEA 1XLUA 4AZ3A 1IUNA 4J0CA 4WFJA 2XMCA 4U2FA 4B9EA 5J3JA 4MEAA 2OGZA 3BJRA 3HEAA 3NOXA 5DNUA 3R40A 1LZLA 3FLEA 5AI4A 3M83A 5BWBA 1AKNA 1VE7A 4B7ZA 1C4XA 3O4JA 2GBIA 1XRNA 5JADA 4QDOA 3OPMA 2CJPA 5LKAA 4KE7A 4B0OA 2JBWA 3WK4A 4B82A 3AIKA 5K3AA 4W1RA 4EY5A 2GBFA 5A7HA 1C7IA 2OCIA 5SYNA 3HSSA 4AQDA 3R3ZA 1XZBA 3GFFA 4HS9A 5KWJA 5FKJA 5KWIA 5SYMA 4V2IA 5A6VA 4H7EA 1K5PA 4DIUA 2R8BA 3L1JA 2WM2A 2RHWA 4ITVA 5EIHA 3EBLA 2OXEA 1XZCA 4IHAA 3W2TA 2ECFA 3A2LA 4GI1A 3IUJA 4BTLA 1U8EA 5ALWA 2XMQA 5ALQA 4QLAA 2QXTA 2HFJA 1EA5A 1EVEA 3I2FA 5JZ9A 4AX4A 5CRIA 3R3VA 3TJMA 2I78A 4K2AA 1JFRA 4AMZA 1DWOA 1JMKC 4FFWA 3O9VA 3IA2A 1XZHA 2CBGA 4ZI5A 1XZGA 5JYCA 4CG3A 3BJMA 2E3JA 1XLVA 1VA5A 1GQRA 4EY8A 2OLEA 2HA4A 2HA3A 2ZYSA 3DJYA 1TCCA 3W9UA 1Q84A 1XRMA 3PUIA 2J4CA 3WQHA 4BE9A 3H19A 2XUOA 1W75A 2IIVA 1ZD5A 1YS2X 2XUQA 2ACEA 4ARBA 1H2WA 2DR0A 1ZJ5A 1AMNA 1FFBA 3ILSA 1QIEA 3AZPA 3K6KA 4B81A 3S8YA 1YASA 3KXPA 4HZGA 1TIBA 2VQ6A 3GROA 4ETWA 2XQJA 1JKMA 4QA9A 1LPOA 3LS2A 1KEZA 1WHSA 3I2JA 4PO3X 1ZI9A 4Y7DA 4BATA 3C6BA 5EHNA 3WWEA 1UK7A 4DMHA 1WB4A 3BWXA 3I6ZA 1EB8A 4G8CA 2ROQA 4NVRA 4I19A 2PU5A 3QH4A 3FOBA 2QZPA 3HZOA 2QXUA 2H7CA 5IH7A 4FKBA 4NMWA
chains in the Genus database with same CATH superfamily
2P41A 4W9NC 1GYPA 2C5HA 3Q3JB 4TS4A 2GRAA 1NYTA 4WCDA 1LBQA 2HLDD 4ZWNA 3ZCQA 2J0UA 1A27A 4MR7A 1QYVA 3FZNA 3B53X 2Q41A 4FR0A 1WUKS 2QHXA 2R8ZA 4HNAB 3QA9A 3DZIA 4BN0A 4YMTA 2C3YA 1OV4A 3WB0A 2H1LA 2I9KA 2FJ0A 1DBRA 2WJYA 3IHTA 4MVJG 3TBFA 2IOYA 1M7BA 3U6KA 1Z7GA 1M0EA 3LX4A 3OBBA 2QRUA 3QF7A 1UK8A 3DQQA 4B76A 4C9BA 1F2DA 3R8FA 1QSGA 4KXLA 4DR7B 3IIMA 1VJCA 4YJ2F 4UTPA 3WRVA 4UDNA 2B8EA 4ZYZA 3PXCX 4Y6PA 1ITZA 2ZR7A 2ZE8A 3S2GA 3O9MA 5KOIA 5EGNA 1PNTA 1PKXA 2CD7A 2PUBA 3L7NA 3U7QA 1VRWA 3PXBA 4EGQA 2E85A 1Y3BE 2UVDA 3BUSA 4KVFA 3ZDQA 1P91A 3T9CA 1RQPA 1EJ6A 1XMVA 2WTNA 4O2BF 4OLFA 4ER3A 2X6TA 2MSKA 5G1PA 2VNKA 5BN4B 1PVDA 1W0KA 2Q45A 1AGPA 1UZMA 3BK2A 5FB3A 3VI3B 4XLTA 2XZTA 2BEWB 3H05A 4G2NA 1CE8B 4YN3A 3RYIB 5KIAA 3MSCA 2H57A 3R0ZA 4QTXA 4TS1A 3VDXA 1ULUA 2WVJA 1RJDA 4M1ZA 2NG1A 1Q1AA 5HF5A 3B52X 2ZVJA 4YB8A 4R6WA 3DKIA 1P4SA 4A10A 4LV5B 2PS0A 5FWXB 4F93B 4PGAA 4X1KB 3LPAA 1YRLA 4BP8A 3SVZA 5CAEA 3T7EA 5SV2A 2FPOA 1EESA 1PUJA 3WTBA 1IM5A 2VNIA 3L3BA 4L76A 4WBNF 5BORA 1CUCA 1S6YA 3LKVA 2VATA 1DL5A 1RR6A 3OQHA 4ITRC 4O2LA 2O7NA 1Q6YA 1R18A 2QJTA 2ZYDA 4PW0A 4KRFA 3R3XA 3BCUA 3CSDA 4ASUD 4M8NE 5KWVA 3WMGA 3KFXA 3T5CA 2CNWD 1KL7A 1HSZA 1ZD4A 4X62B 3FCAA 3THWB 3DZKA 4BNGA 3SQWA 4GYYA 3AOGA 4RA9B 3IR5A 1B6TA 2JI9A 1G7CA 4PSAA 4XFJA 1SC3A 2WHEA 3N2GA 3PNVA 4JQZA 4EEZA 4RL4A 2GH1A 3DZGA 5F51A 1NI4A 3JX9A 1SQSA 1QRUA 3RB8A 3K9QO 3AJ8A 2VJQA 3MMNA 1V26A 5BXYA 2VUTA 3UBMA 1KE1A 5SYAA 3RKSA 1QIMA 3PE6A 4WACA 4WXYB 5KYTA 3QYFA 3PRKE 4HC4A 3DAHA 3URMA 4YQEA 2QTRA 2DWPA 3O2QB 4NIMA 1M5TA 4H31A 3WJAA 5A4MS 1J8YF 1OC4A 4GDMA 4S12A 4DUGD 1SBZA 3GD7A 1LS6A 1U1DA 1GD1O 4QULA 2XOXA 2IVZA 1T3LA 3WV5A 3O91A 2GB4A 1MLDA 4B85A 1DKQA 1DMSA 1VYHA 4LFCB 1JSCA 2Y4OA 1KIFA 2FQXA 3IO5A 3PX3A 2DLNA 2FFBA 1IC6A 4MKFA 4JIGA 2OQIA 1JRLA 1E79D 1FSZA 2PT5A 2V7GA 1OASA 2YRWA 4DIEA 1KYQA 1R66A 4P4SB 3E0XA 5E8RA 4A0QA 4IKPA 1U2TA 2J9YB 5DM4A 3TLAA 4X6YA 3H9GA 2OCAA 3S1SA 1B23P 5BN5A 1TB4A 2P5TB 3D6TB 1MEOA 1U5AA 1CKEA 3ZWKA 1YKFA 1TJNA 2RKBA 2VWHA 2Q49A 3QLJA 4V0RA 4D97A 3GP3A 4NFSA 2D59A 5LLSA 3H4VA 2CMKA 4N48A 5EIWA 5LYJF 2BN4A 4ZTZB 1IAVA 2W8ZA 1G8AA 3K92A 3MWDB 5REQB 1ZLYA 3I4FA 1SKBA 2I67A 1CVRA 1KI6A 1YCDA 1WOYA 2D7CA 5TGDA 3HHEA 3IJ5A 1H94A 4OKNA 2ENUA 4F60A 1F3LA 4E5NA 3PYMA 4W5RA 5BVHA 1GUBA 5K0ZA 1P61B 1P2SA 2QJRA 3GUYA 2IF0A 2GSDA 2K87A 2P3QA 5FV7A 5H3HA 4PN3A 4G1BA 4YAWA 2VJLA 4L5IA 2QU7A 4WCVA 2OAP1 4N9WA 3I9JA 4NBWA 1HPLA 1YR2A 4LS3A 3KC2A 4DLTA 4PR0A 1DEOA 3BK1A 1D6SA 4LKRA 2ZETA 1Z12A 5F77A 1KDVA 5HR5A 1EFCA 1EUCB 3LP8A 1Y63A 3E82A 