1EY0A

Structure of wild-type s. nuclease at 1.6 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey0A00
2F0IA 5IGBA 1KDCA 2F0TA 5C4HA 3D4WA 4EQOA 3D6CA 2RKSA 4J6HA 4QMGA 4NKLA 5M9OA 1RKNA 5HGTA 4ODGA 4K8IA 4PNYA 5IODA 2EYPA 2WACA 4KD3A 5EGTA 4DFAA 4KD4A 3NP8A 5I9PA 2EY2A 1SYFA 2OXPA 1SNQA 5DAUA 4ID6A 3TP7A 2EYHA 1STHA 1SYGA 3MEHA 5IGEA 1KAAA 1TT2A 5HURA 5CV8A 4R8NA 2SNSA 5I9OA 2EY6A 5KYIA 2PW7A 4IALA 2LKVA 4HMJA 2OF1A 2EYJA 2F0UA 2M00A 3VA5A 1EY8A 4ZUJA 1SNCA 3MHBA 4HMIA 4K8JA 4KY7A 1F2ZA 3NQTA 5CV6A 4DF7A 1AEXA 5ISRA 5CV4A 3TMEA 1STBA 3D4DA 4E6IA 4F8MA 5C4ZA 1EYDA 1SNPA 1STGA 1EY4A 5CV9A 4K5XA 1STYA 3MXPA 5C5LA 2NUCA 2QDBA 5EKLA 2F0LA 3TP6A 2F0MA 2F0QA 5CC4A 3ERQA 3NXWA 5I6YA 2EY5A 2EYMA 3OSOA 4QB4A 5KYLA 1II3A 3HEJA 4PMBA 1EY9A 3D8GA 5E3FA 2PZWA 4ME5A 5CR3A 5JOBA 1KABA 1U9RA 3BDCA 3DMUA 3P1HA 1JOKA 4KTAA 2F0NA 1A3TA 4S3SA 1EYCA 4ZQ3A 1A3VA 5C5MA 3T16A 2OEOA 3P75A 5KRUA 1STAA 3QOJA 5NUCA 5IGDA 1SYCA 3NHHA 2F0JA 4K2LA 4IZ8A 3MVVA 5CV7A 5KGUA 3DHQA 4EQPA 4TRDA 3SK5A 1ENCA 1TR5A 3C1FA 1KDAA 2EXZA 1SYBA 4H7BA 4NDXA 4QF4A 4RKLA 3SXHA 4EQNA 3PMFA 3SK8A 4KJOA 4B9XA 2F0WA 3OWFA 1NSNS 4J1MA 5J39A 3QOLA 4WRDA 1A2TA 4KHVA 5E1FA 5IGGA 5IIFA 3H6MA 2F0KA 3ITPA 1F2MA 2SNMA 4RKBA 5I6WA 1KDBA 3T13A 4KV6A 4I65A 3HZXA 4YIJA 5F2DA 2F3VA 4KY6A 5IOCA 4WORA 1A2UA 2ENBA 4K14A 4DGZA 5J1ZA 3V2TA 4N9PA 2HQEA 3LX0A 5DEHA 1JORA 3NUCA 5C6AA 2PZTA 2F0DA 5IGFA 4B9WA 3TP8A 3C1EA 4NP5A 1SNDA 1EY5A 1SNMA 2EYLA 4N9TA 4OL7A 5EKKA 4F7XA 4K2KA 1SYDA 2RBMA 1TQOA 1JOOA 2PW5A 1EY0A 2F3WA 1EZ6A 2RDFA 5KEEA 2F0PA 1ENAA 2SOBA 3TP5A 2EYFA 5C3WA 4PMCA 4KJNA 4HTHA 4ZUIA 4EVOA 2O4XA 3EVQA 1STNA 4G57A 3SK4A 4K6DA 1NUCA 1EYAA 5KIXA 2F0EA 3OMGA 1SNOA 2F0OA 3BDLA 4K5VA 4NMZA 1EY7A 2KQ3A 2EY1A 5CGKA 3EJIA 3MZ5A 4K5WA 3U9OA 1EY6A 5CV5A 3NK9A 3QB3A 3SK6A 1F2YA 1EZ8A 2KHSA 5K5PA 2F0SA 3S9WA 3R3OA 4DU9A 2PQEA 1JOQA 5JAVA 3OMCA 3E5SA 5J22A 2PYKA 1SYEA 2PZUA 4KY5A 2F0HA 3RUZA 4LAAA 3SHLA 5C3XA 5IGCA 2F0VA 1A3UA 4IUNA 1IHZA 4MIUA 3SR1A 2F0GA 1EQVA 2EYOA 2F0FA 3EROA
chains in the Genus database with same CATH superfamily
4HIKA 2KCNA 3PCOB 3I4NG 5JJKA 1HH2P 3CMEA 1KXLA 5IP7G 4LNQA 4GNXC 3KDFA 4ZLTF 5IGEA 2X6LA 1STHA 2C5CA 4FXKC 2BDOA 1K83H 3PO3B 3KUPA 2YYZA 3GDEA 3S2HB 2OTLA 1V1PB 4DR5L 4DA2A 2WP8J 1Q1EA 3VYTA 4Y52H 1XPUA 1B1ZA 5M3MB 3U9SA 4UDUC 1IBKL 2QILA 5CV9A 3FPPA 2UUAQ 2VQFQ 3UE0A 1S40A 1E22A 3ICEA 4BBRH 4B3MQ 3J80E 4CDEC 1IZ6A 1EY9A 1GUWA 1UNSA 1Z47A 3PIOA 4A3GG 4JI8L 1A3VA 3HOXB 1MGSA 2JA6B 3HOWH 1H9KA 5KGUA 2N78A 4JVZA 1KRSA 1N32Q 1C4QA 2EXZA 4JBMA 1RHPA 3CCJA 3BYYB 1DONA 1N34Q 5IGGA 1F2MA 1E0BA 2AWOA 5F2DA 3KLSA 1A2UA 2NZHA 1EWIA 4A3JH 2DY7A 5C4JH 3TZUA 3SE0A 2NVYH 1SFOB 2JA7H 1SNMA 3M4OB 1HFGA 2KCMA 4HSPA 1G51A 4CJ2C 1KL9A 2DJGC 2RDHA 1LT6D 3J81c 1YITA 1CA5A 3CD6A 4QGUA 3I4LA 2E76C 4L5QA 2PNHA 2EY1A 1SE4A 5ELNA 1VQLA 1WFQA 3RLNA 2UXBL 3T1YQ 5FJ8H 2AMCB 3G7LA 1XTDA 3H15A 4C3IH 4XQJA 4BXXG 1EUJA 1XXGA 2B2YC 4BWGB 1X55A 3EROA 4A93H 3AMUA 1X6OA 4RMFA 2I5LX 1H95A 1NR4A 1IKLA 4BY7G 3A7LA 4PNYA 4DR1Q 2BE5D 4DAVA 2RA4A 2HHHL 3UDGA 1S5BD 1RL2A 1WTWA 5FKAC 3H91A 2M00A 3VA5A 1D1KA 1HA5A 2BOSA 3MA2B 2XSCA 2KVMA 1K3BC 4LFBL 3KK7A 1RODA 2XWJB 3D4DA 1PH4A 3NTKA 4X64L 2E5LL 2CW0C 1YBYA 4P75A 1Y1WG 2F0MA 4YWKA 2Q2HA 2EYMA 1B7YB 5T1IA 5KYLA 1LTTD 3K57A 3PIO3 4B3SL 4HIMA 2N55A 1YVCA 1BCPC 3IFTA 3DMUA 1FJGL 1M8AA 5ELCA 4DR6L 1EYCA 3PF5A 2R93B 2NVXB 2XWBB 4U673 3PF4A 1CSPA 1Y14B 4IO9A 1JJGA 1I5FA 1PFBA 1EOVA 3SXHA 4FP5D 1Y69U 1TS2A 3OWFA 1NSNS 4LFCQ 2MJ8A 4NPSA 5E1FA 2WIIB 3J80i 2QF7A 3M4QA 1HNWQ 1UEBA 2R7ZH 4IUUA 1NMGA 2D62A 4JI5L 2WKDA 2ES2A 1JT8A 1R4QB 3W3AA 2IW3A 3GTPH 2UUAL 3S17B 4U68A 2VQFL 5C4XG 2XRSD 4R8IA 5KNCA 2PPBC 4B3ML 3HOUB 1NR2A 3FHWA 1TS4A 4R4TA 3RZOH 1QNKA 1TVXA 2HIXA 3K0XA 2JXMB 1BBXC 4ZUIA 1H9SA 4IPGA 1LYLA 2OQKA 1VQPA 2ZTCA 4AH6A 1GOZA 4HEDA 4GNXB 1VF7A 1ZYRD 3L0OA 1PFSA 1N32L 4LW1A 1PH2A 3T53B 1NBWA 1EZ8A 5T1GA 2K5WA 4N8X1 1N34L 1FVIA 1PLFA 4OEMB 4XTCS 5I2YA 4BBSG 3M7GA 1PMRA 4GLVB 2NN6H 1BNZA 1VDZA 3D4WA 4ZCKA 4PV1C 3HOVG 2AQ2B 1Q8IA 4JBWA 1L0YB 1SYFA 2MFIA 3FKIB 1SYGA 2G5DA 4QJFA 1CT1D 2WKCA 1WD0A 2ZT9C 4RCOA 3JAMc 2HD3A 1LTID 2KENA 4LUOA 4KN7C 2ZTEA 1V43A 3EIVA 1SNPA 1K8MA 4JI0Q 3K7AH 4DV7Q 1X3EA 2EY5A 4G4KA 1MSHA 4PMBA 2L1BA 4G7HC 5M5XH 2LMCB 1Y1VB 2YU9H 1CK1A 5GQOA 2B3GA 1STAA 5GAGC 2N49A 2F0JA 3K5MA 3N6RA 1KLGD 4H7BA 3J80L 4DR1L 4X65Q 5FLXE 4BBRG 1T9HA 3VR6A 1GM5A 3WDNA 2SNMA 3CC7A 1EU4A 1EQRA 3DWAA 3HGBA 4YIJA 3HOZG 3GTGB 1SE3A 3HOWG 3S1NB 3A8IE 4N9PA 1HCZA 5CBEE 4DR2Q 5K36H 1JORA 1X3GA 2PZTA 3H3VI 1LTBD 5C44H 1BO0A 2YTVA 1I50H 1PRTF 4JK1C 5KNDA 4IQZA 5EKKA 3D4RA 1TQOA 2K75A 2K5HA 3CRLC 3S15H 2SOBA 2CH4W 4A3EH 1S5CD 1BDOA 1STNA 1VQMA 3OMGA 2C35B 4DNTB 1H9MA 4NMZA 4A3JG 4NB3A 3SK6A 3KJOA 1EQQA 1K9MC 1IBMQ 2JA7G 1V8QA 1TS3A 4RCNA 3MC0B 4PZ6A 4LFCL 3ULLA 1BXTA 4G7ZC 4A3CH 2QEXA 1HNWL 1KIXA 1TKWB 1F9SA 2F0FA 4C3HH 1K8AC 5BN4A 4HSVA 4UP7A 3S1RB 3M9BA 4POGA 5HGTA 3ULJA 3UE1A 1Q46A 5IT9L 5CBAE 2VUMH 2HCIA 2F52A 3NWSA 5FJ8G 5LMNW 4C3IG 1BCPB 1KAAA 2MO0A 2IWHA 4L8JA 4B3TQ 3M4YA 2PW7A 4A93G 1HPCA 3A55A 2BDNA 4H0LC 1QG7A 4K8JA 3CCLA 2I07B 3GTKB 4C3JH 3MAQA 4TKOB 5GADC 3V96A 1KQSA 1STYA 3MXPA 1KC8C 4GN3B 2FMCA 2D5DA 1ET9A 3HKZG 2Z6KA 3MXNB 1B44D 2LSSA 4JBJA 2V1CC 1VCIA 5NUCA 2B63B 2OT2A 2L5TA 3KLWA 4Q0FA 1EL0A 4WRDA 3KFUA 3KYHC 2VQEQ 1LT3D 4KJOA 1WTOA 1WI5A 4PMWA 1GUOA 4LF7Q 4UP9A 2B39A 4AYBG 3C46A 3GV6A 1GUGA 2SDFA 4GN5A 4ILWA 4P2CB 1IKMA 1PH6A 4DUZQ 1F9RA 3BZCA 4JI0L 3S16B 3UDIA 4DV7L 4DNIA 3VYSA 1F9QA 2VL6A 2AHOB 1QZGA 2G9HD 1PZJD 2K1BA 1ENAA 4L63B 3LNNA 2R7ZG 1C48A 5M3FB 4HR7B 3F2UA 4PQXA 1QVFA 2L55A 1EYAA 2JN4A 2VXWA 3NEMA 3VR3A 3CQZB 4X65L 4Y7NH 3KBGA 2PQEA 1XNRQ 3PGZA 3EN2A 3SHLA 2K50A 1NJIC 1X3PA 4TVAB 3E9IA 1H9SB 3KLSX 4RGTA 4FYDA 5JVG3 1X3QA 5FOBB 1CKNA 4LF5Q 4DR2L 5C3EG 1TWGB 2LY7A 4FVMA 4LMQD 4YHHQ 2R61A 2HDMA 4KD4A 3G4SA 1D8LA 4PZ8A 1QZHA 3FRPB 3J81i 3AEVA 1HUNA 1ESFA 1UEAB 2EY6A 4KI0A 1Q82C 4IALA 2LFNA 2K6AA 1VQHA 1XPOA 2LXKA 5CV6A 1ET6A 3RZDH 4R4OA 2A69D 2XN9C 4DK6C 2F1MA 4IPHA 2NUCA 1TWAH 2H1EA 1IBML 3R8BA 1W3SA 3A8JE 3GTPB 3CCUA 1II3A 5E4XA 3M3YH 1OXSC 4MNOA 2PI2A 5E3FA 2Q8IB 2VB2X 1JWSD 3P1HA 4ZQ3A 4KTAA 4FF3A 2N8NA 2L9HA 3T16A 1VQEA 2HT1A 4A3BH 3RZOB 4IJHA 2Q2IA 1K28A 1TWHH 1X3FA 1KDAA 4QF4A 1WTPA 4EQNA 4PG3A 1EEID 1PHJA 5JJZA 2B2WC 3P20A 1HR0Q 5JVH3 4B3TL 4QIWE 4K14A 1PYWD 3ULPA 4IJLA 2Z0SA 2UUBQ 1IW7D 3LX0A 1X56A 1EU3A 5ELFA 5IGFA 4GKJQ 2K05A 1VQ6A 2YTYA 2TSSA 2WB1G 2Y0SG 3A54A 5IP9H 3D6WA 1EWHA 3TREA 3W5OA 4FXGC 5C4XH 2F0PA 4NXMQ 1QILA 2D2CC 2Q8RE 3EVQA 4EVOA 3OTOQ 2VB3X 1Q86C 5K36G 3I91A 4OWTB 1DOLA 4XYOA 3V05A 4RWSC 2VQEL 4DU9A 3GV3A 4IPDA 1SXTA 3RD4A 4LF7L 4GNXA 1XNQQ 1U4PA 3FVQA 3LWUA 4TSSA 5E7NA 4DV5Q 2PI2E 3DUZA 1BOSA 1W2BA 1Q3LA 5M5WB 5AJ3Q 1IYVA 1SDFA 4DUZL 2RCNA 4WJWA 2DNCA 3HP3A 2C9OA 3MEFA 4POFA 3J81L 2ZTDA 3HOVH 3MEHA 4A3CG 2ICEC 1N8RC 3GTLB 3QJYA 2MQHA 1B4OA 5KYIA 2A6ED 4C3HG 4ZKCB 1O80A 3AQQA 3VA7A 1U5KA 1F2ZA 2A68D 2XRQD 2AWNA 2B8GA 5GAHC 1SROA 1H9RA 3C3LA 4I7ZC 4ZRZA 2QW7A 2E2JH 2VUMG 3TP6A 4XQNA 1YJNA 5C44B 1XNRL 1VS0A 4ALPA 2PZWA 4A76A 2F0NA 2VY3A 3CCVA 1WVLA 4XDXA 1KLUD 4C3JG 4FF2A 2JA6G 4LF5L 5IGDA 3I4OA 3KF8B 3NHHA 2VNUD 1HRJA 1PTOC 4LUVA 5A35A 4BY1B 3JAMi 1HHVA 1IL8A 1TXYA 5I2XA 1TS5A 1SMYC 2JP1A 4JI3Q 4R9WA 3TZDA 3HS0C 3H6MA 1PH9A 3O13A 2E2IH 1OTCA 3OW2A 2R92B 5EJWA 3T4AC 4CKBA 2OQ0A 3NE5B 1DOMA 1EIGA 1WTHA 2K01A 1HUMA 4A3KB 3TRZA 3OWEB 1FNVA 3DEPA 3HFZB 3V2TA 2JA9A 4FO2A 2EZVA 5C6AA 3HOZH 5FLXc 2A6HC 1VQKA 4IOCA 1R4PB 1YEZA 2RSNA 1AN8A 1UWVA 1B3AA 2O2LD 4MHEA 5EBCA 1LTGD 3G48A 2WINB 3H3VC 3G71A 3I4NB 1CI3M 4DR3Q 1HQRD 3GO5A 1XMOQ 1SJHD 1S72A 2B2YA 1Y8PB 1L0XB 2FHTA 3P7JA 1NY4A 3U4VA 4ZYSA 3J7ZC 2A1AA 4OX9Q 4YCVA 3MZ5A 2KHSA 4A3IH 2E75C 3PV0A 3R3OA 5LMUQ 5C3XA 1HR0L 3DM3A 4JV5Q 4OO1H 4A3DH 1KDCA 1QNUA 1EIFA 1AFPA 3K59A 2UUBL 2J4XA 3X3NA 2BA1A 4GKJL 3NENA 1XJVA 4LF4Q 4DFAA 4KN4C 5E4WC 4A3GB 2EY2A 4LFAQ 3TN2A 1FL0A 3I7FA 3GTJH 4A75A 2CFMA 4BA2I 2SNSA 2X69A 4DAMA 4QIWB 4A4IA 2EYJA 1CKNB 1FR3A 5FK9C 4NXML 3OTOL 4A3FH 1S3OA 1F9PA 1Y8NB 4DAPA 3TMEA 4F8MA 1STBA 1E24A 2MGSA 4O1NA 4O2DA 4DKAC 4C1NK 1HA6A 1D5MC 5CORA 1EIYB 2ZXRA 2JA5G 1XNQL 2NB0A 3K5LA 4DV5L 4FF1A 4S3SA 1JOKA 1TWFB 4XQQA 4DV4Q 4RGMA 3AFQA 1SMXA 5JJLA 2B29A 3NELA 3QOJA 2UUCQ 4NW2A 2Z8LA 3JAML 2A69C 5D3DA 1LUZA 4OXPA 2RSOA 5AJ3L 1C0AA 1NTGA 5JJIA 3C1FA 2EQSA 3MXNA 3HOYH 1C9OA 3S14H 2WAQE 1NCVA 2OTJA 2NVQB 1GUSA 1PDQA 3QR8A 