1EY0A

Structure of wild-type s. nuclease at 1.6 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey0A00
1A2TA 1TT2A 5CGKA 2F0DA 1KABA 5CV5A 1EZ6A 3P75A 2F0JA 1EY0A 2RDFA 4KY7A 3C1EA 5EGTA 5HURA 5EKLA 4K6DA 5CV6A 4HMIA 1STAA 3T13A 3OMGA 4S3SA 4DF7A 3ERQA 3MVVA 2PQEA 5EKKA 4K5XA 3QOLA 3HEJA 3NP8A 5CV8A 4EVOA 5F2DA 3SXHA 2SNMA 1NSNS 2EYMA 2F3WA 1ENAA 4KJOA 5CV7A 5IGDA 2M00A 2SNSA 1SNQA 3NHHA 4HTHA 2F0OA 5E1FA 2OXPA 5IGGA 5E3FA 4NDXA 4K5VA 4YIJA 3DMUA 2EYPA 1F2YA 3NQTA 4QF4A 5DEHA 4DGZA 2F0IA 3QB3A 4DFAA 4KTAA 3D8GA 2EYLA 3NXWA 4DU9A 5IGEA 1A3VA 5M9OA 2F0UA 4ZUIA 3VA5A 1STNA 1F2MA 1KAAA 1NUCA 3EROA 2QDBA 4PNYA 5J1ZA 2F0WA 2F0PA 3E5SA 4PMBA 3SK6A 4J6HA 4F7XA 2PW5A 2PZUA 3EVQA 1SNMA 5I6YA 3NK9A 2OEOA 1TQOA 3RUZA 4G57A 4LAAA 4E6IA 2KHSA 1STYA 2HQEA 5C4ZA 4K2LA 1EY7A 3D4DA 5C5MA 5IGCA 1STGA 3TMEA 3SK4A 2F3VA 2KQ3A 5DAUA 3SK8A 1SYBA 1SYGA 4ZUJA 1EY8A 5J22A 1EY9A 1EYDA 2F0MA 3OMCA 4K14A 4R8NA 1JOQA 2EYFA 3TP8A 4KD3A 2F0KA 5IGFA 4ME5A 1SYFA 2RKSA 3TP7A 4NMZA 1SYCA 4QMGA 4KY5A 2EYJA 2PYKA 4ID6A 2EY6A 4WORA 3SHLA 1U9RA 4KHVA 4K8IA 2OF1A 4PMCA 2F0FA 5IOCA 2ENBA 5HGTA 1KDBA 3H6MA 1JORA 2EY5A 1A2UA 5KIXA 1JOOA 1EYAA 3SK5A 4N9PA 4EQNA 2EYOA 3P1HA 2F0GA 5KYIA 4KD4A 1KDCA 2RBMA 3HZXA 1EY4A 5I6WA 3EJIA 5JAVA 1A3TA 5C4HA 1EZ8A 5KYLA 2NUCA 3QOJA 1SYDA 5CC4A 3DHQA 5CV4A 5JOBA 4EQPA 5C6AA 3R3OA 5J39A 1SNOA 3OSOA 4F8MA 4QB4A 4I65A 3ITPA 3SR1A 5IGBA 3U9OA 1AEXA 4B9WA 1SNDA 4NP5A 2F0TA 4RKLA 5NUCA 1EYCA 2SOBA 2EY2A 2F0NA 3NUCA 4H7BA 4RKBA 1TR5A 5IIFA 3D6CA 3BDCA 1STBA 1JOKA 5C3WA 4OL7A 1EY6A 4EQOA 3T16A 5CR3A 4KJNA 2F0HA 1SNPA 1ENCA 5KEEA 1A3UA 1EY5A 4K8JA 4K5WA 2F0QA 4WRDA 4J1MA 4B9XA 2PZWA 1IHZA 2EXZA 4N9TA 1EQVA 3V2TA 5IODA 2F0EA 3C1FA 4TRDA 3MEHA 5C3XA 2PW7A 4IALA 2PZTA 2LKVA 4NKLA 1STHA 3TP6A 4IUNA 3OWFA 2F0VA 5C5LA 3TP5A 1F2ZA 1SYEA 3PMFA 2EY1A 3BDLA 5CV9A 3MHBA 4ODGA 4KY6A 1SNCA 4HMJA 4ZQ3A 5ISRA 1KDAA 3LX0A 5I9PA 4IZ8A 5I9OA 3S9WA 4K2KA 4KV6A 3MXPA 5KGUA 2WACA 5KRUA 2O4XA 3MZ5A 1II3A 4MIUA 2F0SA 5K5PA 3D4WA 2F0LA 1RKNA 2EYHA
chains in the Genus database with same CATH superfamily
3M4QA 4LUZA 4A3IB 1KABA 3TRZA 2E8GA 4CJ2C 4ZLTF 2MUYA 4YCUA 3ERQA 3U9SA 3S1RH 2D0OA 5EKKA 3BZDB 5CORA 1CUKA 4EVOA 4BY1H 1B3AA 4TVAB 4MTNA 3S1RB 4J15A 1BO0A 2SNSA 5E1FA 2PNRC 4BY1B 5KNDA 2IT1A 5ELFA 1Z6HA 3U50C 3S1MH 2K04A 2J7ZA 4FO2A 2FINB 3R93A 2F0UA 3K5OA 1NUCA 2DJGC 1EIHA 4BA2I 1OXSC 3BYTB 1TQOA 3VYTA 2RDHA 4E6IA 1SE4A 3BVZA 5DLQE 1N36L 5C5MA 2ATWA 1STGA 1QJOA 4GOPA 1SYGA 1EYDA 1JICA 3OMCA 4K14A 1N33Q 1VQLA 4RCOA 1I4XA 4LF8L 5GAGC 4BBSH 2A6HC 1PH7A 1E22A 4FF2A 1HCZA 1K83H 5JEAH 2A6HD 2X6GA 4C3JB 1EIYB 1K83B 1VF7A 2KECA 4FYDA 3IFTA 3RZDH 2F0GA 1IW7C 4KD4A 1FJGQ 3HZXA 2MO0A 1CHQD 2ZTEA 3BZCA 1BBUA 3NWTA 3RZDB 2MHVA 4POGA 3FP9A 1I4QA 2Z4HA 4R4TA 5COYA 2JYOA 2NB0A 3H0GG 3RN2A 4KI0A 2XRQD 1GKHA 1STBA 3R2IA 3HOVH 1EY6A 4JOIA 2VQFL 2QDLA 4O42A 1SNPA 3T56B 1MHWC 2BH2A 3GTKH 4C3HG 3HOVB 1B9NA 2QW7A 1YBYA 1LYLA 1UWVA 1VCIA 3MWYW 2PZTA 4IUUA 2VB2X 1GUGA 1PTOH 4IUQA 4PMWA 2L15A 4JI0Q 1HUMA 2Y0SG 1PTOB 3PUYA 1A15A 2Q8TA 3CMAA 4B3RL 1UNSA 1K3BC 1U4PA 5I9PA 3QWNA 1D1KA 1K3RA 3C3LA 1II3A 4A3LG 5K5PA 3BS1A 2NVYB 1NCVA 1PRTB 4DAYB 4GKJQ 2F4VQ 2L55A 4H02A 5HURA 2E5LL 1CZGA 4KN4C 1RIPA 3T13A 1XPOA 2KOLA 3NBHA 1I4GA 2SNMA 2ZXRA 4IUVA 1NSNS 4KJOA 1M90C 2I5HA 4XYOA 4PV1C 5BN5A 2ZXPA 5E3FA 3A5UA 3PO2B 1VQBA 3NQTA 5DEHA 5BN3A 3EA6A 4OXPA 2YTYA 3D8GA 4DR5L 5E4XA 5FLMH 1NAPA 1PTOF 5JJIA 1MJCA 3RNUA 3E5SA 4CDDC 1F9QA 1HNZQ 3C2PA 2NVTH 1F9RA 4OWXB 4U68A 5C4ZA 2RA4A 3J80E 2PMZE 1PRTF 2KUMA 1JJGA 1T9HA 1WTWA 1Y14B 1LTTD 2EYFA 3I4NG 1XTCD 2EJMA 3HG9A 2RKSA 4KK7A 4LF7L 1YNXA 4ID6A 3SHLA 2MNAA 3X3NA 1MSGA 3TDQA 3IAYA 3GO5A 2X6LA 3CP0A 1IZ6A 2N78A 1EOVA 3H6MA 4A3IG 3QR8A 4IPGA 4DR3L 3MEFA 4C56C 4EQNA 2XSCA 2IY5B 3S14B 2OT2A 4XQQA 2WIIB 3EIVA 1N9WA 1SYDA 5CC4A 5CV4A 4DK1A 1QUQB 3U4ZA 3GTPH 3OSOA 1QE6A 1FJGL 5GAHC 5L37A 3ITPA 4R8IA 1LT3D 1NR2A 4OHJA 3F2BA 2FFKB 3W5OA 4MN3A 3T16A 4IOAA 2NYZD 3GV6A 1A3UA 4IN3A 5IODA 2D5DA 1D5MC 3MEHA 2PPBC 3BYYB 1L1OC 1I5FA 3K5LA 4B08A 3OPOA 4DV7Q 1RODA 1WVLA 2I0QA 2MO1A 2NTSA 3OWFA 1F2ZA 2B2WC 4V0BA 3ZYYX 2BA0A 2DNCA 1D7QA 4KY6A 1GXDC 4IZ8A 1SMYC 5KGUA 3CHBD 2FHTA 2O4XA 4LNQA 1SMYD 3W3AA 4C3JG 1LM0A 3SVMA 1FVIA 5JEAG 2EXDA 3RZOH 5CV6A 2TSSA 1XYIA 1LT6D 1UE1A 1WD0A 4GKJL 4IFDJ 3PUXA 4K5XA 4UY8C 1WTHA 2F4VL 2RDGA 1SEBD 1IBML 3BVMA 3J7A5 2CCZA 1D8LA 3OTOQ 1H9MA 1QVFA 4X64Q 4NXMQ 3F8TA 2RVLA 1PYSB 5ELDA 1HXYD 3KLRA 1I4HA 2M9VA 5C3XA 3HOVG 3AEVA 2PNHA 4LFCQ 4ZKBB 4P73A 4DR4L 2EOTA 3DM1A 1K0RA 1YI2A 4B3ML 3MA2B 1EY7A 1C4QA 1Y8PB 5FO8B 1H9KA 3BG3A 2XTIA 3K59A 3RLFA 3NQIA 1L2FA 1O7LA 1BCPC 2L12A 1EY9A 4LW1A 2B39A 4QUCA 4LF6L 2JQOA 1SE8A 2L1BA 1BCPD 1YEZA 1TS4A 3DM3A 2VW9A 3SEBA 2ID0A 2UXDQ 1KIXA 4DR7Q 3CKIB 2KVMA 2GA4B 4DA2A 3M7NA 2ALYB 3RLNA 3MTSA 1XNQQ 5I6WA 4NB3A 2JE6I 1YVCA 2BDOA 5M3MH 4HIMA 2ZJQA 4YHHQ 4JYAQ 3NENA 5BR8Q 3P20A 1QILA 3TS2A 1L0YB 3PO2G 4AYBE 1F2LA 3BZKA 4ME3A 3LWUA 1DOLA 2WKCA 1SROA 2BCOA 4K8JA 1S5DD 4WRDA 1HNXQ 2IHEA 5FLMG 3FKIH 1ML0D 2LFNA 3K0YA 2WKDA 4JG2A 4NKLA 2X69A 1CK1A 4O1NA 3FKIB 4DNTB 5FLXc 1PH4A 3S1NH 4P72A 3J80L 1X6OA 1I94Q 1FR3A 1EQRA 2E76C 1S5BD 3HOUG 1F77A 2GVAA 2A1AA 4DV5Q 3W2DA 4FF4A 3D4RA 1SDFA 3ICEA 1TT2A 1UAPA 5CV5A 1S72A 3PV0A 1G51A 4GLXA 1TWFH 1XMOQ 2CFMA 2OQ0A 3KF8A 4JI4Q 1PMRA 5DNFA 4XQNA 3UE1A 1GHJA 2KJXA 1H9JA 3K7AH 3VR2A 1CKOA 2Z6KC 2F0OA 3CCVA 1Z7TA 2AMCB 3OTOL 4X64L 4M8AA 1TS2A 3VA5A 3JC66 3IRBA 2F0WA 4PMBA 2B2VC 2HD3A 5EPJA 4AIMA 1QB5D 2CQOA 2I07B 1NMGA 2RCNA 1PH1A 1AZPA 2VL6A 3TMEA 3Q0AA 3SK8A 3FEWX 3KOJA 3MXGA 2K5QA 1ILQA 2A69C 2KCNA 5GQOA 4B3SL 1TWGH 2Q2IA 4NMZA 5DM73 2A69D 3OHXC 3M3YB 1NE3A 4RAUC 4JI1L 1TWGB 3CD6A 1PFBA 2EYOA 3P1HA 2Z9HA 5KYIA 1SSOA 1X32A 2KCTA 5IT9L 3FMCA 3S2DH 5IYCH 2YU9H 3K57A 1WTPA 1U4LA 1XNQL 3S2DB 2K1BA 4NW2A 3S1QH 1A8VA 1IYVA 2QCPX 2YU9B 1L1OB 2IX1A 4KKSA 3S1QB 3KF6B 5KEEA 3J81j 1LTSD 3CPFA 3A8JE 2A73B 1AN8A 1UE6A 3C1FA 2Q2UA 1STEA 2WINB 2CKZB 3HRZC 1XX8A 2F03A 2B2VA 3KBGA 3PMFA 4H44C 4QL5A 1JR0D 2PO4A 1SFOH 4ODGA 5AJ3L 2UUCL 5M3FB 1LLRD 3LNNA 4BBRB 4DAPA 5FOBB 1J5EQ 3UDGA 2FXQA 1FNWA 2XIWA 4KLKA 2ZTDA 1A6XA 2PI2E 4BXXG 2JA9A 5TSSA 4MNOA 4QIWE 1TWAH 4JI8Q 2B2YA 4I7AA 5C3EH 2ZTCA 4YIJA 3HOWH 1A63A 3Q24A 4DGZA 3M4PA 5C3EB 1A3VA 3T53B 1C48A 1STNA 4JCVE 1BCPB 2OCEA 4CJ0B 1MGSA 3NK9A 3KJPA 1PLFA 1KRTA 1KNAA 2XWJB 4LAAA 1EQQA 2VQEQ 1Y8NB 3FKIG 2RF4A 3D4DA 4IQZA 3J7AV 3RLOA 2F3VA 4QY7A 1CQFA 1SYBA 1CKNA 3KDFA 1PRTC 1D1IA 1E2ZA 4L5TA 2N3SA 1JT8A 1PRTD 1CFMA 4CDCC 1KXLA 1BF4A 1TY2A 2E2IH 2MPMA 4DV3L 1VQGA 3R2TA 2L11A 4Y52H 3FHWA 2QEJC 4PG3A 2E2IB 1LUZA 2IJ0A 3HOZH 3K0XA 1SJED 3EJIA 4L5RC 4L8JA 3HOZB 4POFA 5D14A 4RMFA 4UAIA 4YY3L 1PH5A 4RGOS 2F0TA 4UP7A 1PDQA 3MAQA 2OTLA 5D3IB 1SJHD 3U58A 1IBKQ 2QKIC 1I4PA 3I4LA 2Q2HA 3CCLA 1R4PB 1VMPA 1IHZA 1KLUD 4LUVA 3GTOH 2R92H 1MJEA 3M4YA 3GTOB 4APVA 4EGVA 1MIUA 4IUNA 1MD2D 2F0VA 2XRSD 5C5LA 3TP5A 3I73A 1PH3A 3I91A 3M4OB 2BE5C 5CV9A 3VR3A 4WJWA 3M9BA 1KDAA 2BE5D 3I4OA 4K2KA 4YWMA 1I50H 2F0SA 4PZ8A 4OIJA 3CCJA 5FLXE 3L3OC 4DAYA 4X3TA 1I50B 5C4JH 4X6AH 3IL8A 5IP7H 4HMIA 3OMGA 4JBKA 1B53A 2PQEA 3GTMH 1VQIA 3H09A 1H9SA 4C3IH 3GTMB 4B3TQ 4LF5Q 1SNQA 5IYCG 1YNNC 4KHPQ 4C3IB 4K5VA 1S3OA 1XJVA 1P8LA 1YNND 4GN3B 1NJIC 3CAMA 2JEAI 3A55A 2OTJA 3PF4A 4JI2L 4FP5D 4K0KQ 3HKZB 3A7LA 2UU9L 4QGUA 4X3UA 1IBLQ 4CDFC 2EVBA 4ZYSA 3G6EA 2K28A 2YTVA 5J22A 3T1YQ 1T5EA 1V1OA 3JAML 1PHJA 4IFDH 5M3FG 2EYJA 1GUWA 4DUYL 4DAVA 4BBRG 2O5JC 3UE0A 4A3FH 3QG1A 5KIXA 3QO2A 3I56A 1LTAD 3S1MB 1X65A 3SK5A 4A3DH 3FRPB 3NWSA 4A3FB 2KA7A 1DOMA 2K33A 1BNZA 5KYLA 1A3TA 5JOBA 1QUQA 5C6AA 1X9NA 5EJWA 1SNOA 2IX0A 2SDFA 2AQ2B 1CKNB 1HZ9A 3KDFB 3NTIA 2FMMA 3HKZE 1JOKA 5C3EG 3WDNA 1LACA 1VQHA 5E4WC 4BBSB 1EUJA 1SR3A 2EXZA 4N9TA 4IUPA 1BKBA 5LMNW 5JVG3 2WB1E 1MI2A 2NVQH 4DV1Q 4X65Q 3A7AB 3NELA 1ESRA 5J3BA 1IW7D 2J0TD 2Z4IA 4U673 4GKKL 1RF2D 3MXPA 3J81i 3DLLA 1SN8A 4X62Q 3I70A 4QUFA 4CKEA 4A3EH 3C1EA 3GTKB 4HJ7A 4RH6A 4A4IA 3HOZG 3GD7A 3WOEA 2L0CA 2L4NA 1SE3A 1CKMA 4KKUA 1Q8KA 2M00A 2NN6H 1PV4A 2RQXA 2PMZB 4NDXA 5ELBA 1Y1VH 4PZ6A 2I5MX 3VA7A 5C0XI 1U0LA 1BBWA 4L6TB 4DR2Q 4B3TL 4JV5L 1Q46A 1IKLA 1Y1VB 3L9AX 4PNYA 1L0XB 5J1ZA 1S5ED 4DUZQ 4OO1G 2VUMH 3KLSA 4K2LA 2BOSA 4HAEA 1O7YA 1GUSA 2UUBQ 4K0KL 4X3KA 1PFMA 5FO9B 1FYCA 4LF4Q 1PH8A 5M5XH 1GJXA 4ZUJA 1EY8A 2F0MA 1H9SB 1B7YB 5IWAQ 3FPPA 5M5XB 1UE7A 3V05A 1HA5A 4KY5A 4NXNQ 3M85A 3A8KE 3NBIA 4R9WA 5IOCA 2CQAA 3CC7A 1YJ9A 