3LOPA 1M1NB 1T5LA 2VXYA 5DBOA 3SSAA 4ALIA 3DVAA 1M1YA 4P4NA 5KWSA 3BGVA 3FROA 1RXYA 3LUAA 2G06A 4CM9A 1TU0A 2FW1A 2OPBA 4FMCF 1SXHA 2BZSA 1DO2A 3LDFA 3PK0A 4D9MA 2ZTSA 4XUCA 4PNPA 1CPYA 1LKZA 3L8MA 4TL7A 4LGCA 1M34A 2GARA 1MH9A 4NFYA 1L7DA 1CY2A 1H4VB 1P8AA 2MOKA 2VTEA 2XT0A 4P3YA 1FUIA 5DNVA 3ZKWA 1AQLA 1B8OA 1N25A 1NM5C 5LJLA 2MWMA 3HDQA 2GRJA 2ZSIA 1Z5OA 4MPDA 1XL1A 3ONEA 1MO4A 2ZAYA 1OZAA 4LRUA 1G21E 3CRQA 2RJ3A 3GU3A 3UICA 2IFTA 3AEKB 2UKDA 1YB7A 5HS6A 1FTNA 4RIIA 4ZVNA 3BE4A 3A06A 4D0SA 4RAOA 5A4JA 1EVIA 4CI0B 3WIOA 1TDJA 2A9PA 4JLDA 3H3XA 5JE8A 3PDHA 1QOZA 1TM2A 3H3JA 2JIDA 1EK2A 3FF4A 2Q6LA 2B7CA 4DIOA 4LJ4A 4OF4A 1KYIA 3MF4A 1G4HA 3I37X 3MUFA 1SD2A 4ZO4A 4RDXA 4FFBA 2R44A 2YY7A 3O8BA 3U3MA 4HR7A 3E4DA 1XTUA 4LCBA 4WERA 1SMKA 1R4ZA 3K73O 1RAIA 1NQUA 4ZO8A 3V7YA 1KAOA 2YWDA 5H83A 2VEOA 1FLNA 1BX0A 1OX4A 1N2SA 1M8GA 3KZVA 1VRCA 4QUAA 1SKYE 2HH9A 2KBEA 2W58A 1TFUA 3BWDD 3FSGD 3GVPA 4DJDC 4PY2A 4AYTA 4Y3UA 1ZD1A 3RVOA 2G9ZA 4DUPA 3E9NA 4KPUA 2QYHA 5IXSA 3LQKA 5TARA 3PA8A 2AI2A 5C1IA 4BUJA 3FDZA 4CRWB 2JZOA 3DEFA 3NOQA 2GXAA 5F23A 3AERB 3CVYA 1JLMA 2CHEA 3I76A 1HDRA 3ZBQA 1XCPA 5KVCA 4A6PA 1U1CA 3GH1A 5KOJB 4H6VA 1GNTA 1EHCA 2HEGA 1EE1A 2ALJA 4JEHA 4XGKA 4KR3A 3VKVA 3ZCRA 1X7XB 5KHOC 1XTKA 3PKIA 4DDVA 3TLGB 3RBZA 1I10A 3ZI0A 1XD2A 3M4NA 1XGKA 3D6UA 4IVQA 1ODIA 1N5MA 2GAOA 4BBZA 4IHJB 3CONA 1SK8A 3ZK7A 5BN1A 4J0JA 2J0SA 3LDHA 1CUVA 5FLEX 4DF3A 1PL6A 1NC3A 4ZOLF 4F9GA 5T4HA 3EMVA 3MM4A 2GF9A 9GPBA 2HBZA 5IDWA 3B6ZA 4EHDA 4BU0A 3DPSA 5H16A 2C2BA 1XYGA 3FWKA 4YLGA 3IBYA 4KR0A 4C0XA 3LFUA 4WOCA 3DMHA 2HCFA 2VZLA 2GZRA 2QMZA 4I6EA 1TUGA 2GHQA 3H7AA 2AKAB 4BO8A 5I4CA 1BA3A 5CH5A 1AZTA 2JDID 4NECA 2E89A 1DO0A 2HO5A 3EE6A 4AJJA 5I9IA 1U8ZA 2VHJA 4N3BA 1J97A 2VH2A 4KQ9A 1BD3A 5ENDA 1ZK2A 4OGLA 2HF8A 1XNJA 5HMLA 1FYDA 2EAUA 4HFJA 3B3FA 4ZMBA 2TSYB 2WHYA 1ZCZA 1Z38A 3BXEA 3SCZA 3VOBA 1ZVMA 2JGIA 1KU0A 2VYFA 2YMPA 3L0DA 1XL0A 4AO6A 4CTJA 2JJYA 3SMVA 3H5NA 3MTJA 3JWGA 4L4YA 1ZZGA 2BZGA 2VPQA 1UEIA 3MT0A 3JQEA 3ETDA 1YKSA 1JSXA 2QUAA 3QUBA 3ZJ5A 2XRZA 3CGWA 3TSAA 4BMOB 3O8LA 4X0EA 1U3DA 1SCQA 1E1QD 3G13A 3DMRA 4JUBA 4OLJA 5TF4A 1U0NA 1W5SA 3MCTA 4A4DA 2UYGA 3EVEA 3IESA 1RWWA 1QRTA 1XQVA 1A9PA 1AN0A 2ECQA 2JFXA 1ZGCA 3N2KA 2DKNA 3QXCA 4RQUA 4NZPA 2GUWA 4RQTA 2R751 2X4IA 2DEUA 1IN5A 1ZMTA 3B70A 2WK1A 2ZQYA 2R68A 1DC5A 1RU3A 1XVUA 4GF5A 4YAJA 1OXVA 1EFRA 1VI6A 2ID7A 4KODA 1HEIA 2W83A 3KQMA 3KKEA 4OP1A 1FP1D 4E11A 2CYBA 3D6AA 3MYRA 2PUGA 1OWMA 1TM1E 4LGYA 3MTBA 4IOJA 2NVOA 2EJTA 2HRDA 1U7PA 3C45A 3OPYI 1ZQ9A 4TLEA 1E99A 4WHMA 4YTEA 3UZUA 4EQ6B 2ZRPA 4NJEA 1E7WA 4EB3A 3IPXA 4FPXA 2ZZNA 2O8BA 4BLPA 2IPLA 1KAQA 1ZMOA 4BLOA 4WBNB 4ZGWA 3L7IA 4S24A 2P68A 1EVQA 2CWDA 3KB8A 4MR9B 1GSOA 1RYYA 2JJ2D 3EWNA 3KR2A 4WY5A 1H2ZA 2QNRA 4YJ3F 2MCFA 2OT3B 1NT2A 3T3EA 1FMTA 2C29D 2CMFA 1JJAA 4KGDA 1MP0A 4A8TA 1IYZA 2JHFA 2JI6A 2YZMA 3EH2A 3LI2A 3PC8C 4F4IA 1ANKA 3GLFB 1PUXA 3A04A 1H2XA 3H2SA 4UASA 5LB4A 3P2MA 2YQZA 4LHEA 4TRJA 4MUBA 2C92A 2ACKA 1FVHA 1UBRS 3LUDA 2ZZMA 1WXHA 1K97A 4HG2A 2B3TA 2P9YA 5C7IO 4RMJA 3A1CA 4OQMA 4A23A 3AUFA 1A5AB 1H42A 1N3LA 1FXWA 2J5RA 1UODA 2YJ4A 1TZJA 2QGFA 3OCUA 16PKA 4B73A 1NJ8A 1XRLA 3ZWCA 1HE8B 3K6SB 3F78A 1EU1A 3AESA 1ZNXA 3TKAA 3QU7A 5IUJC 1QOQB 1CLEA 1MC5A 2JCXA 3FUTA 5DTQA 4B09A 4GX5A 1E69A 1EXWA 3HN6A 4N54A 4M54A 3SR3A 4LJLA 1AF4A 4LYAA 3ZX5A 4LBZA 3E3MA 2VSYA 1E7MA 4R40A 3A6HA 3VDQA 5COBA 4YAOA 1O58A 1RBMA 2GJAA 5EJ6A 2ZAGA 3L02A 3OQPA 2EKDA 3GLIA 1R7RA 4G1EB 2XE7A 3KDAA 1DAKA 1I2CA 1SBTA 2FSFA 3OIGA 4C7VA 2JD2A 2GNPA 4RM2A 2G0NA 2ZE5A 1P5FA 2I7VA 3HCEA 3KSMA 2XUJA 3ICVA 3WLRA 4DEYA 5J40A 1JHXA 1M6WA 5G0WA 4MW2A 4J90A 3UCEA 1W0KD 4KPFC 3E0QA 4LJ7A 2AOWA 3W4KA 2NXEA 3K0HA 3K09A 4CMJA 2CXTA 1GNQA 2X0IA 3GLHA 2JLQA 3VSBA 3KPJA 3GWGA 1T8WA 3OT1A 4PEVA 1GAXA 2AMLA 2NTVA 4PN7A 4ZO7A 