1EX9A

Crystal structure of the pseudomonas aeruginosa lipase complexed with rc-(rp,sp)-1,2-dioctylcarbamoyl-glycero-3-o-octylphosphonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
285
structure length
285
Chain Sequence
b'STYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAVLSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTONIZING LIPASE
publication title Crystal structure of pseudomonas aeruginosa lipase in the open conformation. The prototype for family I.1 of bacterial lipases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 114
structure length 285
sequence length 285
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ex9A00
3DKKA 4DMFA 2HA6A 2C0QA 3ZV7A 1Z68A 4Y2VA 1YASA 3I1IA 1CUCA 2HA4A 2OCLA 3G9TA 1ZD2P 3IULA 3BJRA 2HRRA 2HDWA 3AIMA 4B85A 1EB8A 1VA5A 3EQ9A 3M82A 2WJ6A 3GFFA 5CH3A 2C0PA 2XUGA 4X6UA 3IVMA 4TVKA 1QIKA 5KREA 1B41A 3F8SA 1XQVA 2ECFA 1LPOA 1KU0A 4QNNA 3GROA 5CT9A 1SFRA 1UOPA 2ZSIA 1ACLA 1XLVA 4X97A 3V1NA 3DKRA 3FCXA 5FUMA 3G0DA 2HU8A 3ZI7A 3M3DA 4W1RA 2XUQA 3IB3A 3FNBA 1WPXA 1CR6A 4J03A 1VXOA 3STXA 1X70A 3BE8A 5K3FB 3FLBA 1QONA 2YYSA 1WHSA 5HFAA 5HF5A 4AX4A 5KWIA 4GEGA 4XIIA 3OOSA 1ISPA 3BL8A 1P0QA 4ZREA 4WY8A 2C7BA 2WUDA 2B20A 4CG1A 1CQZA 1E8MA 1FFAA 2EDAA 5DTIA 2XT0A 4HRYA 5K3DA 1WHTA 4B83A 3I2IA 1O6FA 4UHBA 1CEXA 2BGRA 5LZ4A 3O9MA 1MPXA 1W52X 5FPPA 2HA7A 4ZGBA 2VTVA 3E1GA 3ILSA 2PUJA 3I6ZA 4H7KA 3G0GA 4BRSA 3G9ZA 5AM3A 4C6HA 5KBYA 3WL6A 4DSAA 3D2BA 3N0TA 2HU7A 1ZI8A 1CUXA 4E15A 1JI3A 5CBKA 1DTEA 4AB1A 2XMRA 5LZ5A 2JIDA 3R3UA 1GZ7A 4YK7A 4EUSA 1MX5A 1E89A 4DSZA 5AI9A 1DT3A 4H7JA 4YASA 3NGMA 4BCBA 3C5VA 5LZ8A 4E14A 4O08A 2GBIA 3ESDA 4CFSA 4Q05A 5AI4A 3K9BA 1VZ3A 1XZBA 5AK4A 4GHWA 4HXGA 1CLEA 2QJRA 4ZRDA 3WK7A 2ACEA 5HK8A 1MU0A 1G4HA 2XB6A 5AIBA 2AXEA 3Q0TA 3W9UA 2D0DA 5ALDA 2QZPA 1ZD4A 3I2HA 3G7NA 2XMCA 3IUNA 1MX9A 3DD5A 3QH4A 4ITVA 3C87A 3V48A 4DMKA 3WKAA 3WWPA 1HDEA 5HQ3A 5CH5A 1IMJA 4KACA 4OB7A 4RGYA 5BOVA 4B0PA 5CXUA 4U2CA 4OYYA 4U2EA 2R8BA 5JD5A 1Q0RA 3O9VA 1XROA 2DR0A 1MTZA 2EEPA 4AO8A 4BCCA 5J3JA 4Q34A 1W1IA 2QUAA 1R88A 5DYWA 1SCIA 2QXTA 5CT8A 3IUQA 2Y2UA 4LXIA 1WB6A 2VAXA 4NVRA 1ZI6A 4PF1A 3HACA 3A2MA 3PE6A 5AM4A 1TCBA 1XZAA 5IVIA 5AKKA 1UKBA 1CUAA 1P0IA 4X85A 3EQ8A 1J06A 2AJ8A 4DM7A 4INZA 5IVDA 1HBJA 2V98A 3C43A 2WIJA 4P93A 2CKMA 1CFJA 1WOMA 4DMHA 5A7GA 4DIUA 5AH0A 3QM1A 1VE7A 2WFLA 3I6YA 1BCRA 2WUFA 1SC9A 3WL5A 2R11A 2O2GA 1HKHA 4MQMA 1XZHA 3H2GA 5D7BA 5K3BA 4W1SA 2HADA 4ARAA 2WUGA 3O4JA 1Y7IA 3KXPA 4AMZA 4WFIA 4M0EA 4UHDA 3NOXA 1AX9A 1UKCA 4XVCA 1LZLA 4HRXA 4J0GA 1KEZA 1LPBB 5IVKA 2ZSHA 4BRZA 5HFNA 2GBGA 1CUSA 3I2FA 2OQVA 3V9AA 2FJ0A 1UFOA 1K8QA 2H9YA 4G9GA 3OTQA 4RNCA 1C7IA 3PI6A 2PUHA 4GDMA 1VKHA 1SOMA 5BWCA 3I6MA 1FSSA 1UK6A 3PFCA 4UHCA 4E11A 5JANA 4B0OA 3H18A 1QFSA 2XQJA 5ALLA 1XRNA 3AUKA 1H2WA 3QPCA 3FCYA 5ALGA 1EXWA 3ESCA 2AJCA 3KWJA 4BZZA 4H18A 1OCEA 1EDBA 3A2NA 3FYUA 5LYYA 4D9JA 5ALHA 5ALPA 3DQZA 3STUA 1F0PA 4KRYA 1UK8A 1YS1X 1QIHA 2PSJA 1UOQA 2JBWA 3WKDA 1XZCA 1N8SA 3AFIA 2WHRA 3BF7A 3WA7A 1MN6A 3CN7A 3ANTA 2V96A 2WJ4A 1K63A 3W04A 3WJ1A 4N5IX 4LYEA 4AN1A 5T4BA 3U1TA 6YASA 5AKEA 2QXUA 1WCYA 3PF9A 4UBMA 1UT6A 1X2BA 1JJIA 5ALQA 1CUVA 2J3DA 4FWBA 4NS4A 4P9NA 1RP1A 1KU6A 4A16A 1LBSA 1VZ2A 5AKYA 5JADA 4FTWA 2WUEA 3MUNA 3SWWA 2OPHA 2ZYRA 4FOLA 1RYYA 1UK9A 5T4FA 1LPMA 5DTJA 3DOHA 1EHYA 2VJCA 2DQYA 2V97A 2VF2A 5JAHA 3FVRA 2OAGA 3ZLVA 1R9MA 3HRHA 1QO9A 1NX9A 3FBWA 4UFOA 5ALTA 4HVTA 4HXFB 5T4EA 5HKAA 1CUEA 3YASA 4BAGA 1T2NA 1QZ3A 2OCKA 2ONCA 2Y2VA 1J1IA 3SX4A 5JAOA 1XRMA 4ZV9A 4J0KA 3H2JA 1PFQA 2BCEA 3VJLA 2I78A 3KWFA 3CCBA 2DQZA 4M0FA 4H7HA 1U2EA 4BTVA 2V9ZA 2FUKA 1DX6A 2IX9A 4BE9A 5AM2A 1T4MA 1CIJA 5SYNA 2WHPA 3OG9A 3HJUA 4EY4A 2BUAA 4DNPA 2WJ3A 4G5XA 4MJ3A 4G8BA 3QMWA 2BJHA 3QBJA 4B9AA 5H3HA 5AKZA 1A88A 4C4ZA 4JUIA 1K5PA 4PSCA 1TKRA 2IIVA 2RIPA 4Y2QA 1SCKA 2YH2A 3GBSA 2PSEA 4YPVA 5YASA 4YX9A 1EINA 4X6XA 3WWDA 4AXBA 1VE6A 1YB7A 4Y2UA 3VISA 3H2KA 4QDZA 3AINA 3B3QA 2B61A 3VJMA 4UFPA 2XLBA 5CH8A 2XE4A 5ALFA 3C6XA 4L0CA 2OGZA 4CCYB 1CUZA 4DGQA 3IIIA 3QPDA 3R41A 1GT6A 2JEYA 4FLMA 4IH9A 1DQYA 2BGNA 4LYDA 2DHCA 5A7HA 2Y6UA 1EVQA 2CZQA 1EX9A 1H2YA 3D2AA 2XUHA 2XMZA 3C70A 4ZI5A 1VOTA 3G8YA 3IUMA 1JFRA 5AOCA 4L72A 4DNFA 5EHXA 1AGYA 2QJWA 1BN7A 1ZIXA 4N8SA 2XMSA 3LP5A 1F8UA 5A6VA 1HPLA 1QIIA 5AKJA 4L9AA 2QKYA 5CW2A 1ZD5A 2C5GA 4N8DA 2Q0XA 3WA6A 1OILA 2XUKA 1TRHA 4IH1A 4AZ3A 4X92A 2QVBA 3FYUC 1G42A 4H35A 2HIHA 1Y7HA 4Z49A 2B9VA 2GYWA 4BVLA 1E3QA 1CV2A 3WKCA 2OLEA 5E4YA 1EH5A 2G5TA 2ROQA 1ODCA 4OYLA 4CCWA 3EQ7A 1L7RA 5AKLA 1A8UA 4B9EA 2O7VA 2QM0A 2CJPA 4AZ0A 1Q83A 5AM1A 4AN0A 1EI9A 2RHWA 4JH0A 2PU5A 5EFZA 5ALUA 3CXUA 4EHBA 3AIOA 5FLKA 2D5LA 5CT4A 1FFDA 5AO9A 1ZIYA 3WKEA 3GUUA 2H7YA 2WG2A 3W05A 1GKKA 4LHEA 4B82A 2WIDA 4PQEA 3MUOA 2HA2A 4Q82A 4ARBA 4QDUA 5FP0A 4WDRA 4H7EA 2UZ0A 5EIAA 4B81A 3F67A 3R3YA 4HS9A 2PSDA 4KE6A 4HAIA 3T52A 3PUHA 3WLAA 1IZ7A 1A8QA 3VDXA 1CRLA 2K2QB 1P0MA 3U0VA 2XUOA 5AI5A 5JAUA 1HQDA 3PF8A 3ESAA 1JU3A 3I28A 3FLAA 4QDOA 4J0HA 4QEKA 3F96A 5ALVA 2HFJA 3DEAA 3WIOA 3A6ZA 5AKHA 3LS2A 