1EY8A

Structure of s. nuclease stabilizing triple mutant p117g/h124l/s128a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 41
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey8A00
3D4DA 1U9RA 3OSOA 4QMGA 3MZ5A 1EY8A 1NSNS 3EJIA 5C4ZA 5EGTA 5KYIA 2F0KA 2F0LA 2KQ3A 4KY6A 2F0VA 4EVOA 1IHZA 2EYMA 1STGA 2F0OA 4KD4A 4K14A 2HQEA 3D8GA 1A3UA 2KHSA 4KY7A 4S3SA 4ODGA 2LKVA 4KJOA 4J1MA 2F0HA 4WORA 1TR5A 4EQOA 2F0SA 3BDCA 2PQEA 5CV6A 1F2YA 3T13A 1KDAA 3QOJA 4ZUIA 4IZ8A 2PZWA 1SYBA 2EY5A 2M00A 5IOCA 3ITPA 1TQOA 1SYGA 4DFAA 1EZ6A 1SYEA 1TT2A 2EYJA 1SNOA 4PNYA 1A3TA 2EYLA 4RKLA 1A2UA 5E3FA 5K5PA 3NUCA 5CR3A 1KDCA 1F2MA 3NQTA 2RBMA 4K8IA 3C1FA 1SYDA 1ENCA 3MHBA 1ENAA 5KIXA 3EVQA 3SK6A 4EQNA 3TMEA 3SHLA 1JOKA 1EYAA 3MXPA 4ZUJA 1JOQA 3C1EA 2SNMA 4TRDA 2NUCA 5IODA 5ISRA 2SOBA 2RKSA 2EY1A 4RKBA 2F0NA 4PMBA 2OF1A 1A2TA 3DMUA 2EXZA 4K5VA 1SNQA 4I65A 3TP8A 3R3OA 4B9WA 5KYLA 2F0PA 2QDBA 5CGKA 3VA5A 4N9PA 4OL7A 5C5MA 4N9TA 2F0QA 2EY2A 4WRDA 1EQVA 3P75A 3TP6A 1SNMA 3NP8A 4ME5A 4ID6A 2PYKA 3D6CA 2F0FA 4KJNA 3HZXA 2F0MA 4B9XA 1STNA 5J22A 2F3WA 4KV6A 5NUCA 3MVVA 5J1ZA 1EY4A 3PMFA 4NKLA 2PZTA 5CV5A 1A3VA 5E1FA 5EKKA 4DGZA 4K2LA 1EY0A 4QB4A 1EY7A 5DAUA 2OEOA 4PMCA 1AEXA 4HTHA 3TP7A 5C3WA 3NK9A 5CV4A 5IIFA 2OXPA 5IGCA 1KDBA 5IGFA 4MIUA 3HEJA 3NHHA 1STBA 2RDFA 4KY5A 5F2DA 3SK5A 4H7BA 1EZ8A 5C6AA 2ENBA 4KHVA 4DF7A 1EY9A 2F3VA 3SK8A 4HMJA 4F7XA 3LX0A 4K8JA 5CV8A 3U9OA 5CV9A 4F8MA 1II3A 5M9OA 5KRUA 3V2TA 2O4XA 1F2ZA 3ERQA 1KABA 4R8NA 3DHQA 2F0GA 5CV7A 3RUZA 4J6HA 3OMCA 2EYHA 1EY6A 5I6WA 2F0UA 5IGGA 3P1HA 1EY5A 2F0DA 3D4WA 3MEHA 3TP5A 4EQPA 2EY6A 2F0JA 1STHA 1EYDA 5KEEA 1SNPA 3T16A 2WACA 2F0WA 4IALA 4DU9A 4KTAA 1KAAA 2SNSA 4IUNA 5C3XA 4K6DA 5CC4A 3SR1A 5IGBA 2PZUA 4G57A 1SNDA 3EROA 3OMGA 4KD3A 4K5XA 5C5LA 3SXHA 4LAAA 5I9OA 3SK4A 4NMZA 3S9WA 2PW5A 3QB3A 1JOOA 1JORA 1STYA 1SYFA 4K2KA 4YIJA 5C4HA 5HGTA 5HURA 2EYOA 5IGDA 1SYCA 3E5SA 3OWFA 4NDXA 3QOLA 3H6MA 5EKLA 2EYPA 4E6IA 1STAA 5I6YA 5KGUA 4HMIA 4NP5A 4ZQ3A 5JOBA 1NUCA 2F0TA 2F0IA 1RKNA 1SNCA 1EYCA 5DEHA 5IGEA 3BDLA 5J39A 4QF4A 2PW7A 5I9PA 2EYFA 5JAVA 2F0EA 4K5WA 3NXWA
chains in the Genus database with same CATH superfamily
1WTXA 1VQPA 3EJIA 4QUFA 2JA6G 2RDHA 1NTGA 4J8QA 3ULJA 1UE7A 1IHZA 1C9OA 3SVMA 2K5WA 2F3IA 1XPRA 2X6GA 1XNQL 4OWXB 2HIVA 3J7AF 5E4WC 1SYBA 2EY5A 2M00A 4N8FA 2B63G 3A0JA 1TQOA 3VR5A 4RFBA 1DONA 5LL6X 2NTTA 3OW2A 1F2MA 1RF2D 1ICWA 1HNZQ 5BR8Q 2NTSA 1NJIC 4A93G 3TMEA 3GTGB 4TRDA 5IODA 4FF1A 2F0NA 1K28A 2VXWA 4H44C 1EFID 1JJ2A 1HUMA 1PRTC 2MHVA 2Q2HA 1TWFB 4DV3L 2DUDA 4KJNA 2F0MA 3VR6A 1GOZA 3PQIA 3M4QA 4GNXA 1O7IA 3A8KE 1SMXA 3CC2A 1HNXL 2OEOA 5C3WA 1TWCH 3X3NA 1IBLL 2OXPA 3LWEA 1VQ7A 5IGFA 1HNWQ 2K75A 4PZ6A 5IYCH 1WTRA 5C6AA 3AEVA 1EY9A 3SK8A 4A3EH 4B3RL 3J7ZC 4X62L 2MO0A 1AZQA 1ZYRD 4OX9L 1VQ4A 3HOXG 2VL6A 4A3IG 1M90C 5CV7A 4A3MB 1PH2A 2N55A 4DR7Q 1PHJA 2WAQE 1B44D 2ZM6L 2A6HC 3CCUA 4DNTB 2F1MA 3TN2A 3U9SA 4KKTA 5M3FG 3VYTA 2R93B 5CC4A 2HUGA 3FKIG 2YTVA 3KLWA 4L5SA 1JORA 5M3MG 1JT8A 4GNXB 4A3LH 1Y14B 4C3IG 1BVSA 3RZOH 3MC0B 3VA7A 4HMIA 2WB1E 1X6OA 3KLRA 3PCOB 5FLXE 4GOPC 1X54A 2DGYA 5DEHA 4JI6Q 3I4NH 2C9OA 1TWFH 2K5VA 1SLJA 1HZBA 2AHOB 4OEMB 2EIFA 4Y52H 5KYIA 1QZGA 4CDEC 3CXCA 3MFYA 1VQHA 3IFTA 4OO1H 1XNRL 4KD4A 1TU2B 1CSQA 2PNRC 3C3LA 2F4IA 1KDAA 4ZUIA 4EQ5A 4CKCA 1EWHA 4O42A 3S16B 3K8AA 3E6ZX 1LYLA 4FP5D 4A3FB 2EYJA 2K5HA 3QWNA 1LTTD 2R7DA 4Q5VA 1VQFA 4A3MH 1PH3A 4K8IA 5M5YH 4DR4Q 4IN3A 4PZ8A 3MXPA 2R93H 2NUCA 4HCSA 4IJHA 1FJGL 3UDXA 4KHPQ 4R4CA 3S17H 2O5IC 2A74C 3BZCA 4X3SA 3K5NA 2VY3A 5KYLA 2QDBA 4N9PA 4OL7A 4P75A 4LF5Q 1XWEA 2UXBL 3S24A 1TKWB 5A2QE 2LMCB 5HY6A 3JAME 2PCFB 2IX3A 4B3SL 4QIWE 1KNEA 4LW1A 3TP7A 3KLSA 3HG9A 1KTKA 3JC66 2KBNA 2YU9B 1KDBA 4K6LA 1VQMA 1LTSD 1ET9A 1LM0A 4A75A 3I4MH 5CYUA 3GO5A 2Z1CA 3VR2A 3S1QH 1VS0A 2MPMA 1IKLA 1AW7A 1EOTA 1HXYD 4JCVE 4IUQA 1L1OC 5K36H 4JI8Q 2RSNA 1F77A 2BDOA 2N88A 3T56B 4GKJL 5BN3A 2WP8J 3DHQA 1L2FA 2FFKB 3OMCA 4GOPA 3GD7A 3P1HA 1EY5A 3OW7A 2FXQA 2EY6A 4L6TB 1ZXTA 3DWAA 2QEXA 1N32L 2DN8A 1F9PA 1B4OA 4IALA 4LF7Q 2BE5C 3FEWX 1WD0A 1W2BA 3H0GH 4C3HB 3QIAA 4L5RC 1V8QA 1HQRD 2BA1A 3SXHA 2VQFL 4QQBX 4NPSA 1DCZA 1JOOA 3HOYG 2EPBA 1B3AA 4FNFA 1STAA 1PTOC 