1NJ2A 3WA6A 3ESAA 3R7SA 4OI0A 4OTZA 4EX6A 1KC1A 3CB4A 3N6RA 1HNZB 5JALA 2RIPA 3FJ1A 4RORA 3INGA 3L06A 3SR0A 1WWKA 4AXXA 4Z9BA 5SZIA 1NSFA 1ZGAA 3JRWA 3ZWMA 1NZJA 3OQJA 1Y4ZA 4FD3A 3W4IA 4N39A 2VPXA 1X2EA 3FZQA 3L4SO 5T64A 5FTMA 2NWQA 1CYEA 1VJRA 4OIFA 4FQ5A 1AKEA 1GPLA 5LD2B 1O5TA 3L6RA 1U2PA 1F8GA 4RESA 2X0NA 5ALEA 4J1QA 4DR3B 3W5JA 1EFKA 4TMWA 4Q05A 5AICA 2O2JA 3V6LA 3KZOA 1KBZA 1P9OA 4I3GA 4KXUA 1CEYA 3DOFA 4RK6A 1OGYA 1LI5A 4OB6A 1UJNA 1XT6A 5AHKA 3RC2A 4HPXB 1T36A 4NEHB 5D7NA 5BQXA 4ZARA 1L4KA 4RIGA 3LW7A 4QUEA 4WPGA 5AJTA 2J9XB 1Z4PX 1OZFA 4Q7KA 3EXEB 1CW2B 1RLOA 3ZS9A 1P75A 4XD2A 4CIVA 5L4NA 2R4UA 1NG9A 4JOBA 4FMCB 4P98A 1E58A 1VHDA 2VI5A 4NH0A 4C0QC 5LU9A 4KN6A 4RTMA 3F5FA 1BE6A 3HP1A 5D85A 5TY0A 1QP4A 4KR7A 2V7QA 1CETA 2AFHB 5JASA 2B1JA 2Q2OA 2ZSJA 3EGVA 4GPIB 2ZYWX 3DV0A 2G82A 4DL9A 3FYTA 3IPRA 1HE3A 4G86A 2VLBA 2A1TS 4CIDA 2P9JA 1XAIA 1XPRA 3ED1A 4BIIA 1ZJ6A 2O8VA 2JGRA 2WJ6A 2PZEA 2I7XA 2VWPA 3O47A 5JYEA 3BMCB 2WD9A 1YAHA 1UDRA 2RGRA 3KLBA 4OGWA 7REQA 4YK7A 1C9KA 1TC1A 3OA2A 3E6AA 1M0TA 4FX2A 2Q3DA 4RTJA 1CU1A 1DQYA 1QJCA 2DHEA 1MHTA 4CLOB 1XNQB 3C6ZA 3Q9LA 1IBCA 2HRQA 3N3BC 3QF4A 5KCMA 1QP0A 1VJ1A 5I47A 2DYKA 3MBOA 3V33A 1ZJZA 5DP1A 3C97A 4UUAA 1PL0A 4JNCA 4O4JB 2Z08A 1B41A 3MMXA 3WZ2A 4LZZA 3ZJTA 1VZ2A 2NSLA 2GLTA 3W5DA 1I33A 2BI7A 3ONWA 4J7XA 4ZZ0A 1IJEA 2C1EA 2ZWPA 1JU3A 4DREA 1GG9A 5TB5A 3G0HA 1DUVG 2G6BA 1TLFA 2SCUB 2PX2A 2V6JA 4NBRA 2I2CA 3H1AA 2RGXA 4RS3A 1E62A 1NL3A 1PYDA 1TUBA 4JAVC 4OMCA 4Y1FA 4N5HX 3VAZA 1RWPA 2A4MA 2EP8A 4D3SA 4EATA 3TSWA 9MHTA 4RY0A 1F9EA 1HYEA 2H4FA 2Q07A 4PVDA 3WJ2A 1JILA 3QUAA 2VFAA 5H0IA 4B3BA 4ZEOA 4Z54A 2ODNA 4AO7A 2WYWA 1JEAA 1H9BA 1UKYA 3WB9A 4MVCA 2NADA 4WZZA 2YHIA 5CYFA 4AJKA 4E2YA 3TXAA 1WXFA 1SNYA 1TMGE 2HLPA 1RIFA 2O3RA 1EFHA 3T3DA 5HNKA 1BKYA 2C59A 1KYYA 4CNBA 4RY8A 1T4CB 2BCJQ 4HADA 2JCYA 2XCQA 4QHYA 2O54A 3GCGA 1A5TA 2Z3VA 1IWOA 1GTVA 1P45A 2Z1DA 3ICOA 4H16A 1N0VC 4N7RA 3U39A 3PR2B 2ONYA 4ZOLB 3UAWA 3UA3A 2LV8A 1N6OA 4Z9YA 3BULA 3LYUA 1P19A 3AB3A 3BF7A 1G3MA 1NYLA 1Q0LA 1RWNA 1SOUA 1U8TA 4CM9D 4HRXA 3WBKA 4F1JA 1EWVA 2VDVE 3RS5A 1EDZA 3KYBA 4WLVA 4ETMA 3LUJA 4PHFA 2X9VA 1E2HA 1LVGA 2CFCA 2I54A 1SVUA 3FHCB 4J7UA 3EB9A 4WN9B 3AU8A 3P2JA 2XAUA 4HQRA 3UHPA 3IP7A 4KWIA 2QRPA 2IBMA 3VJLA 1I3OA 1VE6A 3MLBA 4V3BA 3ZIUA 3Q7SA 1JLRA 4JKYA 1ZVVA 1RXEA 2H85A 4YT4A 3T9AA 1M8PA 1NNLA 2F3TA 4I36A 2HC9A 3R3HA 4Q3EA 5BURA 5K20A 4DLXA 1T6YA 4BX3A 1Q1QA 4HGNA 2FB9A 3DEAA 1HRKA 1Y8CA 3AINA 1U0TA 2OAGA 2V5VA 1W1WA 3ONNA 4XJXA 3VUFA 4JJIA 4HD8A 4OUKX 2PX8A 1VIVA 1RNLA 5H5JA 5DN6A 1AKYA 3UHOA 3RHFA 3BCSA 221PA 1T9GS 3QQ5A 3QVVA 2XCTB 1O94A 3ZDCA 2FTKE 3RRYA 1QZZA 2OQRA 2IF2A 2H0QA 4C30A 4GSLA 2Q1TA 3AM4A 3GNQA 4Z0PA 1II8B 3M1AA 1PFYA 3IR6A 2CFTA 5KJCA 2HR1A 4OOEA 1LY1A 1CULC 2IYOA 1C2TA 2MU1A 3OX4A 4XWAA 5CT9A 2P9GA 3VOSA 5ILGA 2IYXA 1G6Q1 2A1UA 2GAAA 2PSFA 2X22A 3LUGA 4NCNA 2H9YA 4PZAA 4B79A 4DPMA 5L4LA 5HCUA 3AI1A 1UFVA 3AT1A 2R8RA 1TE2A 1F0PA 1U0JA 4HB4A 4X85A 1OH8A 2O7SA 3SVLA 3QU9A 2EEZA 4GMXA 3CWZA 3G8BA 3VKWA 4LDQA 1WB9A 1W2HA 1DBWA 2V5AA 2COEA 2VHUA 2GHIA 3UOGA 4DNQA 5ES4B 3ESYA 2NUAA 3HKBA 1RPTA 3D7LA 3F46A 3GA0A 4PC1A 4KLZA 2CXRA 1LI4A 4PCAA 1X8KA 4S35A 4JA2A 5F1KA 4CL8A 3ODPA 1DDOA 1FFWA 3DMNA 4JJ4A 2ZBUA 4NZYA 4U3JA 5IDVA 5LQUA 4KR9A 1ESEA 4YJ3B 4E88A 1FQKA 2GJ9A 3ESRA 4WUVA 1VIAA 2VAPA 3KTOA 3OF2A 1T43A 2O6HA 3WYCA 4AN1A 4BNYA 3DH0A 2UZ3A 3P0FA 1PDOA 3A2NA 3D31A 4II7A 4KXNA 1I5RA 3GLGB 2NU6B 2ONZA 3JQGB 2FR1A 4GE0A 3TL2A 3BWBA 1B73A 2H4ZA 2Q4BA 1SAYA 2QG6A 1B14A 3E5MA 2CNLA 3ETCA 4RYLA 1V47A 3ZNOA 2C58A 3MXTA 4YP7A 2FUEA 3UANA 1U2RA 1XWFA 2E37A 3PVCA 4RSGA 5EHXA 2HRRA 2PR2A 1U7DA 3ZPXA 1U7OA 1HY3A 1PK7A 1UWVA 4CEHA 2OV8A 2E18A 1WTAA 3CC8A 1A4UA 4KCGA 3IBTA 1DU4A 2FZGA 3SQNA 3PVSA 4JMPA 4LHVA 1N77A 1L1RA 1E1RD 4F84A 1W96A 2AEEA 3KG2A 