1O7LA 1R9TH 4A3BG 1K0RA 2OWOA 1ILQA 1D7QA 3H94A 4KKSA 1VQ5A 1YNND 1XTCD 4M1UB 3K80C 4MN3A 4F7XA 2AUJD 1KNAA 2KEDA 3HOUG 1PH5A 2ZXPA 5EPLA 4BY7B 1B3QA 1XPRA 3X3MA 3I4MB 3TS2A 1PVOA 1Z7TA 3GTOB 2P5ZX 1JCKB 1BVSA 3K81C 1EFID 4YWMA 1EY6A 4JPBW 5IE8A 3K58A 4JI4Q 3BJUA 3S1QH 4JI3L 1CQVA 5IP9G 1F2LA 4KY5A 4LAAA 3GTMH 1K3RA 2ZJQA 1SLJA 4JC0A 1LLRD 3E6ZX 4R8NA 1RF2D 3M3YB 1Y1WB 1AE2A 3U50C 2E2DC 1PH3A 1TWCH 3U58A 1OXTA 2HDLA 1HNXQ 5GAEC 1SNQA 1DCZA 1KRTA 5C3EH 1O78A 2HUGA 4QY7A 1DJRD 4DR3L 1PH8A 2E74C 4G7OC 1M90C 4HMJA 3PSIA 1XMOL 1OO9B 3K8AA 3H0GG 4CHTB 3MHBA 4HMIA 1SN8A 2GVBA 1PTOB 3NSWA 3Q22A 2QEJC 3E3XA 1HTLD 1LO5D 4DV0Q 1I6HH 4RG1A 3SGIA 4OX9L 5LHY1 5CC4A 5I4DA 4HN7A 4ME3A 3BS1A 5IWAQ 4FXDA 5LMUL 3D8GA 3PO2H 4J8QA 1QVGA 5JOBA 3VDYA 3BDCA 4JV5L 3GTQH 1A0IA 4LF8Q 1MBYA 3STBD 1I3QB 3CW2C 4EQPA 1JE5A 4LF4L 1TR5A 3G6JB 1B2TA 3PMFA 1Q1BA 2F0WA 2JK8A 4LFAL 3HKZE 4DR4Q 3QOLA 4R1JA 4RKBA 1BF4A 2OCEA 3T1YL 3RN2A 3RLOA 2JA8B 1B50A 1FNUA 3MXUA 1PXUA 1YNJD 1JICA 5J1ZA 1E1OA 4YY3Q 2EIFA 4AQYQ 1A15A 4C2MB 3F1ZA 3AU7A 3TP8A 3C1EA 3W2DA 4BBSB 4N9TA 3LWEA 2RBMA 3AB9A 1JOOA 1PYBA 1Z9FA 3HRZC 1KNEA 2JYOA 2ZXOA 5H1SE 1EZ6A 1SRUA 4DV4L 2E2HH 4G57A 4CDDC 2J0TD 2UUCL 1WD1A 5C0XJ 1BBWA 1EY7A 2IT1A 1E7ZA 5CGKA 2DGYA 3QB3A 2F03A 1BCPF 4IURA 4ABNA 3DLLA 1PA6A 1LTAD 4DV2Q 4IFDJ 4MTNA 3J7AV 3KF6A 5DM73 2PMZE 3L3OC 1D2BA 2CHBD 2Q8TA 2IHFA 1XYIA 5M9OA 2WAQB 5IODA 1K83B 2WACA 3KOJA 2R6GA 2JEBI 4A3IG 4EQ5A 3F8TA 4ID6A 4DUYQ 2EYHA 4CJ1B 2NYZD 3DM1A 1UAPA 1LTSD 1X32A 3NPPA 2LKVA 4OO1G 2F0UA 4A3DG 4RHRA 1YHAA 3NBHB 3NQTA 2B2TA 1LT4D 3TDQA 4BBRB 3U4ZA 4DF7A 5CV4A 2UXDQ 3S2HH 2KOLA 3WWVA 1YHBA 4A3MG 1C8CA 5C5LA 4JI4L 4X66Q 4KK7A 3IFDA 3OSOA 5JPMC 5M3MH 4HJAA 3SEBA 1A63A 3HEJA 3HOWB 3RNUA 2Z4IA 3BZKA 1CTMA 5C5MA 1G291 4A3FG 2ASBA 2HCCA 4HCSA 4LK1C 2YTXA 3Q23A 1ENCA 5IYCG 3HOXH 2L15A 1SYBA 3I90A 3IRBA 2JA6H 1HNXL 3DWQA 1GD7A 3KF8A 4KHVA 1E3PA 2BE5C 2O5JC 4LF9Q 4I65A 4A3JB 4KY6A 3E0EA 3M85A 5C4JB 1EFWA 2NVYB 2JA7B 4DGZA 2B2TC 4DV0L 4OIJA 2XVSA 4V0BA 3BVZA 2VW9A 4EGVA 3HOYG 1JJCB 4KKUA 5C0XG 2RDGA 5IWAL 1VQAA 2SEBD 5KEEA 2RDFA 2B8FA 2L4NA 3E9HA 2RVLA 1L1OC 4LF8L 1B8AA 3R2TA 2L0CA 4EX5A 2EJMA 1FGBD 1YNNC 4C3IB 4JBKA 2Y0SE 3S2DH 1LV9A 2LXJA 2PCFB 3FEWX 2F0SA 1RTOA 3PUZA 4A93B 4DR4L 3OMCA 2F4VQ 2PYKA 1JJ2A 4RHSA 4WJ4A 5JPNC 1W6JA 3RUZA 3CCMA 2AKWB 5BN5A 2PQAA 4MZ9A 1VQ9A 1U0LA 4OONA 1A6XA 1G2SA 2F0TA 5EPJA 4HJ9A 2UU9Q 4XT3B 4QMGA 1DYQA 4YY3L 4OO1I 3GQBA 4K6LA 4AQYL 2JJQA 3HKZB 5DAUA 3TP7A 5J3BA 4GOPC 2UXCQ 4R4QA 4C56C 1TT2A 2CQAA 1V1QA 1TY0A 4CDCC 2I0QA 3Q8DA 1VQOA 2IL8A 3I8ZA 2IX1A 2NVTH 1CHPD 4K5XA 1QUQB 4X6AH 1HXYD 1QCBD 1ZYRC 1FGUA 3A5ZB 4XYQA 4JOIC 5LL6S 2QA4A 1JR0D 4DV3Q 2F3IA 4DV2L 2Z1CA 3ND9A 1TU2B 4GLXA 2B2WA 3Q24A 3RMHA 2NTSA 3PIPA 1I94Q 1CM9A 1ENFA 4OWXB 2JA5H 2PNRC 1PH7A 1IYJB 5EQ0A 3MVVA 5EBDA 2IY5B 1ML0D 3CRKC 3CCEA 1XX8A 2ALYB 2WFWA 4IUQA 2R93H 2NVXH 1ZXTA 4R4IA 1MKHA 2I5MX 1Q90A 3SVMA 2R7ZB 4DUYL 3VR2A 1N36Q 1A2TA 1GKHA 2PMZB 5IT9c 1YJ9A 3PO2G 2K7VA 3VYRA 5C0XI 4ZAIA 3HZXA 4IPCA 4V190 3S1QB 3CMAA 5D65A 3AFPA 1JE4A 1NMFA 4A3LH 3BU2A 5EPKA 2B2UA 2HQEA 5DEHA 1LACA 2UXDL 3A5UA 4R4CA 2K03A 4X66L 1SNDA 1EY5A 4JI7Q 4HJ7A 3I73A 3LGJA 4JI8Q 2AQ1B 1EEFD 3CXCA 3K5OA 4HIDA 3S17H 1CKMA 1MSGA 4PMCA 4DV6Q 4UY8C 3HOUH 1YZ6A 4QL5A 2CW0D 1MI2A 3BDLA 1ICWA 1RTNA 1EYGA 4TQUS 1F2YA 1WYDA 3D3RA 1Q81C 4KKTA 4Q5VA 4M8AA 3T1HQ 5J22A 5FLXL 1BCPD 1AZPA 3R2IA 2F0HA 4YCUA 4UHVA 3R93A 3SR1A 4LF9L 2IX3A 4ULLA 1PRTD 1E2VA 3ERSX 3MFYA 1JB7A 2CH4A 4CKCA 4XXEA 2B2UC 2Q2UA 2DN8A 4ODGA 1ASYA 4NXNQ 1FYCA 2EYPA 3EBEA 3CC2A 5EGTA 1I4HA 1K8OA 1MIUA 1NAPA 2LS01 2OXPA 4WJ3M 3EFXD 3JC66 4IUPA 3CF5A 3KF6B 5CV8A 5TSSA 2RQXA 4YWLA 1KAWA 3FKIH 2K33A 1WCMG 3S24A 1RDPD 3K7AB 5KNBA 1VQ4A 1VQCA 2X6GA 1JMCA 4JW0A 3RLFA 2R7DA 5C4ZA 3A8KE 1K0SA 1O7IA 3H0GH 5M5XB 2YU9B 5AFWA 2R3ZA 5I6YA 2K28A 2QCPX 1B9MA 1TIID 3I56A 1LM0A 2F4VL 3NTIA 2EDGA 1U9RA 3PIP3 1SBBB 2VS1A 1JB3A 4BA1I 4DXGA 2K32A 3MTSA 1Y1VH 2Y0SB 2UU9L 3PO3G 4K2LA 5L37A 4O0AA 4B3RQ 3HG9A 3F2CA 4L5SA 3IL8A 1UE7A 4B9XA 5M3MG 5JEAH 1WTRA 2K04A 2UXCL 4IOAA 4OWWB 4KHPQ 2D0OA 1G2TA 2BCOA 4JCVE 4KV6A 1L1OB 1AP0A 2KEEA 2EXDA 4GS3A 5IOCA 2F3VA 2R92G 1YJWA 2EJFC 2NZ1D 1MJEA 1I50B 3UDFA 2QKIC 1ASZA 1V1OA 2JSOA 1LT5D 4HCEA 4P74A 3HOXG 3S15B 3S1NH 2V4DA 1VQDA 2BH2A 3S1MH 4A3EB 1DM0B 3OHXC 3PUXA 3NBIA 1GHJA 4YHHL 4DV3L 4C1NI 2MUYA 3FDTA 1I4GA 3KLRA 5C3WA 3K6OA 2Z6BA 1I94L 3A7AB 1VQFA 1NUCA 2F0EA 1N33Q 2KUMA 3SDZA 4GOPB 1I4PA 4OIKA 3L2PA 4C3HB 3M4PA 3DEOA 1N36L 4CDFC 1SSOA 3CPWA 4JI5Q 2Z4HA 3Q0AA 4IUNA 1IHZA 4LUZA 2NZOA 3QG1A 2VUMB 2KCTA 1B53A 4UPAA 1AZQA 1D5XC 1O7ZA 3W1GA 5IYDG 3S1RH 2A74C 4JI7L 4DR7Q 2XIWA 5DLQE 2PQAB 2JQOA 4C3JB 1DD2A 2WV6D 1UE6A 5ELDA 4DV6L 1VQ7A 2RCFA 2IHEA 4KY7A 4MTKA 1K8GA 1AEXA 1V9PA 2M9VA 4UP8A 5D3IB 2DUDA 1STGA 4HIOA 1XMQQ 2F0QA 3GTKH 1GXDC 3NBHA 3G6EA 2CCZA 3ND8A 3T1HL 1G91A 5M5YH 1HZAA 4A3MH 2QGQA 4ME5A 1KABA 5FO8B 2OEOA 3A0JA 3UI2A 5IYBG 3CAMA 1J8IA 1SYCA 2DNEA 2I46A 1OXXK 5FO9B 3DHQA 3SK5A 4NXNL 1A8VA 1J9OA 2B63H 4J1MA 2D9UA 3S2DB 1CKOA 2F0KA 4ZKBB 5IYCH 1KDBA 4OHJA 3OPOA 3ZJYC 1SE2A 2YV5A 3NTHA 5FO7B 1I4QA 4DK3C 3BYTB 1J5EQ 1JWMD 1SEBD 5IT9E 2F0DA 1U4LA 2R93G 3CCQA 2IJ0A 4NP5A 4O42A 2E8GA 4OL7A 5LL6X 5LMNQ 1D5ZC 5ELEA 2AQ3B 3CHBD 4OGQC 1ZKOA 3TP5A 5C0XH 3S16H 3CPFA 1IBLQ 4KJNA 2O4XA 3I4MG 4A3LG 1CHQD 3SK4A 4Y7NB 4LF6Q 4JI1Q 1HJPA 4J15A 1GUTA 1HZ9A 2K5NA 5JEAJ 4B3RL 4IFDH 2B2VA 3PUVA 4X3UA 4QUFA 4K5WA 3I55A 5M3FH 1HZCA 3S9WA 2NVTB 3D0FA 3B6YA 5BN3A 4KHPL 1HR0W 2KJXA 2F0VA 3CQZH 2QDBA 1PTOF 2FMMA 2F0IA 5IGBA 5G3LF 4QQBX 4AIMA 2RKSA 1YNXA 2DJFC 1QOHA 3WOEA 2JA5B 2QDLA 4KD3A 1IW7C 2MO1A 3NP8A 4FNFA 4N8FA 3BVMA 2FXQA 3PQIA 3CCSA 1TWGH 2ICIA 3FPUB 1PRTC 3RZDB 3L9AX 5D14A 2OF1A 2EVBA 5BR8Q 1TWAB 5ISRA 1N33L 5DNFA 4E6IA 1BR9A 1EY4A 2B2VC 4IUTA 4P72A 1TY2A 2Q2TA 1Q7YC 1EOTA 4CBVA 4A3BB 2K4KA 1DXMA 1QUQA 1TWHB 1IXRA 4JI6Q 3FKIG 2BH8A 3A74A 2KA7A 3QO2A 3WOFA 5ELBA 3K7UC 4CGYB 4NDXA 1X54A 4Z9CB 1O7YA 1WTVA 1B70B 3J7A5 1H9JA 4DR7L 1XWEA 2RF4A 5HY6A 3BG3A 2J7ZA 4CKEA 4I7AA 2JA8G 3F2DA 2XTIA 2A73B 4L5TA 3BDOA 3MWYW 2K5DA 1RIPA 2A6EC 3F2BA 1Y1VG 4JI2Q 1LTLA 2A68C 1UUPA 1GHKA 2CVRA 4IUVA 1XMQL 5C4XB 4GLAC 2EYLA 4DAYB 5JEAG 4LJZC 3OIQA 4QCLA 1DGSA 4RAUC 3UDXA 4IN3A 1GO3E 4HTHA 3I2ZA 1VQIA 5FLMG 5KIXA 4GZYC 2K5VA 2R7FA 4F87A 2F0OA 1AE3A 3U9OA 3NK9A 1CZGA 1BBUA 2XNAC 5EKIA 3H0GB 2PZUA 1VQBA 1D6EC 3I72A 1J6QA 1BQQT 4DK0A 4MIUA 1YHQA 3QIAA 4LWCA 5C4HA 4AYBE 2N88A 3KDFB 4RA8A 1IL2A 2CQOA 3TEHB 1J5EL 2IPKD 4F88A 3HOVB 2H4OA 5A2QE 2WAQG 1ZEQX 3OYYA 3FMCA 3ZYYX 2N3SA 3T51B 5M5WH 2FJ2A 5LMNL 1G8ZD 3TS0A 2MPMA 1M4VA 2TMPA 2DY8A 1IBLL 1EY8A 3C2PA 2E2JB 2XGTA 2VZAA 1EIHA 1PZID 4LF6L 3GTLH 4JYAQ 4JI1L 1ICFB 4APVA 1WCMH 1VQJA 4KHZA 3IKJA 2A19A 3NXWA 1G6ZA 4QB4A 1HTPA 1G6PA 2PO4A 1AW7A 1WOCA 4DK1A 1LTRD 1S4ZA 3S1MB 5CR3A 1JQYD 2CKZB 3VYUA 3IAYA 4RGOS 5COYA 1AH9A 3P75A 3QWNA 2GVAA 1JWUD 5GROA 4IZ8A 1FD7D 5CV7A 2JEAI 3BZDB 4TRDA 1YI2A 1MJCA 3T56B 1X9NA 2E2IB 1K73C 3SK8A 4X3SA 3PO3H 5J39A 2HQLA 1EQTA 4BY1H 3GD7A 1GUNA 5I6WA 1DZ1A 3T13A 5HGQA 3HOZB 1N9WA 3DXJC 1RJTA 1MD2D 1VMCA 5BR8L 2ENBA 1VF5C 4WFN3 2A5HA 1L0WA 1IYUA 1L1OA 2R92H 3J81E 4A3KH 2HIVA 1PV4A 1WTQA 2B63G 4KLKA 2ATWA 1QE6A 1WTXA 4X3TA 2PW5A 2EYFA 2FFKB 4JI6L 1PH1A 2CWPA 1SE8A 3RN5A 2KECA 5IY0A 3I4NH 4A3IB 1SNOA 4XIGS 5IP7H 1FNWA 2O5IC 4X62Q 4A3DB 3BVGA 2K52A 4XT1B 1PRTB 1RD9D 4GOPA 2EYOA 2ID0A 4K0KQ 5M5YB 1GVPA 4X3KA 1RCVD 1PTOD 4A3MB 5ELOA 1QVCA 1V1PA 4FDBA 5G3LD 1SFOH 1NNXA 4J6HA 3GTJB 4NKLA 4JI2L 1SMYD 4IFDG 2K14A 3M4OH 5M3FG 1HNZQ 4GN4B 2RHSB 2BA0A 2F4IA 1D1IA 2L12A 1T5XD 1VQGA 2WB1E 2CWAA 1A62A 4A3FB 2FINB 5I9OA 2K5QA 4JOIA 4A3GH 5IYDH 3TBIB 4ZUJA 1SNCA 4KMUC 2KHJA 2MHVA 2A6HD 1F77A 4RGNA 1E1TA 3J80c 4H02A 1C7YA 1EYDA 3OIPA 5EKLA 1OXVA 2F0LA 3ERQA 4QUCA 4PZ7A 1CQFA 3HKSA 2NTTA 1SAPA 3RR5A 1ESRA 3N52A 1Y8OB 1UE5A 1X65A 2KCCA 3HOYB 3S14B 4GKKQ 3J7YW 1TWFH 3CKIB 1MHWC 2KBNA 1STEA 1B9NA 1OXUA 3CC4A 1U4RA 5IYBH 4DV1Q 3GP7A 3ER0A 2A8VA 2Z6KC 1P8LA 1R9TB 2ZM6Q 3ITPA 3K0YA 1P16A 1S5ED 4AYBB 3H09A 4DN4M 4RFBA 1CSQA 4JG2A 1SJED 1VQ8A 2NVQH 1DOKA 4JYAL 1PFNA 3NUCA 1ONLA 5CMDA 3KBXA 1QB5D 4L6TB 1HQMC 2ZJRA 3I3CA 1E2WA 4BXXH 2F3WA 3AYHB 4HJ8A 1L2FA 4DR5Q 4P71A 4P73A 3TQYA 4K6DA 1VQNA 4BY7H 4K5VA 1IBKQ 1W6KA 3URYA 3KJPA 2JE6I 3STBC 1YIJA 3GTMB 3I4MH 3EJIA 1HZBA 2EE1A 1JOQA 2H5XA 2NN6G 4HJ5A 2NBFA 1PZKD 2KHIA 1SYEA 3E5SA 3GTOH 4H13C 4IFDI 3ONAB 1CZWA 3VR4A 3M7NA 3K5NA 2F0GA 1EQVA 3CU7A 1GJXA 1TWCB 2M2LA 1BUVT 1QWYA 5EAYA 3JAME 4EQOA 3D6CA 2RHQB 3PUYA 1S5FD 1RKNA 2MNAA 5C3EB 3OW7A 4K8IA 1YNJC 4DPGA 1I4XA 4UAIA 1Y1WH 2NWGA 1U4MA 3D31A 4H44C 5I9PA 4CJ0B 2Z9HA 3E0JA 1KTKA 1CA6A 2AUKA 5HURA 1I6HB 4B08A 1I6VC 5A2QL 3L7ZC 1VMPA 2GN5A 3PO2B 3CCRA 4OELB 1T5EA 1PTOH 1PFMA 3NWTA 4X62L 3CP0A 3Q6SA 3GTQB 3A56A 1ILPA 1CFMA 1I4RA 1PYSB 2GA4B 1A3TA 4K0KL 4YCWA 3MFGA 1QJOA 5KRUA 3OOCA 4HAEA 4L5RC 3I70A 3NQIA 4RKLA 1HNZL 1E2ZA 4RH6A 1I3QH 2UXBQ 1CUKA 1WJJA 4BS9A 1Q8KA 5IIFA 2EPBA 2I5HA 5DM63 4DNRB 1KHIA 3EQLC 3H3VH 5C44G 2L11A 4WORA 3PUWA 3VR5A 1UE1A 1S5DD 1Z6HA 1LABA 2JA8H 1HFNA 4B9WA 4DXFA 2MP1A 3DWPA 2WB1B 1SR3A 1NE3A 2HHHQ 2EOTA 2E2HB 2D0PA 1SYDA 4K2KA 4A3EG 4BY1G 4C2MH 1EY0A 3EA6A 4ZK9B 4BBSH 2NN6I 1KD1C 4DAYA 4LFBQ 4GKKL 3FP9A 1M1KC 2G9DA 3TSSA 1Q12A 3J81j 4X64Q 2E5LQ 2IX0A 2KQ3A 1JC7A 5JAVA 4A3KG 1BKBA 5CV5A 5FLMH 5CYUA 5K5PA 2ZJPA 4DV1L 3J7AF 3MXGA 1WCMB 4B3SQ 4FF4A 3W1BA 2ZM6L 3GTGH 5IGCA 1A3UA 2EJGC 1EWCA 1FJGQ 4DR6Q