1YA8A 2GZSA 1F6WA 3A70A 4Y2XA 3E4DA 4FMPA 2HL6A 1LGYA 4EBBA 3D3NA 3DS8A 3PDCA 1JJBA 2J3QA 4BP8A 1WB5A 4ZWNA 4G8CA 4UHEA 3LLCA 1LPNA 5CT6A 2DSNA 3FYTA 5DNUA 2GBFA 2XUJA 4KAAA 3TEJA 5JALA 2Z8XA 4B84A 4Y2TA 4DLNA 1MJ5A 2OXEA 5CMLA 2JGFA 3NWOA 4OD0A 5C81A 3IA2A 5DNVA 2Z3WA 2BFNA 4PW0A 4NMWA 5D3KA 2CBGA 3L1JA 1O6GA 2RI6A 1XZKA 2ES4A 1TCCA 1TIBA 4GXNA 2WG1A 5AI0A 3BIWA 3B5EA 4H7DA 4V2IA 4BB0A 4U2BA 4J0CA 1BS9A 4KJXA 5AJHA 4X91A 2VT7A 3WL8A 1A7UA 5JZSA 1XZJA 2IITA 5LZ9A 4XWGA 1G66A 4X90A 4EZIA 1U4NA 2AJLI 4S0XA 4DNQA 1BEEA 4FKBA 1LLFA 3IUJA 3G0IA 5ALIA 3ZLUA 1ZJ5A 5K3AA 1XRRA 3H19A 1JMYA 4UBNA 2BUBA 2VATA 1QLWA 2VAVA 2PU7A 4X6YA 3HLKA 4AO6A 4AQDA 5LKAA 1GGVA 1XKLA 4OU4A 4RE6A 1YAHA 3WZMA 4GECA 4FLFA 3M81A 2HA0A 4PV7A 5HCUA 4BDSA 2ZYSA 4QZVA 4WCVA 3WK9A 3WK6A 3R3VA 1FJ2A 2XLCA 4KRXA 1UXOA 4H7FA 1XRQA 4WJLA 4NZZA 2WU4A 3WMRA 4W1PA 2LIPA 5K3FA 3V1LA 4W9RA 3QZUA 3ESBA 1PJAA 4G4JA 1HLGA 2W22A 4AMYA 1QTRA 5ISMA 1DU4A 1EA5A 3R0VA 4J0DA 4MEAA 3RKSA 5EHNA 5CT5A 2QRUA 3RLIA 5E4JA 2RGUA 1ODTC 3D59A 1QIGA 3FWHA 1UZAA 3S2ZA 3KSRA 1VA4A 5AK6A 4X93A 3UMJA 2E3JA 2WLSA 1U8EA 1SCQA 1MO2A 2GYUA 5EI5A 4MWSA 4RE5A 4EB0A 3D7RA 4HTAA 4J3JA 5AKIA 3ICVA 2WILA 4U2GA 3DL4A 4UBOA 1ZJ4A 5AIAA 2O2HA 5AOBA 4EY7A 4ETWA 1QO7A 2GYVA 4BC1A 2XQFA 1QOZA 4N5HX 1DINA 2DHEA 1GQSA 1IZ8A 3F9CA 2ZJ6A 2JEZA 1USWA 1XFDA 4MEBA 1QTIA 3HC7A 1FFBA 2C4HA 4BYMA 3HZOA 1R50A 4G4IA 2AJBA 1GPKA 5A7FA 5CTAA 5JZ9A 3L1HA 3RK4A 5BV7A 1ZI9A 1QGED 2CUTA 2B4KA 4Y2RA 2JGMA 5HF9A 4Q1VA 3HXKA 5LZ2A 2Y1KA 1BN6A 5DWDA 1ETHA 3S8YA 2DCMA 2PL5A 1DWOA 1XZLA 3R3WA 2WSLA 4M0MA 3KDAA 4TGLA 1GQRA 3B12A 2WIKA 4I19A 4BVKA 3DYVA 1ODSA 2WTMA 3MVEA 3BWXA 2XI4A 4OU5A 3EF3A 3M83A 1XZFA 5T4HA 3EBLA 1FFCA 5KWJA 4C01A 1E5TA 3BJMA 3O95A 4IH4A 5DYTA 3W06A 5LP1A 1W76A 2O7RA 3DNMA 4FNMA 3BF8A 2WIGA 5SYMA 3PICA 3G02A 1AURA 3WK8A 3VJKA 2OAEA 5JD6A 2XQGA 3H0CA 2AJDA 1CVLA 1C4XA 2XMQA 1CUWA 5AI8A 3K2IA 1M33A 2Z8ZA 1XZEA 5AM5A 3C8DA 3EIOA 2RONA 3ZPXA 3E3AA 4C87A 4DNOA 1QFMA 3O4HA 2YXPX 5ALMA 4QWMA 2FJPA 5HQ3B 5LZ7A 4KYVA 1AUOA 1XRPA 5DYYA 2OG1A 4GBGA 3KOOA 4MYDA 5K5EA 3R3XA 4KE7A 1CPYA 2HRQA 2WM2A 2X8BA 2XQIA 3H1AA 3V1KA 4PO3X 3WIBA 3I2KA 1IUOA 3HEAA 1UOOA 1YAJA 4Y7DA 2WHQA 4Y2PA 4UHFA 4G8DA 1LPAB 3SK0A 4P08A 5FV4A 1DQZA 3GZJA 4Y9SA 1ZGCA 1EK1A 5AOAA 1CUFA 1RWQA 4U2DA 2PM8A 1PV1A 2JGLA 4X3CA 2VJDA 3WWEA 1R4ZA 4GWLA 1QJ4A 5HK9A 5CRIA 1YB6A 2ZYHA 1U65A 3DCNA 1BE0A 4W1QA 4BP9A 1QIDA 5FKJA 3WJ2A 4Y2SA 5EGNA 2HU5A 3QYJA 5BWBA 3TRDA 4Q3KA 2WQZA 2H1IA 4UBJA 5ALWA 2WFLB 2J4FA 4MYSA 3WZLA 1WM1A 3H17A 3G0CA 4JEIA 4BTLA 1DX4A 3O4IA 1QIMA 3GA7A 3FSGA 4F21A 1QIEA 4KE9A 3AJAA 3VVMA 3JW8A 4BBZA 3UUFA 3C5WP 3PUIA 1MAAA 2WU3A 5ALXA 2QMQA 2VT6A 4PSUA 3OM8A 4J0IA 4Y2JA 1JMKC 5AK3A 1GKLA 2XUPA 5HF8A 4L3WA 3HI4A 4DMCA 1X2EA 5E4TA 1AMNA 3V1MA 2GBCA 5K3EA 5LKRA 2H7XA 3D4LA 1XQYA 2X76A 1GXSA 4BVJA 4H7IA 3WWOA 4Q3OA 2WKWA 2XUAA 5HKBA 1MNAA 2XDWA 1K4YA 1DWQA 2CEKA 1E8NA 1JU4A 2WTNA 5FDFA 3H2IA 4A23A 1CQWA 4C4YA 3W9BA 1CUUA 5F4ZA 1XKTA 4BDTA 2PVSA 2C5FA 4QA9A 1MAHA 1L7AA 3OPMA 1LBTA 5DLPA 5A62A 4JYPA 4TPKA 2O2IA 2G63A 4OB8A 4BE4A 4QLOA 3WYNA 4KE8A 2VA9A 1UWCA 2QR5A 5JD4A 4KR0A 4QE3A 4FLEA 3TGLA 1AKNA 1CUBA 2G5PA 1J2EA 4EY8A 3FYUB 2JGEA 4B7ZA 1H22A 4G1FA 4LXGA 1F0NA 3RARA 2JGKA 4CG3A 3DL7A 5ALYA 4UBIA 2CMFA 2HA3A 1H2ZA 4EY5A 1GPNA 1YR2A 1H23A 1XLUA 1EDEA 3QITA 5I7UA 4OUKX 3FOBA 3AZQA 1MNQA 2RHTA 4ROTA 3AZPA 3QMVA 3BIXA 5A71A 4K5QA 1Q84A 2ACKA 5I8PA 1CUDA 2Z5GA 3DLTA 4AO7A 1ZOIA 3L1IA 1QIFA 4BZWA 2HM7A 2QTBA 1BEZA 1DT5A 3R40A 5ALJA 4WY5A 5ALRA 4LXHA 3FAKA 4PSDA 2VQ6A 4Y2YA 3WQHA 4DTCA 3IDAA 3AILA 4CG2A 7YASA 4FFVA 3WWCA 1XQXA 2QS9A 2Y6VA 4F60A 3VXKA 5IH7A 2W6CX 3STVA 3VVLA 1JJFA 3RM3A 2WFZA 5ALEA 3WK4A 4FHZA 4BC0A 3T4UA 4OCZA 2OGSA 1HL7A 1GPLA 1XLWA 3F98A 4H0CA 1WB4A 1AC5A 5D3ZA 1B6GA 1H2XA 1R9NA 2HFKA 5HZGA 2XUDA 1LPSA 3K6KA 1XZDA 4F0JA 3H1BA 2BKLA 2OGTA 5FXMA 1R3DA 2I3DA 4F5ZA 5ALNA 3I2GA 1ZD3A 1C7JA 5CURA 4ZXFA 1I6WA 1DWPA 2RAUA 5JAPA 3C6YA 4UHHA 1W6RA 5ALOA 5I9IA 4UPDA 1MT3A 4P92A 4MWTA 4IO0A 3ICWA 5IVHA 2JGIA 4UBKA 1NU6A 1P0PA 3TJMA 4X7BA 3ZWQA 1N5RA 1VXRA 5ESRA 4WFKA 1THGA 5C8XA 3D5EA 3DOIA 4GI1A 3BXPA 2PPLA 3P2MA 1XQWA 5C7YA 5A2GA 4B80A 4LKOA 1XZIA 4CCYA 2ZVDA 2PSHA 2WHPB 3JYHA 3LIIA 1BCSA 3DJYA 5FPQA 5DNWA 4BAUA 1QIJA 3WK5A 1JT2A 3WI7A 5IKXA 5HF6A 4ZV7A 4KAJA 1R1DA 4E46A 5EHQA 2JF0A 5C8ZA 4EY6A 1YA4A 4DYHA 1XZGA 2OCIA 1Y37A 1YSCA 4WFJA 2XUFA 4UFNA 3LCRA 5JASA 2PX6A 3G9XA 4K2AA 2PSFA 2BAGA 4B6GA 1XZMA 4QLAA 1EVEA 1QE3A 4G9EA 4CIBA 1ORVA 2QUBA 3DYIA 4JYMA 4N8EA 1CUGA 2ZYIA 5JARA 5JIBA 4PNZA 2FX5A 3G9UA 4CI9A 4K6GA 1WPRA 1LPPA 2DFPA 1NU8A 5EIEA 1BU8A 3MGAA 1CUIA 5FRDA 5AP9A 1AZWA 2G4LA 1VLQA 4J0JA 3HSSA 3I2JA 3WYDA 3QPAA 5E2IA 3H2HA 2DHDA 1EDDA 2XUIA 1EB9A 5AHXA 1UK7A 2Z3ZA 2X5XA 2PBLA 1TQHA 3D0KA 4I3FA 4GLBA 2HHAA 3F97A 5AKXA 1IVYA 1YCDA 4OB6A 2QOEA 2VJBA 1D07A 4K6HA 3AIKA 1TK3A 4IHAA 5FOQA 4KAFA 1W4LA 3N2ZB 4I4CA 5EIHA 4C89A 5CXXA 3CCCA 3OC0A 3KD2A 4HXEB 2ZJFA 3BDIA 1FFEA 3STYA 5DJ5A 2OQIA 3QVMA 1TAHA 3E0XA 3IURA 2VJAA 5AKGA 4GW3A 4OSEA 1A8SA 3H04A 2WIFA 5D6OA 1MX1A 