1X54A 2KBNA 3HGBA 4MTKA 2KHJA 3PIOA 5JAVA 1RTOA 5FLXL 3DHQA 5IP7G 2NVTB 1AE3A 1TY0A 2VXWA 1XMQQ 3U9OA 1VQCA 4DV0Q 2EY2A 2CVRA 4C3IG 1VQ4A 3BDCA 2H1EA 5C3WA 2D62A 1N33L 1N32Q 3AYHB 5CR3A 1VQFA 4IFDI 3J7YW 1P16A 4HSPA 1JCKB 1LTRD 1EU4A 4B9XA 4LFBQ 4XIGS 3HKZG 1BQQT 1NTGA 4OX9Q 2IW3A 1W6KA 5C0XJ 2K32A 2WP8J 3ER0A 2EIFA 1LTBD 3VR6A 2QILA 4MHEA 4X3SA 1K8GA 1ILPA 4DV1L 4YCWA 4ALPA 1VQ5A 1JE5A 3MHBA 4BY1G 1SNCA 1O7ZA 5ISRA 3GTPB 1HRJA 1OXXK 4HJ8A 1LABA 4FF3A 3MZ5A 1OXTA 2NZHA 2UXBQ 1B4OA 5EPLA 3PO3H 4A3FG 3P75A 2Z1CA 1WTVA 1DYQA 1ZXTA 4JK1C 3LGJA 2JA8H 2K5NA 4TSSA 1QZHA 2JA8B 2G9DA 4GZYC 1HPCA 1IL2A 1JWUD 2E75C 4HTHA 2TMPA 2EJFC 5IGGA 3KYHC 4JI0L 1U5KA 2Z0SA 2B2TC 2K7VA 2R3ZA 1F2MA 2XGTA 4BBSG 1PFSA 3DEPA 3CCRA 5C4XH 4J6HA 4ZCKA 2PW5A 3KLSX 3TSSA 3KJOA 1N34Q 3L2PA 4OONA 2KCMA 4G57A 2KHSA 2GN5A 5C4XB 3QIAA 1OTCA 1G6PA 5IE8A 2HIXA 3RZOB 1B2TA 1ET9A 4R4QA 3M7GA 1YIJA 3GQBA 2A8VA 4AQYQ 2A5HA 3J81c 4LF4L 1SYCA 1VF5C 2NN6I 1H9RA 2A19A 3ND8A 1B1ZA 1E1OA 2BDNA 5C44H 4IPHA 1JOOA 1RL2A 3PQIA 2O2LD 1X3GA 4AYBB 1GM5A 1TWCH 1YHBA 4IPCA 4DNIA 5C44B 1E3PA 4UP9A 2A6EC 5M5WH 1YHAA 1XPUA 2DGYA 2HIVA 2A6ED 4DKAC 3ULPA 1C8CA 1HNZL 1QOHA 4F8MA 3K80C 2PI2A 4CGYB 1QVGA 1AEXA 1SNDA 2GVBA 4BY7H 3DWQA 2NBFA 1L1OA 3KF6A 4DV2Q 4LK1C 1DD2A 4BY7B 1TWHH 4DV0L 1Y1VG 2B2WA 2ICEC 3F2CA 2PZWA 5FJ8H 1CSQA 5E7NA 4A3JH 3BDOA 5IP9H 2FJ2A 4OWWB 2AWOA 4LUOA 2UUAQ 4LFBL 4A3JB 1XXGA 4IOCA 4OX9L 4CKCA 1E2VA 3P7JA 4A3CH 4GN5A 2HCCA 2HDLA 3A0JA 5M3MB 5I2XA 4KV6A 5A2QE 5IYDH 4XTCS 5CBAE 4AH6A 1VQ8A 1K8OA 2J4XA 3IFDA 5LMNQ 2Z6BA 1HJPA 4DPGA 3V96A 5EGTA 3VYSA 1VQMA 2L9HA 1HTLD 4DF7A 1LO5D 4O0AA 4DN4M 1ZKOA 5CV8A 3CC4A 1WCMH 2MP1A 3HOXH 1LT5D 1LT4D 3N6RA 3E6ZX 4DV7L 2OXPA 4XQJA 1EIFA 4XDXA 3S1NB 1PXUA 3KLWA 4XYQA 5FO7B 3OIQA 1BUVT 2BH8A 5LMUQ 1ASZA 3H3VI 4Q0FA 2JK8A 4ZKCB 2K52A 2RCFA 1N34L 1CA5A 1KRSA 2F4IA 3T1HQ 5EPKA 1QG7A 1TWFB 1CSPA 4KD3A 1HH2P 3VR5A 5IGFA 4ME5A 1C9OA 1EEFD 1JB7A 4FNFA 3I4MH 5JJZA 4Q5VA 3HP3A 3FVQA 4X66Q 3K7AB 1U9RA 2OF1A 4NXML 3I4MB 2F0FA 2ENBA 1JORA 1KTKA 1A2UA 1E7ZA 1FL0A 1EYAA 4TQUS 4V190 4A93H 3K58A 2B8GA 3MFGA 1V8QA 4R4CA 1EY4A 4A93B 2NUCA 4LFCL 1J9OA 3BJUA 5ELCA 2JA8G 3AFQA 4EQPA 1E0BA 3K6OA 4JBMA 4RKLA 1KHIA 2QEXA 4DK0A 4JI5Q 3GDEA 4OGQC 5BN4A 1XPRA 3PF5A 1BDOA 4K5WA 4DR1Q 3EFXD 3EN2A 2D2CC 4RA8A 2PQAB 3Q23A 2UXDL 1GUOA 5C4XG 3A8IE 1UEBA 1PFNA 1X3PA 4DR7L 1WYDA 1ASYA 1KAWA 4KN7C 2OWOA 3E0JA 2DJFC 4GS3A 2HT1A 5I9OA 1Y1WH 4YHHL 1VDZA 4JYAL 3PIPA 4QIWB 2XWBB 5BR8L 3G6JB 1Y1WB 2KENA 4CKBA 3A5ZB 2Z6KA 3TQYA 4AYBG 4KY7A 3MXNB 2F3IA 1CI3M 4CBVA 1HZBA 1HNXL 1Z9FA 1D5XC 1ENAA 4IUTA 2R61A 4JI6Q 2EYPA 1JC7A 2DUDA 3S24A 4KTAA 3NXWA 1SFOB 2RHSB 1WOCA 1NNXA 1I94L 3J7AF 4DK3C 1EWCA 1Y8OB 2R6GA 4DV5L 4A3KH 1STYA 5FJ8G 1WJJA 4A3JG 1W2BA 1ICFB 4A3KB 3PUWA 3SK4A 1TXYA 1ESFA 4LWCA 4RWSC 1S4ZA 4HR7B 4DR6Q 1ONLA 3E9IA 4DV6Q 1XMOL 4Z9CB 2DN8A 5HY6A 3TEHB 2K5HA 5M3MG 4JI4L 2SEBD 3TP7A 1K8AC 2R7ZH 1TWAB 2HHHQ 4QMGA 2H5XA 2KEEA 3N52A 1VQ7A 3TN2A 2ZM6Q 2R7ZB 1KDBA 1WTXA 4HIKA 3HOWB 1Q3LA 5A2QL 3J81E 1MSHA 3WOFA 4GLVB 2LMCB 3GTLH 2AQ3B 5K36H 2QGQA 3DXJC 3GTLB 3SGIA 2SOBA 3NUCA 4OWTB 1XNRQ 1PZID 4G7OC 1B3QA 2B2UC 3QJYA 4OIKA 1ENCA 1O78A 1CT1D 3TZDA 1HQRD 1KLGD 2F0EA 2N88A 1Q8IA 3GTGH 1IXRA 3CC2A 4IALA 3T4AC 3TP6A 3K5NA 4C1NI 1M1KC 3GTGB 1QNUA 1QCBD 4XT3B 4KHZA 1DOKA 3GTJH 1B9MA 2ZJPA 5AFWA 2EZVA 1HNWQ 2DY7A 4N8X1 3CCMA 2JA6H 2K05A 1TVXA 3I4MG 1I6VC 4ABNA 4JBJA 5M5YH 1N36Q 4C2MH 2NTTA 5I4DA 1D6EC 2JA6B 3IKJA 2K14A 1SRUA 1EY0A 2RDFA 4C2MB 1X3EA 4K6DA 4A93G 2HDMA 4QJFA 2R92B 1K9MC 4LF8Q 1F9PA 1A0IA 3PIO3 1SXTA 1LTGD 4HEDA 5C0XH 4UP8A 4A3LH 1S5FD 2IPKD 2Q8RE 1Q1BA 4DFAA 4G7ZC 1TIID 1CZWA 1JJ2A 2QDBA 2CH4W 4F7XA 1V1PB 3EVQA 1J5EL 1U4MA 2B2UA 4ULLA 5IGCA 5C4JB 5G3LD 3CQZH 3HFZB 3OYYA 3UI2A 4EQ5A 4A75A 1F9SA 4NPSA 4A76A 4IURA 1HUNA 4ZK9B 3STBC 1W3SA 4XXEA 3CQZB 1K0SA 4FDBA 4DV6L 4Y7NH 4JI8L 4JI3Q 4TKOB 2AWNA 1Q82C 5IY0A 1Y1WG 4GOPC 3HS0C 4Y7NB 1WTQA 3X3MA 2AKWB 1VQ6A 2RHQB 5JVH3 1WD1A 5CBEE 2A74C 5IT9c 1UEAB 4HJ9A 1PZKD 4HJ5A 4B3RQ 3UDXA 5LHY1 1D2BA 4BWGB 3S2HH 2VQEL 2WB1B 1GUTA 4H0LC 2P5ZX 3S2HB 5KNCA 4A3IH 1HA6A 1G91A 2YTXA 2E5LQ 3I3CA 3K81C 4J1MA 4JVZA 3CCSA 1K73C 3V2TA 1XNRL 1IYJB 4FXDA 4A3GH 4FXKC 3T51B 2JJQA 3ONAB 3OOCA 4A3KG 4A3GB 2LSSA 1VQOA 4JOIC 4A3DB 3RMHA 3L0OA 5H1SE 2FMCA 3KBXA 2K4KA 4DR5Q 1EWHA 1IYUA 4F88A 3I7FA 1Q7YC 4ZQ3A 3LX0A 3JAMi 3NPPA 2WACA 3MFYA 3ZJYC 3B6YA 3A56A 2K6AA 2E2HH 1HNWL 2R7ZG 5JPNC 4HIOA 1IL8A 2HCIA 3HOWG 3WWVA 1OO9B 3CXCA 1PVOA 2E2HB 2F0JA 3K7UC 2Q8IB 4C1NK 1PH2A 1IBKL 1NY4A 4P71A 1HZCA 3TZUA 3MVVA 1K8MA 4PQXA 3GTQH 1BBXC 1AW7A 1CM9A 4LF7Q 2NVQB 1PYBA 3J81L 3GTQB 1O7IA 3NHHA 4K6LA 5K36G 4DR3Q 3DMUA 4WJ4A 1F2YA 4QF4A 4C3JH 1I6HH 4WFN3 3RR5A 1S40A 3MC0B 1BVSA 2F1MA 1KAAA 3LWEA 4XT1B 5ELNA 1XTDA 1I6HB 2PZUA 1SNMA 3I8ZA 2N8NA 2R93H 2HQEA 5LL6X 1K28A 5JPMC 5DM63 3AQQA 3I55A 2K5DA 4A3EB 2R93B 2YV5A 3J7ZC 1EFID 2NVXH 1X3FA 3VYUA 3FPUB 2ASBA 3TP8A 1ENFA 3NEMA 2NVXB 3DWAA 4WORA 1W6JA 2B63H 4K8IA 4LF5L 4KHPL 1QVCA 2B63B 4OO1I 2JA6G 4N8FA 3EQLC 3URYA 4JI3L 1JMCA 1JJCB 1RHPA 4RCNA 4L63B 1KDCA 2R92G 4KKTA 1PZJD 1SAPA 1TU2B 3TS0A 2VUMB 3H91A 1EFWA 1UE5A 1BR9A 1VMCA 4G4KA 3DWPA 1IBLL 2NVYH 1HZAA 3DUZA 1GVPA 2K75A 5C0XG 4YWKA 2BA1A 3CCQA 4JW0A 4EQOA 1ZYRC 2G9HD 3T1YL 1C0AA 1DGSA 1GOZA 1ZYRD 1KQSA 2Z8LA 1IBMQ 1NMFA 5EBCA 4JC0A 4FF1A 4BA1I 3CPWA 1OXUA 3PO2H 1SYEA 3I72A 2MQHA 4HJAA 2JEBI 1ET6A 4DR4Q 4JPBW 3C46A 3OIPA 3D4WA 3R8BA 2PW7A 1RKNA 4B3MQ 1U4RA 3ERSX 3ULJA 3D6WA 2JP1A 4RGMA 3PCOB 1EZ6A 2IHFA 3F2UA 4S3SA 4LF6Q 4HSVA 4HCEA 3HEJA 2B3GA 3DEOA 2VS1A 5T1IA 2QA4A 3HOUH 2CW0C 5D3DA 2WB1G 4X65L 3Q6SA 1AFPA 3ND9A 1JWMD 2CW0D 3HOUB 1VS0A 5IYBH 2E2JH 2EYLA 1A62A 4ZAIA 4R1JA 1AE2A 1V1QA 3S14H 4CDEC 4IFDG 1SBBB 2E2JB 3H3VH 5I6YA 4DAMA 1HR0W 3K8AA 2V1CC 2OEOA 3UDFA 4LF9Q 1J8IA 4X62L 1JQYD 4A3GG 3PO3B 4A3DG 5FK9C 1DZ1A 4GOPB 1FGUA 3AB9A 1KNEA 3JAMc 1R9TH 2F0KA 1AH9A 2D9UA 1QNKA 2B8FA 1B70B 1R9TB 4M1UB 2Q2TA 5A35A 3MXUA 4O2DA 2I46A 1B8AA 5HGTA 3E3XA 5G3LF 5ELEA 4N9PA 4DR2L 2IWHA 4DXFA 3PIP3 1CTMA 3PUZA 3U4VA 3KUPA 2XN9C 3PGZA 4DUZL 1AZQA 4JBWA 1YJNA 3SR1A 4R4IA 1Q81C 3PSIA 2NWGA 2UUBL 5GROA 4H7BA 1TR5A 1JB3A 1FGBD 4OL7A 4LFAQ 3CRKC 3NTHA 3OWEB 4KJNA 5IWAL 5IT9E 1LTID 4YWLA 2F0QA 4RGNA 4QCLA 2JN4A 2XVSA 4MZ9A 1VQNA 1RDPD 4NXNL 2PQAA 1YNJC 2JA7H 2H4OA 4QQBX 2LKVA 2K50A 1G291 1YNJD 2EPBA 4A3EG 2R93G 2JA7B 1DCZA 4GNXC 1TWCB 2E74C 2XNAC 1G2SA 4G7HC 5M5WB 4ILWA 2EY1A 2UXCQ 4RHRA 3SE0A 1N8RC 2NN6G 1XMQL 4A3BH 4LMQD 3Q8DA 4A3MH 1VQJA 2B63G 2F0DA 3CCEA 3ULLA 4A3BB 1GO3E 1TWHB 5EKIA 1N32L 1RCVD 3MXNA 4A3MB 2C5CA 3SDZA 3E0EA 1VQKA 2B2TA 1JE4A 1ICWA 3NBHB 5I2YA 3NP8A 4B3SQ 2VUMG 5JEAJ 3D31A 5CV7A 5FKAC 3D0FA 4JI1Q 3E9HA 5GAEC 3TBIB 3S16H 3H94A 2F0IA 4GN4B 2WFWA 4DU9A 5EQ0A 1BOSA 5M9OA 3S16B 1QZGA 3EROA 4BXXH 1MBYA 3G71A 1JOQA 1Q1EA 2VY3A 3S15H 1S5CD 3G4SA 5HGQA 1FD7D 4IJHA 2UXBL 3S15B 4LJZC 4LF9L 2YYZA 2B29A 1EYGA 3RN5A 2ZJRA 1OXVA 4P2CB 1CA6A 1WCMB 1YZ6A 2MFIA 2IX3A 3HOXB 5IIFA 2ZT9C 4GNXA 2JXMB 1SLJA 4KHVA 1I4RA 2EY5A 4HCSA 4UPAA 2KCCA 5T1GA 2RSNA 1TKWB 1V43A 2RBMA 2K03A 1EU3A 4CHTB 2C9OA 2VB3X 1KD1C 5AJ3Q 2UUCQ 2MJ8A 2I5LX 5J39A 4JI7Q 1EQTA 2IL8A 4QB4A 1DM0B 3KK7A 4I65A 3VR4A 4IO9A 1PH6A 3BVGA 4NP5A 2F0NA 4UDUC 2AQ1B 3CU7A 2F52A 1WI5A 3J80i 4RGTA 3CCUA 3RD4A 4AQYL 2F0HA 1GHKA 5IYBG 3HOYH 1RD9D 1V9PA 3W1GA 2ZXOA 1SMXA 3AMUA 3O13A 1EQVA 4LFAL 3I2ZA 4OEMB 1R4QB 5JJLA 1VQEA 3HOYB 3CW2C 1M4VA 1STHA 3PO3G 2M2LA 4H13C 3TREA 2LY7A 2JA5H 1RTNA 3Q22A 3D3RA 2DY8A 1EWIA 3BDLA 2AHOB 1PH9A 2JA5B 2HQLA 1XWEA 4EX5A 3S9WA 5KRUA 4MIUA 2UXCL 2WAQB 3HKSA 3CMEA 2K5WA 4KMUC 3CF5A 2O5IC 1A2TA 2E2DC 2L5TA 1VQPA 2HUGA 5CGKA 3VDYA 4DV2L 2KEDA 4DK6C 1STAA 4P75A 2KHIA 2QF7A 2C35B 3QOLA 4ZRZA 2JSOA 3F2DA 2F3WA 3M3YH 1GD7A 5IGDA 2UUAL 4DV3Q 1G8ZD 5D65A 1WFQA 2EE1A 3GV3A 1GUNA 3SK6A 1KL9A 4HN7A 1V1PA 2NZ1D 2B2YC 1X56A 4GLAC 4DNRB 2AUKA 3RUZA 1SE2A 5C44G 2WV6D 4YY3Q 5ELOA 5LMNL 2JA7G 2V4DA 1Y69U 2KQ3A 2R7FA 2WAQE 4R8NA 1BXTA 2K01A 1SYFA 4RFBA 1MKHA 1Q90A 4L5SA 4PMCA 4BY7G 1G6ZA 3KFUA 1Z47A 1QWYA 4R4OA 3W1BA 3EBEA 1HR0Q 2DNEA 4A3BG 2LXKA 3K5MA 3S17H 2R7DA 3UDIA 4A3MG 5CYUA 1DJRD 4J8QA 3JAME 2PCFB 3S17B 3OW7A 5C4HA 4I7ZC 5EBDA 5LMUL 1I3QH 5IP9G 1LTLA 3R3OA 3F1ZA 5M3FH 4DV4Q 2EDGA 4B9WA 1I3QB 4BBRH 3VYRA 4A3CG 1EYCA 4RKBA 3T1HL 4JI7L 3D6CA 4FVMA 4GNXB 1EY5A 1X3QA 1KC8C 5IYDG 1Q12A 2K5VA 4IPDA 4X66L 1EEID 5GADC 1FNUA 1TS3A 3OW2A 1L0WA 1D5ZC 1NR4A 1E2WA 1JWSD 3L7ZC 4F87A 2EJGC 1YHQA 2N49A 2VZAA 3BU2A 2A68C 1WCMG 1WTRA 3A54A 3HOXG 4JI2Q 4WJ3M 2A68D 2UU9Q 2F0LA 2EYHA 1TS5A 1ZEQX 2CWAA 3AFPA 1VQAA 1PTOC 1PYWD 4JI5L 5EKLA 3A74A 1LV9A 4DR1L 1PTOD 1CHPD 3KF8B 1E1TA 4YCVA 1G2TA 5F2DA 3SXHA 3H0GH 5EAYA 2EYMA 3NSWA 4DUYQ 3G7LA 4RHSA 1YJWA 3J80c 3H0GB 1HQMC 3GTJB 4C3HH 3QB3A 5IGEA 4ZUIA 3PUVA 3NTKA 1PA6A 2F0PA 4C3HB 1IKMA 2N55A 2ES2A 1FNVA 4OELB 4BS9A 3HOYG 2LXJA 5M5YB 1BCPF 1M8AA 1DONA 4IJLA 5DAUA 1NBWA 2Y0SB 4HIDA 2NZOA 2JA5G 1UUPA 1E24A 2ICIA 4FXGC 1C7YA 3CRLC 5JJKA 2PYKA 2EY6A 1O80A 1HTPA 2WAQG 2EQSA 5LL6S 4OO1H 1Q86C 4JI6L 2CHBD 2D0PA 2CH4A 1HR0L 3M4OH 1EIGA 1EZ8A 1T5XD 3QOJA 1EOTA 4GKKQ 2LS01 4UHVA 4PZ7A 2AUJD 5IGBA 2VQFQ 3AU7A 3G48A 5NUCA 1J6QA 1B50A 3NE5B 1WTOA 4DV4L 3H3VC 4DR6L 3STBD 1H95A 1CQVA 4RG1A 4CJ1B 1HHVA 2HHHL 4TRDA 2VNUD 3I90A 1YITA 2ZM6L 2Y0SE 2OQKA 1VQ9A 2G5DA 1EL0A 2RSOA 3I4NH 1B44D 1VQDA 1X55A 5KNBA 4L5QA 5CMDA 4JV5Q 2CWPA 2MGSA 3I4NB 1HFNA 4HMJA 4DXGA 1DXMA 3FDTA 3GP7A 4P74A 3H15A 1AP0A 1HFGA 1RJTA