chains in the Genus database with same CATH topology
2KCNA 4ZLTF 5IGEA 2X6LA 1STHA 2C5CA 4FXKC 2BDOA 3PO3B 3KUPA 2YYZA 3S2HB 1V1PB 4DA2A 2WP8J 1Q1EA 3VYTA 1B1ZA 5M3MB 3U9SA 4UDUC 2QILA 5CV9A 3FPPA 3J80E 1EY9A 1GUWA 1UNSA 1Z47A 1A3VA 3HOXB 1MGSA 2JA6B 1H9KA 5KGUA 1C4QA 2EXZA 1RHPA 3BYYB 1DONA 5IGGA 1F2MA 1E0BA 2AWOA 5F2DA 3KLSA 1A2UA 2DY7A 3TZUA 3SE0A 1SFOB 1SNMA 3M4OB 1HFGA 4HSPA 4CJ2C 2RDHA 1LT6D 1CA5A 3I4LA 2E76C 2EY1A 1SE4A 3G7LA 4XQJA 1XXGA 2B2YC 4BWGB 3EROA 3AMUA 1NR4A 1IKLA 3A7LA 4PNYA 2BE5D 4DAVA 2RA4A 1S5BD 1WTWA 5FKAC 3H91A 2M00A 3VA5A 1D1KA 1HA5A 2BOSA 3MA2B 2XSCA 2KVMA 3KK7A 1RODA 2XWJB 3D4DA 3NTKA 2CW0C 2F0MA 2EYMA 5T1IA 5KYLA 1LTTD 3K57A 3PIO3 2N55A 1BCPC 3IFTA 3DMUA 1M8AA 5ELCA 1EYCA 2R93B 2NVXB 2XWBB 4U673 3SXHA 1PFBA 4FP5D 1Y69U 1TS2A 3OWFA 1NSNS 2MJ8A 5E1FA 2WIIB 2QF7A 4IUUA 2D62A 2WKDA 1R4QB 3W3AA 2IW3A 3S17B 4U68A 2XRSD 4R8IA 5KNCA 2PPBC 3HOUB 1NR2A 1TS4A 1QNKA 1TVXA 2JXMB 1BBXC 4ZUIA 1H9SA 1GOZA 4HEDA 1VF7A 1ZYRD 3T53B 1EZ8A 5T1GA 2K5WA 1PLFA 4XTCS 5I2YA 3M7GA 1PMRA 2NN6H 1BNZA 1VDZA 3D4WA 4PV1C 2AQ2B 1Q8IA 4JBWA 1L0YB 1SYFA 3FKIB 1SYGA 1CT1D 2WKCA 1WD0A 2ZT9C 4RCOA 1LTID 4KN7C 1V43A 1SNPA 1K8MA 2EY5A 4G4KA 1MSHA 4PMBA 2L1BA 4G7HC 2LMCB 1Y1VB 1CK1A 1STAA 2F0JA 3K5MA 3N6RA 1KLGD 4H7BA 3J80L 5FLXE 3VR6A 3WDNA 2SNMA 1EU4A 3DWAA 3HGBA 4YIJA 3GTGB 1SE3A 3S1NB 3A8IE 4N9PA 1HCZA 5CBEE 1JORA 5K36H 2PZTA 1LTBD 1BO0A 1PRTF 4JK1C 5KNDA 4IQZA 5EKKA 3D4RA 1TQOA 3CRLC 2SOBA 1S5CD 1BDOA 1STNA 3OMGA 4DNTB 1H9MA 4NMZA 3SK6A 1V8QA 1TS3A 4RCNA 3MC0B 1BXTA 4G7ZC 1TKWB 1F9SA 2F0FA 5BN4A 4HSVA 3S1RB 5HGTA 5IT9L 5CBAE 2HCIA 3NWSA 4C3IG 1BCPB 1KAAA 2IWHA 4L8JA 3M4YA 2PW7A 1HPCA 3A55A 2BDNA 4H0LC 1QG7A 4K8JA 2I07B 3GTKB 3MAQA 4TKOB 3V96A 1STYA 3MXPA 2FMCA 2D5DA 1ET9A 1B44D 1VCIA 5NUCA 2B63B 2OT2A 2L5TA 4Q0FA 1EL0A 4WRDA 1LT3D 4KJOA 1WTOA 4PMWA 1GUOA 2B39A 3C46A 3GV6A 1GUGA 2SDFA 4ILWA 4P2CB 1IKMA 1F9RA 3S16B 3VYSA 1F9QA 2G9HD 1PZJD 2K1BA 1ENAA 4L63B 3LNNA 1C48A 5M3FB 4HR7B 3F2UA 4PQXA 2L55A 1EYAA 2VXWA 3VR3A 3CQZB 3KBGA 2PQEA 3SHLA 1X3PA 1H9SB 3KLSX 4RGTA 4FYDA 5JVG3 1X3QA 5FOBB 1TWGB 2LY7A 4FVMA 4LMQD 2R61A 2HDMA 4KD4A 3FRPB 1HUNA 1ESFA 1UEAB 2EY6A 4KI0A 4IALA 2LFNA 2K6AA 5CV6A 1ET6A 2A69D 2XN9C 2F1MA 2NUCA 2H1EA 3R8BA 3A8JE 3GTPB 1II3A 5E4XA 1OXSC 5E3FA 2Q8IB 2VB2X 1JWSD 3P1HA 4ZQ3A 4KTAA 4FF3A 2L9HA 3T16A 3RZOB 1KDAA 4QF4A 1WTPA 4EQNA 1EEID 5JJZA 2B2WC 3P20A 5JVH3 4K14A 1PYWD 1IW7D 3LX0A 1EU3A 5ELFA 5IGFA 2K05A 2TSSA 3A54A 3D6WA 1EWHA 4FXGC 2F0PA 1QILA 2D2CC 2Q8RE 3EVQA 4EVOA 2VB3X 5K36G 3I91A 1DOLA 4XYOA 3V05A 4RWSC 4DU9A 3GV3A 1SXTA 3RD4A 1U4PA 3FVQA 3LWUA 4TSSA 3DUZA 1BOSA 1Q3LA 5M5WB 1IYVA 1SDFA 4WJWA 2DNCA 3HP3A 2C9OA 3J81L 3MEHA 2ICEC 3GTLB 3QJYA 1B4OA 5KYIA 2A6ED 4C3HG 4ZKCB 1O80A 3VA7A 1F2ZA 2A68D 2XRQD 2AWNA 2B8GA 1H9RA 3C3LA 4I7ZC 4ZRZA 3TP6A 4XQNA 5C44B 2PZWA 2F0NA 1WVLA 4XDXA 1KLUD 4C3JG 4FF2A 5IGDA 2VNUD 3NHHA 1HRJA 1PTOC 5A35A 4BY1B 1HHVA 1IL8A 5I2XA 1TS5A 1SMYC 2JP1A 4R9WA 3TZDA 3HS0C 3H6MA 3O13A 2R92B 5EJWA 3T4AC 4CKBA 1DOMA 3NE5B 4A3KB 1EIGA 2K01A 1HUMA 1FNVA 3DEPA 3V2TA 3OWEB 4FO2A 2EZVA 5C6AA 2A6HC 1R4PB 2RSNA 1AN8A 1B3AA 2O2LD 4MHEA 5EBCA 1LTGD 2WINB 3H3VC 3I4NB 1CI3M 1HQRD 3GO5A 1SJHD 2B2YA 1Y8PB 1L0XB 2FHTA 3P7JA 4ZYSA 3MZ5A 2KHSA 2E75C 3PV0A 3R3OA 5C3XA 4OO1H 1KDCA 1QNUA 1AFPA 3K59A 2J4XA 3X3NA 2BA1A 4DFAA 4KN4C 5E4WC 4A3GB 2EY2A 3TN2A 4BA2I 2SNSA 2X69A 4QIWB 2EYJA 1FR3A 5FK9C 1F9PA 1Y8NB 4DAPA 3TMEA 4F8MA 1STBA 2MGSA 4O1NA 4C1NK 1HA6A 1D5MC 5CORA 2ZXRA 2NB0A 3K5LA 4FF1A 4S3SA 1JOKA 1TWFB 4XQQA 4RGMA 3QOJA 4NW2A 2Z8LA 3JAML 2A69C 5D3DA 2RSOA 3C1FA 3MXNA 1NCVA 2NVQB 1GUSA 1PDQA 1O7LA 1ILQA 3H94A 4KKSA 1YNND 1XTCD 4M1UB 4MN3A 4F7XA 2AUJD 1KNAA 2KEDA 2ZXPA 5EPLA 4BY7B 3X3MA 3I4MB 1Z7TA 3GTOB 1JCKB 1EFID 1EY6A 3K58A 1CQVA 1F2LA 4KY5A 4LAAA 1LLRD 3E6ZX 4R8NA 1RF2D 3M3YB 1Y1WB 2E2DC 1OXTA 2HDLA 1SNQA 1DCZA 1O78A 2HUGA 1DJRD 2E74C 4G7OC 4HMJA 1OO9B 4CHTB 3MHBA 4HMIA 1PTOB 3NSWA 3Q22A 2QEJC 1HTLD 1LO5D 5LHY1 5CC4A 5I4DA 4HN7A 3BS1A 4FXDA 3D8GA 4J8QA 5JOBA 3BDCA 1MBYA 1I3QB 4EQPA 1TR5A 3G6JB 1B2TA 3PMFA 1Q1BA 2F0WA 3QOLA 4RKBA 1BF4A 2JA8B 1B50A 1FNUA 3MXUA 1PXUA 1YNJD 1JICA 5J1ZA 1A15A 4C2MB 3AU7A 3TP8A 3C1EA 3W2DA 4BBSB 4N9TA 3LWEA 2RBMA 3AB9A 1JOOA 3HRZC 1KNEA 2JYOA 2ZXOA 1EZ6A 4G57A 2J0TD 1WD1A 5C0XJ 1EY7A 2IT1A 5CGKA 3QB3A 2F03A 1BCPF 4IURA 4ABNA 1LTAD 4IFDJ 3J7AV 5DM73 3L3OC 1D2BA 2CHBD 2Q8TA 1XYIA 5M9OA 2WAQB 5IODA 1K83B 2WACA 2R6GA 2JEBI 4ID6A 2EYHA 4CJ1B 2NYZD 3DM1A 1UAPA 1LTSD 1X32A 3NPPA 2LKVA 4OO1G 2F0UA 4RHRA 3NQTA 2B2TA 1LT4D 3TDQA 4BBRB 4DF7A 5CV4A 2KOLA 1C8CA 5C5LA 4KK7A 3IFDA 3OSOA 5JPMC 3SEBA 3HEJA 3HOWB 2Z4IA 1CTMA 5C5MA 1G291 2HCCA 4HCSA 4LK1C 3Q23A 1ENCA 1SYBA 3I90A 3DWQA 3KF8A 4KHVA 2BE5C 2O5JC 4I65A 4A3JB 4KY6A 3M85A 5C4JB 2NVYB 2JA7B 4DGZA 2B2TC 4OIJA 2XVSA 4V0BA 3BVZA 4EGVA 4KKUA 5C0XG 2RDGA 2SEBD 5KEEA 2RDFA 2B8FA 2L4NA 2RVLA 3R2TA 2L0CA 2EJMA 1FGBD 1YNNC 4C3IB 1LV9A 2PCFB 3FEWX 2F0SA 1RTOA 3PUZA 4A93B 3OMCA 2PYKA 4RHSA 5JPNC 1W6JA 3RUZA 5BN5A 1A6XA 1G2SA 2F0TA 5EPJA 4XT3B 4QMGA 1DYQA 4OO1I 3GQBA 4K6LA 3HKZB 5DAUA 3TP7A 4C56C 1TT2A 2CQAA 1TY0A 2IL8A 3I8ZA 2IX1A 1CHPD 4K5XA 1HXYD 1QCBD 1ZYRC 4XYQA 5LL6S 1JR0D 2Z1CA 3ND9A 1TU2B 2B2WA 3Q24A 3RMHA 2NTSA 1CM9A 1ENFA 2PNRC 5EQ0A 3MVVA 5EBDA 1ML0D 3CRKC 1XX8A 4IUQA 1ZXTA 1Q90A 3SVMA 2R7ZB 3VR2A 1A2TA 2PMZB 2K7VA 3VYRA 5C0XI 4ZAIA 3HZXA 4V190 3S1QB 5D65A 1JE4A 5EPKA 2B2UA 2HQEA 5DEHA 1LACA 2K03A 1SNDA 1EY5A 3I73A 2AQ1B 1EEFD 3K5OA 1MSGA 4PMCA 2CW0D 1MI2A 3BDLA 1ICWA 1RTNA 4TQUS 1F2YA 3D3RA 4KKTA 4Q5VA 4M8AA 5J22A 5FLXL 1BCPD 1AZPA 3R2IA 2F0HA 3R93A 3SR1A 2IX3A 4ULLA 1PRTD 1E2VA 3MFYA 4CKCA 4XXEA 2B2UC 2DN8A 4ODGA 1FYCA 2EYPA 5EGTA 1I4HA 1K8OA 1NAPA 2LS01 2OXPA 3EFXD 4IUPA 5CV8A 5TSSA 2RQXA 5KNBA 2K33A 1RDPD 3K7AB 2X6GA 3RLFA 5C4ZA 3A8KE 5M5XB 2YU9B 5AFWA 2R3ZA 5I6YA 2K28A 2QCPX 1B9MA 1TIID 3NTIA 2EDGA 1U9RA 3PIP3 1SBBB 1JB3A 4BA1I 4DXGA 2K32A 3MTSA 2Y0SB 4K2LA 3HG9A 3IL8A 4B9XA 5JEAH 1WTRA 2K04A 1G2TA 2BCOA 4KV6A 1AP0A 2KEEA 5IOCA 2F3VA 2EJFC 2NZ1D 1I50B 2QKIC 1V1OA 2JSOA 1LT5D 4HCEA 3S15B 2V4DA 4A3EB 1DM0B 3OHXC 3PUXA 3NBIA 1GHJA 4C1NI 2MUYA 3FDTA 1I4GA 3KLRA 5C3WA 3K6OA 3A7AB 1NUCA 2F0EA 2KUMA 3SDZA 1I4PA 4OIKA 4C3HB 3DEOA 1SSOA 2Z4HA 3Q0AA 4IUNA 1IHZA 3QG1A 2VUMB 1B53A 1AZQA 1D5XC 1O7ZA 2A74C 2XIWA 4C3JB 1DD2A 2WV6D 5ELDA 4KY7A 1AEXA 2M9VA 5D3IB 1STGA 2F0QA 1GXDC 3NBHA 3ND8A 1G91A 4ME5A 1KABA 5FO8B 2OEOA 3UI2A 1J8IA 1SYCA 2DNEA 2I46A 1OXXK 5FO9B 3DHQA 3SK5A 1J9OA 4J1MA 2D9UA 3S2DB 2F0KA 4ZKBB 1KDBA 4OHJA 3OPOA 1SE2A 3NTHA 5FO7B 1I4QA 3BYTB 1JWMD 1SEBD 5IT9E 2F0DA 1U4LA 2IJ0A 4NP5A 4O42A 4OL7A 5LL6X 1D5ZC 5ELEA 2AQ3B 3CHBD 4OGQC 1ZKOA 3TP5A 5C0XH 4KJNA 2O4XA 1CHQD 3SK4A 4Y7NB 1GUTA 4IFDH 5JEAJ 2B2VA 3PUVA 4X3UA 4QUFA 4K5WA 3S9WA 2NVTB 5BN3A 2KJXA 2F0VA 2QDBA 1PTOF 2FMMA 2F0IA 5IGBA 5G3LF 2RKSA 1QOHA 3WOEA 2JA5B 4KD3A 1IW7C 3NP8A 4FNFA 3BVMA 2ICIA 3FPUB 1PRTC 3RZDB 3L9AX 5D14A 2OF1A 2EVBA 1TWAB 5ISRA 5DNFA 4E6IA 1BR9A 1EY4A 2B2VC 4IUTA 1TY2A 1EOTA 4CBVA 4A3BB 1DXMA 1TWHB 2KA7A 3QO2A 3WOFA 5ELBA 4CGYB 4NDXA 4Z9CB 1O7YA 1WTVA 1H9JA 1XWEA 3BG3A 2J7ZA 4CKEA 2A73B 3BDOA 3MWYW 2K5DA 2A6EC 2A68C 1UUPA 1GHKA 2CVRA 4IUVA 5C4XB 2EYLA 5JEAG 4LJZC 3OIQA 4QCLA 4RAUC 4IN3A 4HTHA 5KIXA 4GZYC 4F87A 2F0OA 3U9OA 3NK9A 1CZGA 2XNAC 5EKIA 3H0GB 2PZUA 1D6EC 3I72A 1BQQT 4DK0A 4MIUA 3QIAA 5C4HA 2N88A 4RA8A 2IPKD 4F88A 3HOVB 2H4OA 5A2QE 1ZEQX 3FMCA 3ZYYX 3T51B 2FJ2A 1G8ZD 2MPMA 1M4VA 