2V4DA 3I4OA 1GO3E 1Y1WG 2JA8G 1RKNA 5JJLA 4IUTA 1EYCA 1HUNA 5IYDH 3N52A 5I9PA 4DV4Q 3S1MH 2RSOA 4X3TA 3G6JB 1CKMA 2Y0SB 3SE0A 3EFXD 5DLQE 4NXNL 4X64L 4GOPB 3OYYA 4S3SA 4GZYC 3FP9A 1TR5A 4NB3A 3ZYYX 4DPGA 4B3TL 2JA6B 3NTHA 1BQQT 4JV5Q 1GUSA 2B2TA 3IKJA 3NE5B 2ZJQA 2MJ8A 5C44B 3JAMi 1TWHH 3RR5A 4JI5L 1MD2D 4IUVA 4IUPA 1Q8KA 1HPCA 4WJ3M 4HAEA 4U68A 4ABNA 4C3HH 4LF4Q 1BXTA 3I72A 5T1IA 4HR7B 3E9IA 1N8RC 3PO3G 4DUYL 2JP1A 2NVXB 1LTGD 4YY3Q 4A93B 2IWHA 3P75A 2KCNA 5FLXL 3A8JE 3KF8A 4A3JH 4NXML 4R4OA 3NQIA 1JR0D 5J1ZA 1YJ9A 5C0XI 3S2HH 1EQTA 2QW7A 3KF6B 1HR0L 1GHJA 1CHQD 3OTOQ 5F2DA 5G3LF 1I4XA 1K73C 2QCPX 1ZYRC 3F1ZA 4C3JG 1C8CA 2ZTCA 3LX0A 4ILWA 1YBYA 5M9OA 2IX0A 4IFDG 1F2ZA 5C44H 2I0QA 1RHPA 2EYHA 3I2ZA 2L0CA 4LF6L 3UE0A 1AP0A 3TZUA 5D3DA 4JYAQ 5KEEA 4B3ML 1SNPA 2R7ZH 1YVCA 3HOXB 1FNVA 2F0WA 2BOSA 4A3IB 4K6DA 5ELCA 5LMUL 3KF8B 1SJHD 4KD3A 3E9HA 5I9OA 1I5FA 3CAMA 3S1RH 2OWOA 3QB3A 4K2KA 1K8GA 4DXFA 2NVTB 1FR3A 1ILPA 4LJZC 4NP5A 2AUJD 2ZTEA 4GN4B 4QUCA 2NVXH 1PDQA 1GUNA 4RGTA 5A2QL 5J39A 1NMGA 2BA0A 2AUKA 4DK3C 5M3MB 2F0LA 1FNUA 1D8LA 4MTKA 5IP9G 3JAML 2YTXA 2E2DC 2LXKA 4C3IB 1PTOB 5T1GA 1XPUA 2H5XA 1STGA 1MSHA 2K33A 1V43A 3MTSA 3DUZA 5ELOA 3E0JA 4GN5A 3GTKH 1XXGA 1F9RA 1O80A 2UU9Q 4O1NA 1Q86C 1Y1VB 3PUWA 2TMPA 4XYQA 4BXXH 4MN3A 3KBXA 4ZAIA 1KD1C 1TT2A 3G4SA 4V0BA 2ID0A 4ULLA 2RBMA 4RH6A 3C1FA 4P71A 4C56C 4X3UA 1VQ8A 2H1EA 3CCVA 2KECA 4ZUJA 4DV0Q 1GUTA 2L11A 3UDIA 3CC4A 4ZYSA 4BY1G 3RMHA 1A2TA 2F52A 4DR1Q 1X3FA 1OO9B 1DM0B 3TP8A 4A3KG 2NVTH 1DYQA 3VA5A 1TWGH 4L5TA 2NYZD 1SE2A 3A74A 2MUYA 4BS9A 4X3KA 3CMAA 2JK8A 1EQQA 2FINB 3ERSX 3BZDB 1J9OA 2A6ED 1I3QB 1XMOQ 3BVMA 4NKLA 2J0TD 1VQAA 1A3VA 5CV5A 4BBRB 2UXCL 4K2LA 3H3VI 1PTOH 3FMCA 5CV4A 3CD6A 1DOLA 3K7UC 3PF4A 3L0OA 4DK1A 3M85A 1M8AA 2ENBA 4UY8C 1QCBD 2G9HD 3HOVG 2ZJRA 4C2MH 3BVZA 1Y1VH 1FVIA 1JJCB 4KN4C 4R8NA 1SROA 3S1NH 4J6HA 1S5ED 2RCFA 4BA1I 4HIKA 5IGGA 2L12A 1WD1A 4QCLA 3UI2A 3CCEA 5GAHC 4IO9A 1TS3A 1YHQA 1HFGA 4IUNA 3GTOB 3SR1A 1F2LA 2D9UA 2PZUA 3WWVA 1RCVD 2Q8RE 4PG3A 1ESRA 4UPAA 1STYA 2HCCA 1Z6HA 1SYCA 4AH6A 2R61A 4V190 2BCOA 1LUZA 4DR5Q 5ELEA 1WTPA 3FDTA 1CM9A 1YNND 3TZDA 1UEBA 3NELA 1P8LA 5TSSA 1EY0A 4A3DG 1HCZA 4WJWA 3MZ5A 1I3QH 1EY8A 1RL2A 2JEBI 5ELFA 4BBRH 1S5BD 1Y1WB 1I6HB 2ES2A 4CKBA 2NWGA 2B2VA 4IQZA 3D8GA 2KHSA 4K14A 4DUZQ 1VQ5A 4JOIA 3GTMB 3VR3A 1XTDA 3RD4A 4EQOA 3PIPA 1F2YA 2PI2A 2YTYA 1UE1A 3ITPA 3NBIA 1PFBA 5D14A 3CCRA 4OIKA 5FO9B 2Q8IB 5H1SE 4YCUA 2HHHL 5EBDA 1SYDA 4R8IA 3MHBA 3K5OA 2PQAA 4RCNA 4BBSG 3EQLC 2IL8A 3PO2G 4FYDA 2VUMH 2VS1A 3QJYA 3EIVA 2SDFA 2E74C 4K5VA 1KL9A 2EDGA 4A3CH 3RLFA 2EY2A 3L7ZC 3EN2A 1IYUA 3UDFA 2R92H 3K5LA 5J3BA 4LNQA 1T5XD 4XXEA 1QVGA 1E1OA 3S14H 4FF4A 1Q82C 3PO3B 4DAYA 4QB4A 5BN4A 3T1HL 2UUBQ 1AEXA 4XTCS 1I6HH 2D0PA 2XRSD 1STEA 5KNDA 3K81C 1B2TA 2Z0SA 3GTMH 1G291 2ZXPA 2PQAB 4LF5L 4PMWA 1UE6A 4DV7Q 4X66Q 4DV1L 1EIYB 1EWCA 1KABA 4OWWB 3PIOA 1EY6A 3S15B 2PNHA 2PMZE 4KKSA 1TWAH 4C3JB 1HQMC 1SR3A 4JVZA 1AH9A 1IYJB 3GQBA 2UXDQ 1HFNA 2ICIA 1SNDA 3OMGA 1A0IA 2ICEC 3PGZA 4LAAA 3VR4A 2Z6KA 1Q1BA 4JBWA 2B39A 4AQYL 4DAYB 5I6YA 5KGUA 2F0TA 1RTOA 1HHVA 5IP7H 4IPHA 2YYZA 3RZDH 4BA2I 3CF5A 3D4DA 2IY5B 4GNXC 1I4GA 2KEEA 3PF5A 2KUMA 3M4PA 4KY6A 4P2CB 1X9NA 1D5XC 3LWUA 3HKZE 1XMQQ 3DM1A 4YCVA 1A63A 2L4NA 1VMPA 2UUAL 1JICA 2KOLA 3U50C 4Y7NB 4DN4M 4ZKCB 1I94L 1YHAA 3I3CA 3I8ZA 1BKBA 3KBGA 4CHTB 5M5WH 3VYRA 3W3AA 2PO4A 3S15H 3OOCA 4GKKQ 1KC8C 5C4XH 3SHLA 3G71A 2BH8A 3C1EA 3F2BA 1VCIA 2HT1A 1J6QA 2SOBA 3IRBA 4LFAQ 4BY7G 2I5LX 5C3EG 1KAWA 4WJ4A 1I50B 4XYOA 4N9TA 4WRDA 3TP6A 3ONAB 1WI5A 1JJGA 2AQ1B 1O78A 1X32A 1JQYD 4I7ZC 3NTIA 3ULPA 3GTLB 3TS0A 5EBCA 1S5DD 1WCMG 3QG1A 3I91A 5IT9E 1VQEA 3RN2A 3CHBD 2A8VA 4DV5Q 1PFNA 4MIUA 3HOZG 3PSIA 3R8BA 1MBYA 2NN6H 2F4VL 4Y7NH 1L0XB 3Q22A 1PTOF 1Q7YC 4DR2L 1YJNA 2A19A 4OO1I 5I6WA 2ALYB 2K1BA 2K14A 1S4ZA 3HOVB 4DV2Q 3BG3A 3EBEA 4IPDA 1K83B 3HP3A 4AYBB 5C3XA 4R4TA 5JEAH 2EQSA 3D4RA 1XTCD 4MHEA 1Y8OB 5IGDA 2VW9A 4IURA 4XIGS 2K01A 3OWFA 1G2SA 2L15A 1BBUA 4ZQ3A 1FYCA 1NUCA 2DY7A 4JI4L 5LHY1 2FMCA 5C0XG 3M3YB 2CQAA 1B9MA 5KNBA 1DGSA 3TDQA 3S2DB 4QMGA 1HTLD 1BDOA 2Z9HA 5C4ZA 4DR3Q 1IBKL 4GLVB 3GTLH 3IFDA 4UAIA 4A3GG 4IOAA 2IHFA 3ND8A 