3N74A 3RRNA 1P9RA 4P33A 1Z45A 4YRSA 1R0SA 3ZX4A 5E6SA 5JMTA 1QPBA 5HBGA 1ZSNA 2Q2VA 1ONNA 2P2GA 2AGVA 4DC9A 3QOWA 1OB2A 3T3GA 1KWKA 1TGVA 3G2LA 4Q48A 5AOVA 1MVNA 4FIDA 2PO7A 3W9YA 3PQ3A 4JLKA 3PNSA 3WHIA 4IIJA 5JS2A 1ZN7A 5HF9A 2BMDA 2QM0A 2DVMA 3OM8A 2PRZA 3IRVA 5KHAA 1QNLA 3DUFA 5E1OA 3UMGA 5B3JA 3I1FA 5IU6A 2B8JA 2V3VA 5CLIA 1P18A 3TM4A 5CA0F 1DLJA 1PJSA 1F8UA 4NY1A 1YBHA 4ECAA 3EZLA 4FQ8A 5HRAA 4OHYA 2IS1A 4MA5A 3HJRA 2BGUA 2VDUE 3TJZA 4CBVA 4YIKA 1CZRA 1YULA 5BNTA 2BGGA 1CUUA 2AFIE 2BKUA 2FQ1A 2JFNA 3AO0B 4LHYA 3VYSB 5DCYA 3GIDA 4TKZA 3CS3A 4XB6B 3PHGA 4D4IA 3H11B 2G70A 3TZCA 5E4FA 1Y1SA 2Y0PA 4M0EA 2D4HA 1ZM7A 3K0CC 4FYJA 3EF1A 1M2VA 2Q1WA 1EFRD 3ZWXA 3KL4A 1J39A 2O8FB 4ZYTA 5HW0A 1Z15A 1TVKB 2QVGA 3WLOA 4ZT7A 2P90A 1Z07A 3JQPA 1ID8A 2IOHA 1E6MA 4PIMA 4DQUA 3G49A 2R8OA 3H0CA 5BT9A 2WI8A 3DLTA 4Q01A 2X13A 1Y9ZA 2BWJA 3RTGA 3DZJA 5C51B 1FMFA 5JZMA 2XLCA 1U7TA 3HYTA 1C1HA 2QYSA 5E8JA 1FSGA 1M1ZA 1Q0UA 4GOND 5ADWA 3CU5A 2C2XA 3IRUA 1Z8NA 5IBQA 4E6PA 4AKEA 1NNUA 1QH1A 2INGX 2WF9A 3T5AA 3CSUA 1USWA 2H08A 2WYVA 4BV2A 1JZSA 2BRUC 4X1YA 3NGMA 3BFPA 1RT9A 2JHAA 4NPAA 1W9MA 4NOKA 4XXHA 5FV4A 4EO9A 1CZHA 1RYMA 4KIJA 4DUZB 2JJMA 3KJZA 2L17A 3BVPA 3KELA 4IOMA 4R1TA 5GJVC 3X1YA 5BPHA 1ZBQA 1D7OA 2DCMA 4J0EA 2H1FA 5EKUA 1X1SA 2BTQB 1MX3A 4FE4A 1XQ1A 2HX1A 2Q5OA 4RFSA 5EEHA 1WV0A 2XVYA 1VL8A 2FI1A 1IBLB 1H0SA 1QTQA 3I6IA 4I55A 4K9SA 3X1DA 1M74A 4EMBA 4EYGA 4NCKA 2PQ6A 4NHOA 1Z7EA 1S3GA 3QBVA 4CT4B 1JF8A 4E31A 4AC9A 3R24A 3I6MA 2PWYA 3KKQA 3V42A 1NVWQ 3HNOA 3CNBA 3O7MA 2ZSHA 5GGXA 2ZUFA 4KWCA 5GIOE 1XWIA 3CFYA 1S8AA 4HLNA 4UHFA 3D3EA 4WFQA 2QTTA 2P75A 5IAGA 1ODTC 2O3SA 1JBKA 3Q6MA 3IQDB 1V8ZA 1T1GA 3EY4A 1U3GA 5EQDA 3QKSB 1L5SA 1QHFA 4B3RB 4Q5IA 5AKGA 1QIFA 3DS8A 5FULA 1V9SA 3PFIA 4H27A 3VH2A 3AK4A 4OHVA 1G41A 2XA9A 1AV6A 4EHKA 1G5PA 4L6CA 4BMZA 5FI1B 3LBHA 4B2YA 3I2IA 1J21A 1P8JA 1SBCA 3MWJA 4RPHA 4B3IA 1B15A 1X19A 4CNQA 1OXBB 4O63O 4MIKA 1CEEA 2NYUA 1OWNA 2H1HA 4BO0A 4ZO9A 1BIFA 1OTYA 2VYVD 5AJYA 1KF0A 2FSIA 3N2IA 5C1BA 5ITVA 4LOHA 3DPUA 5F2EA 4A92A 1PCXA 1VLQA 5C7YA 1E9VA 3UQYS 1EVZA 3U48A 1KKUA 2WJPA 5DISB 2W70A 2VP2A 3VAYA 4UUPA 3BILA 5CP8A 4MUNA 3CJQA 4RTPA 1EG2A 3RUHA 1AURA 2F3UA 1ZHFA 1ZI8A 2OOSA 2HPZA 3STHA 1R8QA 2QE7D 5CA1A 4EB6A 3HCRA 3BL6A 4AS2A 4LXQA 1EVKA 3EEIA 1XDUA 4IRUB 4F72A 2E4UA 1IVSA 3JTMA 4BEVA 1UOQA 4CYMA 2IXTA 2QTNA 1DNPA 4QODA 5HKAA 1DJOA 2HSWA 3IC5A 3K1TA 5K8TA 4F9FA 5H8WA 4B47A 1U90A 3CPHA 3IALA 1VHLA 2R6GA 4NL4H 4RHTA 1BDMA 1XKTA 3L1KA 4TWRA 3WR5A 5LVAA 1I32A 5DI3B 4Q1DA 1O57A 1VL0A 2W48A 1YA4A 3OZCA 4RY9A 1G21A 1KEEB 1JKJB 1UJ5A 3FZGA 2BEKA 4E30A 4HGRA 2RH5A 2AUNA 2DFKB 3NVKI 5DB4A 2XEDA 2PGJA 5EIFA 1U94A 2A0XA 3LPMA 4GZ6A 2QTWB 3H5WA 3GLVA 1CFJA 4H59A 1AQYA 4GKVA 4Z86A 2P0YA 3JAWB 2V7QD 3OTWA 5AJUA 3JASB 3CJTA 1Z6YA 2CJFA 4GC5A 2BM0A 3GRUA 3HLYA 1OF1A 4GXNA 4IRMA 1OA1A 2BV3A 3KRTA 3NYIA 3FZYA 4PLPA 3D02A 5DTEA 3SZMA 3R4VA 2P11A 1VCNA 3AJAA 4G0NA 3T0IA 4B6RA 3ICQB 4CEIA 2EZUA 2VCHA 3C6MA 3VU1A 3AR3A 4POAA 2L42A 3LH5A 4DSZA 2BKLA 3PRYA 1XMOB 3O8OA 1GRVA 3HJUA 2CDAA 1KTVA 4EW2A 2VIIA 4MDEA 1ZNQO 1A7UA 4L6IA 5DNWA 3QHPA 1L2TA 2IP1A 5JAZA 5CEJA 1UT5A 1QHHB 2B20A 3THSA 4IW3B 4CI9A 2XCIA 4RXTA 2EKPA 3G2NA 4P7JA 3IV6A 4UHKA 3HJNA 3K0FA 1TUIA 2EGUA 4E5YA 1F3OA 1C4WA 1PP4A 1PJ8A 4JKOA 1X3LA 4O2AA 3S55A 2BFCB 1UMBB 3TM5A 4FWIB 2HSDA 3JQFA 3CZ4A 5C1OA 5CLLA 3EFBA 3G9TA 1WB5A 3KE9A 3V4SA 1GQSA 1KIMA 1KNQA 2J9ZB 2QTFA 2QYTA 3B5JA 4LWQA 1W19A 2L2QA 2ZDGA 5TQ0B 1WBDA 3I9FA 2V96A 3J80A 5CPFA 5FORA 2C7OA 2M9MA 3BDIA 3BKXA 3K35A 3LGXA 4YJHB 3M6LA 4E1BA 1XXLA 2FMKA 2RGAA 3FPCA 3T38A 5F1PA 3HBLA 1N0UA 1UBNA 1IEXA 1IVYA 1YR3A 3C7TA 4V1CA 5C8YA 4GPAA 3O8NA 2QLMA 3X2EA 2GM5A 3GK3A 4NE7A 4DC0A 4EPYA 2NO9A 1JDNA 2QL6A 4P53A 2Y1EA 3IUBA 3H2ZA 3UJ9A 3VV2A 3WWDA 4FINA 2BHLA 3LK6A 3BH7A 1WQ1R 