2TMPA 2DY8A 1EY8A 3C2PA 2E2JB 1EIHA 1PZID 4KHZA 3IKJA 3NXWA 1G6ZA 4QB4A 1HTPA 2PO4A 1AW7A 4DK1A 1LTRD 1S4ZA 3S1MB 5CR3A 1JQYD 3VYUA 3IAYA 4RGOS 5COYA 3P75A 3QWNA 1JWUD 4IZ8A 1FD7D 5CV7A 2JEAI 3BZDB 4TRDA 3T56B 2E2IB 3SK8A 4X3SA 5J39A 1EQTA 3GD7A 1GUNA 5I6WA 1DZ1A 3T13A 3HOZB 3DXJC 1RJTA 1MD2D 1VMCA 2ENBA 1VF5C 4WFN3 2A5HA 1IYUA 3J81E 1WTQA 1QE6A 1WTXA 4X3TA 2PW5A 2EYFA 2FFKB 2KECA 4A3IB 1SNOA 4XIGS 1FNWA 2O5IC 4A3DB 3BVGA 4XT1B 1PRTB 1RD9D 2EYOA 2ID0A 5M5YB 4X3KA 1RCVD 1PTOD 4A3MB 1V1PA 5G3LD 4J6HA 3GTJB 4NKLA 1SMYD 4IFDG 2BA0A 2F4IA 1D1IA 2L12A 1T5XD 4A3FB 2FINB 5I9OA 2K5QA 3TBIB 4ZUJA 1SNCA 4KMUC 2MHVA 2A6HD 1F77A 4RGNA 1EYDA 3OIPA 5EKLA 1OXVA 2F0LA 3ERQA 4QUCA 1CQFA 2NTTA 1SAPA 1ESRA 3N52A 1Y8OB 2KCCA 3HOYB 3S14B 3J7YW 3CKIB 1STEA 1B9NA 1OXUA 1U4RA 3GP7A 1R9TB 3ITPA 3K0YA 1S5ED 4AYBB 3H09A 4DN4M 4RFBA 1SJED 1DOKA 1PFNA 3NUCA 1ONLA 5CMDA 3KBXA 1QB5D 4L6TB 1HQMC 3I3CA 1E2WA 2F3WA 4K6DA 4K5VA 1W6KA 3URYA 2JE6I 3GTMB 3EJIA 2EE1A 1JOQA 2NN6G 2NBFA 1PZKD 3E5SA 1SYEA 4IFDI 4H13C 3ONAB 1CZWA 3VR4A 3M7NA 3K5NA 2F0GA 1EQVA 3CU7A 1GJXA 1TWCB 2M2LA 1BUVT 1QWYA 3JAME 4EQOA 3D6CA 3PUYA 1S5FD 1RKNA 5C3EB 3OW7A 4K8IA 1YNJC 1I4XA 4UAIA 2NWGA 1U4MA 3D31A 4H44C 5I9PA 4CJ0B 1KTKA 3E0JA 1CA6A 2AUKA 5HURA 1I6HB 4B08A 1I6VC 5A2QL 3L7ZC 1VMPA 3PO2B 1T5EA 1PTOH 1PFMA 3NWTA 3Q6SA 3GTQB 3A56A 1ILPA 1CFMA 1I4RA 2GA4B 1A3TA 3MFGA 1QJOA 5KRUA 3OOCA 4HAEA 3I70A 3NQIA 4RKLA 1E2ZA 4RH6A 4BS9A 5IIFA 2EPBA 5DM63 4DNRB 3EQLC 2L11A 4WORA 3PUWA 3VR5A 1S5DD 1Z6HA 1LABA 1HFNA 4B9WA 4DXFA 2MP1A 3DWPA 2WB1B 2EOTA 2E2HB 4K2KA 1SYDA 1EY0A 3EA6A 4ZK9B 2NN6I 4DAYA 2G9DA 3TSSA 1Q12A 2IX0A 2KQ3A 1JC7A 5JAVA 5CV5A 5CYUA 5K5PA 3J7AF 3MXGA 1WCMB 4FF4A 5IGCA 1A3UA 2EJGC 1EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0I A;  5IGB A;  1KDC A;  2F0T A;  5C4H A;  3D4W A;  4EQO A;  3D6C A;  2RKS A;  4J6H A;  4QMG A;  4NKL A;  5M9O A;  1RKN A;  5HGT A;  4ODG A;  4K8I A;  4PNY A;  5IOD A;  2EYP A;  2WAC A;  4KD3 A;  5EGT A;  4DFA A;  4KD4 A;  3NP8 A;  5I9P A;  2EY2 A;  1SYF A;  2OXP A;  1SNQ A;  5DAU A;  4ID6 A;  3TP7 A;  2EYH A;  1STH A;  1SYG A;  3MEH A;  5IGE A;  1KAA A;  1TT2 A;  5HUR A;  5CV8 A;  4R8N A;  2SNS A;  5I9O A;  2EY6 A;  5KYI A;  2PW7 A;  4IAL A;  2LKV A;  4HMJ A;  2OF1 A;  2EYJ A;  2F0U A;  2M00 A;  3VA5 A;  1EY8 A;  4ZUJ A;  1SNC A;  3MHB A;  4HMI A;  4K8J A;  4KY7 A;  1F2Z A;  3NQT A;  5CV6 A;  4DF7 A;  1AEX A;  5ISR A;  5CV4 A;  3TME A;  1STB A;  3D4D A;  4E6I A;  4F8M A;  5C4Z A;  1EYD A;  1SNP A;  1STG A;  1EY4 A;  5CV9 A;  4K5X A;  1STY A;  3MXP A;  5C5L A;  2NUC A;  2QDB A;  5EKL A;  2F0L A;  3TP6 A;  2F0M A;  2F0Q A;  5CC4 A;  3ERQ A;  3NXW A;  5I6Y A;  2EY5 A;  2EYM A;  3OSO A;  4QB4 A;  5KYL A;  1II3 A;  3HEJ A;  4PMB A;  1EY9 A;  3D8G A;  5E3F A;  2PZW A;  4ME5 A;  5CR3 A;  5JOB A;  1KAB A;  1U9R A;  3BDC A;  3DMU A;  3P1H A;  1JOK A;  4KTA A;  2F0N A;  1A3T A;  4S3S A;  1EYC A;  4ZQ3 A;  1A3V A;  5C5M A;  3T16 A;  2OEO A;  3P75 A;  5KRU A;  1STA A;  3QOJ A;  5NUC A;  5IGD A;  1SYC A;  3NHH A;  2F0J A;  4K2L A;  4IZ8 A;  3MVV A;  5CV7 A;  5KGU A;  3DHQ A;  4EQP A;  4TRD A;  3SK5 A;  1ENC A;  1TR5 A;  3C1F A;  1KDA A;  2EXZ A;  1SYB A;  4H7B A;  4NDX A;  4QF4 A;  4RKL A;  3SXH A;  4EQN A;  3PMF A;  3SK8 A;  4KJO A;  4B9X A;  2F0W A;  3OWF A;  1NSN S;  4J1M A;  5J39 A;  3QOL A;  4WRD A;  1A2T A;  4KHV A;  5E1F A;  5IGG A;  5IIF A;  3H6M A;  2F0K A;  3ITP A;  1F2M A;  2SNM A;  4RKB A;  5I6W A;  1KDB A;  3T13 A;  4KV6 A;  4I65 A;  3HZX A;  4YIJ A;  5F2D A;  2F3V A;  4KY6 A;  5IOC A;  4WOR A;  1A2U A;  2ENB A;  4K14 A;  4DGZ A;  5J1Z A;  3V2T A;  4N9P A;  2HQE A;  3LX0 A;  5DEH A;  1JOR A;  3NUC A;  5C6A A;  2PZT A;  2F0D A;  5IGF A;  4B9W A;  3TP8 A;  3C1E A;  4NP5 A;  1SND A;  1EY5 A;  1SNM A;  2EYL A;  4N9T A;  4OL7 A;  5EKK A;  4F7X A;  4K2K A;  1SYD A;  2RBM A;  1TQO A;  1JOO A;  2PW5 A;  1EY0 A;  2F3W A;  1EZ6 A;  2RDF A;  5KEE A;  2F0P A;  1ENA A;  2SOB A;  3TP5 A;  2EYF A;  5C3W A;  4PMC A;  4KJN A;  4HTH A;  4ZUI A;  4EVO A;  2O4X A;  3EVQ A;  1STN A;  4G57 A;  3SK4 A;  4K6D A;  1NUC A;  1EYA A;  5KIX A;  2F0E A;  3OMG A;  1SNO A;  2F0O A;  3BDL A;  4K5V A;  4NMZ A;  1EY7 A;  2KQ3 A;  2EY1 A;  5CGK A;  3EJI A;  3MZ5 A;  4K5W A;  3U9O A;  1EY6 A;  5CV5 A;  3NK9 A;  3QB3 A;  3SK6 A;  1F2Y A;  1EZ8 A;  2KHS A;  5K5P A;  2F0S A;  3S9W A;  3R3O A;  4DU9 A;  2PQE A;  1JOQ A;  5JAV A;  3OMC A;  3E5S A;  5J22 A;  2PYK A;  1SYE A;  2PZU A;  4KY5 A;  2F0H A;  3RUZ A;  4LAA A;  3SHL A;  5C3X A;  5IGC A;  2F0V A;  1A3U A;  4IUN A;  1IHZ A;  4MIU A;  3SR1 A;  2F0G A;  1EQV A;  2EYO A;  2F0F A;  3ERO A; 
#chains in the Genus database with same CATH topology
 4HIK A;  2KCN A;  3PCO B;  3I4N G;  5JJK A;  1HH2 P;  3CME A;  1KXL A;  5IP7 G;  4LNQ A;  4GNX C;  3KDF A;  4ZLT F;  5IGE A;  2X6L A;  1STH A;  2C5C A;  4FXK C;  2BDO A;  1K83 H;  3PO3 B;  3KUP A;  2YYZ A;  3GDE A;  3S2H B;  2OTL A;  1V1P B;  4DR5 L;  4DA2 A;  2WP8 J;  1Q1E A;  3VYT A;  4Y52 H;  1XPU A;  1B1Z A;  5M3M B;  3U9S A;  4UDU C;  1IBK L;  2QIL A;  5CV9 A;  3FPP A;  2UUA Q;  2VQF Q;  3UE0 A;  1S40 A;  1E22 A;  3ICE A;  4BBR H;  4B3M Q;  3J80 E;  4CDE C;  1IZ6 A;  1EY9 A;  1GUW A;  1UNS A;  1Z47 A;  3PIO A;  4A3G G;  4JI8 L;  1A3V A;  3HOX B;  1MGS A;  2JA6 B;  3HOW H;  1H9K A;  5KGU A;  2N78 A;  4JVZ A;  1KRS A;  1N32 Q;  1C4Q A;  2EXZ A;  4JBM A;  1RHP A;  3CCJ A;  3BYY B;  1DON A;  1N34 Q;  5IGG A;  1F2M A;  1E0B A;  2AWO A;  5F2D A;  3KLS A;  1A2U A;  2NZH A;  1EWI A;  4A3J H;  2DY7 A;  5C4J H;  3TZU A;  3SE0 A;  2NVY H;  1SFO B;  2JA7 H;  1SNM A;  3M4O B;  1HFG A;  2KCM A;  4HSP A;  1G51 A;  4CJ2 C;  1KL9 A;  2DJG C;  2RDH A;  1LT6 D;  3J81 c;  1YIT A;  1CA5 A;  3CD6 A;  4QGU A;  3I4L A;  2E76 C;  4L5Q A;  2PNH A;  2EY1 A;  1SE4 A;  5ELN A;  1VQL A;  1WFQ A;  3RLN A;  2UXB L;  3T1Y Q;  5FJ8 H;  2AMC B;  3G7L A;  1XTD A;  3H15 A;  4C3I H;  4XQJ A;  4BXX G;  1EUJ A;  1XXG A;  2B2Y C;  4BWG B;  1X55 A;  3ERO A;  4A93 H;  3AMU A;  1X6O A;  4RMF A;  2I5L X;  1H95 A;  1NR4 A;  1IKL A;  4BY7 G;  3A7L A;  4PNY A;  4DR1 Q;  2BE5 D;  4DAV A;  2RA4 A;  2HHH L;  3UDG A;  1S5B D;  1RL2 A;  1WTW A;  5FKA C;  3H91 A;  2M00 A;  3VA5 A;  1D1K A;  1HA5 A;  2BOS A;  3MA2 B;  2XSC A;  2KVM A;  1K3B C;  4LFB L;  3KK7 A;  1ROD A;  2XWJ B;  3D4D A;  1PH4 A;  3NTK A;  4X64 L;  2E5L L;  2CW0 C;  1YBY A;  4P75 A;  1Y1W G;  2F0M A;  4YWK A;  2Q2H A;  2EYM A;  1B7Y B;  5T1I A;  5KYL A;  1LTT D;  3K57 A;  3PIO 3;  4B3S L;  4HIM A;  2N55 A;  1YVC A;  1BCP C;  3IFT A;  3DMU A;  1FJG L;  1M8A A;  5ELC A;  4DR6 L;  1EYC A;  3PF5 A;  2R93 B;  2NVX B;  2XWB B;  4U67 3;  3PF4 A;  1CSP A;  1Y14 B;  4IO9 A;  1JJG A;  1I5F A;  1PFB A;  1EOV A;  3SXH A;  4FP5 D;  1Y69 U;  1TS2 A;  3OWF A;  1NSN S;  4LFC Q;  2MJ8 A;  4NPS A;  5E1F A;  2WII B;  3J80 i;  2QF7 A;  3M4Q A;  1HNW Q;  1UEB A;  2R7Z H;  4IUU A;  1NMG A;  2D62 A;  4JI5 L;  2WKD A;  2ES2 A;  1JT8 A;  1R4Q B;  3W3A A;  2IW3 A;  3GTP H;  2UUA L;  3S17 B;  4U68 A;  2VQF L;  5C4X G;  2XRS D;  4R8I A;  5KNC A;  2PPB C;  4B3M L;  3HOU B;  1NR2 A;  3FHW A;  1TS4 A;  4R4T A;  3RZO H;  1QNK A;  1TVX A;  2HIX A;  3K0X A;  2JXM B;  1BBX C;  4ZUI A;  1H9S A;  4IPG A;  1LYL A;  2OQK A;  1VQP A;  2ZTC A;  4AH6 A;  1GOZ A;  4HED A;  4GNX B;  1VF7 A;  1ZYR D;  3L0O A;  1PFS A;  1N32 L;  4LW1 A;  1PH2 A;  3T53 B;  1NBW A;  1EZ8 A;  5T1G A;  2K5W A;  4N8X 1;  1N34 L;  1FVI A;  1PLF A;  4OEM B;  4XTC S;  5I2Y A;  4BBS G;  3M7G A;  1PMR A;  4GLV B;  2NN6 H;  1BNZ A;  1VDZ A;  3D4W A;  4ZCK A;  4PV1 C;  3HOV G;  2AQ2 B;  1Q8I A;  4JBW A;  1L0Y B;  1SYF A;  2MFI A;  3FKI B;  1SYG A;  2G5D A;  4QJF A;  1CT1 D;  2WKC A;  1WD0 A;  2ZT9 C;  4RCO A;  3JAM c;  2HD3 A;  1LTI D;  2KEN A;  4LUO A;  4KN7 C;  2ZTE A;  1V43 A;  3EIV A;  1SNP A;  1K8M A;  4JI0 Q;  3K7A H;  4DV7 Q;  1X3E A;  2EY5 A;  4G4K A;  1MSH A;  4PMB A;  2L1B A;  4G7H C;  5M5X H;  2LMC B;  1Y1V B;  2YU9 H;  1CK1 A;  5GQO A;  2B3G A;  1STA A;  5GAG C;  2N49 A;  2F0J A;  3K5M A;  3N6R A;  1KLG D;  4H7B A;  3J80 L;  4DR1 L;  4X65 Q;  5FLX E;  4BBR G;  1T9H A;  3VR6 A;  1GM5 A;  3WDN A;  2SNM A;  3CC7 A;  1EU4 A;  1EQR A;  3DWA A;  3HGB A;  4YIJ A;  3HOZ G;  3GTG B;  1SE3 A;  3HOW G;  3S1N B;  3A8I E;  4N9P A;  1HCZ A;  5CBE E;  4DR2 Q;  5K36 H;  1JOR A;  1X3G A;  2PZT A;  3H3V I;  1LTB D;  