chains in the Genus database with same CATH topology
4A3IB 1KABA 4CJ2C 4ZLTF 2MUYA 3ERQA 3U9SA 5EKKA 3BZDB 5CORA 4EVOA 1B3AA 3S1RB 1BO0A 2SNSA 5E1FA 2PNRC 4BY1B 5KNDA 2IT1A 5ELFA 1Z6HA 2K04A 2J7ZA 4FO2A 2FINB 3R93A 2F0UA 3K5OA 1NUCA 1EIHA 4BA2I 1OXSC 3BYTB 1TQOA 3VYTA 2RDHA 4E6IA 1SE4A 3BVZA 5C5MA 1STGA 1QJOA 1SYGA 1EYDA 1JICA 3OMCA 4K14A 4RCOA 1I4XA 2A6HC 4FF2A 1HCZA 5JEAH 2A6HD 2X6GA 4C3JB 1K83B 1VF7A 2KECA 4FYDA 3IFTA 2F0GA 1IW7C 4KD4A 3HZXA 1CHQD 3NWTA 3RZDB 2MHVA 1I4QA 2Z4HA 5COYA 2JYOA 2NB0A 4KI0A 2XRQD 1STBA 3R2IA 1EY6A 4O42A 1SNPA 3T56B 4C3HG 3HOVB 1B9NA 1VCIA 3MWYW 2PZTA 4IUUA 2VB2X 1GUGA 1PTOH 4IUQA 4PMWA 1HUMA 1PTOB 3PUYA 1A15A 2Q8TA 1UNSA 1U4PA 5I9PA 3QWNA 1D1KA 3C3LA 1II3A 5K5PA 3BS1A 2NVYB 1NCVA 1PRTB 2L55A 5HURA 1CZGA 4KN4C 3T13A 2KOLA 3NBHA 1I4GA 2SNMA 2ZXRA 4IUVA 1NSNS 4KJOA 4XYOA 4PV1C 5BN5A 2ZXPA 5E3FA 3PO2B 3NQTA 5DEHA 5BN3A 3EA6A 3D8GA 5E4XA 1NAPA 1PTOF 3E5SA 1F9QA 3C2PA 1F9RA 5C4ZA 4U68A 3J80E 2RA4A 1PRTF 2KUMA 1WTWA 1LTTD 2EYFA 1XTCD 2EJMA 3HG9A 2RKSA 4KK7A 4ID6A 3SHLA 3X3NA 1MSGA 3TDQA 3IAYA 3GO5A 2X6LA 3H6MA 4C56C 4EQNA 2XSCA 3S14B 2OT2A 4XQQA 2WIIB 1SYDA 5CC4A 5CV4A 4DK1A 3OSOA 1QE6A 3ITPA 4R8IA 1LT3D 1NR2A 4OHJA 2FFKB 4MN3A 3T16A 2NYZD 3GV6A 1A3UA 4IN3A 5IODA 2D5DA 1D5MC 3MEHA 2PPBC 3BYYB 3K5LA 4B08A 3OPOA 1RODA 1WVLA 3OWFA 2NTSA 1F2ZA 2B2WC 4V0BA 3ZYYX 2BA0A 2DNCA 4KY6A 1GXDC 4IZ8A 1SMYC 5KGUA 3CHBD 2FHTA 2O4XA 1SMYD 3W3AA 4C3JG 3SVMA 5JEAG 5CV6A 2TSSA 1XYIA 1LT6D 1WD0A 4IFDJ 3PUXA 4K5XA 2RDGA 1SEBD 3BVMA 1H9MA 2RVLA 5ELDA 1HXYD 3KLRA 1I4HA 2M9VA 5C3XA 4ZKBB 2EOTA 3DM1A 3MA2B 1EY7A 1C4QA 1Y8PB 5FO8B 1H9KA 3BG3A 3K59A 3RLFA 3NQIA 1BCPC 1O7LA 2L12A 1EY9A 2B39A 4QUCA 2L1BA 1BCPD 1TS4A 3SEBA 2ID0A 3CKIB 2KVMA 2GA4B 4DA2A 3M7NA 3MTSA 5I6WA 2JE6I 2BDOA 3P20A 1QILA 1L0YB 1F2LA 3LWUA 4K8JA 1DOLA 2WKCA 2BCOA 4WRDA 1S5DD 1ML0D 2LFNA 3K0YA 2WKDA 4NKLA 2X69A 1CK1A 4O1NA 3FKIB 4DNTB 3J80L 1FR3A 2E76C 1S5BD 1F77A 3W2DA 4FF4A 3D4RA 1SDFA 1TT2A 1UAPA 5CV5A 3PV0A 3KF8A 1PMRA 5DNFA 4XQNA 1GHJA 2KJXA 1H9JA 3VR2A 2F0OA 1Z7TA 4M8AA 1TS2A 3VA5A 2F0WA 4PMBA 2B2VC 5EPJA 1QB5D 2I07B 1AZPA 3TMEA 3Q0AA 3SK8A 3FEWX 3MXGA 2K5QA 1ILQA 2A69C 2KCNA 4NMZA 5DM73 2A69D 3OHXC 3M3YB 4RAUC 1TWGB 1PFBA 2EYOA 3P1HA 5KYIA 1SSOA 1X32A 5IT9L 3FMCA 3K57A 1WTPA 1U4LA 3S2DB 2K1BA 4NW2A 1IYVA 2QCPX 2YU9B 2IX1A 4KKSA 3S1QB 5KEEA 1LTSD 3A8JE 2A73B 1AN8A 3C1FA 1STEA 2WINB 3HRZC 1XX8A 2F03A 2B2VA 3KBGA 3PMFA 4H44C 1JR0D 2PO4A 4ODGA 5M3FB 1LLRD 4BBRB 3LNNA 4DAPA 5FOBB 1FNWA 2XIWA 1A6XA 5TSSA 2B2YA 4YIJA 3Q24A 4DGZA 5C3EB 1A3VA 3T53B 1C48A 1STNA 1BCPB 4CJ0B 1MGSA 3NK9A 1PLFA 1KNAA 2XWJB 4LAAA 1Y8NB 3D4DA 4IQZA 3J7AV 2F3VA 1CQFA 1SYBA 1PRTC 1D1IA 1E2ZA 1PRTD 1CFMA 1BF4A 1TY2A 2MPMA 3R2TA 2L11A 2QEJC 2E2IB 2IJ0A 1SJED 3EJIA 4L8JA 3HOZB 5D14A 4UAIA 4RGOS 2F0TA 1PDQA 3MAQA 5D3IB 1SJHD 2QKIC 1I4PA 3I4LA 1R4PB 1VMPA 1IHZA 1KLUD 3M4YA 3GTOB 4EGVA 4IUNA 1MD2D 2F0VA 2XRSD 5C5LA 3TP5A 3I73A 3M4OB 3I91A 2BE5C 5CV9A 3VR3A 4WJWA 1KDAA 2BE5D 4K2KA 2F0SA 4OIJA 5FLXE 3L3OC 4DAYA 4X3TA 1I50B 3IL8A 4HMIA 3OMGA 1B53A 2PQEA 3H09A 1H9SA 3GTMB 1SNQA 1YNNC 4C3IB 4K5VA 1YNND 2JEAI 3A55A 4FP5D 3HKZB 3A7LA 4X3UA 2EVBA 4ZYSA 2K28A 5J22A 1T5EA 1V1OA 3JAML 4IFDH 2EYJA 1GUWA 4DAVA 2O5JC 3QG1A 5KIXA 3QO2A 1LTAD 3S1MB 3SK5A 3FRPB 3NWSA 4A3FB 2KA7A 1DOMA 2K33A 1BNZA 5KYLA 1A3TA 5JOBA 5C6AA 5EJWA 1SNOA 2IX0A 2SDFA 2AQ2B 3NTIA 2FMMA 1JOKA 3WDNA 1LACA 5E4WC 4BBSB 2EXZA 4N9TA 4IUPA 5JVG3 1MI2A 3A7AB 1ESRA 1IW7D 2J0TD 2Z4IA 4U673 1RF2D 3MXPA 3I70A 4QUFA 4CKEA 3C1EA 3GTKB 4RH6A 3GD7A 3WOEA 2L0CA 2L4NA 1SE3A 4KKUA 2M00A 2NN6H 2RQXA 2PMZB 4NDXA 5ELBA 5C0XI 3VA7A 4L6TB 1IKLA 1Y1VB 3L9AX 4PNYA 1L0XB 5J1ZA 1S5ED 4OO1G 3KLSA 4K2LA 2BOSA 4HAEA 1O7YA 1GUSA 4X3KA 1PFMA 5FO9B 1FYCA 1GJXA 4ZUJA 1EY8A 2F0MA 1H9SB 3FPPA 5M5XB 3V05A 1HA5A 4KY5A 3M85A 3A8KE 3NBIA 4R9WA 5IOCA 2CQAA 3HGBA 5JAVA 1RTOA 5FLXL 3DHQA 2NVTB 1TY0A 2VXWA 3U9OA 2EY2A 2CVRA 4C3IG 3BDCA 2H1EA 5C3WA 2D62A 5CR3A 4IFDI 3J7YW 4HSPA 1JCKB 1LTRD 1EU4A 4B9XA 4XIGS 1BQQT 2IW3A 1W6KA 5C0XJ 2K32A 2WP8J 1LTBD 3VR6A 2QILA 4MHEA 4X3SA 1ILPA 3MHBA 1SNCA 1O7ZA 5ISRA 3GTPB 1HRJA 1OXXK 1LABA 4FF3A 3MZ5A 1OXTA 1B4OA 5EPLA 3P75A 2Z1CA 1WTVA 1DYQA 1ZXTA 4JK1C 4TSSA 2JA8B 2G9DA 4GZYC 1HPCA 1JWUD 2E75C 4HTHA 2TMPA 2EJFC 5IGGA 2B2TC 2K7VA 2R3ZA 1F2MA 3DEPA 4J6HA 2PW5A 3KLSX 3TSSA 4G57A 2KHSA 5C4XB 3QIAA 3RZOB 1B2TA 1ET9A 3M7GA 3GQBA 2A5HA 1SYCA 1VF5C 2NN6I 1H9RA 3ND8A 1B1ZA 2BDNA 1JOOA 2O2LD 4AYBB 5C44B 2A6EC 2A6ED 1C8CA 1QOHA 4F8MA 4CGYB 1AEXA 1SNDA 3DWQA 2NBFA 4LK1C 1DD2A 4BY7B 2B2WA 2ICEC 2PZWA 3BDOA 2FJ2A 2AWOA 4A3JB 1XXGA 4CKCA 1E2VA 3P7JA 2HCCA 2HDLA 5M3MB 5I2XA 4KV6A 5A2QE 4XTCS 5CBAE 1K8OA 2J4XA 3IFDA 3V96A 5EGTA 3VYSA 2L9HA 1HTLD 4DF7A 1LO5D 4DN4M 1ZKOA 5CV8A 2MP1A 1LT5D 1LT4D 3N6RA 3E6ZX 2OXPA 4XQJA 4XDXA 3S1NB 1PXUA 4XYQA 5FO7B 3OIQA 1BUVT 4Q0FA 4ZKCB 1CA5A 2F4IA 5EPKA 1QG7A 1TWFB 4KD3A 3VR5A 5IGFA 4ME5A 1EEFD 4FNFA 5JJZA 4Q5VA 3HP3A 3FVQA 3K7AB 1U9RA 2OF1A 3I4MB 2F0FA 2ENBA 1JORA 1KTKA 1A2UA 1EYAA 4TQUS 4V190 3K58A 2B8GA 3MFGA 1V8QA 1EY4A 4A93B 2NUCA 1J9OA 5ELCA 4EQPA 1E0BA 3K6OA 4RKLA 4DK0A 4OGQC 5BN4A 1BDOA 4K5WA 3EFXD 2D2CC 4RA8A 3Q23A 1GUOA 3A8IE 1PFNA 1X3PA 4KN7C 3E0JA 5I9OA 1VDZA 4QIWB 2XWBB 3G6JB 1Y1WB 4CKBA 4KY7A 1CI3M 4CBVA 1D5XC 1ENAA 4IUTA 2R61A 2EYPA 1JC7A 4KTAA 3NXWA 1SFOB 3J7AF 1EWCA 1Y8OB 2R6GA 1STYA 4A3KB 3PUWA 3SK4A 1ESFA 4RWSC 1S4ZA 4HR7B 1ONLA 4Z9CB 2DN8A 2SEBD 3TP7A 1TWAB 4QMGA 2KEEA 3N52A 3TN2A 2R7ZB 1KDBA 1WTXA 3HOWB 1Q3LA 5A2QL 3J81E 1MSHA 3WOFA 2LMCB 2AQ3B 5K36H 3DXJC 3GTLB 2SOBA 3NUCA 1PZID 4G7OC 2B2UC 3QJYA 4OIKA 1ENCA 1O78A 1CT1D 3TZDA 1HQRD 1KLGD 2F0EA 2N88A 1Q8IA 4IALA 3T4AC 3TP6A 3K5NA 4C1NI 3GTGB 1QNUA 1QCBD 4XT3B 4KHZA 1DOKA 1B9MA 5AFWA 2EZVA 2DY7A 2K05A 1TVXA 1I6VC 4ABNA 2NTTA 5I4DA 1D6EC 2JA6B 3IKJA 1EY0A 2RDFA 4C2MB 4K6DA 2HDMA 2R92B 1F9PA 3PIO3 1SXTA 1LTGD 4HEDA 5C0XH 1S5FD 2IPKD 2Q8RE 1Q1BA 4DFAA 4G7ZC 1TIID 1CZWA 2QDBA 4F7XA 1V1PB 3EVQA 1U4MA 2B2UA 4ULLA 5IGCA 5C4JB 5G3LD 3UI2A 1F9SA 4IURA 1HUNA 4ZK9B 4XXEA 3CQZB 4TKOB 2AWNA 3HS0C 4Y7NB 1WTQA 3X3MA 5JVH3 1WD1A 5CBEE 2A74C 1UEAB 1PZKD 5LHY1 1D2BA 4BWGB 2WB1B 1GUTA 4H0LC 3S2HB 5KNCA 1HA6A 1G91A 3I3CA 4J1MA 3V2TA 4FXDA 4FXKC 3T51B 3ONAB 3OOCA 4A3GB 4A3DB 3RMHA 2FMCA 3KBXA 1EWHA 1IYUA 4F88A 4ZQ3A 3LX0A 3MFYA 2WACA 3NPPA 3A56A 2K6AA 5JPNC 1IL8A 2HCIA 1OO9B 2E2HB 2F0JA 2Q8IB 4C1NK 3TZUA 3MVVA 1K8MA 4PQXA 1BBXC 1AW7A 1CM9A 2NVQB 3J81L 3GTQB 3NHHA 4K6LA 5K36G 3DMUA 1F2YA 4QF4A 4WFN3 3MC0B 2F1MA 1KAAA 3LWEA 4XT1B 1I6HB 2PZUA 1SNMA 3I8ZA 2HQEA 5LL6X 5DM63 5JPMC 2K5DA 4A3EB 2R93B 1EFID 3VYUA 3FPUB 3TP8A 1ENFA 2NVXB 3DWAA 4WORA 1W6JA 4K8IA 2B63B 4OO1I 3EQLC 3URYA 1RHPA 4RCNA 4L63B 1KDCA 4KKTA 1PZJD 1SAPA 1TU2B 2VUMB 3H91A 1VMCA 1BR9A 4G4KA 3DWPA 3DUZA 5C0XG 2BA1A 4EQOA 1ZYRC 2G9HD 1GOZA 1ZYRD 2Z8LA 5EBCA 4FF1A 4BA1I 1OXUA 1SYEA 3I72A 2JEBI 1ET6A 3C46A 3OIPA 3D4WA 3R8BA 2PW7A 1RKNA 1U4RA 3D6WA 2JP1A 4RGMA 1EZ6A 3F2UA 4S3SA 4HSVA 4HCEA 3HEJA 3DEOA 5T1IA 2CW0C 5D3DA 3Q6SA 1AFPA 3ND9A 1JWMD 2CW0D 3HOUB 2EYLA 4ZAIA 4IFDG 1SBBB 2E2JB 5I6YA 2OEOA 1J8IA 1JQYD 3PO3B 5FK9C 1DZ1A 3AB9A 1KNEA 2F0KA 2D9UA 1QNKA 2B8FA 1R9TB 4M1UB 5A35A 3MXUA 2I46A 5HGTA 5G3LF 5ELEA 4N9PA 2IWHA 4DXFA 3PIP3 1CTMA 3PUZA 3KUPA 2XN9C 1AZQA 4JBWA 3SR1A 2NWGA 4H7BA 1TR5A 1JB3A 1FGBD 4OL7A 3CRKC 3NTHA 3OWEB 4KJNA 5IT9E 1LTID 2F0QA 4RGNA 4QCLA 2XVSA 1RDPD 1YNJC 2H4OA 2LKVA 1G291 1YNJD 2EPBA 2JA7B 1DCZA 1TWCB 2E74C 2XNAC 