1DBQA 4DE5A 1II9A 1VB3A 2CLFB 2H8KA 2HY7A 3BA1A 3LT4A 4GG1A 5ANRB 3S1LA 1BWQA 1Q12A 2WU0A 3KB6A 4ZU3A 3SF8B 3W1EA 4D2IA 1NLZA 4KQIA 1X1CA 1YDFA 4INZA 3B9RA 2VH1A 3VDNB 4DJEC 1KVRA 2QTCA 3L49A 1U8XX 2J0VA 3SXUB 4LXIA 4EMUA 4TSFD 2G7ZA 4DLAA 4MRAA 3STXA 3V34A 4G81A 4N5IX 3LCMA 1LSJA 1QFYA 3PLNA 4HFRA 5TJHA 4XCVA 3ASZA 1W29A 4S04A 3GUVA 4M1OA 1G5IA 3T3HA 1XCGB 5F21A 2UUAB 1V7ZA 3AXSA 1CQXA 5CX4A 3F98A 3HUTA 3NS7A 5DXFA 3ZU4A 4B35A 1Y9DA 3H17A 3KOXA 2ECPA 4YPOA 3O95A 1A7AA 4IAOA 4KK3A 4LQ4A 2PGLA 4R83A 3UXYA 3ZWYA 2QRZA 5GJWC 4K6GA 2AXEA 4QYWA 2ZRFA 5HIJA 5L3SA 1VG8A 2KYRA 3MCWA 3R44A 1AZLA 2YYAA 3HYRA 4AF6A 1ELOA 2FW8A 1C8KA 3DE0X 3O74A 4GI7A 4AP6A 1RWOA 1V43A 3F1LA 4P5PA 4UPVA 3VR2A 3IOYA 3GJYA 5HSGA 2VUUA 1ISIA 2C9ZA 3GWZA 3RVDA 4Y98A 5CDGA 4OBBA 4PG5A 5K0SA 1JHUA 4L22A 5D1NA 5IM4A 3MXOA 4F71A 1F2TB 1U80A 1T1JA 1T13A 3KAQA 4NV3A 1Z6QA 3IJPA 1H1LB 1SU4A 3RTCA 3E3AA 3RADC 5K51A 3RWMB 3D0QA 2HXYA 1KEVA 4MQ5A 3HXPA 1QDLB 1Z5VA 3I9KA 4D7AA 4BWGA 3FB1A 4Z4IA 4B3XA 3AUKA 3VSDA 5JTUA 5E6RB 1TEVA 4F9EA 1WUJS 1FUYB 4JLAA 5DM1A 4CR6A 3QOXA 1OV6A 1D1TA 3PXEA 5ICEA 3X0DA 5BQPA 1Z4NA 3JQ8B 1NG1A 3IR7A 3WDMA 4JBIA 2J30A 3ABQB 3CG4A 4YYZA 5EWJB 3OC6A 3RIEA 2J9FB 3UUGA 3AHDA 2PSHA 1NAIA 3FDFA 3ZG6A 3HSYA 3D7NA 2XBLA 3CO5A 3VQTA 2VSNA 5C5CA 4ZYVA 4ZGBA 4J0HA 2E4XA 2V7EA 2NTEA 3E9RA 5L7TA 2ZIEA 4UQOA 4IS2A 2FG6C 4CPDA 4EJFA 3T34A 4AMGA 4II2A 1C9JA 1MHPA 2FEMA 2YCLA 3W8NA 3WSTA 1ISMA 2WU4A 3QELB 4DWWA 4KE9A 1CUGA 1RRFA 1OBCA 1GG5A 2WOJA 1UC5B 2XRYA 3NTLA 3Q85A 4FYPA 4AX8A 1UPUA 3KU1A 2HHLA 2EGGA 2WM9B 1U5BB 3LCRA 1U3TA 1Y34E 1TYDE 4BVFA 2CDCA 3UA4A 3OCVA 3TQFA 3ZHBA 5I7UA 1Y3CE 2OGSA 1OYWA 2NQTA 3A9CA 5G3ZA 3OEEA 3KP1A 1ATIA 2I55A 4LYEA 1YZ3A 1I13A 1N8SA 4HGPA 4PZDA 1P2BA 1XX6A 3DBHA 4X20B 4HQLA 4I1YA 3TZEA 3CURA 3CEMA 1QS0B 2NSYA 4J49A 2Q4OA 1XA3A 3A6JA 2C2OA 4ENVA 1W59A 3IYLW 3Q8WA 4X9XA 4YQYA 5ECGC 2VA8A 3M6MD 3E9ZA 4DKJA 3ZJUA 3E9CA 1SEPA 5DU2A 5DBGA 2F4NA 1EAMA 2P9FA 2QV7A 2VNSA 3GRVA 1JXAA 3RS0A 1M33A 3KVOA 1TTHA 3UY4A 3NNSA 2Q0SA 4COOA 3TNDA 4OHFA 3PSAA 2DGDA 1NJSA 1WZ2A 1WMAA 3KHUA 3DMTA 1KEKA 2PBZA 1MV5A 4RTQA 5LLDA 4LF4B 2AC4A 1G5QA 1YNSA 2XUFA 3IE0A 2O8CA 1PJRA 1R15A 4RVDA 5C46F 2G77B 3AR9A 3R3UA 4UDOA 1Z4OA 3BGOS 3I5YA 4LYGA 3A4YA 3IAEA 3QENA 2B4TO 4FTWA 2ORVA 1B74A 2BONA 2V45A 4QU9A 2F43A 5HJ7A 4PYIA 2OHGA 5ARCA 1NVFA 2HBYA 2YY6A 3KOWA 4DQDA 2X5XA 4J1TA 2PX3A 2YHSA 2GZ1A 3G2PA 3JVVA 1Z2NX 2AJLI 1I14A 1SKUA 2AYYA 3FBTA 4KQHA 2V9ZA 5FUXA 4ZVSA 4E2XA 3IP1A 2FPRA 3GUUA 3JTEA 3CTPA 3H5OA 3NIBA 5I7WA 1VPLA 4DB2A 4BKRA 2QS9A 2BFFA 2BL4A 1Q20A 3QKIA 3UG7A 1BWRA 2QVBA 1UDXA 3Q15C 4PGGA 1N2BA 1ZWLA 3U4DA 3GOHA 1LSSA 1G19A 2O19A 5GOTA 4ZYWA 1GA1A 1UC9A 2A5DA 2F1IA 2XJ4A 4L0QA 4N18A 5FUWA 2ZYRA 4RACA 3KEQA 2FWJA 1JXOA 1L7PA 1RRMA 3EULA 3IMFA 4GMFA 4LEIA 1VMKA 4HWGA 1PBTA 1XRJA 2II6A 4UATA 2ORWA 2DERA 1SOAA 3UF0A 1K7YA 3KZMA 4ZVQA 4YCSA 1YFLA 2NP6A 2ZIXA 3WWOA 1YDWA 4KQEA 2C83A 4RTRA 3SLRA 3AR2A 3EXG1 2QTHA 4XIFA 5K03A 4DUYB 1M72A 1U0RA 2FQQA 2FH5B 4KWTA 2Q21A 4F46A 1DX4A 3SU8A 1L9XA 1LUAA 3IEXA 3PL1A 1B2LA 1ONSA 2Y1KA 2HLHA 2QGNA 3CEJA 1YV9A 2Q3CA 1AMOA 1Y8QB 1RM4A 1SHKA 4KFRA 3ZZTA 1V39A 3AEXA 4CJXA 4F4UA 1F1BA 4X8HA 2H2AA 2RB5A 4TX1A 4U2DA 4DLVA 5D3KA 4TWJA 3U40A 4B4WA 3CPSA 4OB7A 2XT9A 1XTPA 2GZ3A 3IP6A 4O4HA 4AUEA 1IBMB 2VBIA 5GONB 2FU5C 2XYQA 3PV0A 2IEGA 3OSUA 3I28A 3O4VA 3OHSX 3C4JA 1WXQA 3VPFA 1N3IA 4IPTA 3ZVKA 1D0VA 3E8XA 4ROSA 1Y1KE 3V1MA 2W5UA 4PS0A 3ANNA 1HG0A 1Q91A 1GWNA 2GEUA 3PJEA 4Q7MB 4D3XA 3AFOA 4I1PA 1ORWA 2ADFA 4MV3A 1ECBA 3PNLA 3OJEA 3S7TA 1OXTA 4C29A 2QSYA 5B1IA 4YR7A 3FYUB 4M0MA 4DHEA 1R0ZA 2C07A 2C84A 2PZBA 3QNMA 4QUKA 2RIRA 5KDDA 2XMRA 4LK3A 3P71T 2RE8A 4YP5A 3KJQA 3TN7A 2OBBA 3MB8A 4HNSA 1CHNA 1ECGA 1TMYA 3NEYA 4PYNA 5AYVA 4RTNA 3PBKA 1J7JA 4HYEA 4TYQA 4XPIA 3ZVRA 1RKUA 4WZAE 