5C44 H;  1BO0 A;  2YTV A;  1I50 H;  1PRT F;  4JK1 C;  5KND A;  4IQZ A;  5EKK A;  3D4R A;  1TQO A;  2K75 A;  2K5H A;  3CRL C;  3S15 H;  2SOB A;  2CH4 W;  4A3E H;  1S5C D;  1BDO A;  1STN A;  1VQM A;  3OMG A;  2C35 B;  4DNT B;  1H9M A;  4NMZ A;  4A3J G;  4NB3 A;  3SK6 A;  3KJO A;  1EQQ A;  1K9M C;  1IBM Q;  2JA7 G;  1V8Q A;  1TS3 A;  4RCN A;  3MC0 B;  4PZ6 A;  4LFC L;  3ULL A;  1BXT A;  4G7Z C;  4A3C H;  2QEX A;  1HNW L;  1KIX A;  1TKW B;  1F9S A;  2F0F A;  4C3H H;  1K8A C;  5BN4 A;  4HSV A;  4UP7 A;  3S1R B;  3M9B A;  4POG A;  5HGT A;  3ULJ A;  3UE1 A;  1Q46 A;  5IT9 L;  5CBA E;  2VUM H;  2HCI A;  2F52 A;  3NWS A;  5FJ8 G;  5LMN W;  4C3I G;  1BCP B;  1KAA A;  2MO0 A;  2IWH A;  4L8J A;  4B3T Q;  3M4Y A;  2PW7 A;  4A93 G;  1HPC A;  3A55 A;  2BDN A;  4H0L C;  1QG7 A;  4K8J A;  3CCL A;  2I07 B;  3GTK B;  4C3J H;  3MAQ A;  4TKO B;  5GAD C;  3V96 A;  1KQS A;  1STY A;  3MXP A;  1KC8 C;  4GN3 B;  2FMC A;  2D5D A;  1ET9 A;  3HKZ G;  2Z6K A;  3MXN B;  1B44 D;  2LSS A;  4JBJ A;  2V1C C;  1VCI A;  5NUC A;  2B63 B;  2OT2 A;  2L5T A;  3KLW A;  4Q0F A;  1EL0 A;  4WRD A;  3KFU A;  3KYH C;  2VQE Q;  1LT3 D;  4KJO A;  1WTO A;  1WI5 A;  4PMW A;  1GUO A;  4LF7 Q;  4UP9 A;  2B39 A;  4AYB G;  3C46 A;  3GV6 A;  1GUG A;  2SDF A;  4GN5 A;  4ILW A;  4P2C B;  1IKM A;  1PH6 A;  4DUZ Q;  1F9R A;  3BZC A;  4JI0 L;  3S16 B;  3UDI A;  4DV7 L;  4DNI A;  3VYS A;  1F9Q A;  2VL6 A;  2AHO B;  1QZG A;  2G9H D;  1PZJ D;  2K1B A;  1ENA A;  4L63 B;  3LNN A;  2R7Z G;  1C48 A;  5M3F B;  4HR7 B;  3F2U A;  4PQX A;  1QVF A;  2L55 A;  1EYA A;  2JN4 A;  2VXW A;  3NEM A;  3VR3 A;  3CQZ B;  4X65 L;  4Y7N H;  3KBG A;  2PQE A;  1XNR Q;  3PGZ A;  3EN2 A;  3SHL A;  2K50 A;  1NJI C;  1X3P A;  4TVA B;  3E9I A;  1H9S B;  3KLS X;  4RGT A;  4FYD A;  5JVG 3;  1X3Q A;  5FOB B;  1CKN A;  4LF5 Q;  4DR2 L;  5C3E G;  1TWG B;  2LY7 A;  4FVM A;  4LMQ D;  4YHH Q;  2R61 A;  2HDM A;  4KD4 A;  3G4S A;  1D8L A;  4PZ8 A;  1QZH A;  3FRP B;  3J81 i;  3AEV A;  1HUN A;  1ESF A;  1UEA B;  2EY6 A;  4KI0 A;  1Q82 C;  4IAL A;  2LFN A;  2K6A A;  1VQH A;  1XPO A;  2LXK A;  5CV6 A;  1ET6 A;  3RZD H;  4R4O A;  2A69 D;  2XN9 C;  4DK6 C;  2F1M A;  4IPH A;  2NUC A;  1TWA H;  2H1E A;  1IBM L;  3R8B A;  1W3S A;  3A8J E;  3GTP B;  3CCU A;  1II3 A;  5E4X A;  3M3Y H;  1OXS C;  4MNO A;  2PI2 A;  5E3F A;  2Q8I B;  2VB2 X;  1JWS D;  3P1H A;  4ZQ3 A;  4KTA A;  4FF3 A;  2N8N A;  2L9H A;  3T16 A;  1VQE A;  2HT1 A;  4A3B H;  3RZO B;  4IJH A;  2Q2I A;  1K28 A;  1TWH H;  1X3F A;  1KDA A;  4QF4 A;  1WTP A;  4EQN A;  4PG3 A;  1EEI D;  1PHJ A;  5JJZ A;  2B2W C;  3P20 A;  1HR0 Q;  5JVH 3;  4B3T L;  4QIW E;  4K14 A;  1PYW D;  3ULP A;  4IJL A;  2Z0S A;  2UUB Q;  1IW7 D;  3LX0 A;  1X56 A;  1EU3 A;  5ELF A;  5IGF A;  4GKJ Q;  2K05 A;  1VQ6 A;  2YTY A;  2TSS A;  2WB1 G;  2Y0S G;  3A54 A;  5IP9 H;  3D6W A;  1EWH A;  3TRE A;  3W5O A;  4FXG C;  5C4X H;  2F0P A;  4NXM Q;  1QIL A;  2D2C C;  2Q8R E;  3EVQ A;  4EVO A;  3OTO Q;  2VB3 X;  1Q86 C;  5K36 G;  3I91 A;  4OWT B;  1DOL A;  4XYO A;  3V05 A;  4RWS C;  2VQE L;  4DU9 A;  3GV3 A;  4IPD A;  1SXT A;  3RD4 A;  4LF7 L;  4GNX A;  1XNQ Q;  1U4P A;  3FVQ A;  3LWU A;  4TSS A;  5E7N A;  4DV5 Q;  2PI2 E;  3DUZ A;  1BOS A;  1W2B A;  1Q3L A;  5M5W B;  5AJ3 Q;  1IYV A;  1SDF A;  4DUZ L;  2RCN A;  4WJW A;  2DNC A;  3HP3 A;  2C9O A;  3MEF A;  4POF A;  3J81 L;  2ZTD A;  3HOV H;  3MEH A;  4A3C G;  2ICE C;  1N8R C;  3GTL B;  3QJY A;  2MQH A;  1B4O A;  5KYI A;  2A6E D;  4C3H G;  4ZKC B;  1O80 A;  3AQQ A;  3VA7 A;  1U5K A;  1F2Z A;  2A68 D;  2XRQ D;  2AWN A;  2B8G A;  5GAH C;  1SRO A;  1H9R A;  3C3L A;  4I7Z C;  4ZRZ A;  2QW7 A;  2E2J H;  2VUM G;  3TP6 A;  4XQN A;  1YJN A;  5C44 B;  1XNR L;  1VS0 A;  4ALP A;  2PZW A;  4A76 A;  2F0N A;  2VY3 A;  3CCV A;  1WVL A;  4XDX A;  1KLU D;  4C3J G;  4FF2 A;  2JA6 G;  4LF5 L;  5IGD A;  3I4O A;  3KF8 B;  3NHH A;  2VNU D;  1HRJ A;  1PTO C;  4LUV A;  5A35 A;  4BY1 B;  3JAM i;  1HHV A;  1IL8 A;  1TXY A;  5I2X A;  1TS5 A;  1SMY C;  2JP1 A;  4JI3 Q;  4R9W A;  3TZD A;  3HS0 C;  3H6M A;  1PH9 A;  3O13 A;  2E2I H;  1OTC A;  3OW2 A;  2R92 B;  5EJW A;  3T4A C;  4CKB A;  2OQ0 A;  3NE5 B;  1DOM A;  1EIG A;  1WTH A;  2K01 A;  1HUM A;  4A3K B;  3TRZ A;  3OWE B;  1FNV A;  3DEP A;  3HFZ B;  3V2T A;  2JA9 A;  4FO2 A;  2EZV A;  5C6A A;  3HOZ H;  5FLX c;  2A6H C;  1VQK A;  4IOC A;  1R4P B;  1YEZ A;  2RSN A;  1AN8 A;  1UWV A;  1B3A A;  2O2L D;  4MHE A;  5EBC A;  1LTG D;  3G48 A;  2WIN B;  3H3V C;  3G71 A;  3I4N B;  1CI3 M;  4DR3 Q;  1HQR D;  3GO5 A;  1XMO Q;  1SJH D;  1S72 A;  2B2Y A;  1Y8P B;  1L0X B;  2FHT A;  3P7J A;  1NY4 A;  3U4V A;  4ZYS A;  3J7Z C;  2A1A A;  4OX9 Q;  4YCV A;  3MZ5 A;  2KHS A;  4A3I H;  2E75 C;  3PV0 A;  3R3O A;  5LMU Q;  5C3X A;  1HR0 L;  3DM3 A;  4JV5 Q;  4OO1 H;  4A3D H;  1KDC A;  1QNU A;  1EIF A;  1AFP A;  3K59 A;  2UUB L;  2J4X A;  3X3N A;  2BA1 A;  4GKJ L;  3NEN A;  1XJV A;  4LF4 Q;  4DFA A;  4KN4 C;  5E4W C;  4A3G B;  2EY2 A;  4LFA Q;  3TN2 A;  1FL0 A;  3I7F A;  3GTJ H;  4A75 A;  2CFM A;  4BA2 I;  2SNS A;  2X69 A;  4DAM A;  4QIW B;  4A4I A;  2EYJ A;  1CKN B;  1FR3 A;  5FK9 C;  4NXM L;  3OTO L;  4A3F H;  1S3O A;  1F9P A;  1Y8N B;  4DAP A;  3TME A;  4F8M A;  1STB A;  1E24 A;  2MGS A;  4O1N A;  4O2D A;  4DKA C;  4C1N K;  1HA6 A;  1D5M C;  5COR A;  1EIY B;  2ZXR A;  2JA5 G;  1XNQ L;  2NB0 A;  3K5L A;  4DV5 L;  4FF1 A;  4S3S A;  1JOK A;  1TWF B;  4XQQ A;  4DV4 Q;  4RGM A;  3AFQ A;  1SMX A;  5JJL A;  2B29 A;  3NEL A;  3QOJ A;  2UUC Q;  4NW2 A;  2Z8L A;  3JAM L;  2A69 C;  5D3D A;  1LUZ A;  4OXP A;  2RSO A;  5AJ3 L;  1C0A A;  1NTG A;  5JJI A;  3C1F A;  2EQS A;  3MXN A;  3HOY H;  1C9O A;  3S14 H;  2WAQ E;  1NCV A;  2OTJ A;  2NVQ B;  1GUS A;  1PDQ A;  3QR8 A;  1O7L A;  1R9T H;  4A3B G;  1K0R A;  2OWO A;  1ILQ A;  1D7Q A;  3H94 A;  4KKS A;  1VQ5 A;  1YNN D;  1XTC D;  4M1U B;  3K80 C;  4MN3 A;  4F7X A;  2AUJ D;  1KNA A;  2KED A;  3HOU G;  1PH5 A;  2ZXP A;  5EPL A;  4BY7 B;  1B3Q A;  1XPR A;  3X3M A;  3I4M B;  3TS2 A;  1PVO A;  1Z7T A;  3GTO B;  2P5Z X;  1JCK B;  1BVS A;  3K81 C;  1EFI D;  4YWM A;  1EY6 A;  4JPB W;  5IE8 A;  3K58 A;  4JI4 Q;  3BJU A;  3S1Q H;  4JI3 L;  1CQV A;  5IP9 G;  1F2L A;  4KY5 A;  4LAA A;  3GTM H;  1K3R A;  2ZJQ A;  1SLJ A;  4JC0 A;  1LLR D;  3E6Z X;  4R8N A;  1RF2 D;  3M3Y B;  1Y1W B;  1AE2 A;  3U50 C;  2E2D C;  1PH3 A;  1TWC H;  3U58 A;  1OXT A;  2HDL A;  1HNX Q;  5GAE C;  1SNQ A;  1DCZ A;  1KRT A;  5C3E H;  1O78 A;  2HUG A;  4QY7 A;  1DJR D;  4DR3 L;  1PH8 A;  2E74 C;  4G7O C;  1M90 C;  4HMJ A;  3PSI A;  1XMO L;  1OO9 B;  3K8A A;  3H0G G;  4CHT B;  3MHB A;  4HMI A;  1SN8 A;  2GVB A;  1PTO B;  3NSW A;  3Q22 A;  2QEJ C;  3E3X A;  1HTL D;  1LO5 D;  4DV0 Q;  1I6H H;  4RG1 A;  3SGI A;  4OX9 L;  5LHY 1;  5CC4 A;  5I4D A;  4HN7 A;  4ME3 A;  3BS1 A;  5IWA Q;  4FXD A;  5LMU L;  3D8G A;  3PO2 H;  4J8Q A;  1QVG A;  5JOB A;  3VDY A;  3BDC A;  4JV5 L;  3GTQ H;  1A0I A;  4LF8 Q;  1MBY A;  3STB D;  1I3Q B;  3CW2 C;  4EQP A;  1JE5 A;  4LF4 L;  1TR5 A;  3G6J B;  1B2T A;  3PMF A;  1Q1B A;  2F0W A;  2JK8 A;  4LFA L;  3HKZ E;  4DR4 Q;  3QOL A;  4R1J A;  4RKB A;  1BF4 A;  2OCE A;  3T1Y L;  3RN2 A;  3RLO A;  2JA8 B;  1B50 A;  1FNU A;  3MXU A;  1PXU A;  1YNJ D;  1JIC A;  5J1Z A;  1E1O A;  4YY3 Q;  2EIF A;  4AQY Q;  1A15 A;  4C2M B;  3F1Z A;  3AU7 A;  3TP8 A;  3C1E A;  3W2D A;  4BBS B;  4N9T A;  3LWE A;  2RBM A;  3AB9 A;  1JOO A;  1PYB A;  1Z9F A;  3HRZ C;  1KNE A;  2JYO A;  2ZXO A;  5H1S E;  1EZ6 A;  1SRU A;  4DV4 L;  2E2H H;  4G57 A;  4CDD C;  2J0T D;  2UUC L;  1WD1 A;  5C0X J;  1BBW A;  1EY7 A;  2IT1 A;  1E7Z A;  5CGK A;  2DGY A;  3QB3 A;  2F03 A;  1BCP F;  4IUR A;  4ABN A;  3DLL A;  1PA6 A;  1LTA D;  4DV2 Q;  4IFD J;  4MTN A;  3J7A V;  3KF6 A;  5DM7 3;  2PMZ E;  3L3O C;  1D2B A;  2CHB D;  2Q8T A;  2IHF A;  1XYI A;  5M9O A;  2WAQ B;  5IOD A;  1K83 B;  2WAC A;  3KOJ A;  2R6G A;  2JEB I;  4A3I G;  4EQ5 A;  3F8T A;  4ID6 A;  4DUY Q;  2EYH A;  4CJ1 B;  2NYZ D;  3DM1 A;  1UAP A;  1LTS D;  1X32 A;  3NPP A;  2LKV A;  4OO1 G;  2F0U A;  4A3D G;  4RHR A;  1YHA A;  3NBH B;  3NQT A;  2B2T A;  1LT4 D;  3TDQ A;  4BBR B;  3U4Z A;  4DF7 A;  5CV4 A;  2UXD Q;  3S2H H;  2KOL A;  3WWV A;  1YHB A;  4A3M G;  1C8C A;  5C5L A;  4JI4 L;  4X66 Q;  4KK7 A;  3IFD A;  3OSO A;  5JPM C;  5M3M H;  4HJA A;  3SEB A;  1A63 A;  3HEJ A;  3HOW B;  3RNU