2XMBA 4IQ4A 3D2CA 3G0BA 1ACJA 1J07A 5EHZA 4Q3LA 3STWA 3OURA 3QMMA 4WDQA 1CUYA 1ZICA 2CB9A 5JATA 4FBLA 4FDMA 2ORYA 5K3CA 3R3ZA 1N1MA 1K6EA 4UBLA 4XJVA 3LIPA 4BCDA 5JZBA 3X3HA 1BRTA 2I3ZA 2HA5A 1THTA 3SC2A 4X94A 3C45A 4X00A 4FNGA 4U2FA 2OCGA 5C8VA 5AM0A 4OPMA 4QWWA 3A2LA 4MXDA 2VEOA 3GELA 3WL7A 4G4GA 5AI6A 2J4CA 1EK2A 2XMGA 4RPCA 2C58A 1W75A 4J7AA 1IUNA 4QDTA 3ZLTA 2YASA 2QT9A 4FBMA 1LZKA 4EA6A 4C4XA 1ZGBA 3WKBA 3I1YA 1E66A 1IUPA 2WG0A 2ZJ7A 3C6ZA 1CUHA 3O4GA 2NW6A 3DDUA 4K6KA 2I03A 1Q0ZA 1S8OA 3FSGD 4CIAA 4X71A 5ALZA 2PKYX 1TCAA 3CN9A 4BAZA 4QDXA 3NUZA 2JGJA 4FFWA 4XX1A 1BROA 3VKFA 4X95A 1L7QA 1JKMA 3IBTA 3FLEA 3ANSA 5LLSA 3ED1A 4KEAA 4MQLA 1OXMA 2XMDA 1UKAA 5AK5A 1VJ5A 2P8SA 4C88A 4HZGA 2GZRA 2VSQA 4UUQA 5ALSA 3W2TA 5AICA 4LIPD 3UUEA 1G5FA 3C6BA 1LNSA 1XRLA 3C8HA 2XQKA 4H77A 3STTA 1CUJA 1N5MA 3AZOA 1E8DA 1ORWA 3HABA 4JNCA 2H7CA 2WFMA 3Q8WA 4W63A 3JWEA 5LIPA 3BDVA 1AQLA 3PFBA 3HYSA 2EDCA 4BATA 2BUCA 3FVTA 5JYCA 4A5SA 5ALKA 3O0DA 1YS2X
chains in the Genus database with same CATH superfamily
1SO8A 5CNJA 2PUVA 4AZTA 2O5EA 1IBSA 4X60A 4K3UA 2H4JA 1OYYA 3LBYA 3N5CA 3ZV7A 4AAYA 2VHCA 4F9TA 3T06B 4G5FA 2Y77A 4FKZA 1MAWA 4TS4A 4YREA 3UCXA 4AJNA 1Z68A 2KBFA 1M8KA 1E5LA 2NTVA 4P0TA 3C3JA 4E12A 5LQCA 3U7QB 4QAQA 1B0UA 1DO0A 1WUTA 2ZIVB 1IOWA 1RPAA 2C9MA 2IS4A 3U37A 1FSGA 4DDTA 1G9TA 3K9HA 1U3VA 1WA5A 3Q7RA 1FMCA 5F35A 5HP4A 5CPBA 3BJRA 3OZVA 2HRRA 1S3FA 4R2WA 1BFUA 2VP6A 4M8SA 2E4XA 1V2GA 2JFUA 1JHOA 4AZVA 1WX1A 2VAPA 3KLMX 2Q2VA 4CR8A 2O5RA 5KU7A 3IPCA 1PTJC 4D5EA 1KMHB 1R8YA 2ISCA 3CJTA 2ONJA 5F23A 3VPXA 4AMGA 2JIBA 1TF5A 5AW3A 3ADBA 2J0UA 3ZCPA 3IVMA 3B1XA 3KYIB 1K06A 3CIOA 5GZ6A 2DFTA 2Z57A 2PLNA 5KHAA 3PTLA 2P9YA 3KVRA 4I9GA 4MYUA 4WADA 5CX4A 2ASVA 1YJ8A 3SFTA 1IBLB 1B41A 1SVWA 3KT8A 5HCIA 1FOEB 2O2EA 2OFFA 3S40A 5K09A 3E23A 2R8RA 3DHYA 1JL3A 2WMNB 2ECFA 2ZIEA 4TKVB 4ZDJA 2Q1WA 1KI7A 1ZDMA 2CXPA 3MJRA 3O4FA 3BXZA 5KNBD 5DRYA 3TBHA 1T5SA 2R8YA 4QNNA 4KNYA 2ZSAA 5EN4A 5HM8A 1PIWA 4G97A 1Z2DA 2B8EA 1FP1D 2A9FA 3C3BA 3JY6A 2BLNA 3VR2D 3CUSA 4RU1A 3K8YA 1GNRA 1TQ8A 1KR5A 4P3PA 4WZBA 4E03A 4EY7A 1MPTA 4X97A 4OKSA 1KQPA 2C2MA 3QE4A 4P3NA 3FCXA 4WKNA 1R10A 1FP2A 4Q9HA 1C7ZA 4C4PA 4UDXX 3I73A 4RK0A 3LNTA 5DM70 1VIYA 4L9RA 3PHCA 4HQOA 3O3OB 3T4XA 4DLBA 3W5DA 3LTEA 5A0FA 1RHMA 4J03A 1VXOA 2IYWA 2PBZA 1R74A 4NFHA 4ZAZA 2ZT6A 1N57A 1BWPA 1UBLS 2QXYA 1H3EA 2WWXA 4GNKA 5IH3A 1KQNA 5C7OO 1VKRA 1MLDA 3KKOA 1CIVA 3V00A 1TJNA 2B4TO 1J70A 1RWWA 3BE8A 3L8MA 1RZ3A 2ZJ4A 5I7SA 5K3FB 4HQKA 1MZPA 2AV6A 3DUWA 4RD3A 2ADFA 1CJTC 1ZRHA 2DBVO 3P9RA 3DZKA 2D4AA 5HFAA 4B6JA 3AI7A 4MP8A 3EEFA 1ULZA 1IJFA 3WGZA 4BMNA 4AX4A 5LP6A 1QRDA 1R6BX 3MOSA 1OH6A 5FBQB 3OOSA 1NQTA 2X9LA 2Q21A 4M1YA 4RKFA 3ZWWA 4KHPB 3M3PA 3IIEA 4WGFA 4IXMA 2JD2A 2ZG6A 3RYTC 3TX2A 3WLQA 1K3TA 3QVUA 2PX4A 2FPPA 1RQRA 3ANNA 1U94A 3G5TA 1GO2A 2C7BA 2Z1DA 2RH4A 3E7WA 4F2HA 4UXJA 5F51A 3BSYA 1G3IA 1ORDA 2WUDA 3AP2A 4HFRA 4LCBA 5B5SA 2RC6A 5JXJA 2EDAA 5IJAA 1VG0B 2R4UA 4ZYZA 3AUTA 1IATA 3UA3A 4F1KA 5K3DA 4H3VA 4O4HA 4PHGA 2FF7A 1MOQA 3I2IA 1BXGA 4CDMA 3CWQA 1RFGE 2GEDA 2C4VA 2F00A 1R4NB 3MD0A 2X5KO 4UHBA 4Z9BA 1WV1A 3HM9A 2GRUA 5DNDA 2X2FA 5A3QA 4W8HA 3MOGA 5JSYA 1OWLA 1MPXA 2PZMA 2IF2A 4FYMA 4OI2A 2HK6A 3C1OA 1J9EA 3E35A 4HNGA 2HA7A 1A5BB 1XJCA 4BZPA 1E2GA 4EMUA 3ABSB 4D56A 2VTVA 3VO2A 4OO3A 2XZLA 1W1WA 1RZRD 5G53C 4AULA 2PUJA 4J49A 3NP7A 2I7CA 2QR3A 2QTWB 1KS2A 1ZOPA 1N8NA 2R25B 3L84A 1SBTA 4QREA 3I6ZA 3TQSA 3G0GA 4BRSA 4M7RA 3SKYA 4C6HA 2AOUB 2ZB2A 4NG5A 5JJ5A 2WSSD 2ETXA 2W93A 4FQ8A 4TMZA 2HU7A 3LK6A 3JVUA 3DG9A 4XYMA 2WAYA 3PUJA 3ADDA 4D6PA 1CR4A 4YRLA 3ZY6A 1AZLA 3VOSA 1OYVA 3WLRA 1AZTA 2XNDD 2YMMA 4G4SO 4WZ6A 4AB1A 2VTEA 5LJIA 3E18A 3Q3CA 4FYXA 4C0WA 2YZKA 1UF9A 3SLRA 4MMZB 5KOHA 2AN1A 1GZ7A 1K9SA 1UMBB 2C84A 3IQFA 1J1ZA 2WHEA 3A9SA 3NUQA 4YK7A 3QW2A 3TLAA 2G0NA 2A86A 2NU9A 2IW3A 4RSGA 5AI9A 2GN1A 3NBAA 1BMFA 1D6SA 3RVNA 1E32A 4RPJA 1PYOA 2IUTA 1JQLB 2BP7A 3WQRA 5GADl 4R4JA 4HZUB 5BSWA 2GDJA 2FP4A 2Y92A 4UDYX 2D00A 5DNYB 1GAXA 4K87A 1M7HA 3OY7A 1GN8A 1UXJA 2VDPB 4IRUB 1W0KA 1KDYA 1YR7A 4UDNA 2QM8A 1L8AA 4JVLA 3E61A 3VPCA 3P4XA 1XTVA 1H85A 3AR6A 4E5VA 1CLEA 5HX7A 3OFSA 3B89A 3K16A 2X8JB 5KC8A 2ZDGA 1YE3A 3EVZA 4NBWA 2C97A 5COBA 1MU0A 3TLCA 4YV1A 2VDJA 4U7DA 1Q91A 2XB6A 3DVQX 4R8LA 2IXTA 5AIBA 3W9UA 4WUVA 4JIGA 1FQKA 1YC5A 2A1IA 1ZD4A 2EKDA 3MLEA 5K4GA 1WDWB 2WIAA 2XMCA 4K28A 1T8UA 4LY6A 5F9FA 4RQUA 3KWLA 5DHQA 2X7JA 1JN0A 1JZSA 3O1HB 4DM3A 2GPJA 3B2EA 2PUTA 4DMKA 1KRWA 2X19A 2HUNA 2MCFA 1L4EA 4TXMA 1V5WA 1KEUA 2P78A 2Q9CA 5AVOA 3DXZA 4V3CA 5FYDA 3BX1A 3FMFA 2CL5A 1V7PC 4INAA 5ECDA 4J07A 1C30B 3OWOA 5BOVA 5CXUA 4U2CA 5G3ZA 4ND5A 1OLUB 3P9PA 2PRZA 2ZYWX 3O2JA 4CMJA 3NEJA 1XROA 4P34A 3P0EA 2EWMA 3T7IA 4GQBA 1A4IA 1X39A 3RPEA 1FMFA 2A5DA 1AKYA 1DCMA 2V7WA 4XAQA 3ZW8A 5IZ4A 2HJGA 5ILGA 4UU8A 4G5GA 4D92A 1X8XA 2OHVA 2XYRA 4DRXB 4O6VA 4LVOA 5ICEA 3HKCA 3NZEA 4L95C 2J0QA 4ASUD 3DHVA 2IYZA 2I34A 5FBWB 2PKQO 2QZZA 1R88A 4TRMA 5EL0A 4LXTA 4KO1S 1GTG1 1IM5A 2GPSA 3DVAB 5T5QA 1FVFA 3U16A 1G5HA 4RD0A 1SA0A 4BVBA 5EJ8A 5DWQA 