1AQIA 2WILA 2VUIB 2P62A 3EIOA 3LPCA 3P9ZA 3EUWA 2FKNA 2QUIA 5EMHA 5J2TA 3DB1A 1RXCA 1D2MA 3DT9A 4AY6A 4BV3A 3OLXA 4XM0A 2RGDA 2AH5A 1D2AA 4BAUA 1Y5MA 3WIEA 2G4LA 2RHHA 2VT3A 4MGZR 1GZ4A 4HX9A 2PUEA 2PKWA 1PTJA 2P9HA 5HX7A 2QD1A 3CLUD 2GK4A 3EFHA 4KFSA 3VO8A 5E95A 3DVQX 4INAA 4YRZA 2VUSA 4U9HS 2C9OA 1ZD8A 1FY2A 3LC7O 4I2NA 4BFLA 4DSAA 1XMIA 2NN3C 3GA7A 4EUNA 3H4MA 3T7AA 4YS6A 2WWXA 4WNAB 4RZIA 2VK1A 4KWHA 3A3NA 1EDEA 4OI4A 3KR0A 1DKNA 3BXXA 3VZDA 3UW3A 4FR2A 1PFGA 4F6RB 1PLJA 3EVDA 3OETA 3RO7A 1I7QB 2GN8A 4XI9A 3CGGA 2IYFA 2BOVA 3PUVA 4ZA2A 5LL6P 1UP6A 3EUEA 3MAAC 1NF2A 2YMLA 3OJXA 4K8OA 2OKGA 2WWRA 4OM8A 1P7ZA 3ZLBA 1F17A 3A32A 4B7XA 4TUYB 3IVXA 1JG7A 1YDMA 2JLWA 4LY9A 2JL1A 2EKLA 5LQKA 1A2QA 5CB4A 2QRNA 3ZE2B 3ZE0B 2D5LA 3UK6A 8ATCA 4MYHA 1A8QA 3X44A 5BV7A 1J2YA 1YZGA 4TS3A 4BO6A 2IHUA 3KT6A 5ESRA 4QPNA 1Q77A 5TT0A 2IKQA 3TNLA 5A4DA 4IIVA 1E1NA 4MX8A 1BJTA 2P9BA 3OECA 4OGKA 5LQJA 4FMDF 5HDQA 4GX0A 2PD6A 2V97A 3GJ3A 4C87A 2GEKA 4CR7A 2PK3A 3N0XA 1JQLB 4NONA 1P6QA 2GJ8A 3BT7A 1V2HE 3W3AH 2AOTB 2EBWA 2Q5HA 3SEFA 3ENZA 4MLPA 1NXPA 5BSMA 4OM7A 1ODCA 4OQPA 2E4ZA 5ALTA 4I5EA 2NPFA 4BXOB 3PR1A 4RKFA 4TYYA 4LZJA 4QQ8A 1U81A 2IV3A 4FW9A 3L7CA 4D5EA 3KQKA 1GTMA 3IUPA 3SKXA 4D98A 2PL5A 3CUSA 4P36A 4RHEA 3QY0A 4ALMA 3EIHA 3FN4A 2FUG6 1NU8A 2FZEA 4FT4A 3TAXA 3O3NB 3SBDA 1VKJA 3ZBTA 1DKMA 2VDLB 4D9KA 2BM8A 4I3HA 5L45A 4QXAA 3WGUA 3WRYC 1ZK3A 4HN9A 3BM5A 4FGSA 4JL5A 1UL1X 4M9QA 2AX3A 1SCUB 2RH8A 4JKIA 4BFCA 1Z3IX 5TS3A 4NCJA 2XXAB 5FHQA 1TQHA 1O95D 1MT3A 3QVGB 1GQYA 5EYPB 1FTWA 4MDYA 2WSLA 1QORA 4HTFA 4LVOA 4JGBA 4V0SA 5THKA 1QDUA 1V5EA 1G4UR 1J07A 1HNNA 5LQRA 3GLRA 3TINA 2NLOA 4J6EA 7ABPA 2BMFA 3F7OA 4LY6A 3EZXA 4RBNA 1QIHA 3WX0A 4OI2A 4MJ3A 3T1QA 1L8OA 3RABA 1QQBA 1PEDA 3GYBA 4NBUA 3SD7A 4E12A 1V16A 5EJ9A 3O82A 4N7BA 1L5QA 2B36A 3N8HA 4N7MA 4WESA 2ZBQA 4XW2A 1FW8A 3N8GA 4HB0A 5EESA 3ZWAA 3BRCA 3QVTA 4K6CA 3LBAA 2Z1MA 4C88A 4JYZA 4CDMA 3SM3A 3H97A 1VKZA 1YOBA 2CSXA 5KYXB 2BE9A 4E5KA 1T9AA 3VHQA 1E89A 2W2OA 1MIHA 3PD0A 3QFHA 4FGKA 3FVWA 2L18A 3RQSA 2UVPA 1ECCA 2NOAA 1Y5RA 4Y1RB 1KDOA 4AECA 1MQ8B 5KOHA 2P6NA 2F3SA 5K0FA 2ZVQX 3GP5A 4GI2A 4LF5B 2XGOA 3R3WA 4Q4JB 4UUBA 4A2WA 4CL0A 4LGMA 2WZCA 5K6AA 2AN1A 4RVHA 1S3IA 1YS9A 3NWOA 3QX3A 4Q03A 3V6MA 3HWSA 4NX2A 4X3OA 2AC2A 2JKYA 3ZJ4A 2AFIA 1L5YA 2GCGA 3OE5A 4Y9SA 3K9GA 4AO8A 4CVNA 4YBZA 4RVNA 5HE8A 1F9AA 4N5NA 4ZZ2A 1FBNA 2TMKA 1WF3A 2JHGA 2V0CA 4GGPA 4NAUA 5J4VA 3DL4A 3RUIA 3IQIX 1P2GA 1GT6A 3UAVA 5HZKA 5A9SB 3BXHA 2BEJA 2EX4A 1BHJA 2R97A 4K46A 4XH9B 4TWIA 2XUPA 3B3JA 3RVRA 1VOTA 2OGWA 3D8TA 5DLEA 3NHFA 3BH6A 3VR2D 5EUQB 3FNGA 4LKOA 3QEAZ 3L43A 1QG0A 2AMFA 2H1VA 5EWMB 4FEYA 1KEWA 1JEYB 3JS5A 1TQDA 2CZQA 2POQX 1L5GB 2Q3MA 3KZXA 4PANA 4IZIA 4K6HA 2W11A 4PGMA 5H82A 1FVXA 4BQQA 4C03A 3ON5A 2BR5A 4W9NA 1CQIB 1ZVKA 4JL6A 4P7FA 5FI3A 4EG0A 4MRMA 1OXMA 5ALRA 2PZLA 1EWYA 1N2GA 1XEXA 3DJFA 5FBLB 2D1SA 3RVLA 3PFGA 1M5UA 1SUWA 2C98A 2RHTA 3DBLB 2YUIA 2VSFA 3RUAA 3QK7A 1H3EA 4KKXB 3OT4A 1DWQA 1N5DA 1VSVA 4LPSA 4HSGA 4NU8X 3T1NA 1WP9A 2B6NA 3CIOA 2FDXA 5AOAA 4EUFA 3L5OA 1QG6A 2O8FA 1NKSA 3R76A 3REQA 2BSXA 5LQMA 2FUKA 5EHGA 3IMEA 3QI2A 2WUWE 2XMZA 4ZJPA 2J5KA 4CMKA 2EHJA 3C1AA 5B58T 2MDTA 2XYVA 4YAEA 3RG2A 1J24A 1RKVA 1X1RA 4DIBA 1WEHA 1KERA 3IS3A 2WHPB 3LF2A 3RT7A 3C41J 2DPGA 3OKFA 5B3KA 4EI8A 1NVKA 4EG4A 4U6QA 3TIVA 1JYFA 1VPTA 2XSZA 5C8ZA 5C35A 2HCTA 3WIUA 3HXLA 2JAOA 3UMVA 1DRVA 2J6HA 3CWQA 4F85A 3ZOZA 4TLBA 1ADJA 3G8CA 5CMLA 4BC0A 2Q46A 2A0WA 5AVSA 1OIWA 1UZAA 4H6XA 1DRWA 4MUHA 4N0DA 4XGQA 5ADHA 4BASA 2ADOA 2VQSA 2W9XA 3IMCA 5HBRA 1X8XA 2ERXA 2FE1A 2JKZA 1ULTA 4L3WA 4CM8A 3IERA 5D5PA 2D6FA 4OFZA 3E1KA 4IBOA 1DDIA 3NX4A 4MVJI 5EQJB 3BMQA 3VKFA 2WB4A 3OPXA 3W34A 1JHAA 2BFOA 3OEED 1ZK0A 4CMIB 1H85A 4I4TF 4QXPA 5ALKA 1G17A 1I6LA 4WK0B 2NVUA 1LVUA 3H6KA 4D0GA 4EQZA 