A;  2Z4I A;  3BZK A;  1CTM A;  5C5M A;  1G29 1;  4A3F G;  2ASB A;  2HCC A;  4HCS A;  4LK1 C;  2YTX A;  3Q23 A;  1ENC A;  5IYC G;  3HOX H;  2L15 A;  1SYB A;  3I90 A;  3IRB A;  2JA6 H;  1HNX L;  3DWQ A;  1GD7 A;  3KF8 A;  4KHV A;  1E3P A;  2BE5 C;  2O5J C;  4LF9 Q;  4I65 A;  4A3J B;  4KY6 A;  3E0E A;  3M85 A;  5C4J B;  1EFW A;  2NVY B;  2JA7 B;  4DGZ A;  2B2T C;  4DV0 L;  4OIJ A;  2XVS A;  4V0B A;  3BVZ A;  2VW9 A;  4EGV A;  3HOY G;  1JJC B;  4KKU A;  5C0X G;  2RDG A;  5IWA L;  1VQA A;  2SEB D;  5KEE A;  2RDF A;  2B8F A;  2L4N A;  3E9H A;  2RVL A;  1L1O C;  4LF8 L;  1B8A A;  3R2T A;  2L0C A;  4EX5 A;  2EJM A;  1FGB D;  1YNN C;  4C3I B;  4JBK A;  2Y0S E;  3S2D H;  1LV9 A;  2LXJ A;  2PCF B;  3FEW X;  2F0S A;  1RTO A;  3PUZ A;  4A93 B;  4DR4 L;  3OMC A;  2F4V Q;  2PYK A;  1JJ2 A;  4RHS A;  4WJ4 A;  5JPN C;  1W6J A;  3RUZ A;  3CCM A;  2AKW B;  5BN5 A;  2PQA A;  4MZ9 A;  1VQ9 A;  1U0L A;  4OON A;  1A6X A;  1G2S A;  2F0T A;  5EPJ A;  4HJ9 A;  2UU9 Q;  4XT3 B;  4QMG A;  1DYQ A;  4YY3 L;  4OO1 I;  3GQB A;  4K6L A;  4AQY L;  2JJQ A;  3HKZ B;  5DAU A;  3TP7 A;  5J3B A;  4GOP C;  2UXC Q;  4R4Q A;  4C56 C;  1TT2 A;  2CQA A;  1V1Q A;  1TY0 A;  4CDC C;  2I0Q A;  3Q8D A;  1VQO A;  2IL8 A;  3I8Z A;  2IX1 A;  2NVT H;  1CHP D;  4K5X A;  1QUQ B;  4X6A H;  1HXY D;  1QCB D;  1ZYR C;  1FGU A;  3A5Z B;  4XYQ A;  4JOI C;  5LL6 S;  2QA4 A;  1JR0 D;  4DV3 Q;  2F3I A;  4DV2 L;  2Z1C A;  3ND9 A;  1TU2 B;  4GLX A;  2B2W A;  3Q24 A;  3RMH A;  2NTS A;  3PIP A;  1I94 Q;  1CM9 A;  1ENF A;  4OWX B;  2JA5 H;  2PNR C;  1PH7 A;  1IYJ B;  5EQ0 A;  3MVV A;  5EBD A;  2IY5 B;  1ML0 D;  3CRK C;  3CCE A;  1XX8 A;  2ALY B;  2WFW A;  4IUQ A;  2R93 H;  2NVX H;  1ZXT A;  4R4I A;  1MKH A;  2I5M X;  1Q90 A;  3SVM A;  2R7Z B;  4DUY L;  3VR2 A;  1N36 Q;  1A2T A;  1GKH A;  2PMZ B;  5IT9 c;  1YJ9 A;  3PO2 G;  2K7V A;  3VYR A;  5C0X I;  4ZAI A;  3HZX A;  4IPC A;  4V19 0;  3S1Q B;  3CMA A;  5D65 A;  3AFP A;  1JE4 A;  1NMF A;  4A3L H;  3BU2 A;  5EPK A;  2B2U A;  2HQE A;  5DEH A;  1LAC A;  2UXD L;  3A5U A;  4R4C A;  2K03 A;  4X66 L;  1SND A;  1EY5 A;  4JI7 Q;  4HJ7 A;  3I73 A;  3LGJ A;  4JI8 Q;  2AQ1 B;  1EEF D;  3CXC A;  3K5O A;  4HID A;  3S17 H;  1CKM A;  1MSG A;  4PMC A;  4DV6 Q;  4UY8 C;  3HOU H;  1YZ6 A;  4QL5 A;  2CW0 D;  1MI2 A;  3BDL A;  1ICW A;  1RTN A;  1EYG A;  4TQU S;  1F2Y A;  1WYD A;  3D3R A;  1Q81 C;  4KKT A;  4Q5V A;  4M8A A;  3T1H Q;  5J22 A;  5FLX L;  1BCP D;  1AZP A;  3R2I A;  2F0H A;  4YCU A;  4UHV A;  3R93 A;  3SR1 A;  4LF9 L;  2IX3 A;  4ULL A;  1PRT D;  1E2V A;  3ERS X;  3MFY A;  1JB7 A;  2CH4 A;  4CKC A;  4XXE A;  2B2U C;  2Q2U A;  2DN8 A;  4ODG A;  1ASY A;  4NXN Q;  1FYC A;  2EYP A;  3EBE A;  3CC2 A;  5EGT A;  1I4H A;  1K8O A;  1MIU A;  1NAP A;  2LS0 1;  2OXP A;  4WJ3 M;  3EFX D;  3JC6 6;  4IUP A;  3CF5 A;  3KF6 B;  5CV8 A;  5TSS A;  2RQX A;  4YWL A;  1KAW A;  3FKI H;  2K33 A;  1WCM G;  3S24 A;  1RDP D;  3K7A B;  5KNB A;  1VQ4 A;  1VQC A;  2X6G A;  1JMC A;  4JW0 A;  3RLF A;  2R7D A;  5C4Z A;  3A8K E;  1K0S A;  1O7I A;  3H0G H;  5M5X B;  2YU9 B;  5AFW A;  2R3Z A;  5I6Y A;  2K28 A;  2QCP X;  1B9M A;  1TII D;  3I56 A;  1LM0 A;  2F4V L;  3NTI A;  2EDG A;  1U9R A;  3PIP 3;  1SBB B;  2VS1 A;  1JB3 A;  4BA1 I;  4DXG A;  2K32 A;  3MTS A;  1Y1V H;  2Y0S B;  2UU9 L;  3PO3 G;  4K2L A;  5L37 A;  4O0A A;  4B3R Q;  3HG9 A;  3F2C A;  4L5S A;  3IL8 A;  1UE7 A;  4B9X A;  5M3M G;  5JEA H;  1WTR A;  2K04 A;  2UXC L;  4IOA A;  4OWW B;  4KHP Q;  2D0O A;  1G2T A;  2BCO A;  4JCV E;  4KV6 A;  1L1O B;  1AP0 A;  2KEE A;  2EXD A;  4GS3 A;  5IOC A;  2F3V A;  2R92 G;  1YJW A;  2EJF C;  2NZ1 D;  1MJE A;  1I50 B;  3UDF A;  2QKI C;  1ASZ A;  1V1O A;  2JSO A;  1LT5 D;  4HCE A;  4P74 A;  3HOX G;  3S15 B;  3S1N H;  2V4D A;  1VQD A;  2BH2 A;  3S1M H;  4A3E B;  1DM0 B;  3OHX C;  3PUX A;  3NBI A;  1GHJ A;  4YHH L;  4DV3 L;  4C1N I;  2MUY A;  3FDT A;  1I4G A;  3KLR A;  5C3W A;  3K6O A;  2Z6B A;  1I94 L;  3A7A B;  1VQF A;  1NUC A;  2F0E A;  1N33 Q;  2KUM A;  3SDZ A;  4GOP B;  1I4P A;  4OIK A;  3L2P A;  4C3H B;  3M4P A;  3DEO A;  1N36 L;  4CDF C;  1SSO A;  3CPW A;  4JI5 Q;  2Z4H A;  3Q0A A;  4IUN A;  1IHZ A;  4LUZ A;  2NZO A;  3QG1 A;  2VUM B;  2KCT A;  1B53 A;  4UPA A;  1AZQ A;  1D5X C;  1O7Z A;  3W1G A;  5IYD G;  3S1R H;  2A74 C;  4JI7 L;  4DR7 Q;  2XIW A;  5DLQ E;  2PQA B;  2JQO A;  4C3J B;  1DD2 A;  2WV6 D;  1UE6 A;  5ELD A;  4DV6 L;  1VQ7 A;  2RCF A;  2IHE A;  4KY7 A;  4MTK A;  1K8G A;  1AEX A;  1V9P A;  2M9V A;  4UP8 A;  5D3I B;  2DUD A;  1STG A;  4HIO A;  1XMQ Q;  2F0Q A;  3GTK H;  1GXD C;  3NBH A;  3G6E A;  2CCZ A;  3ND8 A;  3T1H L;  1G91 A;  5M5Y H;  1HZA A;  4A3M H;  2QGQ A;  4ME5 A;  1KAB A;  5FO8 B;  2OEO A;  3A0J A;  3UI2 A;  5IYB G;  3CAM A;  1J8I A;  1SYC A;  2DNE A;  2I46 A;  1OXX K;  5FO9 B;  3DHQ A;  3SK5 A;  4NXN L;  1A8V A;  1J9O A;  2B63 H;  4J1M A;  2D9U A;  3S2D B;  1CKO A;  2F0K A;  4ZKB B;  5IYC H;  1KDB A;  4OHJ A;  3OPO A;  3ZJY C;  1SE2 A;  2YV5 A;  3NTH A;  5FO7 B;  1I4Q A;  4DK3 C;  3BYT B;  1J5E Q;  1JWM D;  1SEB D;  5IT9 E;  2F0D A;  1U4L A;  2R93 G;  3CCQ A;  2IJ0 A;  4NP5 A;  4O42 A;  2E8G A;  4OL7 A;  5LL6 X;  5LMN Q;  1D5Z C;  5ELE A;  2AQ3 B;  3CHB D;  4OGQ C;  1ZKO A;  3TP5 A;  5C0X H;  3S16 H;  3CPF A;  1IBL Q;  4KJN A;  2O4X A;  3I4M G;  4A3L G;  1CHQ D;  3SK4 A;  4Y7N B;  4LF6 Q;  4JI1 Q;  1HJP A;  4J15 A;  1GUT A;  1HZ9 A;  2K5N A;  5JEA J;  4B3R L;  4IFD H;  2B2V A;  3PUV A;  4X3U A;  4QUF A;  4K5W A;  3I55 A;  5M3F H;  1HZC A;  3S9W A;  2NVT B;  3D0F A;  3B6Y A;  5BN3 A;  4KHP L;  1HR0 W;  2KJX A;  2F0V A;  3CQZ H;  2QDB A;  1PTO F;  2FMM A;  2F0I A;  5IGB A;  5G3L F;  4QQB X;  4AIM A;  2RKS A;  1YNX A;  2DJF C;  1QOH A;  3WOE A;  2JA5 B;  2QDL A;  4KD3 A;  1IW7 C;  2MO1 A;  3NP8 A;  4FNF A;  4N8F A;  3BVM A;  2FXQ A;  3PQI A;  3CCS A;  1TWG H;  2ICI A;  3FPU B;  1PRT C;  3RZD B;  3L9A X;  5D14 A;  2OF1 A;  2EVB A;  5BR8 Q;  1TWA B;  5ISR A;  1N33 L;  5DNF A;  4E6I A;  1BR9 A;  1EY4 A;  2B2V C;  4IUT A;  4P72 A;  1TY2 A;  2Q2T A;  1Q7Y C;  1EOT A;  4CBV A;  4A3B B;  2K4K A;  1DXM A;  1QUQ A;  1TWH B;  1IXR A;  4JI6 Q;  3FKI G;  2BH8 A;  3A74 A;  2KA7 A;  3QO2 A;  3WOF A;  5ELB A;  3K7U C;  4CGY B;  4NDX A;  1X54 A;  4Z9C B;  1O7Y A;  1WTV A;  1B70 B;  3J7A 5;  1H9J A;  4DR7 L;  1XWE A;  2RF4 A;  5HY6 A;  3BG3 A;  2J7Z A;  4CKE A;  4I7A A;  2JA8 G;  3F2D A;  2XTI A;  2A73 B;  4L5T A;  3BDO A;  3MWY W;  2K5D A;  1RIP A;  2A6E C;  3F2B A;  1Y1V G;  4JI2 Q;  1LTL A;  2A68 C;  1UUP A;  1GHK A;  2CVR A;  4IUV A;  1XMQ L;  5C4X B;  4GLA C;  2EYL A;  4DAY B;  5JEA G;  4LJZ C;  3OIQ A;  4QCL A;  1DGS A;  4RAU C;  3UDX A;  4IN3 A;  1GO3 E;  4HTH A;  3I2Z A;  1VQI A;  5FLM G;  5KIX A;  4GZY C;  2K5V A;  2R7F A;  4F87 A;  2F0O A;  1AE3 A;  3U9O A;  3NK9 A;  1CZG A;  1BBU A;  2XNA C;  5EKI A;  3H0G B;  2PZU A;  1VQB A;  1D6E C;  3I72 A;  1J6Q A;  1BQQ T;  4DK0 A;  4MIU A;  1YHQ A;  3QIA A;  4LWC A;  5C4H A;  4AYB E;  2N88 A;  3KDF B;  4RA8 A;  1IL2 A;  2CQO A;  3TEH B;  1J5E L;  2IPK D;  4F88 A;  3HOV B;  2H4O A;  5A2Q E;  2WAQ G;  1ZEQ X;  3OYY A;  3FMC A;  3ZYY X;  2N3S A;  3T51 B;  5M5W H;  2FJ2 A;  5LMN L;  1G8Z D;  3TS0 A;  2MPM A;  1M4V A;  2TMP A;  2DY8 A;  1IBL L;  1EY8 A;  3C2P A;  2E2J B;  2XGT A;  2VZA A;  1EIH A;  1PZI D;  4LF6 L;  3GTL H;  4JYA Q;  4JI1 L;  1ICF B;  4APV A;  1WCM H;  1VQJ A;  4KHZ A;  3IKJ A;  2A19 A;  3NXW A;  1G6Z A;  4QB4 A;  1HTP A;  1G6P A;  2PO4 A;  1AW7 A;  1WOC A;  4DK1 A;  1LTR D;  1S4Z A;  3S1M B;  5CR3 A;  1JQY D;  2CKZ B;  3VYU A;  3IAY A;  4RGO S;  5COY A;  1AH9 A;  3P75 A;  3QWN A;  2GVA A;  1JWU D;  5GRO A;  4IZ8 A;  1FD7 D;  5CV7 A;  2JEA I;  3BZD B;  4TRD A;  1YI2 A;  1MJC A;  3T56 B;  1X9N A;  2E2I B;  1K73 C;  3SK8 A;  4X3S A;  3PO3 H;  5J39 A;  2HQL A;  1EQT A;  4BY1 H;  3GD7 A;  1GUN A;  5I6W A;  1DZ1 A;  3T13 A;  5HGQ A;  3HOZ B;  1N9W A;  3DXJ C;  1RJT A;  1MD2 D;  1VMC A;  5BR8 L;  2ENB A;  1VF5 C;  4WFN 3;  2A5H A;  1L0W A;  1IYU A;  1L1O A;  2R92 H;  3J81 E;  4A3K H;  2HIV A;  1PV4 A;  1WTQ A;  2B63 G;  4KLK A;  2ATW A;  1QE6 A;  1WTX A;  4X3T A;  2PW5 A;  2EYF A;  2FFK B;  4JI6 L;  1PH1 A;  2CWP A;  1SE8 A;  3RN5 A;  2KEC A;  5IY0 A;  3I4N H;  4A3I B;  1SNO A;  4XIG S;  5IP7 H;  1FNW A;  2O5I C;  4X62 Q;  4A3D B;  3BVG A;  2K52 A;  4XT1 B;  1PRT B;  1RD9 D;  4GOP