1L4YA 4G0WA 1NULA 5E8RA 4MARA 2CVPA 4MAFA 1Y8AA 3QBDA 1WB6A 4CLEA 4PG6A 4YCDA 1C9NA 1OA0A 1Q0PA 4PF1A 1VE1A 3TQOA 4E13A 2V9PA 3KAJA 3MILA 1P3Y1 3UA4A 1KVRA 3ZTYA 2QLMA 3NHMA 1M10A 2XVXA 1UQUA 4D0LB 1SQGA 3A2MA 4RK1A 3ZHQA 3CRW1 3RYCA 4ZHQB 1AHNA 4NICA 2JC3A 1ANKA 3HDGA 2QX6A 3PKZA 3PSAA 4PYOA 5ETJA 4W5TA 4JUBA 5IVIA 3RFCA 3SXUA 4ARZA 4ZVRA 4QYXA 4US1R 4QYIA 5E3IA 1J06A 4HNAA 2AJ8A 3RH0A 4G1BA 3RS9A 3VRHA 4B3FX 3UYLA 3CVUA 2WBLC 1EE9A 2X1LA 3DCYA 3OZAA 1DBQA 3EZ7A 4HAYA 4PTYA 3FHCB 1SRQA 3EZYA 2V98A 3G88A 5BWNA 2C77A 2PJRA 3DFUA 1Z4MA 2NTJA 3C43A 2L17A 2WIJA 4CMHA 4BMVA 4UTZA 1HEUA 2J09A 4IJKA 1N2IA 2EFCB 3OEEA 3L49A 1KOJA 4Z1MA 2K4MA 3UKOA 8ATCA 4GOXA 1F2TA 1YCGA 5BN1A 1DUSA 3EIHA 1B14A 2AS0A 2E49A 3ETEA 2HXSA 1OAAA 1K89A 5DTQA 4DIUA 1X86B 3KZCA 1U3FA 4RKYA 2NYVA 3VO8A 2A5FA 5AH0A 4EF4A 3MINA 3JVIA 2XWSA 4HAUA 2WFLA 3I6YA 3RHZA 1XDUA 1IDN1 3PCRB 1UAGA 3Q3IA 4BO0A 4FYHA 1BX1A 3EEYA 1BD3A 1H1TA 2R11A 1ECJA 3U9TA 1NVDA 3EUAA 5CVDA 2FW7A 3QFTA 4BWYA 1F2UB 1E2NA 2PRIA 1MENA 3MAGA 3IGFA 3R1IA 1CDZA 4EHJA 4R7GA 2O8FA 4UE2A 3G5MA 1UC9A 4XD2A 1YQEA 1UWLA 3ASYA 4ZDIA 1XYGA 1XYVA 2Y1CA 5EFOA 3ROFA 1Y33E 1HT2E 4LOLA 4ZQGA 2QE7D 4W1SA 4O63O 1VGRA 1LRKA 2IYEA 4OI1A 3JPWA 2FSPA 5L3SA 3CW8X 2W48A 3UJCA 2JIQA 5ICCA 5K0GA 3GVCA 4AKSA 3LYLA 3JD4A 3MK31 5JS7A 2IIPA 3C15C 3PRYA 3C1UA 2OZKA 5GOTA 2GBLC 3VYVA 1TT5B 2VRCA 4OMUA 2WWGA 4RS3A 4BWVA 1OLXB 1JSZA 2XY4A 2GCIA 5KNCH 4V0NA 3T4PA 4DG5A 4YT8A 1ETUA 1LXCA 4K9LA 4YCJA 3W4KA 1JIVA 1TTHA 2DU8A 4TXNA 2QTTA 3HXTA 3HXPA 3PXDA 4HRXA 4B48A 7ABPA 1KEZA 2E4YA 4NNOA 3IEKA 4ZRMA 2FUG6 4MVJG 1BX3A 3MWYW 4YMVA 3AMVA 5IVKA 1VHDA 2F3RA 3ICQB 1S2NA 3GCGA 4HNRA 2BFEA 2QN2A 2VJQA 5JROA 2GBGA 4KLCA 3GLHA 1X6VA 3CX7A 3DZCA 4W8GA 5LQUA 3HKBA 2E21A 2OQVA 4IMIB 2AEMA 4L22A 3PXBA 4CXMA 4OLFA 3KHSA 1P4AA 1IFXA 1UFOA 1SKQA 2XKBA 3P20A 4Q1FA 3A4MA 1A71A 3EQZA 4FDVA 4PONA 3F1LA 3TLJA 1PG5A 1CZLA 4I5GA 1YJCA 4PQRA 5GONA 3ROZA 4RNCA 1WXXA 3F78A 2PH1A 3EVFA 3OT4A 1EX1A 2X14A 3Q6IA 4NU8X 3ESZA 1BQEA 4IKOA 1NDUA 3ADPA 5CR9A 4QYTA 1NW4A 5BWMA 2H5LA 3TK1A 3ADOA 3JWPA 1B8VA 2HCFA 4EFNA 2YN0A 1C81A 3AEKB 4WBNA 3UGJA 5JVDF 4BMXA 2LKCA 5F1KA 1L8OA 2AXPA 3H18A 3R74A 4NRDA 1Q3KA 4B76A 1ZMRA 4FS8A 3AJRA 3DR3A 4D5GA 3ZU2A 4GIBA 4QM6A 4LS3A 4RTRA 3IJ5A 1XRNA 4AIRA 4D8UA 4O4IB 4MV1A 2GESA 1H2WA 1SHKA 1BWSA 1I0LA 1KI3A 1M8FA 1JKJB 2Q0QA 4RAQA 4TXJA 5ALGA 1L4LA 2IPXA 1OYWA 3OE4A 1L5FA 2D5IA 4PAWA 3HA2A 4JSRA 1EXWA 4RVDA 2IYAA 4MUIA 4XE5A 4WAUA 4MRPA 1ABBA 1YQUA 1SXQA 3B13B 1N36B 3SJAA 2W2KA 2FH5B 4F91B 1CZKA 3UB3A 4I8XA 5IAAA 1EDBA 4F5WA 3JZDA 4OAQA 2C2GA 2PFSA 2W0MA 3PIDA 4D4HA 3C8ZA 3N1UA 3LA6A 4G24A 1ODFA 1JWLA 2BFCB 5ALPA 1P1BA 1LDYA 2D1QA 2XZDA 2BELA 3I9NA 3FJYA 1F0PA 1S2IA 3AM4A 3JALA 3PR2B 4J1QA 2CYBA 4KRYA 5EPOA 2FPOA 2Q6IA 3ILYA 4NK5A 4PZDA 3RGGA 4TM7A 5IJWA 5K2OA 1Q21A 2CLLB 4HNQA 2JBWA 3DBVO 4DMGA 1VPVA 1Z2OX 4Q48A 1V1MB 1X13A 1N8SA 3AFIA 4IFIA 3ZWNA 1OI2A 1P33A 2Z58A 3BF7A 3MMZA 3NYQA 4ZN6A 4N82A 4NBTA 1J49A 3V2HA 1LF5A 3VPFA 2BR3A 2D3WA 2V96A 1I5OA 1XDGA 1K63A 1EBBA 2A92A 1RI5A 2V0CA 3FROA 4POOA 1UJCA 4BQEA 3U4HA 4CCAA 3MUFA 3I9KA 4KGXA 3C3AA 4WNAA 4X61A 2VSFA 1QH1B 1J0CA 1Z25A 4AN1A 3Q3VA 3GLGA 4F3YA 4LF7B 4CIXA 5AJWA 2W2QA 2QXUA 1KSHA 2HJVA 1UT6A 4YAEA 2P2ZA 5ALQA 4BV2A 2RHMA 3R0IA 2IHTA 4MI3A 2J3DA 3LZDA 2WOOA 2AW3A 1OXUA 2ZSJA 3L0YA 4FNAA 4GPBA 2O0LA 5I4IA 1STOA 3CNBA 3GQBA 1LY1A 1NXXA 2BEVB 2DF8A 2HQ1A 3PJFA 2ZJBA 4HPWA 4JBXA 4EW3A 4HT3B 5EVCA 3I9MA 4HN2A 2BCGY 4M9RA 5KYTA 1EG2A 2X6RA 4P9NA 4YXWA 1H4TA 2QVLA 3T5DA 1KL7A 1LBSA 1BXGB 1VZ2A 4WKBA 1QK5A 4FTWA 2YBDA 2BI4A 3GJZA 1JDZA 3DZGA 3TNYA 2WUEA 3MUNA 1FNSA 1DFGA 3B70A 4GPIB 2DKOA 3CTPA 4IDBA 3SWWA 1CJUC 2PXCA 1X14A 1G2PA 3CTMA 1QZTA 5HEKA 1NF9A 2VHWA 3WIUA 4QBFA 3CWZA 3M6XA 1AT1A 5SY4A 1UK9A 2EQBA 2G1KA 2ZYAA 2O7SA 2Q3JA 1E1CB 3C97A 3BEOA 4ENTA 1CEEA 2WM8A 5DULA 1LPMA 4RY0A 5EP4A 3RVJA 1YO6A 1XP5A 3AKZA 3EQ6A 5DTJA 3ZVNA 3KAKA 4LHWA 1UFVA 1EHYA 1QV9A 2CLHB 1A04A 2I54A 3HP7A 3LPCA 4IL5A 1UBGA 3QYPA 3IEPA 3JZFA 1DZIA 4RPLA 4MPTA 1FXUA 1URPA 4C9BA 1XCPA 3FVRA 1XNQB 3MB8A 3OCUA 3GCDA 3ZLVA 3E3OA 1C1XB 3FCUB 1R9MA 1MW8X 3M4YA 3EMDA 1KOFA 4P5DA 1OH7A 3ADKA 2R9VA 4YRCA 1G5PA 5MHTA 1WPQA 1RWKA 1KRXA 2R6JA 4JQOA 1LQ2A 2OL4A 3I4FA 2YIJA 3BERA 4E09A 3B8HA 4HVTA 1N0UA 5GAJA 2PYIA 3CLHA 4QOIA 2J59A 4RMHA 1R4AA 1S1MA 2VI5A 1TMYA 2VUSA 1CU1A 3LFUA 1XCLA 4ZIRA 5CDGA 5KZMB 3F6YA 4YNBA 7MHTA 3S29A 1XA3A 1DIOB 1S9HA 1OE0A 2VPTA 3FPEA 4EJFA 2OENG 5CB4A 2BI7A 1VIDA 4BAGA 1T2NA 1GITA 1EK6A 4Q4AA 5IAKA 1IPHA 3ZGVA 1U9YA 2JGDB 4R2KA 2B1JA 1QKIA 1O3YA 4X20B 2HJRA 2F43B 3QE3A 3MWJA 4DCCA 1SU7A 2I4IA 4QDJA 4AY4A 2AQIA 1JHQA 3CH4B 1DG1G 1JQDA 3H3XA 3KEGA 3V6MA 5JAOA 2Z5FA 4GLOA 2G25A 3TLGA 4G0MA 4JEHA 2FUG1 2D1YA 3I53A 4CEHA 1NBME 1ZM3A 4CM1A 3H2JA 1PFQA 2VJKA 1M2KA 1SHLA 3HN2A 3COSA 3CCBA 5LFAA 3ZZTA 4X8LA 1FX1A 1R3UA 4H7HA 1YCHA 1QVAA 5FBVB 3GAZA 3VOAA 1E77A 1ITZA 1XEXA 1B8OA 1I3MA 4DEVA 1RXCA 2PJZA 2Q3DA 2CNDA 2H4FA 5A05A 1U8FO 2XD9A 4N40A 5CIWA 3UNXA 3O9ZA 2IX9A 4ZZIA 4R9RA 2H85A 2OBXA 1U9IC 3IQWA 5BNTA 1CIJA 