1G2SA 4G7HC 5M5WB 4ILWA 2EY1A 4RHRA 3SE0A 2NN6G 4LMQD 2F0DA 4A3BB 1TWHB 5EKIA 1RCVD 3MXNA 4A3MB 2C5CA 3SDZA 2B2TA 1JE4A 1ICWA 5I2YA 3NP8A 5JEAJ 3D31A 5CV7A 5FKAC 3TBIB 3H94A 2F0IA 4DU9A 5EQ0A 1BOSA 5M9OA 3S16B 3EROA 1MBYA 1JOQA 1Q1EA 1S5CD 1FD7D 3S15B 4LJZC 2YYZA 1OXVA 4P2CB 1CA6A 1WCMB 2IX3A 3HOXB 5IIFA 2ZT9C 2JXMB 4KHVA 1I4RA 2EY5A 4HCSA 2KCCA 5T1GA 2RSNA 1TKWB 1V43A 2RBMA 2K03A 1EU3A 4CHTB 2C9OA 2VB3X 2MJ8A 5J39A 1EQTA 4QB4A 2IL8A 1DM0B 3KK7A 4I65A 3VR4A 3BVGA 4NP5A 2F0NA 4UDUC 2AQ1B 3CU7A 4RGTA 3RD4A 2F0HA 1GHKA 1RD9D 2ZXOA 3AMUA 3O13A 1EQVA 1R4QB 3HOYB 1M4VA 1STHA 2M2LA 4H13C 2LY7A 1RTNA 3Q22A 3D3RA 2DY8A 3BDLA 2JA5B 1XWEA 3S9WA 5KRUA 4MIUA 2WAQB 2K5WA 4KMUC 2O5IC 1A2TA 2E2DC 2L5TA 2HUGA 5CGKA 2KEDA 1STAA 2QF7A 3QOLA 4ZRZA 2JSOA 2F3WA 5IGDA 1G8ZD 5D65A 2EE1A 3GV3A 1GUNA 3SK6A 4HN7A 1V1PA 2NZ1D 2B2YC 4DNRB 2AUKA 3RUZA 1SE2A 2WV6D 2V4DA 1Y69U 2KQ3A 4R8NA 1BXTA 2K01A 1SYFA 4RFBA 1Q90A 4PMCA 1G6ZA 1Z47A 1QWYA 2DNEA 3K5MA 5CYUA 1DJRD 4J8QA 3JAME 2PCFB 3S17B 3OW7A 5C4HA 4I7ZC 5EBDA 3R3OA 2EDGA 4B9WA 1I3QB 3VYRA 1EYCA 4RKBA 3D6CA 4FVMA 1EY5A 1X3QA 1Q12A 1EEID 1FNUA 1TS3A 1D5ZC 1NR4A 1E2WA 1JWSD 3L7ZC 4F87A 2EJGC 2A68C 1WTRA 3A54A 2A68D 2F0LA 2EYHA 1TS5A 1ZEQX 1PTOC 1PYWD 5EKLA 1LV9A 1PTOD 1CHPD 1G2TA 5F2DA 3SXHA 2EYMA 3NSWA 3G7LA 4RHSA 3H0GB 1HQMC 3GTJB 3QB3A 5IGEA 4ZUIA 3PUVA 3NTKA 2F0PA 4C3HB 1IKMA 2N55A 1FNVA 4BS9A 5M5YB 1BCPF 1M8AA 1DONA 5DAUA 2Y0SB 1UUPA 2ICIA 4FXGC 3CRLC 2PYKA 2EY6A 1O80A 1HTPA 5LL6S 4OO1H 2CHBD 1EIGA 1EZ8A 1T5XD 3QOJA 1EOTA 2LS01 2AUJD 5IGBA 3AU7A 5NUCA 1B50A 3NE5B 1WTOA 3H3VC 1CQVA 4CJ1B 1HHVA 4TRDA 2VNUD 3I90A 1EL0A 2RSOA 1B44D 5KNBA 5CMDA 2MGSA 3I4NB 1HFNA 4HMJA 4DXGA 1DXMA 3FDTA 3GP7A 1AP0A 1HFGA 1RJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2T A;  1TT2 A;  5CGK A;  2F0D A;  1KAB A;  5CV5 A;  1EZ6 A;  3P75 A;  2F0J A;  1EY0 A;  2RDF A;  4KY7 A;  3C1E A;  5EGT A;  5HUR A;  5EKL A;  4K6D A;  5CV6 A;  4HMI A;  1STA A;  3T13 A;  3OMG A;  4S3S A;  4DF7 A;  3ERQ A;  3MVV A;  2PQE A;  5EKK A;  4K5X A;  3QOL A;  3HEJ A;  3NP8 A;  5CV8 A;  4EVO A;  5F2D A;  3SXH A;  2SNM A;  1NSN S;  2EYM A;  2F3W A;  1ENA A;  4KJO A;  5CV7 A;  5IGD A;  2M00 A;  2SNS A;  1SNQ A;  3NHH A;  4HTH A;  2F0O A;  5E1F A;  2OXP A;  5IGG A;  5E3F A;  4NDX A;  4K5V A;  4YIJ A;  3DMU A;  2EYP A;  1F2Y A;  3NQT A;  4QF4 A;  5DEH A;  4DGZ A;  2F0I A;  3QB3 A;  4DFA A;  4KTA A;  3D8G A;  2EYL A;  3NXW A;  4DU9 A;  5IGE A;  1A3V A;  5M9O A;  2F0U A;  4ZUI A;  3VA5 A;  1STN A;  1F2M A;  1KAA A;  1NUC A;  3ERO A;  2QDB A;  4PNY A;  5J1Z A;  2F0W A;  2F0P A;  3E5S A;  4PMB A;  3SK6 A;  4J6H A;  4F7X A;  2PW5 A;  2PZU A;  3EVQ A;  1SNM A;  5I6Y A;  3NK9 A;  2OEO A;  1TQO A;  3RUZ A;  4G57 A;  4LAA A;  4E6I A;  2KHS A;  1STY A;  2HQE A;  5C4Z A;  4K2L A;  1EY7 A;  3D4D A;  5C5M A;  5IGC A;  1STG A;  3TME A;  3SK4 A;  2F3V A;  2KQ3 A;  5DAU A;  3SK8 A;  1SYB A;  1SYG A;  4ZUJ A;  1EY8 A;  5J22 A;  1EY9 A;  1EYD A;  2F0M A;  3OMC A;  4K14 A;  4R8N A;  1JOQ A;  2EYF A;  3TP8 A;  4KD3 A;  2F0K A;  5IGF A;  4ME5 A;  1SYF A;  2RKS A;  3TP7 A;  4NMZ A;  1SYC A;  4QMG A;  4KY5 A;  2EYJ A;  2PYK A;  4ID6 A;  2EY6 A;  4WOR A;  3SHL A;  1U9R A;  4KHV A;  4K8I A;  2OF1 A;  4PMC A;  2F0F A;  5IOC A;  2ENB A;  5HGT A;  1KDB A;  3H6M A;  1JOR A;  2EY5 A;  1A2U A;  5KIX A;  1JOO A;  1EYA A;  3SK5 A;  4N9P A;  4EQN A;  2EYO A;  3P1H A;  2F0G A;  5KYI A;  4KD4 A;  1KDC A;  2RBM A;  3HZX A;  1EY4 A;  5I6W A;  3EJI A;  5JAV A;  1A3T A;  5C4H A;  1EZ8 A;  5KYL A;  2NUC A;  3QOJ A;  1SYD A;  5CC4 A;  3DHQ A;  5CV4 A;  5JOB A;  4EQP A;  5C6A A;  3R3O A;  5J39 A;  1SNO A;  3OSO A;  4F8M A;  4QB4 A;  4I65 A;  3ITP A;  3SR1 A;  5IGB A;  3U9O A;  1AEX A;  4B9W A;  1SND A;  4NP5 A;  2F0T A;  4RKL A;  5NUC A;  1EYC A;  2SOB A;  2EY2 A;  2F0N A;  3NUC A;  4H7B A;  4RKB A;  1TR5 A;  5IIF A;  3D6C A;  3BDC A;  1STB A;  1JOK A;  5C3W A;  4OL7 A;  1EY6 A;  4EQO A;  3T16 A;  5CR3 A;  4KJN A;  2F0H A;  1SNP A;  1ENC A;  5KEE A;  1A3U A;  1EY5 A;  4K8J A;  4K5W A;  2F0Q A;  4WRD A;  4J1M A;  4B9X A;  2PZW A;  1IHZ A;  2EXZ A;  4N9T A;  1EQV A;  3V2T A;  5IOD A;  2F0E A;  3C1F A;  4TRD A;  3MEH A;  5C3X A;  2PW7 A;  4IAL A;  2PZT A;  2LKV A;  4NKL A;  1STH A;  3TP6 A;  4IUN A;  3OWF A;  2F0V A;  5C5L A;  3TP5 A;  1F2Z A;  1SYE A;  3PMF A;  2EY1 A;  3BDL A;  5CV9 A;  3MHB A;  4ODG A;  4KY6 A;  1SNC A;  4HMJ A;  4ZQ3 A;  5ISR A;  1KDA A;  3LX0 A;  5I9P A;  4IZ8 A;  5I9O A;  3S9W A;  4K2K A;  4KV6 A;  3MXP A;  5KGU A;  2WAC A;  5KRU A;  2O4X A;  3MZ5 A;  1II3 A;  4MIU A;  2F0S A;  5K5P A;  3D4W A;  2F0L A;  1RKN A;  2EYH A; 
#chains in the Genus database with same CATH topology
 3M4Q A;  4LUZ A;  4A3I B;  1KAB A;  3TRZ A;  2E8G A;  4CJ2 C;  4ZLT F;  2MUY A;  4YCU A;  3ERQ A;  3U9S A;  3S1R H;  2D0O A;  5EKK A;  3BZD B;  5COR A;  1CUK A;  4EVO A;  4BY1 H;  1B3A A;  4TVA B;  4MTN A;  3S1R B;  4J15 A;  1BO0 A;  2SNS A;  5E1F A;  2PNR C;  4BY1 B;  5KND A;  2IT1 A;  5ELF A;  1Z6H A;  3U50 C;  3S1M H;  2K04 A;  2J7Z A;  4FO2 A;  2FIN B;  3R93 A;  2F0U A;  3K5O A;  1NUC A;  2DJG C;  1EIH A;  4BA2 I;  1OXS C;  3BYT B;  1TQO A;  3VYT A;  2RDH A;  4E6I A;  1SE4 A;  3BVZ A;  5DLQ E;  1N36 L;  5C5M A;  2ATW A;  1STG A;  1QJO A;  4GOP A;  1SYG A;  1EYD A;  1JIC A;  3OMC A;  4K14 A;  1N33 Q;  1VQL A;  4RCO A;  1I4X A;  4LF8 L;  5GAG C;  4BBS H;  2A6H C;  1PH7 A;  1E22 A;  4FF2 A;  1HCZ A;  1K83 H;  5JEA H;  2A6H D;  2X6G A;  4C3J B;  1EIY B;  1K83 B;  1VF7 A;  2KEC A;  4FYD A;  3IFT A;  3RZD H;  2F0G A;  1IW7 C;  4KD4 A;  1FJG Q;  3HZX A;  2MO0 A;  1CHQ D;  2ZTE A;  3BZC A;  1BBU A;  3NWT A;  3RZD B;  2MHV A;  4POG A;  3FP9 A;  1I4Q A;  2Z4H A;  4R4T A;  5COY A;  2JYO A;  2NB0 A;  3H0G G;  3RN2 A;  4KI0 A;  2XRQ D;  1GKH A;  1STB A;  3R2I A;  3HOV H;  1EY6 A;  4JOI A;  2VQF L;  2QDL A;  4O42 A;  1SNP A;  3T56 B;  1MHW C;  2BH2 A;  3GTK H;  4C3H G;  3HOV B;  1B9N A;  2QW7 A;  1YBY A;  1LYL A;  1UWV A;  1VCI A;  3MWY W;  2PZT A;  4IUU A;  2VB2 X;  1GUG A;  1PTO H;  4IUQ A;  4PMW A;  2L15 A;  4JI0 Q;  1HUM A;  2Y0S G;  1PTO B;  3PUY A;  1A15 A;  2Q8T A;  3CMA A;  4B3R L;  1UNS A;  1K3B C;  1U4P A;  5I9P A;  3QWN A;  1D1K A;  1K3R A;  3C3L A;  1II3 A;  4A3L G;  5K5P A;  3BS1 A;  2NVY B;  1NCV A;  1PRT B;  4DAY B;  4GKJ Q;  2F4V Q;  2L55 A;  4H02 A;  5HUR A;  2E5L L;  1CZG A;  4KN4 C;  1RIP A;  3T13 A;  1XPO A;  2KOL A;  3NBH A;  1I4G A;  2SNM A;  2ZXR A;  4IUV A;  1NSN S;  4KJO A;  1M90 C;  2I5H A;  4XYO A;  4PV1 C;  5BN5 A;  2ZXP A;  5E3F A;  3A5U A;  3PO2 B;  1VQB A;  3NQT A;  5DEH A;  5BN3 A;  3EA6 A;  4OXP A;  2YTY A;  3D8G A;  4DR5 L;  5E4X A;  5FLM H;  1NAP A;  1PTO F;  5JJI A;  1MJC A;  3RNU A;  3E5S A;  4CDD C;  1F9Q A;  1HNZ Q;  3C2P A;  2NVT H;  1F9R A;  4OWX B;  4U68 A;  5C4Z A;  2RA4 A;  3J80 E;  2PMZ E;  1PRT F;  2KUM A;  1JJG A;  1T9H A;  1WTW A;  1Y14 B;  1LTT D;  2EYF A;  3I4N G;  1XTC D;  2EJM A;  3HG9 A;  2RKS A;  4KK7 A;  4LF7 L;  1YNX A;  4ID6 A;  3SHL A;  2MNA A;  3X3N A;  1MSG A;  3TDQ A;  3IAY A;  3GO5 A;  2X6L A;  3CP0 A;  1IZ6 A;  2N78 A;  1EOV A;  3H6M A;  4A3I G;  3QR8 A;  4IPG A;  4DR3 L;  3MEF A;  4C56 C;  4EQN A;  2XSC A;  2IY5 B;  3S14 B;  2OT2 A;  4XQQ A;  2WII B;  3EIV A;  1N9W A;  1SYD A;  5CC4 A;  5CV4 A;  4DK1 A;  1QUQ B;  3U4Z A;  3GTP H;  3OSO A;  1QE6 A;  1FJG L;  5GAH C;  5L37 A;  3ITP A;  4R8I A;  1LT3 D;  1NR2 A;  4OHJ A;  3F2B A;  2FFK B;  3W5O A;  4MN3 A;  3T16 A;  4IOA A;  2NYZ D;  3GV6 A;  1A3U A;  4IN3 A;  5IOD A;  2D5D A;  1D5M C;  3MEH A;  2PPB C;  3BYY B;  1L1O C;  1I5F A;  3K5L A;  4B08 A;  3OPO A;  4DV7 Q;  1ROD A;  1WVL A;  2I0Q A;  2MO1 A;  2NTS A;  3OWF A;  1F2Z A;  2B2W C;  4V0B A;  3ZYY X;  2BA0 A;  2DNC A;  1D7Q A;  4KY6 A;  1GXD C;  4IZ8 A;  1SMY C;  5KGU A;  3CHB D;  2FHT A;  2O4X A;  4LNQ A;  1SMY D;  3W3A A;  4C3J G;  1LM0 A;  3SVM A;  1FVI A;  5JEA G;  2EXD A;  3RZO H;  5CV6 A;  2TSS A;  1XYI A;  1LT6 D;  1UE1 A;  1WD0 A;  4GKJ L;  4IFD J;  3PUX A;  4K5X A;  4UY8 C;  1WTH A;  2F4V L;  2RDG A;  1SEB D;  1IBM L;  3BVM A;  3J7A 5;  2CCZ A;  1D8L A;  3OTO Q;  1H9M A;  1QVF A;  4X64 Q;  4NXM Q;  3F8T A;  2RVL A;  1PYS B;  5ELD A;  1HXY D;  3KLR A;  1I4H A;  2M9V A;  5C3X A;  3HOV G;  3AEV A;  2PNH A;  4LFC Q;  4ZKB B;  4P73 A;  4DR4 L;  2EOT A;  3DM1 A;  1K0R A;  1YI2 A;  4B3M L;  3MA2 B;  