A;  2EYO A;  2ID0 A;  4K0K Q;  5M5Y B;  1GVP A;  4X3K A;  1RCV D;  1PTO D;  4A3M B;  5ELO A;  1QVC A;  1V1P A;  4FDB A;  5G3L D;  1SFO H;  1NNX A;  4J6H A;  3GTJ B;  4NKL A;  4JI2 L;  1SMY D;  4IFD G;  2K14 A;  3M4O H;  5M3F G;  1HNZ Q;  4GN4 B;  2RHS B;  2BA0 A;  2F4I A;  1D1I A;  2L12 A;  1T5X D;  1VQG A;  2WB1 E;  2CWA A;  1A62 A;  4A3F B;  2FIN B;  5I9O A;  2K5Q A;  4JOI A;  4A3G H;  5IYD H;  3TBI B;  4ZUJ A;  1SNC A;  4KMU C;  2KHJ A;  2MHV A;  2A6H D;  1F77 A;  4RGN A;  1E1T A;  3J80 c;  4H02 A;  1C7Y A;  1EYD A;  3OIP A;  5EKL A;  1OXV A;  2F0L A;  3ERQ A;  4QUC A;  4PZ7 A;  1CQF A;  3HKS A;  2NTT A;  1SAP A;  3RR5 A;  1ESR A;  3N52 A;  1Y8O B;  1UE5 A;  1X65 A;  2KCC A;  3HOY B;  3S14 B;  4GKK Q;  3J7Y W;  1TWF H;  3CKI B;  1MHW C;  2KBN A;  1STE A;  1B9N A;  1OXU A;  3CC4 A;  1U4R A;  5IYB H;  4DV1 Q;  3GP7 A;  3ER0 A;  2A8V A;  2Z6K C;  1P8L A;  1R9T B;  2ZM6 Q;  3ITP A;  3K0Y A;  1P16 A;  1S5E D;  4AYB B;  3H09 A;  4DN4 M;  4RFB A;  1CSQ A;  4JG2 A;  1SJE D;  1VQ8 A;  2NVQ H;  1DOK A;  4JYA L;  1PFN A;  3NUC A;  1ONL A;  5CMD A;  3KBX A;  1QB5 D;  4L6T B;  1HQM C;  2ZJR A;  3I3C A;  1E2W A;  4BXX H;  2F3W A;  3AYH B;  4HJ8 A;  1L2F A;  4DR5 Q;  4P71 A;  4P73 A;  3TQY A;  4K6D A;  1VQN A;  4BY7 H;  4K5V A;  1IBK Q;  1W6K A;  3URY A;  3KJP A;  2JE6 I;  3STB C;  1YIJ A;  3GTM B;  3I4M H;  3EJI A;  1HZB A;  2EE1 A;  1JOQ A;  2H5X A;  2NN6 G;  4HJ5 A;  2NBF A;  1PZK D;  2KHI A;  1SYE A;  3E5S A;  3GTO H;  4H13 C;  4IFD I;  3ONA B;  1CZW A;  3VR4 A;  3M7N A;  3K5N A;  2F0G A;  1EQV A;  3CU7 A;  1GJX A;  1TWC B;  2M2L A;  1BUV T;  1QWY A;  5EAY A;  3JAM E;  4EQO A;  3D6C A;  2RHQ B;  3PUY A;  1S5F D;  1RKN A;  2MNA A;  5C3E B;  3OW7 A;  4K8I A;  1YNJ C;  4DPG A;  1I4X A;  4UAI A;  1Y1W H;  2NWG A;  1U4M A;  3D31 A;  4H44 C;  5I9P A;  4CJ0 B;  2Z9H A;  3E0J A;  1KTK A;  1CA6 A;  2AUK A;  5HUR A;  1I6H B;  4B08 A;  1I6V C;  5A2Q L;  3L7Z C;  1VMP A;  2GN5 A;  3PO2 B;  3CCR A;  4OEL B;  1T5E A;  1PTO H;  1PFM A;  3NWT A;  4X62 L;  3CP0 A;  3Q6S A;  3GTQ B;  3A56 A;  1ILP A;  1CFM A;  1I4R A;  1PYS B;  2GA4 B;  1A3T A;  4K0K L;  4YCW A;  3MFG A;  1QJO A;  5KRU A;  3OOC A;  4HAE A;  4L5R C;  3I70 A;  3NQI A;  4RKL A;  1HNZ L;  1E2Z A;  4RH6 A;  1I3Q H;  2UXB Q;  1CUK A;  1WJJ A;  4BS9 A;  1Q8K A;  5IIF A;  2EPB A;  2I5H A;  5DM6 3;  4DNR B;  1KHI A;  3EQL C;  3H3V H;  5C44 G;  2L11 A;  4WOR A;  3PUW A;  3VR5 A;  1UE1 A;  1S5D D;  1Z6H A;  1LAB A;  2JA8 H;  1HFN A;  4B9W A;  4DXF A;  2MP1 A;  3DWP A;  2WB1 B;  1SR3 A;  1NE3 A;  2HHH Q;  2EOT A;  2E2H B;  2D0P A;  1SYD A;  4K2K A;  4A3E G;  4BY1 G;  4C2M H;  1EY0 A;  3EA6 A;  4ZK9 B;  4BBS H;  2NN6 I;  1KD1 C;  4DAY A;  4LFB Q;  4GKK L;  3FP9 A;  1M1K C;  2G9D A;  3TSS A;  1Q12 A;  3J81 j;  4X64 Q;  2E5L Q;  2IX0 A;  2KQ3 A;  1JC7 A;  5JAV A;  4A3K G;  1BKB A;  5CV5 A;  5FLM H;  5CYU A;  5K5P A;  2ZJP A;  4DV1 L;  3J7A F;  3MXG A;  1WCM B;  4B3S Q;  4FF4 A;  3W1B A;  2ZM6 L;  3GTG H;  5IGC A;  1A3U A;  2EJG C;  1EWC A;  1FJG Q;  4DR6 Q; 
#chains in the Genus database with same CATH homology
 2KCN A;  4ZLT F;  5IGE A;  2X6L A;  1STH A;  2C5C A;  4FXK C;  2BDO A;  3PO3 B;  3KUP A;  2YYZ A;  3S2H B;  1V1P B;  4DA2 A;  2WP8 J;  1Q1E A;  3VYT A;  1B1Z A;  5M3M B;  3U9S A;  4UDU C;  2QIL A;  5CV9 A;  3FPP A;  3J80 E;  1EY9 A;  1GUW A;  1UNS A;  1Z47 A;  1A3V A;  3HOX B;  1MGS A;  2JA6 B;  1H9K A;  5KGU A;  1C4Q A;  2EXZ A;  1RHP A;  3BYY B;  1DON A;  5IGG A;  1F2M A;  1E0B A;  2AWO A;  5F2D A;  3KLS A;  1A2U A;  2DY7 A;  3TZU A;  3SE0 A;  1SFO B;  1SNM A;  3M4O B;  1HFG A;  4HSP A;  4CJ2 C;  2RDH A;  1LT6 D;  1CA5 A;  3I4L A;  2E76 C;  2EY1 A;  1SE4 A;  3G7L A;  4XQJ A;  1XXG A;  2B2Y C;  4BWG B;  3ERO A;  3AMU A;  1NR4 A;  1IKL A;  3A7L A;  4PNY A;  2BE5 D;  4DAV A;  2RA4 A;  1S5B D;  1WTW A;  5FKA C;  3H91 A;  2M00 A;  3VA5 A;  1D1K A;  1HA5 A;  2BOS A;  3MA2 B;  2XSC A;  2KVM A;  3KK7 A;  1ROD A;  2XWJ B;  3D4D A;  3NTK A;  2CW0 C;  2F0M A;  2EYM A;  5T1I A;  5KYL A;  1LTT D;  3K57 A;  3PIO 3;  2N55 A;  1BCP C;  3IFT A;  3DMU A;  1M8A A;  5ELC A;  1EYC A;  2R93 B;  2NVX B;  2XWB B;  4U67 3;  3SXH A;  1PFB A;  4FP5 D;  1Y69 U;  1TS2 A;  3OWF A;  1NSN S;  2MJ8 A;  5E1F A;  2WII B;  2QF7 A;  4IUU A;  2D62 A;  2WKD A;  1R4Q B;  3W3A A;  2IW3 A;  3S17 B;  4U68 A;  2XRS D;  4R8I A;  5KNC A;  2PPB C;  3HOU B;  1NR2 A;  1TS4 A;  1QNK A;  1TVX A;  2JXM B;  1BBX C;  4ZUI A;  1H9S A;  1GOZ A;  4HED A;  1VF7 A;  1ZYR D;  3T53 B;  1EZ8 A;  5T1G A;  2K5W A;  1PLF A;  4XTC S;  5I2Y A;  3M7G A;  1PMR A;  2NN6 H;  1BNZ A;  1VDZ A;  3D4W A;  4PV1 C;  2AQ2 B;  1Q8I A;  4JBW A;  1L0Y B;  1SYF A;  3FKI B;  1SYG A;  1CT1 D;  2WKC A;  1WD0 A;  2ZT9 C;  4RCO A;  1LTI D;  4KN7 C;  1V43 A;  1SNP A;  1K8M A;  2EY5 A;  4G4K A;  1MSH A;  4PMB A;  2L1B A;  4G7H C;  2LMC B;  1Y1V B;  1CK1 A;  1STA A;  2F0J A;  3K5M A;  3N6R A;  1KLG D;  4H7B A;  3J80 L;  5FLX E;  3VR6 A;  3WDN A;  2SNM A;  1EU4 A;  3DWA A;  3HGB A;  4YIJ A;  3GTG B;  1SE3 A;  3S1N B;  3A8I E;  4N9P A;  1HCZ A;  5CBE E;  1JOR A;  5K36 H;  2PZT A;  1LTB D;  1BO0 A;  1PRT F;  4JK1 C;  5KND A;  4IQZ A;  5EKK A;  3D4R A;  1TQO A;  3CRL C;  2SOB A;  1S5C D;  1BDO A;  1STN A;  3OMG A;  4DNT B;  1H9M A;  4NMZ A;  3SK6 A;  1V8Q A;  1TS3 A;  4RCN A;  3MC0 B;  1BXT A;  4G7Z C;  1TKW B;  1F9S A;  2F0F A;  5BN4 A;  4HSV A;  3S1R B;  5HGT A;  5IT9 L;  5CBA E;  2HCI A;  3NWS A;  4C3I G;  1BCP B;  1KAA A;  2IWH A;  4L8J A;  3M4Y A;  2PW7 A;  1HPC A;  3A55 A;  2BDN A;  4H0L C;  1QG7 A;  4K8J A;  2I07 B;  3GTK B;  3MAQ A;  4TKO B;  3V96 A;  1STY A;  3MXP A;  2FMC A;  2D5D A;  1ET9 A;  1B44 D;  1VCI A;  5NUC A;  2B63 B;  2OT2 A;  2L5T A;  4Q0F A;  1EL0 A;  4WRD A;  1LT3 D;  4KJO A;  1WTO A;  4PMW A;  1GUO A;  2B39 A;  3C46 A;  3GV6 A;  1GUG A;  2SDF A;  4ILW A;  4P2C B;  1IKM A;  1F9R A;  3S16 B;  3VYS A;  1F9Q A;  2G9H D;  1PZJ D;  2K1B A;  1ENA A;  4L63 B;  3LNN A;  1C48 A;  5M3F B;  4HR7 B;  3F2U A;  4PQX A;  2L55 A;  1EYA A;  2VXW A;  3VR3 A;  3CQZ B;  3KBG A;  2PQE A;  3SHL A;  1X3P A;  1H9S B;  3KLS X;  4RGT A;  4FYD A;  5JVG 3;  1X3Q A;  5FOB B;  1TWG B;  2LY7 A;  4FVM A;  4LMQ D;  2R61 A;  2HDM A;  4KD4 A;  3FRP B;  1HUN A;  1ESF A;  1UEA B;  2EY6 A;  4KI0 A;  4IAL A;  2LFN A;  2K6A A;  5CV6 A;  1ET6 A;  2A69 D;  2XN9 C;  2F1M A;  2NUC A;  2H1E A;  3R8B A;  3A8J E;  3GTP B;  1II3 A;  5E4X A;  1OXS C;  5E3F A;  2Q8I B;  2VB2 X;  1JWS D;  3P1H A;  4ZQ3 A;  4KTA A;  4FF3 A;  2L9H A;  3T16 A;  3RZO B;  1KDA A;  4QF4 A;  1WTP A;  4EQN A;  1EEI D;  5JJZ A;  2B2W C;  3P20 A;  5JVH 3;  4K14 A;  1PYW D;  1IW7 D;  3LX0 A;  1EU3 A;  5ELF A;  5IGF A;  2K05 A;  2TSS A;  3A54 A;  3D6W A;  1EWH A;  4FXG C;  2F0P A;  1QIL A;  2D2C C;  2Q8R E;  3EVQ A;  4EVO A;  2VB3 X;  5K36 G;  3I91 A;  1DOL A;  4XYO A;  3V05 A;  4RWS C;  4DU9 A;  3GV3 A;  1SXT A;  3RD4 A;  1U4P A;  3FVQ A;  3LWU A;  4TSS A;  3DUZ A;  1BOS A;  1Q3L A;  5M5W B;  1IYV A;  1SDF A;  4WJW A;  2DNC A;  3HP3 A;  2C9O A;  3J81 L;  3MEH A;  2ICE C;  3GTL B;  3QJY A;  1B4O A;  5KYI A;  2A6E D;  4C3H G;  4ZKC B;  1O80 A;  3VA7 A;  1F2Z A;  2A68 D;  2XRQ D;  2AWN A;  2B8G A;  1H9R A;  3C3L A;  4I7Z C;  4ZRZ A;  3TP6 A;  4XQN A;  5C44 B;  2PZW A;  2F0N A;  1WVL A;  4XDX A;  1KLU D;  4C3J G;  4FF2 A;  5IGD A;  2VNU D;  3NHH A;  1HRJ A;  1PTO C;  5A35 A;  4BY1 B;  1HHV A;  1IL8 A;  5I2X A;  1TS5 A;  1SMY C;  2JP1 A;  4R9W A;  3TZD A;  3HS0 C;  3H6M A;  3O13 A;  2R92 B;  5EJW A;  3T4A C;  4CKB A;  1DOM A;  3NE5 B;  4A3K B;  1EIG A;  2K01 A;  1HUM A;  1FNV A;  3DEP A;  3V2T A;  3OWE B;  4FO2 A;  2EZV A;  5C6A A;  2A6H C;  1R4P B;  2RSN A;  1AN8 A;  1B3A A;  2O2L D;  4MHE A;  5EBC A;  1LTG D;  2WIN B;  3H3V C;  3I4N B;  1CI3 M;  1HQR D;  3GO5 A;  1SJH D;  2B2Y A;  1Y8P B;  1L0X B;  2FHT A;  3P7J A;  4ZYS A;  3MZ5 A;  2KHS A;  2E75 C;  3PV0 A;  3R3O A;  5C3X A;  4OO1 H;  1KDC A;  1QNU A;  1AFP A;  3K59 A;  2J4X A;  3X3N A;  2BA1 A;  4DFA A;  4KN4 C;  5E4W C;  4A3G B;  2EY2 A;  3TN2 A;  4BA2 I;  2SNS A;  2X69 A;  4QIW B;  2EYJ A;  1FR3 A;  5FK9 C;  1F9P A;  1Y8N B;  4DAP A;  3TME A;  4F8M A;  1STB A;  2MGS A;  4O1N A;  4C1N K;  1HA6 A;  1D5M C;  5COR A;  2ZXR A;  2NB0 A;  3K5L A;  4FF1 A;  4S3S A;  1JOK A;  1TWF B;  4XQQ A;  4RGM A;  3QOJ A;  4NW2 A;  2Z8L A;  3JAM L;  2A69 