1BBWA 1BR9A 3T1YQ 4HJ9A 1BBXC 3AB9A 3NWTA 1SMYD 1UE5A 3GTGH 4KJOA 1AE2A 2JN4A 4NW2A 5CV6A 3V05A 3FPPA 1WTWA 3TS2A 4IPGA 1FGUA 1DXMA 3Q24A 2E2HB 1SNOA 2WIIB 2OTLA 1WTVA 3SEBA 2KCTA 2Z4HA 3HOWB 4FF2A 2N49A 3CRLC 1JMCA 3CRKC 1VQGA 1EIFA 4DAPA 1CUKA 1EIHA 2Z6BA 2JA7B 4IJLA 4BBSB 1KNAA 4QL5A 3W1BA 3PO2B 1OXSC 4ID6A 1PH1A 2PYKA 2B29A 3D6CA 2R3ZA 2EJMA 4DK6C 1K8AC 1QVCA 1VQ6A 1GUGA 3NHHA 3Q0AA 3C46A 1X3GA 5LMNQ 2GN5A 2B2TC 3J80E 2VQEQ 2JA5B 4POGA 1CKNA 4O2DA 1PMRA 3HKSA 5CV9A 4F8MA 1EEFD 1J5EL 1PLFA 1KRTA 2XTIA 4CJ0B 3P20A 1V1OA 3U58A 2E5LQ 5JVH3 1EYDA 3HOWH 1DOMA 1K9MC 1KAAA 4TVAB 2JYOA 2CKZB 3SK4A 5AJ3Q 1SYFA 1PH7A 1DD2A 4ZKBB 2QA4A 5EKLA 3AQQA 3QOLA 3T4AC 2JA7H 1BNZA 1NCVA 2MP1A 1JE5A 4FXGC 1I6VC 1E2ZA 2IT1A 3S16H 1PZJD 1U4MA 4A3FH 4JI2Q 2EYFA 5FLMG 2CVRA 5FKAC 5ELDA 1V1PA 1XX8A 3J81E 3AYHB 1CKNB 1D1IA 5EGTA 4A3BG 2NZOA 1U4PA 5IT9L 4EVOA 3KJOA 4LF8L 1Q90A 1A3UA 4JI7Q 3TRZA 3I4LA 4J1MA 2D5DA 3NPPA 5JPMC 3U4VA 1R9TB 1WVLA 2XWJB 1ICFB 1KQSA 2JA5H 2B8GA 4EX5A 1N34L 1VQCA 2UUCL 4LFCL 4LF9Q 2MNAA 1E0BA 1W6JA 3NUCA 3GTPB 5EKIA 3CCSA 1N33L 2D62A 4DR6L 2QILA 1ENAA 4CDDC 4G7ZC 5E4XA 4GS3A 1GXDC 3I7FA 2YU9H 2GVAA 1V1PB 4PMBA 3J80i 2XVSA 3O13A 3H15A 5FJ8H 1VDZA 4KN7C 5EJWA 4JI3Q 3NP8A 1UNSA 3D0FA 3MA2B 2E2IB 4BY7B 4X65Q 5C3EB 1STNA 4KV6A 2WINB 4PZ7A 3MVVA 2C35B 1HJPA 4M1UB 4DV6L 2IHEA 2Y0SE 2B63B 2WFWA 1IYVA 3X3MA 3HOUG 3D6WA 2CQOA 2VB3X 2F3VA 2H4OA 3KOJA 3OHXC 4HMJA 1K8OA 3KJPA 1XNQQ 3M7NA 1G91A 1IW7D 5C0XJ 1TIID 1II3A 4I7AA 3CPWA 3HOZB 3J81i 2K5NA 2NBFA 2B3GA 1IL8A 3F8TA 1LTLA 3N6RA 2UUBL 2A69D 2F0JA 1STHA 2CHBD 1A62A 4ZRZA 3LGJA 1QZHA 4OGQC 3AMUA 2Q2UA 1CK1A 4JI1L 3TQYA 5C4HA 1LABA 3A5UA 3MXUA 1LT3D 3IL8A 5JOBA 2JA6H 1LTBD 5IYBG 4HJ5A 3MEFA 4JI0L 3BDLA 1C4QA 2QF7A 2OTJA 1JCKB 5IWAL 4DV3Q 2VNUD 2PPBC 4HSVA 1BCPB 3PUZA 1YNXA 3VYUA 1LTAD 4JPBW 2B63H 1HNXQ 2NVQB 2B2WC 1NAPA 1IBLQ 1H9SA 4C1NK 4LFBL 2F0HA 2MQHA 3AFQA 1AZPA 2AKWB 1GD7A 4B3RQ 4X62Q 3J80L 4LUOA 4JBKA 4OXPA 4OX9Q 4JK1C 5M3FB 4A93H 3FKIB 2EYLA 3TSSA 1JE4A 1M1KC 1MGSA 4TQUS 3L9AX 1OTCA 1JC7A 2ZM6Q 5HGQA 5KIXA 2XSCA 2AWNA 5FLXc 3ER0A 1EYAA 1A8VA 1X56A 4KMUC 1W6KA 5EPLA 2NZ1D 4RKBA 4YHHL 4P74A 1QNUA 1N36L 1MJCA 1UWVA 5DM73 1IBML 5IY0A 4M8AA 1H9SB 1B7YB 1EU3A 4FVMA 1SSOA 4QJFA 1OXUA 4OWTB 2DJGC 5NUCA 4GKKL 3J81L 3WOEA 1VQOA 3LNNA 1X3PA 5CORA 1F9SA 2XRQD 4HTHA 5JJKA 1E24A 5IIFA 3E0EA 2B2VC 3D31A 3HOXH 4A3IH 2J4XA 1MJEA 1STBA 3A55A 1XNRQ 4JOIC 1Q46A 2JSOA 3EA6A 1U4RA 3SGIA 2X6LA 1GVPA 4H0LC 1PYBA 4MZ9A 3P7JA 3U9OA 1T9HA 5GAGC 2RF4A 5M3FH 2BH2A 2O4XA 5IYCG 3GV3A 3FKIH 4A3EG 1WJJA 1HNZL 1OXVA 2E8GA 3FRPB 5BR8L 5M3MH 3TP5A 3GTJB 1B70B 3K6OA 4C3IH 1HZAA 4DAMA 2RA4A 1CT1D 1ENFA 4FXDA 3WOFA 2B2WA 3JAMc 4APVA 1FJGQ 2NB0A 5HURA 5HGTA 3ULLA 3GV6A 1C7YA 2TSSA 2K6AA 2GVBA 3DEOA 3E3XA 3CCMA 1I4QA 5IGEA 2UXBQ 1DOKA 5JAVA 2F0EA 1YI2A 4A3LG 3K5MA 1TS5A 5LMNW 4B3SQ 3I4NG 1B8AA 1HNWL 3I90A 3OPOA 2IW3A 4P73A 2WAQG 2LKVA 1SXTA 1LV9A 1ONLA 2F0SA 1QG7A 1M4VA 4A3BB 4IZ8A 4OO1G 1PRTD 1J8IA 1NMFA 2O5JC 2B2UA 1BO0A 1B1ZA 3GDEA 1SYEA 2E2JB 3W1GA 4DR7L 4GKJQ 1D7QA 2RDGA 3PV0A 3CCJA 1Z7TA 2GA4B 3ZJYC 2HIXA 3HOYB 1EYGA 1FD7D 4LK1C 2OQKA 5COYA 2WB1G 1ENCA 3A56A 1X3QA 3HGBA 1PYSB 3T1YL 3SK6A 2KA7A 1N32Q 4PV1C 2JA8B 1WOCA 2SNMA 1KIXA 2CW0D 2Z6KC 4A3MG 2EY1A 3BVGA 2WV6D 3BYYB 2VQFQ 3RLNA 1OXTA 2EXZA 2V1CC 2VZAA 2SEBD 2AQ2B 4OELB 4DNIA 1EQVA 4JI6L 2R93G 2LY7A 4KHZA 1G2TA 1JWUD 3HZXA 2KHIA 4Q0FA 5L37A 1ASZA 4UHVA 3VYSA 1XYIA 2Q2IA 1HTPA 3NENA 1EY7A 2EXDA 1CZWA 4NXNQ 4X64Q 2HD3A 3GTOH 4CDCC 2RVLA 4O0AA 4IFDJ 3KUPA 4F7XA 4B3TQ 1IW7C 3L3OC 3F2DA 3KDFA 5ISRA 1QB5D 3I4MG 2K05A 1IXRA 2F03A 4DR4L 1CTMA 4JI5Q 2A69C 1CQVA 2EOTA 3HOYH 5K36G 3K7AB 1K0SA 4A4IA 1I4RA 2JE6I 1GJXA 1Y1WH 4KHPL 4G57A 2JA8H 2PW5A 1AN8A 1D5ZC 1NR4A 4CKEA 5C4JB 2N78A 3H0GG 4DUYQ 1E22A 1NNXA 4RA8A 2QDLA 3BDOA 1SNCA 1S5CD 1KHIA 1MIUA 4QF4A 4P72A 1KRSA 2R6GA 4K5WA 4NXMQ 1VQIA 4XQJA 2PI2E 1QVFA 3RN5A 3IAYA 3KDFB 4ALPA 2AQ3B 2CH4A 1JB7A 2F0VA 5IYDG 1HR0Q 2EYMA 1U5KA 3Q6SA 3WDNA 3M9BA 3A8IE 1KLGD 2KJXA 1VF5C 3Q23A 1YNJD 4RGMA 3BJUA 3DM3A 3M7GA 2R7FA 4HIMA 3T13A 3QOJA 2RCNA 1BCPD 4JI8L 3DEPA 1SYGA 2EE1A 5DM63 4RGOS 2L9HA 1S72A 1KDCA 5IE8A 3Q8DA 4DXGA 4LF6Q 4X6AH 4LF7L 2LFNA 