1EY7 A;  1C4Q A;  1Y8P B;  5FO8 B;  1H9K A;  3BG3 A;  2XTI A;  3K59 A;  3RLF A;  3NQI A;  1L2F A;  1O7L A;  1BCP C;  2L12 A;  1EY9 A;  4LW1 A;  2B39 A;  4QUC A;  4LF6 L;  2JQO A;  1SE8 A;  2L1B A;  1BCP D;  1YEZ A;  1TS4 A;  3DM3 A;  2VW9 A;  3SEB A;  2ID0 A;  2UXD Q;  1KIX A;  4DR7 Q;  3CKI B;  2KVM A;  2GA4 B;  4DA2 A;  3M7N A;  2ALY B;  3RLN A;  3MTS A;  1XNQ Q;  5I6W A;  4NB3 A;  2JE6 I;  1YVC A;  2BDO A;  5M3M H;  4HIM A;  2ZJQ A;  4YHH Q;  4JYA Q;  3NEN A;  5BR8 Q;  3P20 A;  1QIL A;  3TS2 A;  1L0Y B;  3PO2 G;  4AYB E;  1F2L A;  3BZK A;  4ME3 A;  3LWU A;  1DOL A;  2WKC A;  1SRO A;  2BCO A;  4K8J A;  1S5D D;  4WRD A;  1HNX Q;  2IHE A;  5FLM G;  3FKI H;  1ML0 D;  2LFN A;  3K0Y A;  2WKD A;  4JG2 A;  4NKL A;  2X69 A;  1CK1 A;  4O1N A;  3FKI B;  4DNT B;  5FLX c;  1PH4 A;  3S1N H;  4P72 A;  3J80 L;  1X6O A;  1I94 Q;  1FR3 A;  1EQR A;  2E76 C;  1S5B D;  3HOU G;  1F77 A;  2GVA A;  2A1A A;  4DV5 Q;  3W2D A;  4FF4 A;  3D4R A;  1SDF A;  3ICE A;  1TT2 A;  1UAP A;  5CV5 A;  1S72 A;  3PV0 A;  1G51 A;  4GLX A;  1TWF H;  1XMO Q;  2CFM A;  2OQ0 A;  3KF8 A;  4JI4 Q;  1PMR A;  5DNF A;  4XQN A;  3UE1 A;  1GHJ A;  2KJX A;  1H9J A;  3K7A H;  3VR2 A;  1CKO A;  2Z6K C;  2F0O A;  3CCV A;  1Z7T A;  2AMC B;  3OTO L;  4X64 L;  4M8A A;  1TS2 A;  3VA5 A;  3JC6 6;  3IRB A;  2F0W A;  4PMB A;  2B2V C;  2HD3 A;  5EPJ A;  4AIM A;  1QB5 D;  2CQO A;  2I07 B;  1NMG A;  2RCN A;  1PH1 A;  1AZP A;  2VL6 A;  3TME A;  3Q0A A;  3SK8 A;  3FEW X;  3KOJ A;  3MXG A;  2K5Q A;  1ILQ A;  2A69 C;  2KCN A;  5GQO A;  4B3S L;  1TWG H;  2Q2I A;  4NMZ A;  5DM7 3;  2A69 D;  3OHX C;  3M3Y B;  1NE3 A;  4RAU C;  4JI1 L;  1TWG B;  3CD6 A;  1PFB A;  2EYO A;  3P1H A;  2Z9H A;  5KYI A;  1SSO A;  1X32 A;  2KCT A;  5IT9 L;  3FMC A;  3S2D H;  5IYC H;  2YU9 H;  3K57 A;  1WTP A;  1U4L A;  1XNQ L;  3S2D B;  2K1B A;  4NW2 A;  3S1Q H;  1A8V A;  1IYV A;  2QCP X;  2YU9 B;  1L1O B;  2IX1 A;  4KKS A;  3S1Q B;  3KF6 B;  5KEE A;  3J81 j;  1LTS D;  3CPF A;  3A8J E;  2A73 B;  1AN8 A;  1UE6 A;  3C1F A;  2Q2U A;  1STE A;  2WIN B;  2CKZ B;  3HRZ C;  1XX8 A;  2F03 A;  2B2V A;  3KBG A;  3PMF A;  4H44 C;  4QL5 A;  1JR0 D;  2PO4 A;  1SFO H;  4ODG A;  5AJ3 L;  2UUC L;  5M3F B;  1LLR D;  3LNN A;  4BBR B;  4DAP A;  5FOB B;  1J5E Q;  3UDG A;  2FXQ A;  1FNW A;  2XIW A;  4KLK A;  2ZTD A;  1A6X A;  2PI2 E;  4BXX G;  2JA9 A;  5TSS A;  4MNO A;  4QIW E;  1TWA H;  4JI8 Q;  2B2Y A;  4I7A A;  5C3E H;  2ZTC A;  4YIJ A;  3HOW H;  1A63 A;  3Q24 A;  4DGZ A;  3M4P A;  5C3E B;  1A3V A;  3T53 B;  1C48 A;  1STN A;  4JCV E;  1BCP B;  2OCE A;  4CJ0 B;  1MGS A;  3NK9 A;  3KJP A;  1PLF A;  1KRT A;  1KNA A;  2XWJ B;  4LAA A;  1EQQ A;  2VQE Q;  1Y8N B;  3FKI G;  2RF4 A;  3D4D A;  4IQZ A;  3J7A V;  3RLO A;  2F3V A;  4QY7 A;  1CQF A;  1SYB A;  1CKN A;  3KDF A;  1PRT C;  1D1I A;  1E2Z A;  4L5T A;  2N3S A;  1JT8 A;  1PRT D;  1CFM A;  4CDC C;  1KXL A;  1BF4 A;  1TY2 A;  2E2I H;  2MPM A;  4DV3 L;  1VQG A;  3R2T A;  2L11 A;  4Y52 H;  3FHW A;  2QEJ C;  4PG3 A;  2E2I B;  1LUZ A;  2IJ0 A;  3HOZ H;  3K0X A;  1SJE D;  3EJI A;  4L5R C;  4L8J A;  3HOZ B;  4POF A;  5D14 A;  4RMF A;  4UAI A;  4YY3 L;  1PH5 A;  4RGO S;  2F0T A;  4UP7 A;  1PDQ A;  3MAQ A;  2OTL A;  5D3I B;  1SJH D;  3U58 A;  1IBK Q;  2QKI C;  1I4P A;  3I4L A;  2Q2H A;  3CCL A;  1R4P B;  1VMP A;  1IHZ A;  1KLU D;  4LUV A;  3GTO H;  2R92 H;  1MJE A;  3M4Y A;  3GTO B;  4APV A;  4EGV A;  1MIU A;  4IUN A;  1MD2 D;  2F0V A;  2XRS D;  5C5L A;  3TP5 A;  3I73 A;  1PH3 A;  3I91 A;  3M4O B;  2BE5 C;  5CV9 A;  3VR3 A;  4WJW A;  3M9B A;  1KDA A;  2BE5 D;  3I4O A;  4K2K A;  4YWM A;  1I50 H;  2F0S A;  4PZ8 A;  4OIJ A;  3CCJ A;  5FLX E;  3L3O C;  4DAY A;  4X3T A;  1I50 B;  5C4J H;  4X6A H;  3IL8 A;  5IP7 H;  4HMI A;  3OMG A;  4JBK A;  1B53 A;  2PQE A;  3GTM H;  1VQI A;  3H09 A;  1H9S A;  4C3I H;  3GTM B;  4B3T Q;  4LF5 Q;  1SNQ A;  5IYC G;  1YNN C;  4KHP Q;  4C3I B;  4K5V A;  1S3O A;  1XJV A;  1P8L A;  1YNN D;  4GN3 B;  1NJI C;  3CAM A;  2JEA I;  3A55 A;  2OTJ A;  3PF4 A;  4JI2 L;  4FP5 D;  4K0K Q;  3HKZ B;  3A7L A;  2UU9 L;  4QGU A;  4X3U A;  1IBL Q;  4CDF C;  2EVB A;  4ZYS A;  3G6E A;  2K28 A;  2YTV A;  5J22 A;  3T1Y Q;  1T5E A;  1V1O A;  3JAM L;  1PHJ A;  4IFD H;  5M3F G;  2EYJ A;  1GUW A;  4DUY L;  4DAV A;  4BBR G;  2O5J C;  3UE0 A;  4A3F H;  3QG1 A;  5KIX A;  3QO2 A;  3I56 A;  1LTA D;  3S1M B;  1X65 A;  3SK5 A;  4A3D H;  3FRP B;  3NWS A;  4A3F B;  2KA7 A;  1DOM A;  2K33 A;  1BNZ A;  5KYL A;  1A3T A;  5JOB A;  1QUQ A;  5C6A A;  1X9N A;  5EJW A;  1SNO A;  2IX0 A;  2SDF A;  2AQ2 B;  1CKN B;  1HZ9 A;  3KDF B;  3NTI A;  2FMM A;  3HKZ E;  1JOK A;  5C3E G;  3WDN A;  1LAC A;  1VQH A;  5E4W C;  4BBS B;  1EUJ A;  1SR3 A;  2EXZ A;  4N9T A;  4IUP A;  1BKB A;  5LMN W;  5JVG 3;  2WB1 E;  1MI2 A;  2NVQ H;  4DV1 Q;  4X65 Q;  3A7A B;  3NEL A;  1ESR A;  5J3B A;  1IW7 D;  2J0T D;  2Z4I A;  4U67 3;  4GKK L;  1RF2 D;  3MXP A;  3J81 i;  3DLL A;  1SN8 A;  4X62 Q;  3I70 A;  4QUF A;  4CKE A;  4A3E H;  3C1E A;  3GTK B;  4HJ7 A;  4RH6 A;  4A4I A;  3HOZ G;  3GD7 A;  3WOE A;  2L0C A;  2L4N A;  1SE3 A;  1CKM A;  4KKU A;  1Q8K A;  2M00 A;  2NN6 H;  1PV4 A;  2RQX A;  2PMZ B;  4NDX A;  5ELB A;  1Y1V H;  4PZ6 A;  2I5M X;  3VA7 A;  5C0X I;  1U0L A;  1BBW A;  4L6T B;  4DR2 Q;  4B3T L;  4JV5 L;  1Q46 A;  1IKL A;  1Y1V B;  3L9A X;  4PNY A;  1L0X B;  5J1Z A;  1S5E D;  4DUZ Q;  4OO1 G;  2VUM H;  3KLS A;  4K2L A;  2BOS A;  4HAE A;  1O7Y A;  1GUS A;  2UUB Q;  4K0K L;  4X3K A;  1PFM A;  5FO9 B;  1FYC A;  4LF4 Q;  1PH8 A;  5M5X H;  1GJX A;  4ZUJ A;  1EY8 A;  2F0M A;  1H9S B;  1B7Y B;  5IWA Q;  3FPP A;  5M5X B;  1UE7 A;  3V05 A;  1HA5 A;  4KY5 A;  4NXN Q;  3M85 A;  3A8K E;  3NBI A;  4R9W A;  5IOC A;  2CQA A;  3CC7 A;  1YJ9 A;  1X54 A;  2KBN A;  3HGB A;  4MTK A;  2KHJ A;  3PIO A;  5JAV A;  1RTO A;  5FLX L;  3DHQ A;  5IP7 G;  2NVT B;  1AE3 A;  1TY0 A;  2VXW A;  1XMQ Q;  3U9O A;  1VQC A;  4DV0 Q;  2EY2 A;  2CVR A;  4C3I G;  1VQ4 A;  3BDC A;  2H1E A;  5C3W A;  2D62 A;  1N33 L;  1N32 Q;  3AYH B;  5CR3 A;  1VQF A;  4IFD I;  3J7Y W;  1P16 A;  4HSP A;  1JCK B;  1LTR D;  1EU4 A;  4B9X A;  4LFB Q;  4XIG S;  3HKZ G;  1BQQ T;  1NTG A;  4OX9 Q;  2IW3 A;  1W6K A;  5C0X J;  2K32 A;  2WP8 J;  3ER0 A;  2EIF A;  1LTB D;  3VR6 A;  2QIL A;  4MHE A;  4X3S A;  1K8G A;  1ILP A;  4DV1 L;  4YCW A;  4ALP A;  1VQ5 A;  1JE5 A;  3MHB A;  4BY1 G;  1SNC A;  1O7Z A;  5ISR A;  3GTP B;  1HRJ A;  1OXX K;  4HJ8 A;  1LAB A;  4FF3 A;  3MZ5 A;  1OXT A;  2NZH A;  2UXB Q;  1B4O A;  5EPL A;  3PO3 H;  4A3F G;  3P75 A;  2Z1C A;  1WTV A;  1DYQ A;  1ZXT A;  4JK1 C;  3LGJ A;  2JA8 H;  2K5N A;  4TSS A;  1QZH A;  2JA8 B;  2G9D A;  4GZY C;  1HPC A;  1IL2 A;  1JWU D;  2E75 C;  4HTH A;  2TMP A;  2EJF C;  5IGG A;  3KYH C;  4JI0 L;  1U5K A;  2Z0S A;  2B2T C;  2K7V A;  2R3Z A;  1F2M A;  2XGT A;  4BBS G;  1PFS A;  3DEP A;  3CCR A;  5C4X H;  4J6H A;  4ZCK A;  2PW5 A;  3KLS X;  3TSS A;  3KJO A;  1N34 Q;  3L2P A;  4OON A;  2KCM A;  4G57 A;  2KHS A;  2GN5 A;  5C4X B;  3QIA A;  1OTC A;  1G6P A;  5IE8 A;  2HIX A;  3RZO B;  1B2T A;  1ET9 A;  4R4Q A;  3M7G A;  1YIJ A;  3GQB A;  2A8V A;  4AQY Q;  2A5H A;  3J81 c;  4LF4 L;  1SYC A;  1VF5 C;  2NN6 I;  1H9R A;  2A19 A;  3ND8 A;  1B1Z A;  1E1O A;  2BDN A;  5C44 H;  4IPH A;  1JOO A;  1RL2 A;  3PQI A;  2O2L D;  1X3G A;  4AYB B;  1GM5 A;  1TWC H;  1YHB A;  4IPC A;  4DNI A;  5C44 B;  1E3P A;  4UP9 A;  2A6E C;  5M5W H;  1YHA A;  1XPU A;  2DGY A;  2HIV A;  2A6E D;  4DKA C;  3ULP A;  1C8C A;  1HNZ L;  1QOH A;  4F8M A;  3K80 C;  2PI2 A;  4CGY B;  1QVG A;  1AEX A;  1SND A;  2GVB A;  4BY7 H;  3DWQ A;  2NBF A;  1L1O A;  3KF6 A;  4DV2 Q;  4LK1 C;  1DD2 A;  4BY7 B;  1TWH H;  4DV0 L;  1Y1V G;  2B2W A;  2ICE C;  3F2C A;  2PZW A;  5FJ8 H;  1CSQ A;  5E7N A;  4A3J H;  3BDO A;  5IP9 H;  2FJ2 A;  4OWW B;  2AWO A;  4LUO A;  2UUA Q;  4LFB L;  4A3J B;  1XXG A;  4IOC A;  4OX9 L;  4CKC A;  1E2V A;  3P7J A;  4A3C H;  4GN5 A;  2HCC A;  2HDL A;  3A0J A;  5M3M B;  5I2X A;  4KV6 A;  5A2Q E;  5IYD H;  4XTC S;  5CBA E;  4AH6 A;  1VQ8 A;  1K8O A;  2J4X A;  3IFD A;  5LMN Q;  2Z6B A;  1HJP A;  4DPG A;  3V96 A;  5EGT A;  3VYS A;  1VQM A;  2L9H A;  1HTL D;  4DF7 A;  1LO5 D;  4O0A A;  4DN4 M;  1ZKO A;  5CV8 A;  3CC4 A;  1WCM H;  2MP1 A;  3HOX H;  1LT5 D;  1LT4 D;  3N6R A;  3E6Z X;  4DV7 L;  2OXP A;  4XQJ A;  1EIF A;  4XDX A;  3S1N B;  1PXU A;  