3R5JA 2FEKA 3ZHQA 4FC7A 1QH9A 3AJ9A 2AD1A 3E15A 4UPDA 3PNBA 2V6BA 3R6GA 5K0BA 1ZXXA 1DFHA 3AEYA 3WO1A 3G9ZA 3C6KA 3LTEA 3OZVA 2WR8A 4KO2S 5CIQA 1EAYA 4M86A 4O5OA 4P31A 3RRFA 4DJTA 1L7NA 4ML3A 3FJYA 4RC9A 2QYOA 3OFKA 5JSUA 5JJKA 2ZG6A 3RD5A 1JQ5A 1P7PA 1XQYA 4MZXA 3PWZA 4ZCTA 3ACDA 1RM3A 1VJGA 4KVZA 3OE7A 1X1TA 1ZA1A 1N5LA 2P1DA 3GPDG 4UDXX 1E3DA 1EZZA 1BCSA 1KK3A 1Z4JA 3DGEC 2GD0A 1NR5A 3CCCA 1O87A 4K9QA 5IUKC 5KTKA 4MI6A 2FGJA 4Y30A 3OQNA 2GKOA 3AZQA 2HKIA 4G0OA 3SDBA 1MB0A 1OKKA 5KJ6A 9ATCA 4IJQA 5AI0A 4QG7A 1HL3A 5BR8B 1XVLA 3F9CA 4XDGA 2AG5A 3L6UA 1R8XA 2AN5A 3DR3A 4LTDA 3IOMA 1V41E 5CXXA 5KC8A 1IHOA 1TW2A 3UMMA 4BO7A 1UBMS 2BP7B 2PSDA 3ORFA 1K4MA 2RC5A 4A26A 3K1YA 1M75A 3FWHA 4UVDA 2IS6A 1T9DA 2DH6A 3IEMA 2X2OA 3GEHA 3SS7X 4G5XA 5TGZA 4B3MB 4H0CA 5DFAA 3UATA 1HK7A 4JITA 1Z28A 2MTBA 2QM3A 3MJCA 5DYNA 4EFMA 2WFMA 3SYKA 2YZ7A 2CV2A 3OURA 3QE0A 1A2KC 1FFGA 5AKXA 4J16A 1JVSA 3I5UA 5CFZA 4X90A 4FHZA 1VSBA 1JEJA 3R75A 5JS6A 3AB8A 2O0MA 3CX3A 3UUWA 3EQ7A 4YJKA 4AXBA 2J3EA 5CVEA 1PX0A 1GFWA 2AQ8A 4G89A 1FRFS 5KNCH 2XW6A 4M89A 5BSHA 2V9PA 5FLXA 3UV3A 2VTBA 4G4GA 3HU5A 1Y5IA 4JVOA 3KOYA 5EIBD 1OX5A 1XZKA 2GVDC 3CF2A 1KQFA 4BFSA 4OXNA 3U09A 3CUYA 1ZIXA 2IUSA 4C4AA 5HQ3B 5K6RA 2OHXA 3CNHA 1QIGA 3TRDA 4AJNA 1HDEA 2WTXA 3G85A 3NT4A 3D4NA 1AHNA 2CMGA 1K2WA 2J9RA 4PGFA 3IHWA 3SS9X 4QXMA 5K8IA 1VSQA 1WPQA 2IYLD 4OBWA 4UHBA 5E6UB 3C6QA 4BNDA 4QYSA 1NUAA 3FPFA 4A2QA 1VG1A 1VP9A 2PH5A 3G5TA 3ORSA 4OHCA 5A4AA 3WC4A 3OIUA 3ZE1B 2CEAA 4NQRA 1BFDA 3HB5X 1HYHA 2Z2XA 3TOXA 2WPDD 2VQ3A 4LMRA 4RK7A 5IMSA 4M3NA 3W8DA 1EIZA 1E2LA 4IXTA 2VPIA 1SPXA 3HA2A 2H2WA 4J1SA 4ZAVA 4TXHA 2HAEA 4UULA 5JPIA 3T1TA 1TZ2A 4BJ1A 3DUWA 4MWZA 2D8MA 1XIVA 3QWHA 2Q27A 2Z1NA 1KMCA 2AD5A 2IYSA 2UYYA 3UW1A 1JFSA 1DV2A 3B6EA 4W1PA 3PXGA 3WBJA 3K96A 2H0RA 1QG2A 2WA2A 4NDZA 5B5SA 1F0KA 5LU8A 4JJKA 3HTXA 2ZS9A 1O9BA 1L5KA 1MD9A 2V74B 1SC9A 4B84A 1C0LA 1Z8FA 1JS1X 4HQFA 3JQ6A 4XA8A 5JMPA 4A5OA 4RTKA 1E1CB 4JJFA 4BP1A 1OFHA 1XROA 4WOBA 4EG6A 4P7GA 1Z26A 1YT5A 2NSDA 3T7DA 4YCMA 2R1ZA 3BGWA 5IVDA 1EDBA 2J85A 1ZICA 2I7DA 2YOGA 3TLJA 3GW8A 4JYAB 2XLBA 1IZ0A 1CY4A 1BRMA 1DRUA 1RZVA 1T8RA 4DCOA 4G8BA 3AWIA 5BMVB 3VC1A 5CFPA 1MW8X 1SOWA 2QRGA 3ZBUA 3KVVA 1UM9A 1E9CA 2AOUB 3ZU3A 3FMGA 4N47A 3KVYA 4IFIA 5CURA 3HP7A 2O0HA 4M1QA 2WMOB 2ZRBA 3WAGA 1XNGA 1QE5A 3HRIA 2ZXEA 4GLLA 2Z57A 4NCIA 1PR1A 1XDWA 3HNPA 1TT5B 1SHLA 4E14A 4KQKA 5K2OA 4UHEA 3ER8A 1AN9A 1D04A 4QUJA 5AK5A 5FWYA 4P92A 3DO8A 4F4CA 1V3TA 2BGRA 1AT1A 3L0BA 3NWJA 2JHCA 4OLHA 3R9KA 2MMCA 1W8DA 5FA6A 3WB1A 3ZKAA 4BNVA 1WZUA 3IELA 1UPBA 1XE3A 3LLCA 3SJ7A 4ZEWA 1CF9A 4HQKA 4GC9A 3RSZA 1KBOA 2EW8A 3GJ7A 4EKIA 5IRCD 4I5IA 1F4VA 5KSOA 1RAHA 3CKYA 1UJ4A 1X94A 2NUPB 1XF1A 3JQRA 5EAIA 1NFRA 2NUBA 1LQUA 3HN7A 1U9YA 4PX3A 4UD2A 4YV1A 5J1SB 1TJ5A 4AKSA 5I01A 4KSCA 1KYTA 3P7MA 2IH5A 1Q50A 4RQBA 3Q98A 3R5XA 3PE3A 1FYFA 3ETJA 3PG5A 3HLKA 2QNIA 1V1RB 1YRAA 2HMUA 1QOPB 5CTAA 3EXHB 4YASA 3GCXA 1W1UA 1DX6A 3ZK8A 4C0HA 3TLXA 3FF1A 1VHJA 2E5WA 3TIFA 2AW3A 5BVGB 4ND6A 3BWYA 1PJCA 2QN7A 3QOFA 4P2GA 2MSWA 3GF4A 1XTIA 2J3HA 4BKQA 3H3FA 3K5WA 4PR3A 4AJ9A 3CLVA 3SIPA 4A73A 2P40A 5C7LO 3JQAD 4P7BA 4RHFA 1XU4A 4FOTA 1G4AE 1OXKB 4PWYA 2ONKA 4OOFA 4R69A 4B5LA 1OJ7A 2X4LA 5LFAA 2ZB4A 1EFVB 2CL0X 3SHQA 2FG5A 2PHZA 4JI4B 5I7FA 4JLWA 1F7UA 3EZNA 3ZE8A 5GM2A 3TNFA 4Y8VA 4HEHA 2WZBA 1BYUA 2YZKA 3HY6A 4QJ4A 4D46A 3PZRA 5AKLA 1RRKA 1RAGA 2IDJA 3ZYZA 2MMGA 1WPRA 2EX0A 3GCWA 4PLWA 1PQPA 4QATA 3L0OA 5F4BA 1R00A 1C50A 3FNQA 4ALKA 4GWLA 4D8WA 1H8EA 4KYUA 2C2ZA 4ANFA 4EFNA 4UBNA 5JU6A 1F5SA 3M6FA 2OCPA 2DH5A 1I0LA 1FE8A 1T4MA 2HMVA 4BQFA 3HQ4O 4OAPA 3SQDA 3WDSA 2A9OA 2W6OA 4WVLA 3OBIA 5JPCA 3VVMA 3I61A 3BGIA 3FLMA 2MYNA 2J6BA 2FPSA 2IWHA 1ISHA 4DYDA 3H1TA 1QNFA 4RENA 1P1CA 3CH5A 1J2EA 3MMZA 1Z2EA 4MV7A 2GYWA 5DEIA 1TKBA 5GMOA 4QU5A 