2NN6I 4HSPA 4B3MQ 4FF3A 2EZVA 3PO3H 1JOQA 3W2DA 4ZCKA 2NVYB 5LMUQ 3CCQA 2OF1A 5EPKA 2ZTDA 1PH8A 4I65A 3TREA 5CGKA 4R4QA 2F0QA 1B3QA 4HJ7A 4C3HG 1G8ZD 4DV4L 1HH2P 4ME3A 2MFIA 1E7ZA 1H9JA 4DAVA 1AFPA 1QWYA 3CMEA 1GKHA 2BE5D 3OIPA 1C48A 2CWPA 4C3JH 3HFZB 3PUXA 4A3JG 2WKCA 5GADC 3SK5A 4JBMA 4IFDH 3AFPA 1CQFA 1Q81C 1A15A 4XQNA 4JV5L 1LLRD 1AE3A 1QILA 1JWSD 1QUQA 4K8JA 5ELNA 4LMQD 1YJWA 4CGYB 3NSWA 1G6PA 4JBJA 4BY1B 1IL2A 3SDZA 2A6EC 4A3KB 1OXXK 1TWCB 1HRJA 4KTAA 2B2YA 5C44G 5IGBA 1L0YB 1D6EC 4LF4L 2AWOA 1EIGA 5D65A 4JW0A 5C5LA 2FMMA 3S9WA 2K52A 2NVYH 2XN9C 4A3EB 2G9DA 1TS2A 2R7ZG 4YY3L 1B53A 5IP9H 3UE1A 1G51A 3CPFA 2XIWA 2RHQB 3NTKA 3ND9A 1V9PA 1JWMD 2K5QA 5GQOA 5FOBB 2PW7A 4KLKA 3DWPA 1VQJA 3NXWA 3G6EA 5BN5A 1QUQB 2KHJA 4HJ8A 1YZ6A 2ZJPA 3H94A 3VDYA 4FO2A 2UXCQ 2K7VA 3M4YA 3OTOL 2QGQA 4CJ2C 4LUVA 1Q1EA 2XNAC 3BDCA 4DKAC 3RZOB 3K80C 4LUZA 4CBVA 4OIJA 2K32A 4F87A 1I50H 1QNKA 3I4NB 3URYA 3FVQA 1YNNC 3A7AB 1CA5A 2WAQB 4JYAL 4ZK9B 5CR3A 1TS4A 4BY1H 3I73A 4A3KH 4BXXG 3U4ZA 1TY2A 4AYBE 2CW0C 4H13C 4IOCA 1R4QB 2RKSA 4UP7A 4A3DB 2CH4W 1Z47A 2WB1B 4KKUA 1XJVA 5C5MA 3T51B 1MSGA 3J7A5 2CWAA 3CKIB 4HJAA 5LL6S 5CBEE 5J22A 5M5YB 4DA2A 1K3RA 4XDXA 3HOVH 1I4PA 3NK9A 1K8MA 1S40A 1K83H 2G5DA 3S17B 3G48A 3I55A 2IX1A 4PQXA 1E1TA 2UU9L 1H9KA 2M9VA 3CC7A 3BYTB 3W5OA 2CFMA 4IUUA 1B9NA 1RD9D 3RUZA 2F0GA 2I5MX 1KXLA 3M3YH 2D0OA 3S2DH 1Y1VG 4RHSA 4DV0L 1VQBA 2M2LA 2HHHQ 4XT1B 2J7ZA 2SNSA 4L5QA 3EROA 2DJFC 3I4MB 4DR1L 3S1QB 4Z9CB 2RHSB 4A3DH 3H6MA 3K0YA 5D3IB 1C0AA 3KLSX 2L1BA 1XMOL 2E2HH 3HRZC 3KYHC 5FO7B 1D5MC 1TXYA 3OSOA 4QIWB 3DLLA 3H0GB 1NR2A 2ZT9C 3K58A 3T1HQ 1PFSA 2DNCA 3MXNA 1IKMA 4ODGA 1PZID 4HIDA 2A73B 1K3BC 4WORA 1YNJC 4RGNA 4BBRG 2ZXRA 1ZKOA 1BCPC 2KCMA 5A35A 1FNWA 5IOCA 4EGVA 4BBSH 3CW2C 1WYDA 2KCCA 1S5FD 4K0KQ 4DV1Q 3PO2H 1A2UA 2MO1A 1EQRA 2A68D 2RQXA 1QOHA 1LT6D 1SE3A 4KK7A 1H95A 4TKOB 1ILQA 1PRTB 4EQNA 3TBIB 4HCEA 2KEDA 3AU7A 2VB2X 3R3OA 4DR5L 4AQYQ 3L2PA 1VF7A 4FXKC 3MXNB 3UDGA 1TWHB 2VUMG 1RIPA 1CI3M 5EAYA 1HR0W 1SEBD 3PUVA 4A3CG 3A7LA 5E1FA 4DGZA 1X3EA 2R92G 3CQZB 4QY7A 4DUZL 1CFMA 1Y8PB 2CCZA 1E3PA 3MXGA 5IGCA 3HEJA 5I2YA 4DF7A 1KLUD 1I4HA 1PYWD 4YWLA 4TSSA 1SBBB 1PV4A 1A6XA 2UUAQ 2IPKD 1E2VA 2N3SA 1I94Q 1Q12A 4A3JB 1WFQA 3FHWA 4YCWA 2F0UA 3S2HB 3MAQA 1G6ZA 3I70A 5JJIA 2K04A 4EQPA 1BUVT 1DZ1A 3J81j 2WKDA 3NEMA 3TEHB 2I07B 4L8JA 5G3LD 2MGSA 4K5XA 5I2XA 1VMCA 2NZHA 1PZKD 1RDPD 5IT9c 3I56A 2AMCB 1R9TH 3KF6A 1WCMB 4G4KA 1VQKA 4JG2A 4DNRB 2R7ZB 3GTPH 3B6YA 3R2IA 5IP7G 1SJED 3CQZH 2F0OA 4CDFC 3S1RB 3OWEB 4DV7L 3A54A 2PZWA 5EQ0A 4X66L 1L1OA 2F4VQ 2BDNA 1SDFA 4DFAA 1EZ6A 4PNYA 1YHBA 4RKLA 3T53B 4DR2Q 1A3TA 3K59A 3DWQA 5K5PA 2E2IH 3STBD 4R1JA 1PH5A 1TVXA 3MFGA 4BY7H 5C3EH 3H3VC 2E75C 4RWSC 1HZCA 2UXDL 2FHTA 1JOKA 3R2TA 3GTKB 1P16A 2LSSA 1SMYC 2L55A 4B9WA 3HS0C 2F0PA 5C4XG 3BZKA 3F2CA 4A3GB 3HKZG 2QEJC 1V1QA 1WCMH 4MTNA 2Z4IA 4JI4Q 1SE4A 4B9XA 3HOZH 5FK9C 4R4IA 1L1OB 2EJFC 3FPUB 1ML0D 4PMCA 1N9WA 1IBKQ 1H9MA 1XMQL 2OCEA 2RDFA 1E2WA 2ZXOA 4YWKA 1CA6A 4RG1A 1K0RA 1HZ9A 4F88A 1TWGB 2JEAI 1VQ9A 5I4DA 1O7ZA 1PFMA 2B2UC 4L63B 4RAUC 2HDMA 4RMFA 1H9RA 3H09A 4HIOA 2NN6G 2F0DA 3D4WA 3MEHA 1Y8NB 1WTOA 2B8FA 4DU9A 1WTQA 3BS1A 4LFAL 2E76C 4KI0A 2A1AA 2FJ2A 1PVOA 2NVQH 1SAPA 2JJQA 1D2BA 5DNFA 5C0XH 3J7YW 2X69A 4C2MB 4NDXA 1EUJA 1PH4A 5JEAG 1HA5A 3S1NB 4J15A 4A3GH 1U4LA 3J7AV 1LTID 4ZLTF 1YEZA 1U9RA 4N8X1 3J80c 2OT2A 1LT4D 2F0KA 4DV5L 5ELBA 2HQLA 4C1NI 4AIMA 3BU2A 1YITA 5CBAE 1LT5D 1WTHA 2JXMB 2PQEA 5EPJA 1CKOA 4UP8A 2ATWA 3ICEA 4JC0A 5GROA 2LS01 2XWBB 1J5EQ 2A68C 1RTNA 2OQ0A 4RCOA 4DV2L 2QKIC 4G7HC 1RODA 3G7LA 3H91A 1SRUA 3PIP3 1CSPA 4POFA 4GN3B 3GP7A 3QO2A 3J81c 2KENA 2JQOA 3DMUA 1SNQA 4YWMA 1LTRD 4RHRA 4AYBG 2I5HA 2K03A 1HA6A 3KK7A 4ME5A 1MKHA 2K5DA 1EWIA 2Z8LA 1F9QA 1EL0A 2F3WA 3CP0A 4DR3L 1JB3A 2DY8A 3PMFA 5EKKA 3GTJH 1EOVA 2A5HA 3NBHA 3PUYA 2VUMB 4LWCA 4DK0A 1GM5A 1T5EA 4LF8Q 4KY5A 4H7BA 2KVMA 4GLXA 1QE6A 1ESFA 1LO5D 1MHWC 3QR8A 5CV8A 2R92B 3V96A 3ERQA 2Q8TA 1N34Q 3S14B 2UUCQ 1UUPA 4LFCQ 3F2UA 2A6HD 1X55A 2JA9A 3K57A 1N33Q 1U0LA 4DR6Q 1S3OA 4XT3B 3C2PA 4UP9A 5GAEC 3HOWG 2DNEA 5FLMH 3CU7A 4HN7A 4E6IA 3H3VH 2EYPA 3NBHB 2N8NA 3PIO3 1ZEQX 4A3BH 1NBWA 2L5TA 1PRTF 3D3RA 