3KLW A;  4XYQ A;  5FO7 B;  3OIQ A;  1BUV T;  2BH8 A;  5LMU Q;  1ASZ A;  3H3V I;  4Q0F A;  2JK8 A;  4ZKC B;  2K52 A;  2RCF A;  1N34 L;  1CA5 A;  1KRS A;  2F4I A;  3T1H Q;  5EPK A;  1QG7 A;  1TWF B;  1CSP A;  4KD3 A;  1HH2 P;  3VR5 A;  5IGF A;  4ME5 A;  1C9O A;  1EEF D;  1JB7 A;  4FNF A;  3I4M H;  5JJZ A;  4Q5V A;  3HP3 A;  3FVQ A;  4X66 Q;  3K7A B;  1U9R A;  2OF1 A;  4NXM L;  3I4M B;  2F0F A;  2ENB A;  1JOR A;  1KTK A;  1A2U A;  1E7Z A;  1FL0 A;  1EYA A;  4TQU S;  4V19 0;  4A93 H;  3K58 A;  2B8G A;  3MFG A;  1V8Q A;  4R4C A;  1EY4 A;  4A93 B;  2NUC A;  4LFC L;  1J9O A;  3BJU A;  5ELC A;  2JA8 G;  3AFQ A;  4EQP A;  1E0B A;  3K6O A;  4JBM A;  4RKL A;  1KHI A;  2QEX A;  4DK0 A;  4JI5 Q;  3GDE A;  4OGQ C;  5BN4 A;  1XPR A;  3PF5 A;  1BDO A;  4K5W A;  4DR1 Q;  3EFX D;  3EN2 A;  2D2C C;  4RA8 A;  2PQA B;  3Q23 A;  2UXD L;  1GUO A;  5C4X G;  3A8I E;  1UEB A;  1PFN A;  1X3P A;  4DR7 L;  1WYD A;  1ASY A;  1KAW A;  4KN7 C;  2OWO A;  3E0J A;  2DJF C;  4GS3 A;  2HT1 A;  5I9O A;  1Y1W H;  4YHH L;  1VDZ A;  4JYA L;  3PIP A;  4QIW B;  2XWB B;  5BR8 L;  3G6J B;  1Y1W B;  2KEN A;  4CKB A;  3A5Z B;  2Z6K A;  3TQY A;  4AYB G;  4KY7 A;  3MXN B;  2F3I A;  1CI3 M;  4CBV A;  1HZB A;  1HNX L;  1Z9F A;  1D5X C;  1ENA A;  4IUT A;  2R61 A;  4JI6 Q;  2EYP A;  1JC7 A;  2DUD A;  3S24 A;  4KTA A;  3NXW A;  1SFO B;  2RHS B;  1WOC A;  1NNX A;  1I94 L;  3J7A F;  4DK3 C;  1EWC A;  1Y8O B;  2R6G A;  4DV5 L;  4A3K H;  1STY A;  5FJ8 G;  1WJJ A;  4A3J G;  1W2B A;  1ICF B;  4A3K B;  3PUW A;  3SK4 A;  1TXY A;  1ESF A;  4LWC A;  4RWS C;  1S4Z A;  4HR7 B;  4DR6 Q;  1ONL A;  3E9I A;  4DV6 Q;  1XMO L;  4Z9C B;  2DN8 A;  5HY6 A;  3TEH B;  2K5H A;  5M3M G;  4JI4 L;  2SEB D;  3TP7 A;  1K8A C;  2R7Z H;  1TWA B;  2HHH Q;  4QMG A;  2H5X A;  2KEE A;  3N52 A;  1VQ7 A;  3TN2 A;  2ZM6 Q;  2R7Z B;  1KDB A;  1WTX A;  4HIK A;  3HOW B;  1Q3L A;  5A2Q L;  3J81 E;  1MSH A;  3WOF A;  4GLV B;  2LMC B;  3GTL H;  2AQ3 B;  5K36 H;  2QGQ A;  3DXJ C;  3GTL B;  3SGI A;  2SOB A;  3NUC A;  4OWT B;  1XNR Q;  1PZI D;  4G7O C;  1B3Q A;  2B2U C;  3QJY A;  4OIK A;  1ENC A;  1O78 A;  1CT1 D;  3TZD A;  1HQR D;  1KLG D;  2F0E A;  2N88 A;  1Q8I A;  3GTG H;  1IXR A;  3CC2 A;  4IAL A;  3T4A C;  3TP6 A;  3K5N A;  4C1N I;  1M1K C;  3GTG B;  1QNU A;  1QCB D;  4XT3 B;  4KHZ A;  1DOK A;  3GTJ H;  1B9M A;  2ZJP A;  5AFW A;  2EZV A;  1HNW Q;  2DY7 A;  4N8X 1;  3CCM A;  2JA6 H;  2K05 A;  1TVX A;  3I4M G;  1I6V C;  4ABN A;  4JBJ A;  5M5Y H;  1N36 Q;  4C2M H;  2NTT A;  5I4D A;  1D6E C;  2JA6 B;  3IKJ A;  2K14 A;  1SRU A;  1EY0 A;  2RDF A;  4C2M B;  1X3E A;  4K6D A;  4A93 G;  2HDM A;  4QJF A;  2R92 B;  1K9M C;  4LF8 Q;  1F9P A;  1A0I A;  3PIO 3;  1SXT A;  1LTG D;  4HED A;  5C0X H;  4UP8 A;  4A3L H;  1S5F D;  2IPK D;  2Q8R E;  1Q1B A;  4DFA A;  4G7Z C;  1TII D;  1CZW A;  1JJ2 A;  2QDB A;  2CH4 W;  4F7X A;  1V1P B;  3EVQ A;  1J5E L;  1U4M A;  2B2U A;  4ULL A;  5IGC A;  5C4J B;  5G3L D;  3CQZ H;  3HFZ B;  3OYY A;  3UI2 A;  4EQ5 A;  4A75 A;  1F9S A;  4NPS A;  4A76 A;  4IUR A;  1HUN A;  4ZK9 B;  3STB C;  1W3S A;  4XXE A;  3CQZ B;  1K0S A;  4FDB A;  4DV6 L;  4Y7N H;  4JI8 L;  4JI3 Q;  4TKO B;  2AWN A;  1Q82 C;  5IY0 A;  1Y1W G;  4GOP C;  3HS0 C;  4Y7N B;  1WTQ A;  3X3M A;  2AKW B;  1VQ6 A;  2RHQ B;  5JVH 3;  1WD1 A;  5CBE E;  2A74 C;  5IT9 c;  1UEA B;  4HJ9 A;  1PZK D;  4HJ5 A;  4B3R Q;  3UDX A;  5LHY 1;  1D2B A;  4BWG B;  3S2H H;  2VQE L;  2WB1 B;  1GUT A;  4H0L C;  2P5Z X;  3S2H B;  5KNC A;  4A3I H;  1HA6 A;  1G91 A;  2YTX A;  2E5L Q;  3I3C A;  3K81 C;  4J1M A;  4JVZ A;  3CCS A;  1K73 C;  3V2T A;  1XNR L;  1IYJ B;  4FXD A;  4A3G H;  4FXK C;  3T51 B;  2JJQ A;  3ONA B;  3OOC A;  4A3K G;  4A3G B;  2LSS A;  1VQO A;  4JOI C;  4A3D B;  3RMH A;  3L0O A;  5H1S E;  2FMC A;  3KBX A;  2K4K A;  4DR5 Q;  1EWH A;  1IYU A;  4F88 A;  3I7F A;  1Q7Y C;  4ZQ3 A;  3LX0 A;  3JAM i;  3NPP A;  2WAC A;  3MFY A;  3ZJY C;  3B6Y A;  3A56 A;  2K6A A;  2E2H H;  1HNW L;  2R7Z G;  5JPN C;  4HIO A;  1IL8 A;  2HCI A;  3HOW G;  3WWV A;  1OO9 B;  3CXC A;  1PVO A;  2E2H B;  2F0J A;  3K7U C;  2Q8I B;  4C1N K;  1PH2 A;  1IBK L;  1NY4 A;  4P71 A;  1HZC A;  3TZU A;  3MVV A;  1K8M A;  4PQX A;  3GTQ H;  1BBX C;  1AW7 A;  1CM9 A;  4LF7 Q;  2NVQ B;  1PYB A;  3J81 L;  3GTQ B;  1O7I A;  3NHH A;  4K6L A;  5K36 G;  4DR3 Q;  3DMU A;  4WJ4 A;  1F2Y A;  4QF4 A;  4C3J H;  1I6H H;  4WFN 3;  3RR5 A;  1S40 A;  3MC0 B;  1BVS A;  2F1M A;  1KAA A;  3LWE A;  4XT1 B;  5ELN A;  1XTD A;  1I6H B;  2PZU A;  1SNM A;  3I8Z A;  2N8N A;  2R93 H;  2HQE A;  5LL6 X;  1K28 A;  5JPM C;  5DM6 3;  3AQQ A;  3I55 A;  2K5D A;  4A3E B;  2R93 B;  2YV5 A;  3J7Z C;  1EFI D;  2NVX H;  1X3F A;  3VYU A;  3FPU B;  2ASB A;  3TP8 A;  1ENF A;  3NEM A;  2NVX B;  3DWA A;  4WOR A;  1W6J A;  2B63 H;  4K8I A;  4LF5 L;  4KHP L;  1QVC A;  2B63 B;  4OO1 I;  2JA6 G;  4N8F A;  3EQL C;  3URY A;  4JI3 L;  1JMC A;  1JJC B;  1RHP A;  4RCN A;  4L63 B;  1KDC A;  2R92 G;  4KKT A;  1PZJ D;  1SAP A;  1TU2 B;  3TS0 A;  2VUM B;  3H91 A;  1EFW A;  1UE5 A;  1BR9 A;  1VMC A;  4G4K A;  3DWP A;  1IBL L;  2NVY H;  1HZA A;  3DUZ A;  1GVP A;  2K75 A;  5C0X G;  4YWK A;  2BA1 A;  3CCQ A;  4JW0 A;  4EQO A;  1ZYR C;  2G9H D;  3T1Y L;  1C0A A;  1DGS A;  1GOZ A;  1ZYR D;  1KQS A;  2Z8L A;  1IBM Q;  1NMF A;  5EBC A;  4JC0 A;  4FF1 A;  4BA1 I;  3CPW A;  1OXU A;  3PO2 H;  1SYE A;  3I72 A;  2MQH A;  4HJA A;  2JEB I;  1ET6 A;  4DR4 Q;  4JPB W;  3C46 A;  3OIP A;  3D4W A;  3R8B A;  2PW7 A;  1RKN A;  4B3M Q;  1U4R A;  3ERS X;  3ULJ A;  3D6W A;  2JP1 A;  4RGM A;  3PCO B;  1EZ6 A;  2IHF A;  3F2U A;  4S3S A;  4LF6 Q;  4HSV A;  4HCE A;  3HEJ A;  2B3G A;  3DEO A;  2VS1 A;  5T1I A;  2QA4 A;  3HOU H;  2CW0 C;  5D3D A;  2WB1 G;  4X65 L;  3Q6S A;  1AFP A;  3ND9 A;  1JWM D;  2CW0 D;  3HOU B;  1VS0 A;  5IYB H;  2E2J H;  2EYL A;  1A62 A;  4ZAI A;  4R1J A;  1AE2 A;  1V1Q A;  3S14 H;  4CDE C;  4IFD G;  1SBB B;  2E2J B;  3H3V H;  5I6Y A;  4DAM A;  1HR0 W;  3K8A A;  2V1C C;  2OEO A;  3UDF A;  4LF9 Q;  1J8I A;  4X62 L;  1JQY D;  4A3G G;  3PO3 B;  4A3D G;  5FK9 C;  1DZ1 A;  4GOP B;  1FGU A;  3AB9 A;  1KNE A;  3JAM c;  1R9T H;  2F0K A;  1AH9 A;  2D9U A;  1QNK A;  2B8F A;  1B70 B;  1R9T B;  4M1U B;  2Q2T A;  5A35 A;  3MXU A;  4O2D A;  2I46 A;  1B8A A;  5HGT A;  3E3X A;  5G3L F;  5ELE A;  4N9P A;  4DR2 L;  2IWH A;  4DXF A;  3PIP 3;  1CTM A;  3PUZ A;  3U4V A;  3KUP A;  2XN9 C;  3PGZ A;  4DUZ L;  1AZQ A;  4JBW A;  1YJN A;  3SR1 A;  4R4I A;  1Q81 C;  3PSI A;  2NWG A;  2UUB L;  5GRO A;  4H7B A;  1TR5 A;  1JB3 A;  1FGB D;  4OL7 A;  4LFA Q;  3CRK C;  3NTH A;  3OWE B;  4KJN A;  5IWA L;  5IT9 E;  1LTI D;  4YWL A;  2F0Q A;  4RGN A;  4QCL A;  2JN4 A;  2XVS A;  4MZ9 A;  1VQN A;  1RDP D;  4NXN L;  2PQA A;  1YNJ C;  2JA7 H;  2H4O A;  4QQB X;  2LKV A;  2K50 A;  1G29 1;  1YNJ D;  2EPB A;  4A3E G;  2R93 G;  2JA7 B;  1DCZ A;  4GNX C;  1TWC B;  2E74 C;  2XNA C;  1G2S A;  4G7H C;  5M5W B;  4ILW A;  2EY1 A;  2UXC Q;  4RHR A;  3SE0 A;  1N8R C;  2NN6 G;  1XMQ L;  4A3B H;  4LMQ D;  3Q8D A;  4A3M H;  1VQJ A;  2B63 G;  2F0D A;  3CCE A;  3ULL A;  4A3B B;  1GO3 E;  1TWH B;  5EKI A;  1N32 L;  1RCV D;  3MXN A;  4A3M B;  2C5C A;  3SDZ A;  3E0E A;  1VQK A;  2B2T A;  1JE4 A;  1ICW A;  3NBH B;  5I2Y A;  3NP8 A;  4B3S Q;  2VUM G;  5JEA J;  3D31 A;  5CV7 A;  5FKA C;  3D0F A;  4JI1 Q;  3E9H A;  5GAE C;  3TBI B;  3S16 H;  3H94 A;  2F0I A;  4GN4 B;  2WFW A;  4DU9 A;  5EQ0 A;  1BOS A;  5M9O A;  3S16 B;  1QZG A;  3ERO A;  4BXX H;  1MBY A;  3G71 A;  1JOQ A;  1Q1E A;  2VY3 A;  3S15 H;  1S5C D;  3G4S A;  5HGQ A;  1FD7 D;  4IJH A;  2UXB L;  3S15 B;  4LJZ C;  4LF9 L;  2YYZ A;  2B29 A;  1EYG A;  3RN5 A;  2ZJR A;  1OXV A;  4P2C B;  1CA6 A;  1WCM B;  1YZ6 A;  2MFI A;  2IX3 A;  3HOX B;  5IIF A;  2ZT9 C;  4GNX A;  2JXM B;  1SLJ A;  4KHV A;  1I4R A;  2EY5 A;  4HCS A;  4UPA A;  2KCC A;  5T1G A;  2RSN A;  1TKW B;  1V43 A;  2RBM A;  2K03 A;  1EU3 A;  4CHT B;  2C9O A;  2VB3 X;  1KD1 C;  5AJ3 Q;  2UUC Q;  2MJ8 A;  2I5L X;  5J39 A;  4JI7 Q;  1EQT A;  2IL8 A;  4QB4 A;  1DM0 B;  3KK7 A;  4I65 A;  3VR4 A;  4IO9 A;  1PH6 A;  3BVG A;  4NP5 A;  2F0N A;  4UDU C;  2AQ1 B;  3CU7 A;  2F52 A;  1WI5 A;  3J80 i;  4RGT A;  3CCU A;  3RD4 A;  4AQY L;  2F0H A;  1GHK A;  5IYB G;  3HOY H;  1RD9 D;  1V9P A;  3W1G A;  2ZXO A;  1SMX A;  3AMU A;  3O13 A;  1EQV A;  4LFA L;  3I2Z A;  4OEM B;  1R4Q