5SYNA 2X23A 4HDNA 3Q5EA 2NO0A 2WHPA 4NNPA 3O31A 4KPUB 3SZOA 2IGBA 3U48A 3OG9A 1SBNE 3HJUA 3TAUA 4EY4A 3VTZA 4BLTA 3RU9A 5GM2A 4EHKA 3WMWA 5IU6A 4B6EA 2ZRIA 3O2QB 2WJ3A 2JHCA 3D64A 1T1EA 1SXJC 2EJBA 3BWDD 4MJ3A 1E92A 2DFVA 3NM4A 4G8BA 4Z86A 4CKZA 4II2A 2GASA 3I8XA 3B1ZA 1S5PA 1Y1LA 4RF3A 2GO1A 1RHQA 2PH3A 2G9ZA 1G60A 1R5OA 5HZMA 1F8XA 4B6SA 1WCIB 5JNSA 3DLBA 4C4ZA 3L7AA 3HKCB 4UNPA 4CR6A 3NATA 4RD4A 4HLNA 1Z0JA 2XNHA 3LHKA 2AQKA 3FCEA 2ZIUB 1DAKA 2UUAB 4PSCA 2O23A 5KS2A 1TKRA 1WKCA 2J33A 4PIMA 1FY2A 2IIVA 2ZJ3A 4HJRA 3PGA1 4IIGA 3SX2A 1ZSYA 2X6QA 4C0SA 4HPXB 5L3RA 4J2OA 3CBGA 3OCWA 1J0DA 1G291 4H6VA 3ZV3A 3DE7X 2AW5A 1RKUA 1GZSA 4OHMA 3IP8A 4H27A 4G0YA 4IFEA 5H80A 4CT0A 3KYCB 1EINA 1JFFA 3NI2A 3PWTA 4AXBA 3FW1A 2X2OA 1V43A 3Q4GA 3H2KA 2Z43A 4MLPA 1DE0A 4JI3B 3NDIA 1YHNA 3OZBA 1Z9BA 3E9NA 4ZKEA 2Q5CA 4R1QA 2PD4A 2AF3C 4WE3A 4WESA 3VJMA 1JBQA 1MO3A 4ARZB 5F7OA 9LDBA 2IX3A 1UJ4A 4TUYF 1UT8A 1WULS 2AMVA 2OGZA 2C9DA 4L0CA 4O02B 4QQNA 4RULA 4O8ZA 2DOKA 1Q22A 2BKUA 2CXSA 1GGKA 1L4NA 3N0VA 4ZD6A 1ZQ1A 5KKCA 1J8MF 1T6XA 2YVAA 1IB6A 2ZSKA 5HFJA 4A2CA 3NHFA 1BCSB 4AK9A 3O1IC 1JPNA 2I6FA 2APJA 1JHMA 2PCJA 3MWEB 4U9HS 5J2UF 1IUKA 1MA3A 4O1HA 1KEWA 1R0CA 1S02A 2IA5A 4KG7A 1MGPA 5BQXA 4IH9A 1P6XA 3GJYA 3KDPA 1Z0ZA 2VPXA 4DLUA 4TL7A 3Q7EA 2H52A 3SQMA 1NC1A 2VSOA 3AR9A 3NORA 5ESWA 3IT3A 1XTKA 3BMQA 1XC7A 2DHCA 4X44A 1RRKA 4M6WA 3MEQA 4XYLA 4TKUA 4P86A 1IMOA 5EVJA 1BMTA 1EVQA 3MINB 3M7IA 2F3UA 1ESEA 4IEIA 1VCNA 1G20E 1EX9A 1Q7BA 3CW2A 3Q7IA 2P9JA 4MWOA 5E6UB 1T4CA 2RK6A 3T9AA 3LVRE 4RY8A 2VUIB 4ZI5A 4DBZA 1BWRA 2C2WA 4DCSA 3K0SA 1IM8A 3TR5A 3UMGA 3HR8A 3A1CA 2ZVPX 1B73A 1OTHA 2FZKA 2PEYA 4LOIA 1IN8A 3TFOA 1M5UA 1DXYA 4TYQA 3TTUA 4L72A 4O2BF 5FJJA 6REQA 1SK8A 3G1TA 5LNK6 1VDZA 4HKTA 5SICE 3F90A 3RS8A 2RE8A 2ECPA 1ZIXA 4GQIA 4DCNA 1T2VA 1C2TA 4HDMB 1ADCA 1RAGA 1W85A 3H1GA 2H4WA 3I92A 3LP5A 4KP7A 4LJ6A 4ZZ3A 4BNKA 5KOYA 2WMOB 4PR0A 4Y6GB 3FMIA 3GUVA 1NY6A 2ASEA 4U7FA 3MMPA 1OMOA 4MIKA 2DB3A 3BMOB 4W5NA 1BMFD 1JR3D 1CBUA 5DHTA 2HLDA 2DY1A 2QKYA 2H48A 3S1LA 4GXRA 5K05A 1MB4A 4L8WB 3LCVB 4MIYA 3V8VA 4MQFA 2C5GA 5G0VA 4N8DA 4IVRA 3ZK8A 4AROA 3NVMB 1CS0A 3WC4A 2FVYA 2PS3A 4UE3S 3T95A 1XQ9A 4AY2A 1OBCA 1Y4UA 4QXAA 4PRKA 4AZ3A 2OG2A 5IN4A 1W0KD 3T8YA 2H17A 1T5LA 1I3LA 2O5CA 3EBOA 3W3ZB 2A9OA 1UZMA 3JVVA 2BFEB 2HIHA 3A27A 2CWWA 4M7PA 2XB2A 1LLCA 1CE8A 1U0GA 3GLHB 1XG5A 2B9VA 3TSAA 4Q7JB 3VHLB 2BFBA 5C35A 5IEJA 1E3QA 3GRRA 4M86A 5C32A 5A9TA 4BO4A 2UUBB 4IIHA 3OT5A 2WU8A 3MT7A 3ZQKA 1D1PA 2MDTA 4OBXA 2G5TA 3QSYA 1U0OC 2ROQA 2F9LA 1T6BY 3L6BA 1E9VA 1S7GA 3D8UA 5JCOC 3AB7A 9MHTA 3CVJA 5AKLA 1LRJA 5EJGA 4Y6SA 3VTFA 3L07A 4EECA 4FBGA 1ZL0A 1GYPA 1FDUA 3FPHA 3IPYA 1QB8A 3KALA 2O7VA 5FFNA 1H0SA 3QBVA 2E7ZA 4DUZB 4AZ0A 3H9QA 1Q83A 4QBHA 4CNQA 5I4KA 5K4AA 3KKKA 1F7UA 4H1WA 1DEHA 3ISVA 4HN9A 3DULA 3U9SA 4RFSB 4R8MA 4RPKA 4EUEA 1NOKA 2MYPA 4BNWA 2DFKB 5IS2A 4G5SA 5T7BA 4GYWA 1RLTA 2C82A 3TJZA 2RGDA 2XDQA 1JA1A 2VSYA 4WCFC 4XUCA 5A0VA 3K0HA 4U3JA 2B1GA 3R3SA 2CMHA 3V7UA 2UDPA 4LTMA 3CXUA 4EHIA 1MJHA 3MIZA 2IKSA 5CT4A 5KQSA 4RIHA 4DKJA 5GV7A 5AO9A 5KDLA 3IEXA 4YBZA 4CLRB 2JCSA 3K4QA 3QEJA 4JGIA 4NI5A 4EYEA 1JLKA 5COAA 2QX7A 2H7YA 3DBRA 3E7XA 1E3LA 3H8SA 5FWXB 1GKKA 2AQ8A 2BEKA 4LHEA 1NVFA 2QTGA 2FCAA 4RLHA 2VK8A 2CNLA 4UCQA 4JGGA 3SDZA 2JW5A 1V6AA 1U1FA 3QBEA 3KE8A 3OJOA 3TOVA 2A35A 2AWOA 4KXUA 2ZGVA 4GMFA 4NZPA 3ZHOA 4WK4B 2YJ3A 3OQ6A 4AJJA 4Q4HB 5K7SA 3ITDA 1BKSB 1IE3A 1H8EA 4M1ZA 2ZRFA 1QAMA 1GL6A 3UHJA 5KX5B 2QUHA 4LDQA 1E9RA 3PXXA 1ZWLA 4QDUA 4WIAA 5ADVA 3TWOA 2ZR9A 4WDRA 3K0BA 5LBIA 2XEXA 1E9SA 2NUBA 3LFHA 1Z22A 2UZ0A 2VO1A 3LT5A 1K5HA 4H7EA 4PGAA 3UQZA 1UFQA 2Z6AA 4B81A 2W42A 3R3YA 2PSDA 1HDXA 3Q11A 1O4WA 4JOCA 4BB6A 1Y80A 2IOFK 2PR2A 3IR6A 5K0LA 1UM9B 4QLBA 4WNCA 4KQGA 1IZ7A 4PPYA 4U5XA 1A8QA 4AP6A 2HT1A 2QPAA 5JEDA 2ZWIA 3OPNA 2VHYA 1GEEA 1CRLA 4WNAB 1EP2B 1ACMA 1P0MA 2XRMA 1PJQA 1RQGA 1YDFA 5LMCA 4TYMA 4Z1MD 4O2LA 1SXJD 2O3JA 5GJCA 3KPJA 2A8YA 3L0OA 5FO0A 3H5LA 3OE7D 2XXJA 3GJ8A 1Y1TA 4CLOB 2ZRGA 3INNA 4GR4A 3D4PA 2ID9A 3GQBB 2ZJ5A 3FLAA 2ZU6A 3N8GA 4R1TA 1E1YA 2NYUA 4QDOA 4RACA 4RKRA 3F71A 4RHFA 1AOXA 4Z4EA 2BFFB 3OCXA 5HKKA 2LKDA 2LP4Y 3HMQA 3OPYI 2HFJA 3UM9A 4NESA 2FXVA 5ARCA 3AQIA 1G6HA 3VNRA 2XR1A 3AUYA 5DCLA 1ZMTA 3EWNA 2VHTA 5FTNA 2ZB3A 2ZQ5A 5CVEA 3WIOA 3I0NA 1FMTA 5CIYA 4XQ9A 2Z08A 2R60A 1U2GA 3KKNA 2WB4A 3LS2A 1OLSA 3PWKA 2GZSA 2WP0A 2BZGA 3W8RA 5IXSA 2VWGA 4F04A 1U0NA 2QAGC 2JG3A 3A70A 2ODBA 5SZKB 2IHZA 2ATXA 4LI3X 1YDEA 1QH0A 2JIPA 3AF2A 3EMVA 3ORRA 4OLBA 5LLTA 1FFGA 1OFGA 3RGWS 2PK3A 1JB1A 1LGYA 4DUGA 4P58A 3FNRA 4NENB 2VRCD 1AE1A 4F38A 3WAJA 2BIFA 5B1EA 2GLTA 1JJBA 1LBQA 1DIHA 4DCPA 7GPBA 3K5IA 2OZPA 2EIHA 1BHJA 3GT3A 1EQ2A 4G8CA 1N2OA 4E4YA 2FPIA 2JK0A 3S8MA 5CG1A 1NUQA 1NXVA 1SVUA 2YQZA 5JDCA 5LNK1 2PUAA 3EPHA 3PITA 4JBGA 3RTDA 4BE7B 2P9TA 4KNWA 2BEUA 1LPNA 3OZGA 2QX9A 3NHUA 4J29A 3UN1A 4EKGA 5C4IA 4YCAA 2EQ5A 3FNQA 1OUMA 2CHQA 4NCJA 3PD1A 5B1HA 3VHXB 1N9GA 2ZPUA 5DNUA 2JGNA 3OLWA 2WWIA 4EYOA 5JALA 4MCJA 1J2JA 3AYZB 4KDFA 2HO5A 1E4VA 1EUQA 3ORSA 5L7YA 2XTJA 2UV8A 