3OIQA 2D2CC 3HOUB 1IZ6A 1YIJA 3A5ZB 2E2JH 2K4KA 1TY0A 5KNCA 2LXJA 1TWAB 2JA7G 3GTQB 1Q3LA 1NSNS 2EJGC 1GUOA 2HCIA 2KQ3A 4B08A 4DV6Q 1UEAB 4CJ1B 4A3FG 2HQEA 4KY7A 2Q2TA 5LMNL 2K28A 4A76A 2ASBA 3RNUA 3CCLA 1EFWA 2VQEL 4OONA 2HDLA 4UDUC 3K0XA 1PH6A 4FDBA 3RZDB 3M4OB 2IJ0A 1BOSA 1QJOA 5JJZA 2E5LL 5E3FA 4XQQA 5JVG3 4IFDI 1RJTA 2PMZB 3STBC 1B50A 1W3SA 3NQTA 1SFOB 2JA5G 5M5XB 2B2YC 3EVQA 1VQNA 1O7YA 1ASYA 5E7NA 2EVBA 5AJ3L 4H02A 1NY4A 1Z9FA 3RLOA 4OHJA 1D1KA 4R9WA 4JI1Q 5CMDA 1PH9A 4K0KL 2YV5A 1R4PB 1Y69U 1SNMA 4JI2L 5M5WB 1VQDA 2F0FA 4QGUA 5FO8B 3HOUH 3S1MB 4JI0Q 1GUWA 1EY4A 5IWAQ 5FJ8G 2PZTA 3GTQH 1NE3A 5C4XB 5DAUA 1PXUA 1SN8A 3HKZB 3K7AH 4JI7L 1CHPD 1XPOA 1O7LA 1BF4A 1VQLA 1EU4A 1FL0A 2XGTA 1EZ8A 1GHKA 4KHVA 4LFBQ 5JEAJ 1FGBD 5AFWA 4U673 4G7OC 4IPCA 1UAPA 5C4JH 4LF9L 3M4OH 1SE8A 3R93A 3V2TA 5KRUA 2O2LD 1LACA 4GLAC 1X65A 2P5ZX 4WFN3 4MNOA 4HEDA 1PA6A 3T16A 1L0WA 1SFOH 2WACA 3NWSA 5M5XH 3DXJC 1DJRD 5IYBH 1CZGA 4NMZA 4YIJA 2K50A 3MWYW 2EYOA 4YHHQ 3E5SA 2I46A 1Q8IA 2Y0SG 1PTOD 1MI2A 4JI3L 1N36Q 1BCPF 2C5CA 2F0IA 4BWGB 1ET6A 3KFUA 1IBMQ 4X65L 1EEID 5JPNC
chains in the Genus database with same CATH topology
1WTXA 3EJIA 4QUFA 2RDHA 4J8QA 1IHZA 3SVMA 2K5WA 2X6GA 3J7AF 5E4WC 1SYBA 2EY5A 2M00A 1TQOA 3VR5A 4RFBA 1DONA 5LL6X 2NTTA 1F2MA 1RF2D 1ICWA 2NTSA 3TMEA 3GTGB 4TRDA 5IODA 4FF1A 2F0NA 2VXWA 4H44C 1EFID 1HUMA 1PRTC 2MHVA 1TWFB 4KJNA 2F0MA 3VR6A 1GOZA 3A8KE 2OEOA 5C3WA 3X3NA 2OXPA 3LWEA 5IGFA 1WTRA 5C6AA 1EY9A 3SK8A 1AZQA 1ZYRD 5CV7A 4A3MB 2N55A 1B44D 2A6HC 4DNTB 2F1MA 3TN2A 3U9SA 4KKTA 3VYTA 2R93B 5CC4A 2HUGA 1JORA 4C3IG 3MC0B 3VA7A 4HMIA 3KLRA 5FLXE 5DEHA 2C9OA 5KYIA 3MFYA 3IFTA 4OO1H 4KD4A 1TU2B 2PNRC 3C3LA 2F4IA 1KDAA 4ZUIA 4CKCA 1EWHA 4O42A 3S16B 4A3FB 3E6ZX 4FP5D 2EYJA 3QWNA 1LTTD 4Q5VA 4K8IA 4IN3A 3MXPA 2NUCA 4HCSA 2O5IC 2A74C 4X3SA 3K5NA 5KYLA 2QDBA 4N9PA 4OL7A 1XWEA 1TKWB 5A2QE 2LMCB 3JAME 2PCFB 2IX3A 1KNEA 3TP7A 3KLSA 3HG9A 1KTKA 2YU9B 1KDBA 4K6LA 1LTSD 1ET9A 5CYUA 3GO5A 2Z1CA 3VR2A 2MPMA 1IKLA 1AW7A 1EOTA 1HXYD 4IUQA 5K36H 2RSNA 1F77A 2BDOA 2N88A 3T56B 5BN3A 2WP8J 3DHQA 2FFKB 3OMCA 3GD7A 3P1HA 1EY5A 3OW7A 2EY6A 4L6TB 1ZXTA 3DWAA 2DN8A 1F9PA 1B4OA 4IALA 2BE5C 3FEWX 1WD0A 4C3HB 3QIAA 1V8QA 1HQRD 2BA1A 3SXHA 1DCZA 1JOOA 2EPBA 1B3AA 4FNFA 1STAA 1PTOC 2V4DA 1RKNA 4IUTA 1EYCA 1HUNA 3N52A 5I9PA 2RSOA 4X3TA 3G6JB 2Y0SB 3SE0A 3EFXD 4S3SA 4GZYC 1TR5A 3ZYYX 2JA6B 3NTHA 1BQQT 1GUSA 2B2TA 3IKJA 3NE5B 2MJ8A 5C44B 1MD2D 4IUVA 4IUPA 1HPCA 4HAEA 4U68A 4ABNA 1BXTA 3I72A 5T1IA 4HR7B 2JP1A 2NVXB 1LTGD 4A93B 2IWHA 3P75A 2KCNA 5FLXL 3A8JE 3KF8A 3NQIA 1JR0D 5J1ZA 5C0XI 1EQTA 1GHJA 1CHQD 5F2DA 5G3LF 1I4XA 2QCPX 1ZYRC 4C3JG 1C8CA 3LX0A 4ILWA 5M9OA 2IX0A 4IFDG 1F2ZA 1RHPA 2EYHA 2L0CA 1AP0A 3TZUA 5D3DA 5KEEA 1SNPA 3HOXB 1FNVA 2F0WA 2BOSA 4A3IB 4K6DA 5ELCA 1SJHD 4KD3A 5I9OA 3QB3A 4K2KA 4DXFA 2NVTB 1FR3A 1ILPA 4LJZC 4NP5A 2AUJD 4QUCA 1PDQA 1GUNA 4RGTA 5A2QL 5J39A 2BA0A 2AUKA 5M3MB 2F0LA 1FNUA 3JAML 2E2DC 4C3IB 1PTOB 5T1GA 1STGA 1MSHA 2K33A 1V43A 3MTSA 3DUZA 3E0JA 1XXGA 1F9RA 1O80A 4O1NA 1Y1VB 3PUWA 2TMPA 4XYQA 4MN3A 3KBXA 4ZAIA 1TT2A 4V0BA 2ID0A 4ULLA 2RBMA 4RH6A 3C1FA 4C56C 4X3UA 2H1EA 2KECA 4ZUJA 1GUTA 2L11A 4ZYSA 3RMHA 1A2TA 1OO9B 1DM0B 3TP8A 1DYQA 3VA5A 2NYZD 1SE2A 2MUYA 4BS9A 4X3KA 2FINB 3BZDB 1J9OA 2A6ED 1I3QB 3BVMA 4NKLA 2J0TD 5CV5A 1A3VA 4BBRB 4K2LA 1PTOH 3FMCA 5CV4A 1DOLA 4DK1A 3M85A 1M8AA 2ENBA 1QCBD 2G9HD 3BVZA 4KN4C 4R8NA 4J6HA 1S5ED 4BA1I 5IGGA 2L12A 1WD1A 4QCLA 3UI2A 1TS3A 1HFGA 4IUNA 3GTOB 3SR1A 1F2LA 2D9UA 2PZUA 1RCVD 2Q8RE 1ESRA 1STYA 2HCCA 1Z6HA 1SYCA 2R61A 4V190 2BCOA 5ELEA 1WTPA 3FDTA 1CM9A 1YNND 3TZDA 5TSSA 1EY0A 1HCZA 4WJWA 3MZ5A 1EY8A 2JEBI 5ELFA 1S5BD 1Y1WB 1I6HB 4CKBA 2NWGA 2B2VA 4IQZA 3D8GA 2KHSA 4K14A 3GTMB 3VR3A 3RD4A 4EQOA 1F2YA 3ITPA 3NBIA 1PFBA 5D14A 4OIKA 5FO9B 2Q8IB 5EBDA 1SYDA 4R8IA 3MHBA 3K5OA 4RCNA 3EQLC 2IL8A 4FYDA 3QJYA 2SDFA 2E74C 4K5VA 2EDGA 3RLFA 2EY2A 3L7ZC 1IYUA 3K5LA 1T5XD 4XXEA 4FF4A 3PO3B 4DAYA 4QB4A 5BN4A 1AEXA 4XTCS 2XRSD 1STEA 5KNDA 1B2TA 1G291 2ZXPA 4PMWA 1EWCA 1KABA 1EY6A 3S15B 4KKSA 4C3JB 1HQMC 3GQBA 1HFNA 2ICIA 1SNDA 3OMGA 3VR4A 2ICEC 4LAAA 1Q1BA 4JBWA 2B39A 5I6YA 5KGUA 2F0TA 1RTOA 1HHVA 2YYZA 3D4DA 1I4GA 2KEEA 