B;  5JJL A;  1VQE A;  3HOY B;  3CW2 C;  1M4V A;  1STH A;  3PO3 G;  2M2L A;  4H13 C;  3TRE A;  2LY7 A;  2JA5 H;  1RTN A;  3Q22 A;  3D3R A;  2DY8 A;  1EWI A;  3BDL A;  2AHO B;  1PH9 A;  2JA5 B;  2HQL A;  1XWE A;  4EX5 A;  3S9W A;  5KRU A;  4MIU A;  2UXC L;  2WAQ B;  3HKS A;  3CME A;  2K5W A;  4KMU C;  3CF5 A;  2O5I C;  1A2T A;  2E2D C;  2L5T A;  1VQP A;  2HUG A;  5CGK A;  3VDY A;  4DV2 L;  2KED A;  4DK6 C;  1STA A;  4P75 A;  2KHI A;  2QF7 A;  2C35 B;  3QOL A;  4ZRZ A;  2JSO A;  3F2D A;  2F3W A;  3M3Y H;  1GD7 A;  5IGD A;  2UUA L;  4DV3 Q;  1G8Z D;  5D65 A;  1WFQ A;  2EE1 A;  3GV3 A;  1GUN A;  3SK6 A;  1KL9 A;  4HN7 A;  1V1P A;  2NZ1 D;  2B2Y C;  1X56 A;  4GLA C;  4DNR B;  2AUK A;  3RUZ A;  1SE2 A;  5C44 G;  2WV6 D;  4YY3 Q;  5ELO A;  5LMN L;  2JA7 G;  2V4D A;  1Y69 U;  2KQ3 A;  2R7F A;  2WAQ E;  4R8N A;  1BXT A;  2K01 A;  1SYF A;  4RFB A;  1MKH A;  1Q90 A;  4L5S A;  4PMC A;  4BY7 G;  1G6Z A;  3KFU A;  1Z47 A;  1QWY A;  4R4O A;  3W1B A;  3EBE A;  1HR0 Q;  2DNE A;  4A3B G;  2LXK A;  3K5M A;  3S17 H;  2R7D A;  3UDI A;  4A3M G;  5CYU A;  1DJR D;  4J8Q A;  3JAM E;  2PCF B;  3S17 B;  3OW7 A;  5C4H A;  4I7Z C;  5EBD A;  5LMU L;  1I3Q H;  5IP9 G;  1LTL A;  3R3O A;  3F1Z A;  5M3F H;  4DV4 Q;  2EDG A;  4B9W A;  1I3Q B;  4BBR H;  3VYR A;  4A3C G;  1EYC A;  4RKB A;  3T1H L;  4JI7 L;  3D6C A;  4FVM A;  4GNX B;  1EY5 A;  1X3Q A;  1KC8 C;  5IYD G;  1Q12 A;  2K5V A;  4IPD A;  4X66 L;  1EEI D;  5GAD C;  1FNU A;  1TS3 A;  3OW2 A;  1L0W A;  1D5Z C;  1NR4 A;  1E2W A;  1JWS D;  3L7Z C;  4F87 A;  2EJG C;  1YHQ A;  2N49 A;  2VZA A;  3BU2 A;  2A68 C;  1WCM G;  1WTR A;  3A54 A;  3HOX G;  4JI2 Q;  4WJ3 M;  2A68 D;  2UU9 Q;  2F0L A;  2EYH A;  1TS5 A;  1ZEQ X;  2CWA A;  3AFP A;  1VQA A;  1PTO C;  1PYW D;  4JI5 L;  5EKL A;  3A74 A;  1LV9 A;  4DR1 L;  1PTO D;  1CHP D;  3KF8 B;  1E1T A;  4YCV A;  1G2T A;  5F2D A;  3SXH A;  3H0G H;  5EAY A;  2EYM A;  3NSW A;  4DUY Q;  3G7L A;  4RHS A;  1YJW A;  3J80 c;  3H0G B;  1HQM C;  3GTJ B;  4C3H H;  3QB3 A;  5IGE A;  4ZUI A;  3PUV A;  3NTK A;  1PA6 A;  2F0P A;  4C3H B;  1IKM A;  2N55 A;  2ES2 A;  1FNV A;  4OEL B;  4BS9 A;  3HOY G;  2LXJ A;  5M5Y B;  1BCP F;  1M8A A;  1DON A;  4IJL A;  5DAU A;  1NBW A;  2Y0S B;  4HID A;  2NZO A;  2JA5 G;  1UUP A;  1E24 A;  2ICI A;  4FXG C;  1C7Y A;  3CRL C;  5JJK A;  2PYK A;  2EY6 A;  1O80 A;  1HTP A;  2WAQ G;  2EQS A;  5LL6 S;  4OO1 H;  1Q86 C;  4JI6 L;  2CHB D;  2D0P A;  2CH4 A;  1HR0 L;  3M4O H;  1EIG A;  1EZ8 A;  1T5X D;  3QOJ A;  1EOT A;  4GKK Q;  2LS0 1;  4UHV A;  4PZ7 A;  2AUJ D;  5IGB A;  2VQF Q;  3AU7 A;  3G48 A;  5NUC A;  1J6Q A;  1B50 A;  3NE5 B;  1WTO A;  4DV4 L;  3H3V C;  4DR6 L;  3STB D;  1H95 A;  1CQV A;  4RG1 A;  4CJ1 B;  1HHV A;  2HHH L;  4TRD A;  2VNU D;  3I90 A;  1YIT A;  2ZM6 L;  2Y0S E;  2OQK A;  1VQ9 A;  2G5D A;  1EL0 A;  2RSO A;  3I4N H;  1B44 D;  1VQD A;  1X55 A;  5KNB A;  4L5Q A;  5CMD A;  4JV5 Q;  2CWP A;  2MGS A;  3I4N B;  1HFN A;  4HMJ A;  4DXG A;  1DXM A;  3FDT A;  3GP7 A;  4P74 A;  3H15 A;  1AP0 A;  1HFG A;  1RJT A; 
#chains in the Genus database with same CATH homology
 4A3I B;  1KAB A;  4CJ2 C;  4ZLT F;  2MUY A;  3ERQ A;  3U9S A;  5EKK A;  3BZD B;  5COR A;  4EVO A;  1B3A A;  3S1R B;  1BO0 A;  2SNS A;  5E1F A;  2PNR C;  4BY1 B;  5KND A;  2IT1 A;  5ELF A;  1Z6H A;  2K04 A;  2J7Z A;  4FO2 A;  2FIN B;  3R93 A;  2F0U A;  3K5O A;  1NUC A;  1EIH A;  4BA2 I;  1OXS C;  3BYT B;  1TQO A;  3VYT A;  2RDH A;  4E6I A;  1SE4 A;  3BVZ A;  5C5M A;  1STG A;  1QJO A;  1SYG A;  1EYD A;  1JIC A;  3OMC A;  4K14 A;  4RCO A;  1I4X A;  2A6H C;  4FF2 A;  1HCZ A;  5JEA H;  2A6H D;  2X6G A;  4C3J B;  1K83 B;  1VF7 A;  2KEC A;  4FYD A;  3IFT A;  2F0G A;  1IW7 C;  4KD4 A;  3HZX A;  1CHQ D;  3NWT A;  3RZD B;  2MHV A;  1I4Q A;  2Z4H A;  5COY A;  2JYO A;  2NB0 A;  4KI0 A;  2XRQ D;  1STB A;  3R2I A;  1EY6 A;  4O42 A;  1SNP A;  3T56 B;  4C3H G;  3HOV B;  1B9N A;  1VCI A;  3MWY W;  2PZT A;  4IUU A;  2VB2 X;  1GUG A;  1PTO H;  4IUQ A;  4PMW A;  1HUM A;  1PTO B;  3PUY A;  1A15 A;  2Q8T A;  1UNS A;  1U4P A;  5I9P A;  3QWN A;  1D1K A;  3C3L A;  1II3 A;  5K5P A;  3BS1 A;  2NVY B;  1NCV A;  1PRT B;  2L55 A;  5HUR A;  1CZG A;  4KN4 C;  3T13 A;  2KOL A;  3NBH A;  1I4G A;  2SNM A;  2ZXR A;  4IUV A;  1NSN S;  4KJO A;  4XYO A;  4PV1 C;  5BN5 A;  2ZXP A;  5E3F A;  3PO2 B;  3NQT A;  5DEH A;  5BN3 A;  3EA6 A;  3D8G A;  5E4X A;  1NAP A;  1PTO F;  3E5S A;  1F9Q A;  3C2P A;  1F9R A;  5C4Z A;  4U68 A;  3J80 E;  2RA4 A;  1PRT F;  2KUM A;  1WTW A;  1LTT D;  2EYF A;  1XTC D;  2EJM A;  3HG9 A;  2RKS A;  4KK7 A;  4ID6 A;  3SHL A;  3X3N A;  1MSG A;  3TDQ A;  3IAY A;  3GO5 A;  2X6L A;  3H6M A;  4C56 C;  4EQN A;  2XSC A;  3S14 B;  2OT2 A;  4XQQ A;  2WII B;  1SYD A;  5CC4 A;  5CV4 A;  4DK1 A;  3OSO A;  1QE6 A;  3ITP A;  4R8I A;  1LT3 D;  1NR2 A;  4OHJ A;  2FFK B;  4MN3 A;  3T16 A;  2NYZ D;  3GV6 A;  1A3U A;  4IN3 A;  5IOD A;  2D5D A;  1D5M C;  3MEH A;  2PPB C;  3BYY B;  3K5L A;  4B08 A;  3OPO A;  1ROD A;  1WVL A;  3OWF A;  2NTS A;  1F2Z A;  2B2W C;  4V0B A;  3ZYY X;  2BA0 A;  2DNC A;  4KY6 A;  1GXD C;  4IZ8 A;  1SMY C;  5KGU A;  3CHB D;  2FHT A;  2O4X A;  1SMY D;  3W3A A;  4C3J G;  3SVM A;  5JEA G;  5CV6 A;  2TSS A;  1XYI A;  1LT6 D;  1WD0 A;  4IFD J;  3PUX A;  4K5X A;  2RDG A;  1SEB D;  3BVM A;  1H9M A;  2RVL A;  5ELD A;  1HXY D;  3KLR A;  1I4H A;  2M9V A;  5C3X A;  4ZKB B;  2EOT A;  3DM1 A;  3MA2 B;  1EY7 A;  1C4Q A;  1Y8P B;  5FO8 B;  1H9K A;  3BG3 A;  3K59 A;  3RLF A;  3NQI A;  1BCP C;  1O7L A;  2L12 A;  1EY9 A;  2B39 A;  4QUC A;  2L1B A;  1BCP D;  1TS4 A;  3SEB A;  2ID0 A;  3CKI B;  2KVM A;  2GA4 B;  4DA2 A;  3M7N A;  3MTS A;  5I6W A;  2JE6 I;  2BDO A;  3P20 A;  1QIL A;  1L0Y B;  1F2L A;  3LWU A;  4K8J A;  1DOL A;  2WKC A;  2BCO A;  4WRD A;  1S5D D;  1ML0 D;  2LFN A;  3K0Y A;  2WKD A;  4NKL A;  2X69 A;  1CK1 A;  4O1N A;  3FKI B;  4DNT B;  3J80 L;  1FR3 A;  2E76 C;  1S5B D;  1F77 A;  3W2D A;  4FF4 A;  3D4R A;  1SDF A;  1TT2 A;  1UAP A;  5CV5 A;  3PV0 A;  3KF8 A;  1PMR A;  5DNF A;  4XQN A;  1GHJ A;  2KJX A;  1H9J A;  3VR2 A;  2F0O A;  1Z7T A;  4M8A A;  1TS2 A;  3VA5 A;  2F0W A;  4PMB A;  2B2V C;  5EPJ A;  1QB5 D;  2I07 B;  1AZP A;  3TME A;  3Q0A A;  3SK8 A;  3FEW X;  3MXG A;  2K5Q A;  1ILQ A;  2A69 C;  2KCN A;  4NMZ A;  5DM7 3;  2A69 D;  3OHX C;  3M3Y B;  4RAU C;  1TWG B;  1PFB A;  2EYO A;  3P1H A;  5KYI A;  1SSO A;  1X32 A;  5IT9 L;  3FMC A;  3K57 A;  1WTP A;  1U4L A;  3S2D B;  2K1B A;  4NW2 A;  1IYV A;  2QCP X;  2YU9 B;  2IX1 A;  4KKS A;  3S1Q B;  5KEE A;  1LTS D;  3A8J E;  2A73 B;  1AN8 A;  3C1F A;  1STE A;  2WIN B;  3HRZ C;  1XX8 A;  2F03 A;  2B2V A;  3KBG A;  3PMF A;  4H44 C;  1JR0 D;  2PO4 A;  4ODG A;  5M3F B;  1LLR D;  4BBR B;  3LNN A;  4DAP A;  5FOB B;  1FNW A;  2XIW A;  1A6X A;  5TSS A;  2B2Y A;  4YIJ A;  3Q24 A;  4DGZ A;  5C3E B;  1A3V A;  3T53 B;  1C48 A;  1STN A;  1BCP B;  4CJ0 B;  1MGS A;  3NK9 A;  1PLF A;  1KNA A;  2XWJ B;  4LAA A;  1Y8N B;  3D4D A;  4IQZ A;  3J7A V;  2F3V A;  1CQF A;  1SYB A;  1PRT C;  1D1I A;  1E2Z A;  1PRT D;  1CFM A;  1BF4 A;  1TY2 A;  2MPM A;  3R2T A;  2L11 A;  2QEJ C;  2E2I B;  2IJ0 A;  1SJE D;  3EJI A;  4L8J A;  3HOZ B;  5D14 A;  4UAI A;  4RGO S;  2F0T A;  1PDQ A;  3MAQ A;  5D3I B;  1SJH D;  2QKI C;  1I4P A;  3I4L A;  1R4P B;  1VMP A;  1IHZ A;  1KLU D;  3M4Y A;  3GTO B;  4EGV A;  4IUN A;  1MD2 D;  2F0V A;  2XRS D;  5C5L A;  3TP5 A;  3I73 A;  3M4O B;  3I91 A;  2BE5 C;  5CV9 A;  3VR3 A;  4WJW A;  1KDA A;  2BE5 D;  4K2K A;  2F0S A;  4OIJ A;  5FLX E;  3L3O C;  4DAY A;  4X3T A;  1I50 B;  3IL8 A;  4HMI A;  3OMG A;  1B53 A;  2PQE A;  3H09 A;  1H9S A;  3GTM B;  1SNQ A;  1YNN C;  4C3I B;  4K5V A;  1YNN D;  2JEA I;  3A55 A;  4FP5 D;  3HKZ B;  3A7L A;  4X3U A;  2EVB A;  4ZYS A;  2K28 A;  5J22 A;  1T5E A;  1V1O A;  3JAM L;  4IFD H;  2EYJ A;  1GUW A;  4DAV A;  2O5J C;  3QG1 A;  5KIX A;  3QO2 A;  1LTA D;  3S1M B;  3SK5 A;  3FRP B;  3NWS A;  4A3F B;  2KA7 A;  1DOM A;  2K33 A;  1BNZ A;  5KYL A;  1A3T A;  5JOB A;  5C6A A;  5EJW A;  1SNO A;  2IX0 A;  2SDF A;  2AQ2 B;  3NTI A;  2FMM A;  1JOK A;  3WDN A;  1LAC A;  5E4W C;  4BBS B;  2EXZ A;  4N9T A;  4IUP A;  5JVG 3;  1MI2 A;  3A7A B;  1ESR A;  1IW7 D;  2J0T D;  2Z4I A;  4U67 3;  1RF2 D;  3MXP A;  3I70 A;  4QUF A;  4CKE A;  3C1E A;  3GTK B;  4RH6 A;  3GD7 A;  3WOE A;  2L0C A;  2L4N A;  1SE3 A;  4KKU