1MJ5A 2C88A 1G8FA 2OXEA 1RXIA 1TU3A 1V6CA 2PANA 1VECA 1H8HA 3KLPX 3NWOA 2WR8A 5CMLA 1S96A 5EQJB 3USZA 3ZQJA 1W48A 2WUVA 4IEEA 1TYDE 3IA2A 4NEQA 3LP6A 1E79A 1TT7A 4RJTA 3TLZA 1J9GA 2G7MC 3KP1A 1R8JA 1W73A 1V1JA 2BFNA 1U7TA 1WR8A 3GFVA 3UUWA 2NXJA 3VNBA 3WQQA 3PEUA 4KQXA 5D3KA 3MERA 4LZLA 2ZRJA 1SUIA 2RI6A 4JSYA 4AKTA 2WI8A 5DGTA 3RR2A 1D2NA 1TIBA 4RZSA 4MQ5A 1FDOA 3WRXC 3BIWA 4BB0A 4Z2YA 3TIFA 1JQEA 2QTVB 3H65A 1E9DA 3EYAA 4RX1A 3RF7A 2GNAA 1J23A 2I2CA 3JARA 2A5JA 4W7SA 3RDPA 3AVTA 1JG2A 1NW9B 1T6NA 3F2IA 3KQYA 3JQ9A 3WIDA 1COWA 1W0CA 3MTAA 3I9V6 1W93A 1OXSC 3R5HA 3RBAA 1ICEA 1MB9A 6CHYA 1E1DA 1RYDA 1VL1A 5LOVF 5FI3A 4JYZA 3JAKB 3LUCA 4BFWA 4X7RA 2WC1A 4NFSA 2ZWMA 5DM1A 1XZJA 2IITA 1E2KA 4XWGA 4CV1A 3G8CA 1BXKA 4PZYA 5D5HA 1KDZA 2C5AA 1XPOA 2O3QA 3CEJA 4QSHA 3MD9A 2GPAA 3KJGA 3FM9A 1P73A 1AQYA 1FP4A 1FYVA 2AR9A 3BE6A 4LZZA 5L3QA 1HT3A 1BEEA 1W9MA 2ZUDA 4FKBA 2R7AA 3KTDA 4XJXA 5THXA 1CDEA 4L02A 4AIIA 5ALIA 1L7MA 1PP4A 4B80A 4TVSA 5B2FA 4NTZA 2PO5A 3O7WA 2CYCA 2F67A 4ZALA 1ZJ5A 2OBBA 4BKOA 2CD9A 1XTSA 4GEKA 1PG2A 5KQGA 3H19A 2HWWA 4UBNA 2BUBA 1T5TA 3FVWA 4LV5B 2HNKA 3LCJA 3IUPA 2VAVA 4KO8A 1E2BA 2IDJA 2PU7A 2QN9A 5LL6P 1RTKA 4RMGA 4DCMA 4DQ0A 2AC2A 1NQVA 3M4NA 3GR6A 4L4RA 4X6YA 3JASB 4PLPA 1T9DA 3BULA 1RJWA 2XH8A 1U02A 1G6KA 3KZMA 4JI4B 4DQKA 3EGWA 3ET5A 1YFLA 1YAHA 1CJMA 5AJUA 2HWYA 2PUDA 2BKAA 4H17A 2RHCA 4GECA 4CM6A 4LYHA 5JNUA 2FFHA 1GGEA 3TW8B 1ZHFA 1L7DA 2HA0A 1OBVA 3ZTTA 1PKXA 3DLAA 4RH0A 4QZVA 4QFMA 5DV9A 4UTRA 2V0NA 4WCVA 4BNFA 2Q2NA 3H9EO 4YC7A 1VE3A 1V9CA 1VB3A 2IXEA 3BKWA 4MGZR 3ZE7A 5C18A 3R3VA 1Q3HA 4C4OA 3UENA 2P9QA 2XZTA 2QR2A 4FSHA 4YXWD 3R5TA 4HATA 3M9WA 4MR9B 2XLCA 4PXAA 1O54A 4I14A 3U3RA 4GLLA 4H7FA 1VMIA 1XRQA 3F3YA 4LDPA 1AMUA 3K0KA 4FHFA 4E08A 4WJLA 1CCWA 4MIOA 3KCQA 2GZHA 4QXQA 2WU4A 1ZKDA 4A1FA 4CM8B 1EJ0A 2XCLA 3CZ5A 4W1PA 2LIPA 4W9RA 1DIGA 2X58A 4B3RB 4P83A 4CW7A 4U7GA 1XHFA 1MT0A 4IV5A 4OFZA 4CMEC 4RK6A 5FTLA 4X0EA 1K6JA 2VJMA 2ZOSA 5HZKA 1LVGA 3F4LA 2GKGA 4LBVA 2A58A 3T54A 1FZTA 3WLHA 1JSCA 2H2AA 3TVDA 1Y3CE 1T4CB 1IXZA 4W4TA 3TW6A 5EJMA 4M9UA 4RTOA 2W71A 4NFLA 1APBA 2OXTA 3KHKA 3IDSA 3N2KA 3QBTA 1G1MA 2VDWB 3FFAA 3RRJA 3ZDAA 3IVAA 3ILHA 2QTLA 2J67A 2RGUA 3PZRA 1JDJA 1ODTC 3D59A 3BGOS 3VAYA 1L1EA 1VHWA 2ZJYA 4QBIA 3IUEA 4EELA 3LX8A 2ISQA 2VHQA 1AKTA 1H0HA 3FWHA 1GV1A 1TC2A 2X8AA 1UZAA 4GOMD 4K6MA 4QU8A 4LZOA 2YUIA 3MW8A 4V0RA 4WLEA 3QUSA 4M0KA 4D99A 3OCVA 5CCXA 3TVTA 2BMJA 3CGWA 3OA2A 1RPJA 1TAQA 2E6KA 4CIWA 3DAFA 2QQFA 3ET4A 4NSNA 5FOVA 3WLJA 4E6EA 1ZVJA 1Q3TA 4EPVA 3H1FA 4B4UA 2GXAA 2BBTA 3ZWPA 4V24A 3WLTA 3IJRA 2CLDX 7REQA 3I5YA 3B9BA 2B1QA 4XPZA 3DC7A 3HADA 4OM8A 4R2XA 3Q8KA 4FOTA 1G9XA 3HHEA 3R9XB 3LQ4A 5KCMA 4G36A 5IDYA 1F3OA 1T1GA 4BFLA 5E3HA 1E4EB 1MO2A 2CDBA 4UPVA 5CA1F 3P71T 1P2VA 3T61A 1QPBA 2HMSA 1W5BA 4DY6A 4IDFA 2GXSA 4IIJA 3EULA 3AM1A 3UAXA 1TM7E 1WHSB 3CM0A 4HTAA 3SJ7A 4BNVA 3AVXA 1EYZA 4R68A 4IMJB 2QL5A 3ZY5A 1HG1A 1PGNA 1WL8A 4D74A 1KZ1A 3BB4A 3E8XA 1E99A 2WILA 3B48A 3WTBA 5AVWA 4U2GA 1IEXA 1RWOA 2DQSA 3DV9A 1NDHA 3UPTA 2IH2A 1TVKA 1KZ4A 1GNQA 1J8FA 2BEWA 2OKCA 1KP3A 3ZYCA 4HB0A 3KXKA 2R87A 3JZAA 3NC4A 2PJUA 4CMIA 3GP5A 5K6TA 1KJ9A 3BB1A 1XP8A 1YQWA 2HCTA 2QE6A 4ETWA 3HCNA 1RM5A 4BC1A 2XQFA 4RTNA 4BUJA 3KD3A 3CV3A 3ZGZA 4BECA 5B7GA 4EVIA 3E5NA 3OPYA 3CRRA 4PC2A 1IZ8A 2R85A 1II8B 3A0RB 3CKLA 4IOLA 1KXJA 3LV8A 5ADHA 1W4BA 3HC7A 1FFBA 3RTBA 1AQUA 2WF5A 3T9EA 3MC1A 2TMKA 1ECLA 3FE2A 3M6FA 1XGKA 4NKRA 1HNXB 1UPTA 1I7NA 1DRKA 1OFHA 2VUUA 4NIMA 4KCGA 5KC9A 2ZIZA 2F1RA 3RC1A 1GPKA 1I2BA 3OVMA 4BQPA 4CM4A 5A7FA 4KBYA 2FSSA 2O48X 1F8GA 2HSZA 5CVVA 4MS4A 1G8AA 2GPTA 2Q41A 2D5AA 3PXCX 1C50A 5BV7A 4G86A 2CN1A 1T3GA 1KZGB 1GL3A 1R0RE 2PSSA 3KUUA 1NVVQ 3QKSB 4FJ0A 3TEFA 3TSYA 1JB9A 1Y8ZA 2ZJZA 3I9V1 2MT9A 3CISA 4DCOA 1N6RA 2B4KA 3FWPA 3UKDA 4ED9A 1OI3A 2ZI7A 3LNCA 3ROMA 2JGMA 4E88A 1Y6GA 4R2JA 4P80A 5HF9A 1JLMA 3TMAA 3HXKA 3GA0A 1C0EA 2UYOA 3SEQA 3S8YA 3QP9A 2DCMA 5DHUA 3IB6A 2QBYA 1Y1SA 4M0MA 3KDAA 1RCUA 2I9PA 4JBLA 5M29A 3MIIA 1NG1A 3CR8A 3BE5A 2NYRA 3QTTA 2H1OA 1U11A 2ZIWB 4MKGA 4ZDKA 3FSJX 4BVKA 4TL9A 1XN4A 5JSFA 3BWCA 1R9JA 1TQ2A 2H1CA 4EQ6B 2A57A 5IKEA 1FZQA 4JVSB 2XI4A 1O96B 4OU5A 1Q92A 4DILA 3OQMA 4GSYA 4CPDA 4MDEA 1BH2A 4OA5A 2HTFA 1CY4A 1MDBA 1OPXA 4DREA 5L45A 4KWIA 5LP1A 2IYFA 2FE1A 2KLHA 3A25A 4PLTA 1YGPA 3F6SA 4LJRA 2O7RA 3PQ8A 4ZT4A 4PAOA 3BF8A 3EUEA 4GRIA 4HGRA 2WIGA 3PICA 1AURA 1PGPA 2OAEA 3AJDA 2XQGA 4UEWA 4B6RA 1KFBB 3LO8A 2I2WA 1KIMA 1SU6A 1YR8A 3PK0A 2OQ2A 3RVPA 2AJDA 1E3TA 2YHIA 3L1UA 2WKQA 3FCOA 2DFLA 4P54A 3EZLA 1XMSA 4L5AA 3U49A 2RAPA 3UHOA 4J7XA 4FD3A 3JRNA 5KYYB 3AR2A 1KC1A 1U6KA 4JY7A 1M33A 4RM3A 1E2PA 5IC6A 1XZEA 1IWBB 4BGEA 2RONA 3CLTC 3WGJA 4PN7A 2JZCA 5D7NA 1WDKA 2V3VA 4HX2A 4C87A 1CY1A 3UK1A 5ALMA 4LJSA 4Z54A 1T4BA 3U17A 5HQ3B 4H9GA 3A6LA 1Z5WA 2O8EA 2BT4A 1TQ6A 1AUOA 1DP4A 1FE8A 1VYUA 4V0MA 2AD5A 2HK8A 4JEMA 4YAGA 3TZLA 1RBQA 4GKVA 2O2YA 3L8HA 4YUZA 3A9VA 1N6HA 1R9GA 4RF5A 2WZQA 2IPNA 1RXYA 4QUAA 1EE2A 3I01A 1F2DA 3GH1A 5CBPB 1M34A 1ULBA 3JQ9C 3PLRA 4JKYA 2ZS7A 1UXGA 3R3XA 1P5RA 