2KUMA 4KY6A 4P2CB 1D5XC 3LWUA 3DM1A 2L4NA 1VMPA 1JICA 2KOLA 4Y7NB 4DN4M 4ZKCB 3I3CA 3I8ZA 3KBGA 4CHTB 3VYRA 3W3AA 2PO4A 3OOCA 3SHLA 3C1EA 1VCIA 2SOBA 1I50B 4XYOA 4N9TA 4WRDA 3TP6A 3ONAB 2AQ1B 1O78A 1X32A 1JQYD 4I7ZC 3NTIA 3GTLB 5EBCA 1S5DD 3I91A 3QG1A 5IT9E 4BA2I 3CHBD 1PFNA 4MIUA 3R8BA 1MBYA 2NN6H 1L0XB 3Q22A 1PTOF 4OO1I 5I6WA 2K1BA 1S4ZA 3HOVB 3BG3A 1K83B 3HP3A 4AYBB 5C3XA 5JEAH 3D4RA 1XTCD 4MHEA 1Y8OB 5IGDA 4IURA 4XIGS 2K01A 3OWFA 1G2SA 4ZQ3A 1FYCA 1NUCA 2DY7A 5LHY1 2FMCA 5C0XG 3M3YB 2CQAA 1B9MA 5KNBA 3TDQA 3S2DB 4QMGA 1HTLD 1BDOA 5C4ZA 3IFDA 4UAIA 3ND8A 1BR9A 1BBXC 3AB9A 3NWTA 1SMYD 4KJOA 4NW2A 5CV6A 3V05A 3FPPA 1WTWA 1DXMA 3Q24A 2E2HB 1SNOA 2WIIB 1WTVA 3SEBA 2Z4HA 3HOWB 4FF2A 3CRLC 3CRKC 4DAPA 1EIHA 2JA7B 4BBSB 1KNAA 3PO2B 1OXSC 4ID6A 2PYKA 3D6CA 2R3ZA 2EJMA 1GUGA 3NHHA 3Q0AA 3C46A 2B2TC 3J80E 2JA5B 1PMRA 5CV9A 4F8MA 1EEFD 1PLFA 4CJ0B 3P20A 1V1OA 5JVH3 1EYDA 1DOMA 1KAAA 2JYOA 3SK4A 1SYFA 1DD2A 4ZKBB 5EKLA 3QOLA 3T4AC 1BNZA 1NCVA 2MP1A 4FXGC 1I6VC 1E2ZA 2IT1A 1PZJD 1U4MA 2EYFA 2CVRA 5FKAC 5ELDA 1V1PA 1XX8A 3J81E 1D1IA 5EGTA 1U4PA 5IT9L 4EVOA 1Q90A 1A3UA 3I4LA 4J1MA 2D5DA 3NPPA 5JPMC 1R9TB 1WVLA 2XWJB 2B8GA 1E0BA 1W6JA 3NUCA 3GTPB 5EKIA 2D62A 2QILA 1ENAA 4G7ZC 5E4XA 1GXDC 1V1PB 4PMBA 2XVSA 3O13A 1VDZA 4KN7C 5EJWA 3NP8A 1UNSA 3MA2B 2E2IB 4BY7B 5C3EB 1STNA 4KV6A 2WINB 3MVVA 4M1UB 2B63B 1IYVA 3X3MA 3D6WA 2VB3X 2F3VA 2H4OA 3OHXC 4HMJA 1K8OA 3M7NA 1G91A 1IW7D 5C0XJ 1TIID 1II3A 3HOZB 2NBFA 1IL8A 3N6RA 2A69D 2F0JA 1STHA 2CHBD 4ZRZA 4OGQC 3AMUA 1CK1A 5C4HA 1LABA 3MXUA 1LT3D 3IL8A 5JOBA 1LTBD 3BDLA 1C4QA 2QF7A 1JCKB 2VNUD 2PPBC 4HSVA 1BCPB 3PUZA 3VYUA 1LTAD 2NVQB 2B2WC 1NAPA 1H9SA 4C1NK 2F0HA 1AZPA 3J80L 4JK1C 5M3FB 3FKIB 2EYLA 3TSSA 1JE4A 1MGSA 4TQUS 3L9AX 1JC7A 5KIXA 2XSCA 2AWNA 1EYAA 4KMUC 5EPLA 1W6KA 2NZ1D 4RKBA 1QNUA 5DM73 4M8AA 1H9SB 1EU3A 4FVMA 1SSOA 1OXUA 5NUCA 3J81L 3WOEA 3LNNA 1X3PA 5CORA 1F9SA 2XRQD 4HTHA 5IIFA 2B2VC 3D31A 2J4XA 1STBA 3A55A 2JSOA 3EA6A 1U4RA 2X6LA 4H0LC 3P7JA 3U9OA 2O4XA 3GV3A 1OXVA 3FRPB 3GTJB 3TP5A 3K6OA 2RA4A 1CT1D 1ENFA 4FXDA 3WOFA 2B2WA 2NB0A 5HURA 5HGTA 3GV6A 2TSSA 2K6AA 3DEOA 1I4QA 5IGEA 1DOKA 5JAVA 2F0EA 3K5MA 1TS5A 3I90A 3OPOA 2IW3A 2LKVA 1SXTA 1LV9A 1ONLA 2F0SA 1QG7A 1M4VA 4A3BB 4IZ8A 4OO1G 1PRTD 1J8IA 2O5JC 2B2UA 1BO0A 1B1ZA 1SYEA 2E2JB 2RDGA 3PV0A 1Z7TA 2GA4B 3HOYB 1FD7D 4LK1C 5COYA 1ENCA 3A56A 1X3QA 3HGBA 3SK6A 2KA7A 4PV1C 2JA8B 2SNMA 2CW0D 2EY1A 3BVGA 2WV6D 3BYYB 1OXTA 2EXZA 2SEBD 2AQ2B 1EQVA 2LY7A 4KHZA 1G2TA 1JWUD 3HZXA 4Q0FA 3VYSA 1XYIA 1HTPA 1EY7A 1CZWA 2RVLA 4IFDJ 3KUPA 4F7XA 1IW7C 3L3OC 5ISRA 1QB5D 2K05A 2F03A 1CTMA 2A69C 1CQVA 2EOTA 5K36G 3K7AB 1I4RA 2JE6I 1GJXA 4G57A 2PW5A 1AN8A 1D5ZC 1NR4A 4CKEA 5C4JB 4RA8A 3BDOA 1SNCA 1S5CD 4QF4A 2R6GA 4K5WA 4XQJA 3IAYA 2AQ3B 2F0VA 2EYMA 3Q6SA 3WDNA 3A8IE 1KLGD 2KJXA 1VF5C 3Q23A 1YNJD 4RGMA 3M7GA 3T13A 3QOJA 1BCPD 3DEPA 1SYGA 2EE1A 5DM63 4RGOS 2L9HA 1KDCA 4DXGA 2LFNA 2NN6I 4HSPA 4FF3A 2EZVA 1JOQA 3W2DA 2NVYB 2OF1A 5EPKA 4I65A 5CGKA 2F0QA 4C3HG 1G8ZD 1H9JA 4DAVA 1AFPA 1QWYA 2BE5D 3OIPA 1C48A 3PUXA 2WKCA 4IFDH 3SK5A 1CQFA 1A15A 4XQNA 1LLRD 1QILA 1JWSD 4K8JA 4LMQD 4CGYB 3NSWA 4BY1B 3SDZA 2A6EC 4A3KB 1OXXK 1TWCB 1HRJA 4KTAA 2B2YA 5IGBA 1L0YB 1D6EC 2AWOA 1EIGA 5D65A 5C5LA 2FMMA 3S9WA 4A3EB 2XN9C 2G9DA 1TS2A 1B53A 2XIWA 3NTKA 3ND9A 1JWMD 2K5QA 5FOBB 2PW7A 3DWPA 3NXWA 5BN5A 3H94A 4FO2A 2K7VA 3M4YA 4CJ2C 1Q1EA 2XNAC 3BDCA 3RZOB 4CBVA 4OIJA 2K32A 4F87A 1QNKA 3I4NB 3URYA 3FVQA 1YNNC 3A7AB 1CA5A 2WAQB 4ZK9B 5CR3A 1TS4A 3I73A 1TY2A 2CW0C 4H13C 1R4QB 2RKSA 4A3DB 1Z47A 2WB1B 4KKUA 5C5MA 3T51B 1MSGA 3CKIB 5LL6S 5CBEE 5J22A 5M5YB 4DA2A 4XDXA 1I4PA 3NK9A 1K8MA 3S17B 2IX1A 4PQXA 1H9KA 2M9VA 3BYTB 4IUUA 1B9NA 1RD9D 3RUZA 2F0GA 4RHSA 2M2LA 4XT1B 2J7ZA 2SNSA 3EROA 3I4MB 3S1QB 4Z9CB 3H6MA 3K0YA 5D3IB 3KLSX 2L1BA 3HRZC 5FO7B 1D5MC 3OSOA 4QIWB 3H0GB 1NR2A 2ZT9C 3K58A 2DNCA 3MXNA 1IKMA 4ODGA 1PZID 2A73B 4WORA 1YNJC 4RGNA 2ZXRA 1ZKOA 1BCPC 5A35A 1FNWA 5IOCA 4EGVA 2KCCA 1S5FD 1A2UA 2A68D 2RQXA 1QOHA 1LT6D 1SE3A 4KK7A 4TKOB 1ILQA 1PRTB 4EQNA 3TBIB 4HCEA 2KEDA 3AU7A 2VB2X 3R3OA 1VF7A 4FXKC 1TWHB 1CI3M 1SEBD 3PUVA 3A7LA 5E1FA 4DGZA 3CQZB 1CFMA 1Y8PB 3MXGA 5IGCA 3HEJA 5I2YA 4DF7A 1I4HA 