C;  5D3D A;  2RSO A;  3C1F A;  3MXN A;  1NCV A;  2NVQ B;  1GUS A;  1PDQ A;  1O7L A;  1ILQ A;  3H94 A;  4KKS A;  1YNN D;  1XTC D;  4M1U B;  4MN3 A;  4F7X A;  2AUJ D;  1KNA A;  2KED A;  2ZXP A;  5EPL A;  4BY7 B;  3X3M A;  3I4M B;  1Z7T A;  3GTO B;  1JCK B;  1EFI D;  1EY6 A;  3K58 A;  1CQV A;  1F2L A;  4KY5 A;  4LAA A;  1LLR D;  3E6Z X;  4R8N A;  1RF2 D;  3M3Y B;  1Y1W B;  2E2D C;  1OXT A;  2HDL A;  1SNQ A;  1DCZ A;  1O78 A;  2HUG A;  1DJR D;  2E74 C;  4G7O C;  4HMJ A;  1OO9 B;  4CHT B;  3MHB A;  4HMI A;  1PTO B;  3NSW A;  3Q22 A;  2QEJ C;  1HTL D;  1LO5 D;  5LHY 1;  5CC4 A;  5I4D A;  4HN7 A;  3BS1 A;  4FXD A;  3D8G A;  4J8Q A;  5JOB A;  3BDC A;  1MBY A;  1I3Q B;  4EQP A;  1TR5 A;  3G6J B;  1B2T A;  3PMF A;  1Q1B A;  2F0W A;  3QOL A;  4RKB A;  1BF4 A;  2JA8 B;  1B50 A;  1FNU A;  3MXU A;  1PXU A;  1YNJ D;  1JIC A;  5J1Z A;  1A15 A;  4C2M B;  3AU7 A;  3TP8 A;  3C1E A;  3W2D A;  4BBS B;  4N9T A;  3LWE A;  2RBM A;  3AB9 A;  1JOO A;  3HRZ C;  1KNE A;  2JYO A;  2ZXO A;  1EZ6 A;  4G57 A;  2J0T D;  1WD1 A;  5C0X J;  1EY7 A;  2IT1 A;  5CGK A;  3QB3 A;  2F03 A;  1BCP F;  4IUR A;  4ABN A;  1LTA D;  4IFD J;  3J7A V;  5DM7 3;  3L3O C;  1D2B A;  2CHB D;  2Q8T A;  1XYI A;  5M9O A;  2WAQ B;  5IOD A;  1K83 B;  2WAC A;  2R6G A;  2JEB I;  4ID6 A;  2EYH A;  4CJ1 B;  2NYZ D;  3DM1 A;  1UAP A;  1LTS D;  1X32 A;  3NPP A;  2LKV A;  4OO1 G;  2F0U A;  4RHR A;  3NQT A;  2B2T A;  1LT4 D;  3TDQ A;  4BBR B;  4DF7 A;  5CV4 A;  2KOL A;  1C8C A;  5C5L A;  4KK7 A;  3IFD A;  3OSO A;  5JPM C;  3SEB A;  3HEJ A;  3HOW B;  2Z4I A;  1CTM A;  5C5M A;  1G29 1;  2HCC A;  4HCS A;  4LK1 C;  3Q23 A;  1ENC A;  1SYB A;  3I90 A;  3DWQ A;  3KF8 A;  4KHV A;  2BE5 C;  2O5J C;  4I65 A;  4A3J B;  4KY6 A;  3M85 A;  5C4J B;  2NVY B;  2JA7 B;  4DGZ A;  2B2T C;  4OIJ A;  2XVS A;  4V0B A;  3BVZ A;  4EGV A;  4KKU A;  5C0X G;  2RDG A;  2SEB D;  5KEE A;  2RDF A;  2B8F A;  2L4N A;  2RVL A;  3R2T A;  2L0C A;  2EJM A;  1FGB D;  1YNN C;  4C3I B;  1LV9 A;  2PCF B;  3FEW X;  2F0S A;  1RTO A;  3PUZ A;  4A93 B;  3OMC A;  2PYK A;  4RHS A;  5JPN C;  1W6J A;  3RUZ A;  5BN5 A;  1A6X A;  1G2S A;  2F0T A;  5EPJ A;  4XT3 B;  4QMG A;  1DYQ A;  4OO1 I;  3GQB A;  4K6L A;  3HKZ B;  5DAU A;  3TP7 A;  4C56 C;  1TT2 A;  2CQA A;  1TY0 A;  2IL8 A;  3I8Z A;  2IX1 A;  1CHP D;  4K5X A;  1HXY D;  1QCB D;  1ZYR C;  4XYQ A;  5LL6 S;  1JR0 D;  2Z1C A;  3ND9 A;  1TU2 B;  2B2W A;  3Q24 A;  3RMH A;  2NTS A;  1CM9 A;  1ENF A;  2PNR C;  5EQ0 A;  3MVV A;  5EBD A;  1ML0 D;  3CRK C;  1XX8 A;  4IUQ A;  1ZXT A;  1Q90 A;  3SVM A;  2R7Z B;  3VR2 A;  1A2T A;  2PMZ B;  2K7V A;  3VYR A;  5C0X I;  4ZAI A;  3HZX A;  4V19 0;  3S1Q B;  5D65 A;  1JE4 A;  5EPK A;  2B2U A;  2HQE A;  5DEH A;  1LAC A;  2K03 A;  1SND A;  1EY5 A;  3I73 A;  2AQ1 B;  1EEF D;  3K5O A;  1MSG A;  4PMC A;  2CW0 D;  1MI2 A;  3BDL A;  1ICW A;  1RTN A;  4TQU S;  1F2Y A;  3D3R A;  4KKT A;  4Q5V A;  4M8A A;  5J22 A;  5FLX L;  1BCP D;  1AZP A;  3R2I A;  2F0H A;  3R93 A;  3SR1 A;  2IX3 A;  4ULL A;  1PRT D;  1E2V A;  3MFY A;  4CKC A;  4XXE A;  2B2U C;  2DN8 A;  4ODG A;  1FYC A;  2EYP A;  5EGT A;  1I4H A;  1K8O A;  1NAP A;  2LS0 1;  2OXP A;  3EFX D;  4IUP A;  5CV8 A;  5TSS A;  2RQX A;  5KNB A;  2K33 A;  1RDP D;  3K7A B;  2X6G A;  3RLF A;  5C4Z A;  3A8K E;  5M5X B;  2YU9 B;  5AFW A;  2R3Z A;  5I6Y A;  2K28 A;  2QCP X;  1B9M A;  1TII D;  3NTI A;  2EDG A;  1U9R A;  3PIP 3;  1SBB B;  1JB3 A;  4BA1 I;  4DXG A;  2K32 A;  3MTS A;  2Y0S B;  4K2L A;  3HG9 A;  3IL8 A;  4B9X A;  5JEA H;  1WTR A;  2K04 A;  1G2T A;  2BCO A;  4KV6 A;  1AP0 A;  2KEE A;  5IOC A;  2F3V A;  2EJF C;  2NZ1 D;  1I50 B;  2QKI C;  1V1O A;  2JSO A;  1LT5 D;  4HCE A;  3S15 B;  2V4D A;  4A3E B;  1DM0 B;  3OHX C;  3PUX A;  3NBI A;  1GHJ A;  4C1N I;  2MUY A;  3FDT A;  1I4G A;  3KLR A;  5C3W A;  3K6O A;  3A7A B;  1NUC A;  2F0E A;  2KUM A;  3SDZ A;  1I4P A;  4OIK A;  4C3H B;  3DEO A;  1SSO A;  2Z4H A;  3Q0A A;  4IUN A;  1IHZ A;  3QG1 A;  2VUM B;  1B53 A;  1AZQ A;  1D5X C;  1O7Z A;  2A74 C;  2XIW A;  4C3J B;  1DD2 A;  2WV6 D;  5ELD A;  4KY7 A;  1AEX A;  2M9V A;  5D3I B;  1STG A;  2F0Q A;  1GXD C;  3NBH A;  3ND8 A;  1G91 A;  4ME5 A;  1KAB A;  5FO8 B;  2OEO A;  3UI2 A;  1J8I A;  1SYC A;  2DNE A;  2I46 A;  1OXX K;  5FO9 B;  3DHQ A;  3SK5 A;  1J9O A;  4J1M A;  2D9U A;  3S2D B;  2F0K A;  4ZKB B;  1KDB A;  4OHJ A;  3OPO A;  1SE2 A;  3NTH A;  5FO7 B;  1I4Q A;  3BYT B;  1JWM D;  1SEB D;  5IT9 E;  2F0D A;  1U4L A;  2IJ0 A;  4NP5 A;  4O42 A;  4OL7 A;  5LL6 X;  1D5Z C;  5ELE A;  2AQ3 B;  3CHB D;  4OGQ C;  1ZKO A;  3TP5 A;  5C0X H;  4KJN A;  2O4X A;  1CHQ D;  3SK4 A;  4Y7N B;  1GUT A;  4IFD H;  5JEA J;  2B2V A;  3PUV A;  4X3U A;  4QUF A;  4K5W A;  3S9W A;  2NVT B;  5BN3 A;  2KJX A;  2F0V A;  2QDB A;  1PTO F;  2FMM A;  2F0I A;  5IGB A;  5G3L F;  2RKS A;  1QOH A;  3WOE A;  2JA5 B;  4KD3 A;  1IW7 C;  3NP8 A;  4FNF A;  3BVM A;  2ICI A;  3FPU B;  1PRT C;  3RZD B;  3L9A X;  5D14 A;  2OF1 A;  2EVB A;  1TWA B;  5ISR A;  5DNF A;  4E6I A;  1BR9 A;  1EY4 A;  2B2V C;  4IUT A;  1TY2 A;  1EOT A;  4CBV A;  4A3B B;  1DXM A;  1TWH B;  2KA7 A;  3QO2 A;  3WOF A;  5ELB A;  4CGY B;  4NDX A;  4Z9C B;  1O7Y A;  1WTV A;  1H9J A;  1XWE A;  3BG3 A;  2J7Z A;  4CKE A;  2A73 B;  3BDO A;  3MWY W;  2K5D A;  2A6E C;  2A68 C;  1UUP A;  1GHK A;  2CVR A;  4IUV A;  5C4X B;  2EYL A;  5JEA G;  4LJZ C;  3OIQ A;  4QCL A;  4RAU C;  4IN3 A;  4HTH A;  5KIX A;  4GZY C;  4F87 A;  2F0O A;  3U9O A;  3NK9 A;  1CZG A;  2XNA C;  5EKI A;  3H0G B;  2PZU A;  1D6E C;  3I72 A;  1BQQ T;  4DK0 A;  4MIU A;  3QIA A;  5C4H A;  2N88 A;  4RA8 A;  2IPK D;  4F88 A;  3HOV B;  2H4O A;  5A2Q E;  1ZEQ X;  3FMC A;  3ZYY X;  3T51 B;  2FJ2 A;  1G8Z D;  2MPM A;  1M4V A;  2TMP A;  2DY8 A;  1EY8 A;  3C2P A;  2E2J B;  1EIH A;  1PZI D;  4KHZ A;  3IKJ A;  3NXW A;  1G6Z A;  4QB4 A;  1HTP A;  2PO4 A;  1AW7 A;  4DK1 A;  1LTR D;  1S4Z A;  3S1M B;  5CR3 A;  1JQY D;  3VYU A;  3IAY A;  4RGO S;  5COY A;  3P75 A;  3QWN A;  1JWU D;  4IZ8 A;  1FD7 D;  5CV7 A;  2JEA I;  3BZD B;  4TRD A;  3T56 B;  2E2I B;  3SK8 A;  4X3S A;  5J39 A;  1EQT A;  3GD7 A;  1GUN A;  5I6W A;  1DZ1 A;  3T13 A;  3HOZ B;  3DXJ C;  1RJT A;  1MD2 D;  1VMC A;  2ENB A;  1VF5 C;  4WFN 3;  2A5H A;  1IYU A;  3J81 E;  1WTQ A;  1QE6 A;  1WTX A;  4X3T A;  2PW5 A;  2EYF A;  2FFK B;  2KEC A;  4A3I B;  1SNO A;  4XIG S;  1FNW A;  2O5I C;  4A3D B;  3BVG A;  4XT1 B;  1PRT B;  1RD9 D;  2EYO A;  2ID0 A;  5M5Y B;  4X3K A;  1RCV D;  1PTO D;  4A3M B;  1V1P A;  5G3L D;  4J6H A;  3GTJ B;  4NKL A;  1SMY D;  4IFD G;  2BA0 A;  2F4I A;  1D1I A;  2L12 A;  1T5X D;  4A3F B;  2FIN B;  5I9O A;  2K5Q A;  3TBI B;  4ZUJ A;  1SNC A;  4KMU C;  2MHV A;  2A6H D;  1F77 A;  4RGN A;  1EYD A;  3OIP A;  5EKL A;  1OXV A;  2F0L A;  3ERQ A;  4QUC A;  1CQF A;  2NTT A;  1SAP A;  1ESR A;  3N52 A;  1Y8O B;  2KCC A;  3HOY B;  3S14 B;  3J7Y W;  3CKI B;  1STE A;  1B9N A;  1OXU A;  1U4R A;  3GP7 A;  1R9T B;  3ITP A;  3K0Y A;  1S5E D;  4AYB B;  3H09 A;  4DN4 M;  4RFB A;  1SJE D;  1DOK A;  1PFN A;  3NUC A;  1ONL A;  5CMD A;  3KBX A;  1QB5 D;  4L6T B;  1HQM C;  3I3C A;  1E2W A;  2F3W A;  4K6D A;  4K5V A;  1W6K A;  3URY A;  2JE6 I;  3GTM B;  3EJI A;  2EE1 A;  1JOQ A;  2NN6 G;  2NBF A;  1PZK D;  3E5S A;  1SYE A;  4IFD I;  4H13 C;  3ONA B;  1CZW A;  3VR4 A;  3M7N A;  3K5N A;  2F0G A;  1EQV A;  3CU7 A;  1GJX A;  1TWC B;  2M2L A;  1BUV T;  1QWY A;  3JAM E;  4EQO A;  3D6C A;  3PUY A;  1S5F D;  1RKN A;  5C3E B;  3OW7 A;  4K8I A;  1YNJ C;  1I4X A;  4UAI A;  2NWG A;  1U4M A;  3D31 A;  4H44 C;  5I9P A;  4CJ0 B;  1KTK A;  3E0J A;  1CA6 A;  2AUK A;  5HUR A;  1I6H B;  4B08 A;  1I6V C;  5A2Q L;  3L7Z C;  1VMP A;  3PO2 B;  1T5E A;  1PTO H;  1PFM A;  3NWT A;  3Q6S A;  3GTQ B;  3A56 A;  1ILP A;  1CFM A;  1I4R A;  2GA4 B;  1A3T A;  3MFG A;  1QJO A;  5KRU A;  3OOC A;  4HAE A;  3I70 A;  3NQI A;  4RKL A;  1E2Z A;  4RH6 A;  4BS9 A;  5IIF A;  2EPB A;  5DM6 3;  4DNR B;  3EQL C;  2L11 A;  4WOR A;  3PUW A;  3VR5 A;  1S5D D;  1Z6H A;  1LAB A;  1HFN A;  4B9W A;  4DXF A;  2MP1 A;  3DWP A;  2WB1 B;  2EOT A;  2E2H B;  4K2K A;  1SYD A;  1EY0 A;  3EA6 A;  4ZK9 B;  2NN6 I;  4DAY A;  2G9D A;  3TSS A;  1Q12 A;  2IX0 A;  2KQ3 A;  1JC7 A;  5JAV A;  5CV5 A;  5CYU A;  5K5P A;  3J7A F;  3MXG A;  1WCM B;  4FF4 A;  5IGC A;  1A3U A;  2EJG C;  1EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...