2H06A 1YIAA 2WM2A 2X8BA 2NADA 2XQIA 4RV9A 3V1KA 1M2HA 1JPUA 1ZZEA 4R1PA 2JLVA 3LY9A 1HQCA 1L4BA 1CNFA 1KTVA 3A3PA 1RFLA 4JVMA 1CRZA 3CKYA 1A76A 2VP0A 3V6LA 2CVZA 4RZ2A 1QH8A 2EJVA 2CVHA 1DCFA 2I87A 4RPHA 3MSXA 4Y7DA 3Q0EA 1V7CA 2REQB 4PHHA 4Y2PA 4ER5A 1X9GA 2XXAA 4GO1A 1N9GB 4D82A 1SQ0A 3ZHCA 5TMDA 1R0WA 3LRTA 4RLSA 1NLYA 3DNFA 4CM3A 2QPLA 1R5BA 4RY9A 1T5OA 5FV4A 4LZWA 3IALA 5CVJA 2YRXA 1UP6A 3GZJA 3QI7A 4MO9A 4OHFA 4EUKA 3PHGA 4DWJA 3VH4A 1RYMA 3UY4A 1RDFA 1KYXA 3GHYA 4ARUA 1MHTA 3CZPA 2RH8A 3N2NA 3CNHA 3FWYA 1JXQA 5E3JA 1XTJA 5EPUA 4RYDA 2PUCA 2Y1OA 2QPOA 4S1TA 1VCOA 4QO8A 3VM6A 3BMNA 4L5YA 1OD6A 3TX6A 4X64B 4B6QA 4EHFA 5CRIA 3KKLA 2TMYA 2HRDA 1A9RA 2QUZA 1YB6A 1W5TA 2J6CA 1W4RA 2I66A 1EGMB 1U0TA 2IXBA 1C9YA 1FRZA 1GNVA 1WZIA 2RGAA 1JSLA 3BHNA 4TTQA 5CLHA 1NNUA 2YZ2A 1PT9A 3B38A 2DKNA 4BP9A 3OX4A 1XMJA 2QV7A 5FKJA 1Q1GA 1Z2CA 3RYIA 4ZJZA 3QYJA 3OZRA 1OT3A 4HUQA 3NIFB 4HOYA 4DLSA 5BWBA 5JARA 3MJ4A 1MQSA 3UCFA 3F7NA 1ECGA 3EWSA 1LSJA 4IS2A 3HWX1 4K6OA 4LA4A 3TBFA 4ZI7B 5AW4A 2FN8A 2WY2D 5D8DA 3OF2A 3GCXA 1WMDA 1GDDA 3ID6C 2C4UA 4AKHA 2UZ1A 1M1YA 4JT4A 4Z9FA 4HG2A 1H1LA 3GUYA 3Q7QA 4QUJA 3SZGA 1D4FA 3HJHA 4JEIA 2OLJA 3A6HA 3EDRA 1QIMA 1OVMA 3GA7A 2XVYA 3SKXA 4TSFD 4XUDA 2O50A 4D9BA 3ASUA 1DUIA 2PX5A 2HOQA 2VDRB 3RVSA 4ER6A 1H8ED 4MW6A 4MUMA 3EPLA 4BVGA 2EYQA 4GMHA 2BHRA 4KE9A 1WLYA 2IW1A 5ILOA 1C14A 3JW8A 1W19A 1CRPA 2NO4A 5F21A 3PUIA 5HSGA 3T5MA 2X3YA 1I5RA 3X1WA 1T0IA 2R97A 2X7HA 2Z8YM 2KI5A 1N1EA 5E6RB 4DVJA 2B7BA 3REGA 2VT6A 4PSUA 1O95C 5E9JA 1SXPA 2YHAA 3PS9A 2H08A 3MTDA 3AUSA 4J0IA 3D7KA 5C1IA 4KR6A 2QDXA 4R2IA 2ZI6A 3BM5A 4B5LA 4R2HA 4Z51A 4LHVA 1G7CA 5CYPA 4RJKA 1EVKA 1ZEMA 1KOLA 2BRUA 1J25A 1W30A 4CF4A 3AWIA 2QW8A 2Q0HA 2HB6A 1Z26A 1X2EA 4N0DA 1UR5A 4XQ0A 2JVKA 1YBAA 2GBCA 3N3BC 1OYOA 4KN5A 3ZG6A 4EO9A 1RJ9A 2Q2WA 1DBRA 1PJ4A 3K4HA 4MROA 2GCPA 4PE5B 4XH9B 3V4OA 1VGVA 1GXSA 3HPRA 4Y6LA 2WWFA 2MYNA 3LDHA 4FU0A 4XWWA 4H7IA 4OH7A 4ZMBA 1NJ8A 4MR7A 4Q3OA 1DQPA 4XGIA 2AR7A 2Y68A 3OI7A 2EYUA 3FNGA 3T15A 5KQRA 5HKKD 1QC5A 2FMTA 3KKZA 3K73O 3WBBA 5REQB 1GPAA 4FWTA 2BN4A 1E8NA 2NTNA 3QG5A 3RFVA 1JU4A 2R6R1 4D8XA 4J1TA 2J87A 2XW6A 4IHQA 5F4ZA 4NBLA 3SF8A 3GUHA 3HNRA 1DJPA 3IQIX 2UXDB 1BMQA 3QYFA 4E5DA 1IOLA 3NO4A 4XSGA 4YN3A 3RJ5A 2IBTA 1JQ5A 1G21A 5AHOA 4ZVVA 3JD3A 4QA9A 4NXNB 3NHJA 1MAHA 3OPMA 1V96A 3O92A 3EODA 4XD7A 5EYPA 3L43A 1KMNA 1KYYA 2ZJAA 1XE3A 1RCFA 2DPGA 4GKAA 4KVZA 4Q16A 4BNHA 2GZ1A 4M55A 5DLPA 1C41A 1SCUA 3UJAA 3ZDCA 4DUGD 3WGHA 3O8QA 3E82A 2G63A 2J48A 3AHIA 4YRKA 2ZM6B 3V3TA 3VKVA 3MGBA 4BFXA 1C1HA 3DBLB 3FDIA 3PC8C 3PDIB 4OHRA 5BSUA 1FX0A 1L8LA 3GRPA 3NOVA 4TQGA 4XWTA 5U4XA 4ZT6A 1JNYA 4K03A 2QR5A 1GG8A 4NMLA 4BNMA 1FSFA 2R79A 1GNSA 2AN3A 2CLEB 2V5AA 2VP3A 3A4LA 4Q9DA 4RORA 3HXMA 4FLEA 4YJKA 1U7WA 3GLHE 5I48A 1SH7A 3K9WA 4NLLA 3TMYA 2QENA 4TLAA 2PS1A 3IMFA 3GDHA 1AKNA 1NF8A 2GEFA 1J2EA 1ZA2A 4MS3A 3R7LA 2COUA 1YRWA 4HX9A 4WLOA 3UK6A 4G56A 4Z0TA 5IZCA 4LK3A 3FYUB 2Q3BA 1R37A 4FIDA 4MS1B 1OFUA 1A1VA 1ZH6A 3WS7A 2DCUA 3UBMA 2Y71A 4K86A 1D9XA 2ZBDA 4NONA 2BCJQ 4M49A 5EA2A 1I7PA 4TX1A 1EEXB 4R0MA 5BOSA 5A4MS 2D8MA 4EFDA 2LDBA 3PDWA 1I7DA 1IIBA 4Q7LA 2YJ4A 5ENVA 2RHBA 3EVBA 3QITA 1E79D 3EWAA 1U3TA 1GPMA 1Y9EA 2Z8YA 1MNQA 1J8QA 3CLTD 2RHTA 3WLFA 2PQ6A 3AZPA 4R9NA 3KNZA 3QMVA 4KO3S 4DA8A 5C9ZA 1Q84A 2PBFA 3FHOA 4JNKA 1A69A 2RB5A 3KVOA 1ISJA 4JB3A 3VPDA 1ZC3A 4CGZA 5BQPA 1D03A 4MW2A 1CUDA 1KAGA 3T3NA 3DLTA 4JOBA 1PWYE 2JFHA 1ZOIA 3LQFA 4IDGA 4LN1A 4C0XA 5I5EA 3IP6A 4XDHA 2I71A 3F3KA 2QTBA 4PC3A 5EXTA 3SSMA 4JFAA 1DT5A 3U4DA 3GA5A 4I50F 4F6CA 5GTDA 4EG0A 3HS3A 4IHJF 4WW0A 1PNQA 2PUBA 4REQB 3FHJA 4PSDA 1U6JA 3RAGA 1COWD 2FQQA 2FPRA 1GUFA 1W5EA 2MINA 3FUCA 5EXXA 5J2TF 3WQHA 4DTCA 1SAYA 2D6FA 2JVIA 3BXGA 1U0JA 3HB0A 3AILA 3IDAA 1SB9A 3QJGA 4MV4A 3OZWA 4Y7CA 3R6GA 4NPCA 3V4VB 4EYQA 7YASA 5IBCA 4ISCA 3T9FA 2WDZA 3L0PA 3CUTA 4X1YB 2MSKA 3VPSA 1YTUA 3IMEA 5IH7A 3EFBA 5JJKA 3STVA 4ZPJA 1JJFA 1NC3A 3E5RA 4OI0A 3I39X 3R7AA 3JQDA 3EA5A 1PWXA 5ARDA 3W7AA 2J9FA 3S2YA 1YOVB 3OLQA 3G89A 2QZ9A 3IILA 1KVSA 5JFOA 5JYEA 3H5WA 5CUQA 4LHXA 2LR0A 2YTZA 3RWBA 3D8NA 4KMRA 1GCOA 2I2AA 4GS5A 1GZHB 2RGYA 4JYBA 4ATNA 3CYFA 1A2OA 1HSOA 3HWRA 2H9IA 2VSXA 5LQSA 1QQBA 3ADCA 1HL7A 4YYZA 5AJVB 2B94A 3NW9A 4F4IA 5JMTA 3T0FA 1UWVA 2JKYA 4P31A 4H0CA 4X66B 3RVRA 1B6GA 4HFNA 2JLAA 4YONB 5GWXA 1GZ3A 1Z6XA 1U9JA 1J33A 2FQ1A 2WT9A 2XUDA 1GL9B 1ZJYA 2BEJA 2GJ8A 1E1RA 3HA7A 3ILVA 4UASA 5K8VA 1WB9A 2QBYB 5FOSA 2HW8A 3H1BA 3SYRA 1C1DA 4OX9Y 3IAUA 4MKHA 1OZ0A 2AMJA 4EIWA 2OGTA 1Z12A 1GPBA 4BQRA 4DARA 1R3DA 1CRQA 2D13A 2DAPA 3ZGXA 4CF3A 2AYYA 4F5ZA 4R6XA 3GJRA 5CURA 1JZQA 1FLDA 1L7EA 5LR6A 1QYIA 3HO6A 3OAAA 2Y1XA 3QXXA 4ZK2A 1NSYA 4HQNA 2AVNA 1C7QA 2XF2A 1W6RA 2WVHA 3CVOA 3VI3B 4BNDA 1MT3A 4MWTA 3G2NA 4UTVA 3FYSA 2QI9C 2W8BB 5G1OA 2GI4A 2G88A 1QZUA 3BWBA 1IPEA 1MRNA 3VKGA 1KJQA 4X7BA 4P22A 2IVZA 4N54A 1N5RA 1VXRA 10MHA 2ZUSA 3L6EA 4L28A 1O5OA 4WFKA 3I4CA 5TY0A 1WNTA 2GLXA 1QHHB 3GV0A 2EARA 3PC4A 5C8XA 3EPRA 2R5FA 3DOIA 3DNPA 4NE7A 2J9YB 4TM8A 2H16A 4HB3A 4ND7A 1XQWA 3ZD6A 2QM7A 2VPPA 