1KLUD 1PYWD 4TSSA 1SBBB 1A6XA 2IPKD 1E2VA 1Q12A 4A3JB 2F0UA 3S2HB 3MAQA 1G6ZA 3I70A 2K04A 4EQPA 1BUVT 1DZ1A 2WKDA 2I07B 4L8JA 5G3LD 2MGSA 4K5XA 5I2XA 1VMCA 1PZKD 1RDPD 1WCMB 4G4KA 4DNRB 2R7ZB 3R2IA 1SJED 2F0OA 3S1RB 3OWEB 3A54A 2PZWA 5EQ0A 2BDNA 4DFAA 1SDFA 1EZ6A 4PNYA 4RKLA 3T53B 1A3TA 3K59A 3DWQA 5K5PA 1TVXA 3MFGA 3H3VC 2E75C 4RWSC 2FHTA 1JOKA 3R2TA 3GTKB 1SMYC 2L55A 4B9WA 3HS0C 2F0PA 4A3GB 2QEJC 2Z4IA 1SE4A 4B9XA 5FK9C 2EJFC 3FPUB 1ML0D 4PMCA 1H9MA 2RDFA 1E2WA 2ZXOA 1CA6A 4F88A 1TWGB 2JEAI 5I4DA 1O7ZA 1PFMA 2B2UC 4L63B 4RAUC 2HDMA 1H9RA 3H09A 2NN6G 2F0DA 3D4WA 3MEHA 1Y8NB 1WTOA 2B8FA 4DU9A 1WTQA 3BS1A 2E76C 4KI0A 2FJ2A 1SAPA 1D2BA 5DNFA 5C0XH 3J7YW 2X69A 4C2MB 4NDXA 5JEAG 1HA5A 3S1NB 1U4LA 3J7AV 1LTID 4ZLTF 1U9RA 2OT2A 1LT4D 2F0KA 5ELBA 4C1NI 5CBAE 1LT5D 2JXMB 2PQEA 5EPJA 2LS01 2XWBB 2A68C 1RTNA 4RCOA 2QKIC 4G7HC 1RODA 3G7LA 3H91A 3PIP3 3GP7A 3QO2A 3DMUA 1SNQA 1LTRD 4RHRA 2K03A 1HA6A 3KK7A 4ME5A 2K5DA 2Z8LA 1F9QA 1EL0A 2F3WA 1JB3A 2DY8A 3PMFA 5EKKA 2A5HA 3NBHA 3PUYA 2VUMB 4DK0A 1T5EA 4KY5A 4H7BA 2KVMA 1QE6A 1ESFA 1LO5D 5CV8A 2R92B 3V96A 3ERQA 2Q8TA 3S14B 1UUPA 3F2UA 2A6HD 3K57A 4XT3B 3C2PA 2DNEA 3CU7A 4HN7A 4E6IA 2EYPA 3PIO3 1ZEQX 2L5TA 1PRTF 3D3RA 3OIQA 2D2CC 3HOUB 1TY0A 5KNCA 1TWAB 3GTQB 1Q3LA 1NSNS 2EJGC 1GUOA 2HCIA 2KQ3A 4B08A 1UEAB 4CJ1B 2HQEA 4KY7A 2K28A 2HDLA 4UDUC 3RZDB 3M4OB 2IJ0A 1BOSA 1QJOA 5JJZA 5E3FA 4XQQA 5JVG3 4IFDI 1RJTA 2PMZB 1B50A 3NQTA 1SFOB 5M5XB 2B2YC 3EVQA 1O7YA 2EVBA 4OHJA 1D1KA 4R9WA 5CMDA 1R4PB 1Y69U 1SNMA 5M5WB 2F0FA 5FO8B 3S1MB 1GUWA 1EY4A 2PZTA 5C4XB 5DAUA 1PXUA 3HKZB 1CHPD 1O7LA 1BF4A 1EU4A 1EZ8A 1GHKA 4KHVA 5JEAJ 1FGBD 5AFWA 4U673 4G7OC 1UAPA 3R93A 3V2TA 5KRUA 2O2LD 1LACA 4WFN3 4HEDA 3T16A 2WACA 3NWSA 3DXJC 1DJRD 1CZGA 4NMZA 4YIJA 3MWYW 2EYOA 3E5SA 2I46A 1Q8IA 1PTOD 1MI2A 1BCPF 2C5CA 2F0IA 4BWGB 1ET6A 1EEID 5JPNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4D A;  1U9R A;  3OSO A;  4QMG A;  3MZ5 A;  1EY8 A;  1NSN S;  3EJI A;  5C4Z A;  5EGT A;  5KYI A;  2F0K A;  2F0L A;  2KQ3 A;  4KY6 A;  2F0V A;  4EVO A;  1IHZ A;  2EYM A;  1STG A;  2F0O A;  4KD4 A;  4K14 A;  2HQE A;  3D8G A;  1A3U A;  2KHS A;  4KY7 A;  4S3S A;  4ODG A;  2LKV A;  4KJO A;  4J1M A;  2F0H A;  4WOR A;  1TR5 A;  4EQO A;  2F0S A;  3BDC A;  2PQE A;  5CV6 A;  1F2Y A;  3T13 A;  1KDA A;  3QOJ A;  4ZUI A;  4IZ8 A;  2PZW A;  1SYB A;  2EY5 A;  2M00 A;  5IOC A;  3ITP A;  1TQO A;  1SYG A;  4DFA A;  1EZ6 A;  1SYE A;  1TT2 A;  2EYJ A;  1SNO A;  4PNY A;  1A3T A;  2EYL A;  4RKL A;  1A2U A;  5E3F A;  5K5P A;  3NUC A;  5CR3 A;  1KDC A;  1F2M A;  3NQT A;  2RBM A;  4K8I A;  3C1F A;  1SYD A;  1ENC A;  3MHB A;  1ENA A;  5KIX A;  3EVQ A;  3SK6 A;  4EQN A;  3TME A;  3SHL A;  1JOK A;  1EYA A;  3MXP A;  4ZUJ A;  1JOQ A;  3C1E A;  2SNM A;  4TRD A;  2NUC A;  5IOD A;  5ISR A;  2SOB A;  2RKS A;  2EY1 A;  4RKB A;  2F0N A;  4PMB A;  2OF1 A;  1A2T A;  3DMU A;  2EXZ A;  4K5V A;  1SNQ A;  4I65 A;  3TP8 A;  3R3O A;  4B9W A;  5KYL A;  2F0P A;  2QDB A;  5CGK A;  3VA5 A;  4N9P A;  4OL7 A;  5C5M A;  4N9T A;  2F0Q A;  2EY2 A;  4WRD A;  1EQV A;  3P75 A;  3TP6 A;  1SNM A;  3NP8 A;  4ME5 A;  4ID6 A;  2PYK A;  3D6C A;  2F0F A;  4KJN A;  3HZX A;  2F0M A;  4B9X A;  1STN A;  5J22 A;  2F3W A;  4KV6 A;  5NUC A;  3MVV A;  5J1Z A;  1EY4 A;  3PMF A;  4NKL A;  2PZT A;  5CV5 A;  1A3V A;  5E1F A;  5EKK A;  4DGZ A;  4K2L A;  1EY0 A;  4QB4 A;  1EY7 A;  5DAU A;  2OEO A;  4PMC A;  1AEX A;  4HTH A;  3TP7 A;  5C3W A;  3NK9 A;  5CV4 A;  5IIF A;  2OXP A;  5IGC A;  1KDB A;  5IGF A;  4MIU A;  3HEJ A;  3NHH A;  1STB A;  2RDF A;  4KY5 A;  5F2D A;  3SK5 A;  4H7B A;  1EZ8 A;  5C6A A;  2ENB A;  4KHV A;  4DF7 A;  1EY9 A;  2F3V A;  3SK8 A;  4HMJ A;  4F7X A;  3LX0 A;  4K8J A;  5CV8 A;  3U9O A;  5CV9 A;  4F8M A;  1II3 A;  5M9O A;  5KRU A;  3V2T A;  2O4X A;  1F2Z A;  3ERQ A;  1KAB A;  4R8N A;  3DHQ A;  2F0G A;  5CV7 A;  3RUZ A;  4J6H A;  3OMC A;  2EYH A;  1EY6 A;  5I6W A;  2F0U A;  5IGG A;  3P1H A;  1EY5 A;  2F0D A;  3D4W A;  3MEH A;  3TP5 A;  4EQP A;  2EY6 A;  2F0J A;  1STH A;  1EYD A;  5KEE A;  1SNP A;  3T16 A;  2WAC A;  2F0W A;  4IAL A;  4DU9 A;  4KTA A;  1KAA A;  2SNS A;  4IUN A;  5C3X A;  4K6D A;  5CC4 A;  3SR1 A;  5IGB A;  2PZU A;  4G57 A;  1SND A;  3ERO A;  3OMG A;  4KD3 A;  4K5X A;  5C5L A;  3SXH A;  4LAA A;  5I9O A;  3SK4 A;  4NMZ A;  3S9W A;  2PW5 A;  3QB3 A;  1JOO A;  1JOR A;  1STY A;  1SYF A;  4K2K A;  4YIJ A;  5C4H A;  5HGT A;  5HUR A;  2EYO A;  5IGD A;  1SYC A;  3E5S A;  3OWF A;  4NDX A;  3QOL A;  3H6M A;  5EKL A;  2EYP A;  4E6I A;  1STA A;  5I6Y A;  5KGU A;  4HMI A;  4NP5 A;  4ZQ3 A;  5JOB A;  1NUC A;  2F0T A;  2F0I A;  1RKN A;  1SNC A;  1EYC A;  5DEH A;  5IGE A;  3BDL A;  5J39 A;  4QF4 A;  2PW7 A;  5I9P A;  2EYF A;  5JAV A;  2F0E A;  4K5W A;  3NXW A; 