3C6XA 4CKWA 3TLYA 3QBDA 5CGZA 3MYYA 3VJMA 6REQA 1I4TD 3OCJA 2XUHA 4YMUA 2Z9BA 1XLTC 4CV0A 4MS3A 3RVBA 5FTWA 5AW8A 1WUYA 3WK8A 4LJYA 4H3SA 3N7TA 1L8AA 2CJYA 1TM7E 2J45A 4A8JA 1U8FO 3DDNA 2HCRA 3FKSD 2WU1A 2QMQA 2RHOA 2PQ0A 4W8OA 2Q2NA 3HKCA 4HAZA 3L92A 4FNMA 4LXTA 1PQUA 4G23A 5TGTA 1E2DA 4DMCA 5FT9A 1E2UA 2CWWA 5IKPA 4ZVKA 1PF7E 2HMWA 5G3YA 5JEDA 4JX9A 4JC8A 3V1YA 2Q9AA 4BPBA 1B8VA 4UFOA 3ZI7A 1GADO 4MP3A 5F3DA 4ZEVA 5INTA 3MMPA 4MH0R 3EA0A 4NJMB 2RAUA 3SKVA 3MTGA 1QGYA 2PX0A 4WUTA 1T10A 3ZXXA 3IXMA 2GBLC 2ZUCA 5AI5A 1CQJA 1JDVA 3S1AB 4B4OA 2HN9A 5ALMA 3OAAD 1MC1A 1S3SA 4DQKA 1UPXA 3GGSA 1NMZA 1CR2A 5GY7A 5FI0B 1UXHA 2IHBA 2AW5A 4GP6A 3ZGXA 1X9HA 2FXIA 5JWHA 1TQ8A 2JJQA 3AV3A 1B6SA 1K5HA 2QLFA 3D8UA 5IJ9B 5BR4A 4FVTA 4HVCA 4OJMX 2X7JA 3MD9A 3PC8A 3ZY2A 5AJVB 3AKYA 2P8JA 4U63A 3ZV4A 4C1BA 3AUUA 3AL2A 4TV8F 4WFJA 1X80A 1FC0A 1OHHA 3K8OE 2JLRA 2VZ9A 3O5AA 2Z4RA 2PUFA 1JAXA 2OGZA 4JLOA 3ZGZA 1S2MA 3I8XA 3K16A 4PXSA 1GRCA 3CWCA 4X7PA 1NLUA 5BW5A 1AE1A 5IFLA 4OIMA 2GFIA 2GZDA 4MB0A 3TPFA 5DNUA 3IXQA 2FNAA 3PJDA 1F20A 2ZAIA 5JMWA 5DHFA 3BMNB 2AFHE 1R0KA 4UNSA 5JS1A 4P4TA 3EMKA 3OCWA 1WY7A 4D3FA 1GAQA 3FTFA 4L9SA 3HU3A 4BLSA 4FJ0A 3BC1A 3EPPA 3ANYB 4QUBA 1OLUA 5EMLA 4LI0A 1VE7A 2HD4A 5MHTA 2IUEA 1TO2E 3NXKA 1FXSA 2XY4A 4TL8A 5DTMA 2OWDA 3G17A 4II3A 4B7ZA 1HDZA 4D4LA 4AQYB 4IFEA 4DLLA 3COYA 1E1LA 3A0RB 3LM8A 1VJDA 1F38A 1WA5A 1VRVA 1XRNA 2MINA 2XB9A 5CLFA 3HVRA 1U0OC 2QAGA 2XBMA 5ESWA 1JPJA 5E0KB 4EW3A 1DAEA 2W2KB 5DH9A 1OFUX 4QBHA 2LR0A 1CBUA 1XAHA 4QYXA 2Y9MB 2Z6AA 5G4KB 1J2JA 5D01A 4B0OA 1WEKA 4IVPA 4FB4A 4B82A 5K3AA 3AVVA 3C4VA 4IIJF 4FHCA 4JT9A 2GBFA 2QZJA 5JYBA 1C3JA 5E1BA 2VRBA 1JG4A 4IKOA 3BZBA 3UYLA 3E2MA 1N1DA 3UCFA 4PBTA 2C5SA 3WNZA 1GL7A 2C8KA 3WFZA 1P2VA 1ADBA 4BUCA 2RAPA 1OZHA 1UPFA 1I0IA 3NASA 2Y76A 3F6BX 4J7CA 4RPKA 1QK5A 4LWPA 3NDIA 2ET6A 1PV2A 2R1VA 3O4RA 2HJVA 1YU6A 1S1CA 2NU8B 4YYEA 3GFFA 2I5PO 4HS9A 4MO9A 1VHQA 4G5RA 1NRXA 5FKJA 5EXDA 1Y6ZA 4WZAA 2NP7A 1EFPA 1ISGA 4M8IA 5A5EA 1ZU5A 2V4UA 2YMMA 1AS0A 2G09A 4E5PA 1PJ2A 3B6KA 4CN8A 4DT1A 3LV8A 1ZK1A 2GVZC 2ZSAA 3ZCXA 1YZUA 2O8EB 5KMGA 3RRZA 5I7AA 5EWLB 2DPXA 2WQ7A 1XMJA 1K3TA 3BQMB 4EEKA 5M2QA 5FBKA 1FFXB 2OV3A 1PTKA 1H2RS 4IUDS 2LZ0A 3L7YA 2RHWA 3GEPA 1ESCA 4QRHA 1J90A 1JNYA 5AT1A 4G5QA 3UWKA 4DIFA 2ETVA 1YZQA 4UTZA 1W0CA 3HY4A 1DEKA 4IHAA 3LO8A 3NFYA 3MBKA 1FP4A 1X3SA 2I76A 4B3CA 3MINB 1Z0AA 4XEUA 4Z2AA 4YECA 1X7ZB 3FMOB 3FM9A 2XDQB 3NWBA 4C7XA 1DC6A 3JZDA 1COZA 3IUJA 1Y80A 4ZEMA 2ZREA 3KXLA 4EY3A 4PRLA 3AFHA 1Q44A 3Q0EA 4BTLA 1VYVA 3JD3A 4O0LA 5ALQA 3NVAA 3KV1A 4GQIA 2R8PA 1Y8RB 3GLSA 3QW4B 5K09A 4IFBA 3RSQA 1EVEA 1KZ4A 2NXCA 3EBOA 1NOJA 2ZE6A 3QVLA 4D43A 2AVNA 4V39A 1DJMA 4PNHA 2HHHB 2R8EA 1MC8A 1U28C 3ENKA 3K2EA 4R16A 4TS9A 4JI1B 3UC5A 5IABA 1B00A 1FYVA 1WXEA 2CLDX 5DMHA 5A3SA 3BHNA 2H4XA 4OVKA 2M2IA 4I55F 1VFPA 4IX1A 1TUEA 4LZWA 4UOEA 5KNDD 5SZHB 4WECA 3LZDA 1JMKC 1TF2A 2QRVA 3R5SA 3VHXB 3N0WA 1JE0A 4B71A 2JRCA 1A82A 2CBGA 4HF7A 4OHKA 2O3JA 5EJ2A 1EBBA 5CD9A 1EWKA 2QQFA 3UVEA 2BC9A 2UZ1A 5LSAA 3TECE 1PYOA 4IMJB 3QP9A 5JECA 2PN1A 1D5CA 1VA5A 1GQRA 1XLVA 4ZZ1A 5EA2A 1CVIA 2ZUVA 3KKNA 3EZFA 3JV7A 5L7YA 5TEWA 1Y89A 3SICE 4F8JA 1P60A 1KP9A 3FOEC 2HZ7A 4HBGA 5JOQA 3BRSA 3KBOA 4Q39A 4D8XA 4NC9A 5JCOC 1BHSA 1T0BA 2YHBA 3PUIA 1KZGB 4G26A 2J4CA 1U8YA 3WQHA 3OA0A 2XUOA 4P32A 3Q5EA 3NTRA 3TXXA 4LDJA 5B64A 4DLSA 1SKAA 1G6KA 1YS2X 1UADA 3O93A 3C14C 3QBEA 2VHXA 1YMUA 3DDWA 4EKGA 2ACEA 4L4XA 2B7BA 1Z2DA 3I9NA 1E0DA 4U00A 4TKVA 2IHYA 1J0XO 3A9VA 4ZVTA 1E9EA 3MG9A 2G6TA 3GFGA 4Q1EA 3RS9A 1RQLA 5B2FA 1YE8A 3UENA 2XV1A 5F9MA 2ZP1A 3K05A 3MTAA 1HDCA 1SIOA 4DQVA 2ZSKA 2X23A 1JKIA 3DFKA 3CUUA 1RVV1 4HNAA 1WS6A 3T0GA 1EX7A 2PL1A 1PFUA 5LBTA 3ET5A 4GOKA 3JWHA 3NUQA 4M7OA 5CA1F 3I52A 3DAPA 3KXPA 4J6FA 4M1KA 3UJ8A 3GLGE 1XNRB 3K5IA 5EMNA 1N6LA