1P0CA 3HSKA 2GJKA 4RA6B 2VXOA 2C9OA 3WB2A 3ZZUA 1H4QA 2G1AA 4KXYA 4RVNA 3S28A 3VZSA 5C8YB 2HQRA 3H11B 4JQCA 3BWVA 3UH0A 1DAFA 3GEMA 4NS1A 2GYYA 3QV1A 4PG4A 2F48A 1SQSA 3NRBA 4QOGA 3DKPA 3ZV4A 4ENWA 3GJ6A 3RF6A 1SN7A 2PIDA 5BMOA 3DM5A 3BGSA 5BR4A 2QD2A 2HBZA 3BIOA 3ANMA 2ZRCA 5K2MA 1E4OA 1XO1A 3L8DA 1W96A 1TJYA 3NXKA 2MSCB 4XIFA 4OX9B 3NJRA 2VDQB 1N5KA 1QIJA 3WK5A 4QHYA 1EZ1A 4O2AB 2AKYA 2JFBA 3TL6A 3JR3A 2YZGA 5AJZA 4S24A 2PMWB 1KDVA 3F6EX 5IYZF 3LUKA 2XBLA 1I94B 5LXTA 1GCGA 1GY8A 2WAOA 4ZV7A 4EKYA 2NVUB 4OBEA 4II7A 2IDZA 4KAJA 4KRFA 1ZGHA 2P62A 1XK7A 4KDRA 3ELYA 4RJIA 1VCMA 4QQFA 3UWPA 1DC7A 1QFXA 3LX6A 5ICMA 4BYGA 5HIKA 1Z7GA 4EY6A 3RROA 1RJDA 3LM8A 3TNDA 4BBPA 1YSCA 2ZB4A 1SJ9A 3U7GA 3W1VA 4FS3A 4KIUA 2B69A 5T6BA 2BH2A 5EOVA 3WYFA 1AK9A 1YGYA 4BFSA 2VDOB 2CV1A 3K31A 2WRZA 4PLGA 2RGBA 4K2AA 4DA7A 3TI7A 2DHRA 1J21A 2H3HA 2M9MA 4CKBB 1VKZA 2CXXA 2FSFA 3EXHC 3GD5A 3W9YA 2PSFA 4NZOA 1USKA 1PR2A 1SIBE 1F14A 3I9FA 4J9VA 4F6RA 3QX3A 3FIUA 3IP5A 4QLAA 1BXRA 1H2FA 2XKJE 4QRHA 2BRUC 2A0FA 3VNQA 2CXHA 3BMNB 3K0FB 1E18A 1WZ2A 4DQUA 1ATIA 4UVEA 3DYIA 1Y3BE 5A6SB 1EFPB 4QG7A 2JJ2A 3Q5GA 3LF1A 2QLTA 5HTKA 1ZSNA 2ZYIA 2AN9A 2GRAA 3KSMA 4AZWA 2WYHA 2YY5A 5E9WA 1RXUA 1TK2A 3HA3A 4HF7A 4RWEA 3FI9A 5E1BA 1IL0A 2PJDA 4YRNA 5K6RA 1SY7A 5JV5A 2B5VA 1S8NA 3IBSA 4K6GA 1DARA 4LG1A 3IPLA 4FR0A 5AQ1A 2DFPA 1HLFA 1NU8A 2BJVA 3JQFA 4UMEA 5EIEA 5FJIA 4URVR 3Q15C 4YDRA 3I04A 4I1PA 2QTNA 1PVDA 1YHZA 1CUIA 1THZA 3G2JA 1JUDA 1RZUA 3LDAA 3ZEIA 4LXXA 5AP9A 1AZWA 5LQAA 1M1YB 2Q6KA 1XAHA 1U9CA 2VBFA 3NT4A 3OETA 1H1LB 4J0JA 1J1UA 2Y8EA 1UBKS 3I2JA 1FS5A 3PDHA 4JJEA 4LE0A 1NR5A 1XHEA 1ZNQO 1Y4ZA 3QPAA 5E2IA 3ED5A 5G1NA 2GAFA 3JXEA 5LA6B 3ZGYA 4A8JA 1GQYA 1OXXK 3NS7A 1GTMA 5JCJA 4C2BA 1EDDA 3ZBQA 1BS2A 3NCTA 3O38A 4AJHA 3G79A 4ZGGA 4S1PA 2Z3ZA 1CW2B 1ZRMA 1E0AA 1IY2A 1L5YA 4ICIA 1E9FA 5AW0A 5FWNA 4CKCA 1DKRA 3ND8A 3RABA 3PYXA 1IM2A 2GQ0A 4GLBA 2DETA 1B8PA 3QY9A 1CYDA 3FXAA 3DV2A 2GOYA 4Q7EA 1SU8A 2YIMA 2MSNA 4IR7A 3B3GA 4TV9A 2DG2A 4MLCA 2VXCA 2OO7A 1G6Q1 1TMGE 2FHPA 1X7WA 1YJXA 4HDKA 3AR4A 2VJBA 3F7OA 4MUBA 4PX9A 1E60A 3FPJA 2B2CA 3IOMA 2I8CA 4PSKA 5CA0A 5LDHA 2LV8A 2M2IA 4RIEA 1U3GA 5HE9A 4IIVA 1C0KA 2FDRA 3V8QA 1GRRA 2HDOA 4RELA 1XJQA 1ATZA 1GPDG 1W4LA 3DAPA 3OZCA 4RO0A 5HCNA 3WV4A 2IHKA 3OFJA 3RS5A 1SBIA 4Z4IA 1KYWA 4O25A 1NNLA 1RJ9B 2QSUA 4XIGS 3N8KA 4JCCA 4LJ8A 1ZITA 3IKVA 2VR1A 2P1RA 3OC0A 1ESCA 1A9ZA 2GKOA 2QTZA 4D9GA 2ZYUX 3FRJA 4OAPA 3PFGA 5GOZA 1DQNA 2NSYA 3ONFA 2RKWA 1JQAA 1KQ3A 1UADA 3TOXA 3RRNA 3HUFA 3UW3A 3EG9A 4Y9RA 2M6SA 5DNAA 1K08A 4AT1A 3A7EA 1X7YB 1YZLA 4P7FA 5H9VA 3WLIA 2OQIA 4U39A 2O2JA 4YRGA 1XWWA 3U60B 3IURA 2IJGX 3T41A 2B8WA 1X7GA 1CWUA 2VYVD 2AFVA 1JYEA 3DMDA 5G0UA 2J3IA 4ECAA 2C5HA 4DJJA 5H8WA 1Q0QA 3COPA 1PLKA 3EAFA 4JLOA 4QIHA 4WZAA 1B93A 1A8SA 5L3ZA 3LPAA 2HBYA 3VZPA 4RGBA 2ERYA 1U63A 2Y4NA 2OXIA 2XCUA 2W11A 4WLFA 4FJ1A 4WRRA 5C5EA 3ZBUA 1EEHA 4BV8A 5DPMA 1UXKA 3UAGA 4JLMA 2CLMB 1ZCZA 2GA8A 1MBZA 1XL1A 2NO1A 4CIYA 4K05A 4QNRA 3O8QB 3R5XA 2PD6A 3M0EA 4Q9NA 2P5TB 2VH5R 2VDUE 1L5GB 4WDQA 3P7MA 1FX0B 3DLPX 1VLJA 1Y8RB 1N4DA 3D7SA 3N2EA 5D00A 3TGWA 4Z3OA 4FDMA 2ORYA 3NAMA 5EE9A 2G70A 1MH9A 3DYBA 4LOAA 3DEFA 2XB8A 1IHOA 4PYNA 1SCBA 1G8JA 4XLTA 2WJPA 4BCDA 3EGEA 3FDFA 1KAOA 1ZK1A 4EENA 3MUEA 1THTA 1XV5A 3LUBA 3SC2A 5ARBA 3RCBA 2G6TA 2A9PA 4CHTA 2QX4A 1FU7A 2R6DA 4P2BA 3W9SA 3HVRA 1EX6A 3CX4A 2WD7A 3EGOA 3MRXA 2VP2A 1KH2A 1ZLXA 2H1VA 3GFGA 3NB0A 3LDUA 3OJLA 4OXYA 4YHBA 2QNIA 1L1RA 4TL8A 3T5TA 1EAMA 4D8YA 4U2FA 2OCGA 2QRJA 3OPXA 4ZYTA 2H07A 3L6DA 1XZ8A 4S1VA 1D5WA 2QTMA 4DV0B 1BGXT 3HK2A 4GKJB 2FFRA 3JZIA 1W8IA 1RKVA 3A8TA 3DV0B 3IMKA 3KRTA 4KLAA 4OPMA 3HCOA 3OQIA 4P38A 4Y2GA 3QOXA 3HU2A 4RIGA 1GTVA 2W9XA 3SQOA 3W1EA 4F8YA 5A02A 4MXDA 1XZPA 1G4UR 4DLYA 5LJLA 3K9GA 1MVNA 4N03A 4RK4A 3WL7A 4X41A 5CB8A 5CNKA 3DTNA 3KFVA 5BY2A 3BXEA 1G0NA 2OZEA 4FFLA 4RVHA 2GD6A 2X4DA 5CDUA 5LQJA 2GM4A 1M6EX 3SS8A 3A1EA 4K9KA 2GO7A 1YZVA 3OWXA 3ABZA 2WZCA 2XV1A 3VH2A 4WT7A 1QBKC 2GEUA 2ZRLA 1XCGB 5DGIA 1T4DA 3HJTA 3R0QA 4D46A 3DOEA 2YASA 2QT9A 5F52A 1JG4A 3CLSC 1AUQA 4EA6A 4UM9D 3QXSA 3FDZA 5G3YA 4LX8A 3R8FA 4PGGA 3VNSA 2FKNA 4QQKA 3MLAA 4UOZA 3NKFA 2O0JA 4YCSA 4OXRA 4ESHA 3HH8A 4MQ6A 3GXOA 3DOFA 5IDWA 1MVOA 3O4GA 3C6ZA 1CUHA 4PSAA 2B9EA 3MF4A 2JFXA 4JLUA 4O8CA 4UUAA 3KYDA 4X65B 1R0BA 2LW7A 2VDNB 3OOYA 3ZHUA 2J3MA 4EEXA 3OF5A 2I3BA 3PKIA 4QO7A 1TYCA 3KB8A 4XOUA 4GRDA 1RHRA 2YRFA 4QNMA 3RUHA 5CM2Z 4YMWA 5KO2A 2H92A 2PYDA 1XALA 3SN6A 5DM4A 4CQNA 1P45A 1XAJA 4KKXB 4LKRA 5LN1A 4RH1A 1V11A 4UHKA 3MM4A 3JQAB 3OJFA 4C3ZA 2DLCX 1Y3HA 5EZSA 4HAZA 3UKJA 3QVGB 3QXGA 4DLRA 4FFWA 2JLBA 1AKMA 1E0JA 1JECA 1IEQA 1Y82A 1V6SA 2FPGB 3GH3A 3H6GA 5DHFA 3GGPA 1W4AA 4Q9AA 5D3MA 4AECA 2O54A 1IY8A 1M0SA 2TYSB 4MR8B 1ZYUA 2JZOA 4QFDA 4QU5A 3JQEA 1FQJA 1LSUA 4ZO4A 2IDKA 4QBGB 3BS4A 1AUXA 5LLSA 1JR2A 1Y3AA 4MQLA 4Q93A 4XTRA 6Q21A 2K7FA 1TW2A 5I4BA 4KX5A 3SSAA 4LISA 3JATA 1JG6A 1GKUB 3L2OB 2YJTD 3MTJA 3PNQA 4IDOA 9ABPA 4NARA 4PAGA 4Y0AA 3TG8A 2QU7A 5E4FA 4D98A 1KPHA 4YMSA 3PUYA 3TIGA 1DS6A 2VL7A 2WD9A 3A9WA 3NRCA