A;  2M00 A;  2NN6 H;  2RQX A;  2PMZ B;  4NDX A;  5ELB A;  5C0X I;  3VA7 A;  4L6T B;  1IKL A;  1Y1V B;  3L9A X;  4PNY A;  1L0X B;  5J1Z A;  1S5E D;  4OO1 G;  3KLS A;  4K2L A;  2BOS A;  4HAE A;  1O7Y A;  1GUS A;  4X3K A;  1PFM A;  5FO9 B;  1FYC A;  1GJX A;  4ZUJ A;  1EY8 A;  2F0M A;  1H9S B;  3FPP A;  5M5X B;  3V05 A;  1HA5 A;  4KY5 A;  3M85 A;  3A8K E;  3NBI A;  4R9W A;  5IOC A;  2CQA A;  3HGB A;  5JAV A;  1RTO A;  5FLX L;  3DHQ A;  2NVT B;  1TY0 A;  2VXW A;  3U9O A;  2EY2 A;  2CVR A;  4C3I G;  3BDC A;  2H1E A;  5C3W A;  2D62 A;  5CR3 A;  4IFD I;  3J7Y W;  4HSP A;  1JCK B;  1LTR D;  1EU4 A;  4B9X A;  4XIG S;  1BQQ T;  2IW3 A;  1W6K A;  5C0X J;  2K32 A;  2WP8 J;  1LTB D;  3VR6 A;  2QIL A;  4MHE A;  4X3S A;  1ILP A;  3MHB A;  1SNC A;  1O7Z A;  5ISR A;  3GTP B;  1HRJ A;  1OXX K;  1LAB A;  4FF3 A;  3MZ5 A;  1OXT A;  1B4O A;  5EPL A;  3P75 A;  2Z1C A;  1WTV A;  1DYQ A;  1ZXT A;  4JK1 C;  4TSS A;  2JA8 B;  2G9D A;  4GZY C;  1HPC A;  1JWU D;  2E75 C;  4HTH A;  2TMP A;  2EJF C;  5IGG A;  2B2T C;  2K7V A;  2R3Z A;  1F2M A;  3DEP A;  4J6H A;  2PW5 A;  3KLS X;  3TSS A;  4G57 A;  2KHS A;  5C4X B;  3QIA A;  3RZO B;  1B2T A;  1ET9 A;  3M7G A;  3GQB A;  2A5H A;  1SYC A;  1VF5 C;  2NN6 I;  1H9R A;  3ND8 A;  1B1Z A;  2BDN A;  1JOO A;  2O2L D;  4AYB B;  5C44 B;  2A6E C;  2A6E D;  1C8C A;  1QOH A;  4F8M A;  4CGY B;  1AEX A;  1SND A;  3DWQ A;  2NBF A;  4LK1 C;  1DD2 A;  4BY7 B;  2B2W A;  2ICE C;  2PZW A;  3BDO A;  2FJ2 A;  2AWO A;  4A3J B;  1XXG A;  4CKC A;  1E2V A;  3P7J A;  2HCC A;  2HDL A;  5M3M B;  5I2X A;  4KV6 A;  5A2Q E;  4XTC S;  5CBA E;  1K8O A;  2J4X A;  3IFD A;  3V96 A;  5EGT A;  3VYS A;  2L9H A;  1HTL D;  4DF7 A;  1LO5 D;  4DN4 M;  1ZKO A;  5CV8 A;  2MP1 A;  1LT5 D;  1LT4 D;  3N6R A;  3E6Z X;  2OXP A;  4XQJ A;  4XDX A;  3S1N B;  1PXU A;  4XYQ A;  5FO7 B;  3OIQ A;  1BUV T;  4Q0F A;  4ZKC B;  1CA5 A;  2F4I A;  5EPK A;  1QG7 A;  1TWF B;  4KD3 A;  3VR5 A;  5IGF A;  4ME5 A;  1EEF D;  4FNF A;  5JJZ A;  4Q5V A;  3HP3 A;  3FVQ A;  3K7A B;  1U9R A;  2OF1 A;  3I4M B;  2F0F A;  2ENB A;  1JOR A;  1KTK A;  1A2U A;  1EYA A;  4TQU S;  4V19 0;  3K58 A;  2B8G A;  3MFG A;  1V8Q A;  1EY4 A;  4A93 B;  2NUC A;  1J9O A;  5ELC A;  4EQP A;  1E0B A;  3K6O A;  4RKL A;  4DK0 A;  4OGQ C;  5BN4 A;  1BDO A;  4K5W A;  3EFX D;  2D2C C;  4RA8 A;  3Q23 A;  1GUO A;  3A8I E;  1PFN A;  1X3P A;  4KN7 C;  3E0J A;  5I9O A;  1VDZ A;  4QIW B;  2XWB B;  3G6J B;  1Y1W B;  4CKB A;  4KY7 A;  1CI3 M;  4CBV A;  1D5X C;  1ENA A;  4IUT A;  2R61 A;  2EYP A;  1JC7 A;  4KTA A;  3NXW A;  1SFO B;  3J7A F;  1EWC A;  1Y8O B;  2R6G A;  1STY A;  4A3K B;  3PUW A;  3SK4 A;  1ESF A;  4RWS C;  1S4Z A;  4HR7 B;  1ONL A;  4Z9C B;  2DN8 A;  2SEB D;  3TP7 A;  1TWA B;  4QMG A;  2KEE A;  3N52 A;  3TN2 A;  2R7Z B;  1KDB A;  1WTX A;  3HOW B;  1Q3L A;  5A2Q L;  3J81 E;  1MSH A;  3WOF A;  2LMC B;  2AQ3 B;  5K36 H;  3DXJ C;  3GTL B;  2SOB A;  3NUC A;  1PZI D;  4G7O C;  2B2U C;  3QJY A;  4OIK A;  1ENC A;  1O78 A;  1CT1 D;  3TZD A;  1HQR D;  1KLG D;  2F0E A;  2N88 A;  1Q8I A;  4IAL A;  3T4A C;  3TP6 A;  3K5N A;  4C1N I;  3GTG B;  1QNU A;  1QCB D;  4XT3 B;  4KHZ A;  1DOK A;  1B9M A;  5AFW A;  2EZV A;  2DY7 A;  2K05 A;  1TVX A;  1I6V C;  4ABN A;  2NTT A;  5I4D A;  1D6E C;  2JA6 B;  3IKJ A;  1EY0 A;  2RDF A;  4C2M B;  4K6D A;  2HDM A;  2R92 B;  1F9P A;  3PIO 3;  1SXT A;  1LTG D;  4HED A;  5C0X H;  1S5F D;  2IPK D;  2Q8R E;  1Q1B A;  4DFA A;  4G7Z C;  1TII D;  1CZW A;  2QDB A;  4F7X A;  1V1P B;  3EVQ A;  1U4M A;  2B2U A;  4ULL A;  5IGC A;  5C4J B;  5G3L D;  3UI2 A;  1F9S A;  4IUR A;  1HUN A;  4ZK9 B;  4XXE A;  3CQZ B;  4TKO B;  2AWN A;  3HS0 C;  4Y7N B;  1WTQ A;  3X3M A;  5JVH 3;  1WD1 A;  5CBE E;  2A74 C;  1UEA B;  1PZK D;  5LHY 1;  1D2B A;  4BWG B;  2WB1 B;  1GUT A;  4H0L C;  3S2H B;  5KNC A;  1HA6 A;  1G91 A;  3I3C A;  4J1M A;  3V2T A;  4FXD A;  4FXK C;  3T51 B;  3ONA B;  3OOC A;  4A3G B;  4A3D B;  3RMH A;  2FMC A;  3KBX A;  1EWH A;  1IYU A;  4F88 A;  4ZQ3 A;  3LX0 A;  3MFY A;  2WAC A;  3NPP A;  3A56 A;  2K6A A;  5JPN C;  1IL8 A;  2HCI A;  1OO9 B;  2E2H B;  2F0J A;  2Q8I B;  4C1N K;  3TZU A;  3MVV A;  1K8M A;  4PQX A;  1BBX C;  1AW7 A;  1CM9 A;  2NVQ B;  3J81 L;  3GTQ B;  3NHH A;  4K6L A;  5K36 G;  3DMU A;  1F2Y A;  4QF4 A;  4WFN 3;  3MC0 B;  2F1M A;  1KAA A;  3LWE A;  4XT1 B;  1I6H B;  2PZU A;  1SNM A;  3I8Z A;  2HQE A;  5LL6 X;  5DM6 3;  5JPM C;  2K5D A;  4A3E B;  2R93 B;  1EFI D;  3VYU A;  3FPU B;  3TP8 A;  1ENF A;  2NVX B;  3DWA A;  4WOR A;  1W6J A;  4K8I A;  2B63 B;  4OO1 I;  3EQL C;  3URY A;  1RHP A;  4RCN A;  4L63 B;  1KDC A;  4KKT A;  1PZJ D;  1SAP A;  1TU2 B;  2VUM B;  3H91 A;  1VMC A;  1BR9 A;  4G4K A;  3DWP A;  3DUZ A;  5C0X G;  2BA1 A;  4EQO A;  1ZYR C;  2G9H D;  1GOZ A;  1ZYR D;  2Z8L A;  5EBC A;  4FF1 A;  4BA1 I;  1OXU A;  1SYE A;  3I72 A;  2JEB I;  1ET6 A;  3C46 A;  3OIP A;  3D4W A;  3R8B A;  2PW7 A;  1RKN A;  1U4R A;  3D6W A;  2JP1 A;  4RGM A;  1EZ6 A;  3F2U A;  4S3S A;  4HSV A;  4HCE A;  3HEJ A;  3DEO A;  5T1I A;  2CW0 C;  5D3D A;  3Q6S A;  1AFP A;  3ND9 A;  1JWM D;  2CW0 D;  3HOU B;  2EYL A;  4ZAI A;  4IFD G;  1SBB B;  2E2J B;  5I6Y A;  2OEO A;  1J8I A;  1JQY D;  3PO3 B;  5FK9 C;  1DZ1 A;  3AB9 A;  1KNE A;  2F0K A;  2D9U A;  1QNK A;  2B8F A;  1R9T B;  4M1U B;  5A35 A;  3MXU A;  2I46 A;  5HGT A;  5G3L F;  5ELE A;  4N9P A;  2IWH A;  4DXF A;  3PIP 3;  1CTM A;  3PUZ A;  3KUP A;  2XN9 C;  1AZQ A;  4JBW A;  3SR1 A;  2NWG A;  4H7B A;  1TR5 A;  1JB3 A;  1FGB D;  4OL7 A;  3CRK C;  3NTH A;  3OWE B;  4KJN A;  5IT9 E;  1LTI D;  2F0Q A;  4RGN A;  4QCL A;  2XVS A;  1RDP D;  1YNJ C;  2H4O A;  2LKV A;  1G29 1;  1YNJ D;  2EPB A;  2JA7 B;  1DCZ A;  1TWC B;  2E74 C;  2XNA C;  1G2S A;  4G7H C;  5M5W B;  4ILW A;  2EY1 A;  4RHR A;  3SE0 A;  2NN6 G;  4LMQ D;  2F0D A;  4A3B B;  1TWH B;  5EKI A;  1RCV D;  3MXN A;  4A3M B;  2C5C A;  3SDZ A;  2B2T A;  1JE4 A;  1ICW A;  5I2Y A;  3NP8 A;  5JEA J;  3D31 A;  5CV7 A;  5FKA C;  3TBI B;  3H94 A;  2F0I A;  4DU9 A;  5EQ0 A;  1BOS A;  5M9O A;  3S16 B;  3ERO A;  1MBY A;  1JOQ A;  1Q1E A;  1S5C D;  1FD7 D;  3S15 B;  4LJZ C;  2YYZ A;  1OXV A;  4P2C B;  1CA6 A;  1WCM B;  2IX3 A;  3HOX B;  5IIF A;  2ZT9 C;  2JXM B;  4KHV A;  1I4R A;  2EY5 A;  4HCS A;  2KCC A;  5T1G A;  2RSN A;  1TKW B;  1V43 A;  2RBM A;  2K03 A;  1EU3 A;  4CHT B;  2C9O A;  2VB3 X;  2MJ8 A;  5J39 A;  1EQT A;  4QB4 A;  2IL8 A;  1DM0 B;  3KK7 A;  4I65 A;  3VR4 A;  3BVG A;  4NP5 A;  2F0N A;  4UDU C;  2AQ1 B;  3CU7 A;  4RGT A;  3RD4 A;  2F0H A;  1GHK A;  1RD9 D;  2ZXO A;  3AMU A;  3O13 A;  1EQV A;  1R4Q B;  3HOY B;  1M4V A;  1STH A;  2M2L A;  4H13 C;  2LY7 A;  1RTN A;  3Q22 A;  3D3R A;  2DY8 A;  3BDL A;  2JA5 B;  1XWE A;  3S9W A;  5KRU A;  4MIU A;  2WAQ B;  2K5W A;  4KMU C;  2O5I C;  1A2T A;  2E2D C;  2L5T A;  2HUG A;  5CGK A;  2KED A;  1STA A;  2QF7 A;  3QOL A;  4ZRZ A;  2JSO A;  2F3W A;  5IGD A;  1G8Z D;  5D65 A;  2EE1 A;  3GV3 A;  1GUN A;  3SK6 A;  4HN7 A;  1V1P A;  2NZ1 D;  2B2Y C;  4DNR B;  2AUK A;  3RUZ A;  1SE2 A;  2WV6 D;  2V4D A;  1Y69 U;  2KQ3 A;  4R8N A;  1BXT A;  2K01 A;  1SYF A;  4RFB A;  1Q90 A;  4PMC A;  1G6Z A;  1Z47 A;  1QWY A;  2DNE A;  3K5M A;  5CYU A;  1DJR D;  4J8Q A;  3JAM E;  2PCF B;  3S17 B;  3OW7 A;  5C4H A;  4I7Z C;  5EBD A;  3R3O A;  2EDG A;  4B9W A;  1I3Q B;  3VYR A;  1EYC A;  4RKB A;  3D6C A;  4FVM A;  1EY5 A;  1X3Q A;  1Q12 A;  1EEI D;  1FNU A;  1TS3 A;  1D5Z C;  1NR4 A;  1E2W A;  1JWS D;  3L7Z C;  4F87 A;  2EJG C;  2A68 C;  1WTR A;  3A54 A;  2A68 D;  2F0L A;  2EYH A;  1TS5 A;  1ZEQ X;  1PTO C;  1PYW D;  5EKL A;  1LV9 A;  1PTO D;  1CHP D;  1G2T A;  5F2D A;  3SXH A;  2EYM A;  3NSW A;  3G7L A;  4RHS A;  3H0G B;  1HQM C;  3GTJ B;  3QB3 A;  5IGE A;  4ZUI A;  3PUV A;  3NTK A;  2F0P A;  4C3H B;  1IKM A;  2N55 A;  1FNV A;  4BS9 A;  5M5Y B;  1BCP F;  1M8A A;  1DON A;  5DAU A;  2Y0S B;  1UUP A;  2ICI A;  4FXG C;  3CRL C;  2PYK A;  2EY6 A;  1O80 A;  1HTP A;  5LL6 S;  4OO1 H;  2CHB D;  1EIG A;  1EZ8 A;  1T5X D;  3QOJ A;  1EOT A;  2LS0 1;  2AUJ D;  5IGB A;  3AU7 A;  5NUC A;  1B50 A;  3NE5 B;  1WTO A;  3H3V C;  1CQV A;  4CJ1 B;  1HHV A;  4TRD A;  2VNU D;  3I90 A;  1EL0 A;  2RSO A;  1B44 D;  5KNB A;  5CMD A;  2MGS A;  3I4N B;  1HFN A;  4HMJ A;  4DXG A;  1DXM A;  3FDT A;  3GP7 A;  1AP0 A;  1HFG A;  1RJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...