#chains in the Genus database with same CATH topology
 1WTX A;  1VQP A;  3EJI A;  4QUF A;  2JA6 G;  2RDH A;  1NTG A;  4J8Q A;  3ULJ A;  1UE7 A;  1IHZ A;  1C9O A;  3SVM A;  2K5W A;  2F3I A;  1XPR A;  2X6G A;  1XNQ L;  4OWX B;  2HIV A;  3J7A F;  5E4W C;  1SYB A;  2EY5 A;  2M00 A;  4N8F A;  2B63 G;  3A0J A;  1TQO A;  3VR5 A;  4RFB A;  1DON A;  5LL6 X;  2NTT A;  3OW2 A;  1F2M A;  1RF2 D;  1ICW A;  1HNZ Q;  5BR8 Q;  2NTS A;  1NJI C;  4A93 G;  3TME A;  3GTG B;  4TRD A;  5IOD A;  4FF1 A;  2F0N A;  1K28 A;  2VXW A;  4H44 C;  1EFI D;  1JJ2 A;  1HUM A;  1PRT C;  2MHV A;  2Q2H A;  1TWF B;  4DV3 L;  2DUD A;  4KJN A;  2F0M A;  3VR6 A;  1GOZ A;  3PQI A;  3M4Q A;  4GNX A;  1O7I A;  3A8K E;  1SMX A;  3CC2 A;  1HNX L;  2OEO A;  5C3W A;  1TWC H;  3X3N A;  1IBL L;  2OXP A;  3LWE A;  1VQ7 A;  5IGF A;  1HNW Q;  2K75 A;  4PZ6 A;  5IYC H;  1WTR A;  5C6A A;  3AEV A;  1EY9 A;  3SK8 A;  4A3E H;  4B3R L;  3J7Z C;  4X62 L;  2MO0 A;  1AZQ A;  1ZYR D;  4OX9 L;  1VQ4 A;  3HOX G;  2VL6 A;  4A3I G;  1M90 C;  5CV7 A;  4A3M B;  1PH2 A;  2N55 A;  4DR7 Q;  1PHJ A;  2WAQ E;  1B44 D;  2ZM6 L;  2A6H C;  3CCU A;  4DNT B;  2F1M A;  3TN2 A;  3U9S A;  4KKT A;  5M3F G;  3VYT A;  2R93 B;  5CC4 A;  2HUG A;  3FKI G;  2YTV A;  3KLW A;  4L5S A;  1JOR A;  5M3M G;  1JT8 A;  4GNX B;  4A3L H;  1Y14 B;  4C3I G;  1BVS A;  3RZO H;  3MC0 B;  3VA7 A;  4HMI A;  2WB1 E;  1X6O A;  3KLR A;  3PCO B;  5FLX E;  4GOP C;  1X54 A;  2DGY A;  5DEH A;  4JI6 Q;  3I4N H;  2C9O A;  1TWF H;  2K5V A;  1SLJ A;  1HZB A;  2AHO B;  4OEM B;  2EIF A;  4Y52 H;  5KYI A;  1QZG A;  4CDE C;  3CXC A;  3MFY A;  1VQH A;  3IFT A;  4OO1 H;  1XNR L;  4KD4 A;  1TU2 B;  1CSQ A;  2PNR C;  3C3L A;  2F4I A;  1KDA A;  4ZUI A;  4EQ5 A;  4CKC A;  1EWH A;  4O42 A;  3S16 B;  3K8A A;  3E6Z X;  1LYL A;  4FP5 D;  4A3F B;  2EYJ A;  2K5H A;  3QWN A;  1LTT D;  2R7D A;  4Q5V A;  1VQF A;  4A3M H;  1PH3 A;  4K8I A;  5M5Y H;  4DR4 Q;  4IN3 A;  4PZ8 A;  3MXP A;  2R93 H;  2NUC A;  4HCS A;  4IJH A;  1FJG L;  3UDX A;  4KHP Q;  4R4C A;  3S17 H;  2O5I C;  2A74 C;  3BZC A;  4X3S A;  3K5N A;  2VY3 A;  5KYL A;  2QDB A;  4N9P A;  4OL7 A;  4P75 A;  4LF5 Q;  1XWE A;  2UXB L;  3S24 A;  1TKW B;  5A2Q E;  2LMC B;  5HY6 A;  3JAM E;  2PCF B;  2IX3 A;  4B3S L;  4QIW E;  1KNE A;  4LW1 A;  3TP7 A;  3KLS A;  3HG9 A;  1KTK A;  3JC6 6;  2KBN A;  2YU9 B;  1KDB A;  4K6L A;  1VQM A;  1LTS D;  1ET9 A;  1LM0 A;  4A75 A;  3I4M H;  5CYU A;  3GO5 A;  2Z1C A;  3VR2 A;  3S1Q H;  1VS0 A;  2MPM A;  1IKL A;  1AW7 A;  1EOT A;  1HXY D;  4JCV E;  4IUQ A;  1L1O C;  5K36 H;  4JI8 Q;  2RSN A;  1F77 A;  2BDO A;  2N88 A;  3T56 B;  4GKJ L;  5BN3 A;  2WP8 J;  3DHQ A;  1L2F A;  2FFK B;  3OMC A;  4GOP A;  3GD7 A;  3P1H A;  1EY5 A;  3OW7 A;  2FXQ A;  2EY6 A;  4L6T B;  1ZXT A;  3DWA A;  2QEX A;  1N32 L;  2DN8 A;  1F9P A;  1B4O A;  4IAL A;  4LF7 Q;  2BE5 C;  3FEW X;  1WD0 A;  1W2B A;  3H0G H;  4C3H B;  3QIA A;  4L5R C;  1V8Q A;  1HQR D;  2BA1 A;  3SXH A;  2VQF L;  4QQB X;  4NPS A;  1DCZ A;  1JOO A;  3HOY G;  2EPB A;  1B3A A;  4FNF A;  1STA A;  1PTO C;  2V4D A;  3I4O A;  1GO3 E;  1Y1W G;  2JA8 G;  1RKN A;  5JJL A;  4IUT A;  1EYC A;  1HUN A;  5IYD H;  3N52 A;  5I9P A;  4DV4 Q;  3S1M H;  2RSO A;  4X3T A;  3G6J B;  1CKM A;  2Y0S B;  3SE0 A;  3EFX D;  5DLQ E;  4NXN L;  4X64 L;  4GOP B;  3OYY A;  4S3S A;  4GZY C;  3FP9 A;  1TR5 A;  4NB3 A;  3ZYY X;  4DPG A;  4B3T L;  2JA6 B;  3NTH A;  1BQQ T;  4JV5 Q;  1GUS A;  2B2T A;  3IKJ A;  3NE5 B;  2ZJQ A;  2MJ8 A;  5C44 B;  3JAM i;  1TWH H;  3RR5 A;  4JI5 L;  1MD2 D;  4IUV A;  4IUP A;  1Q8K A;  1HPC A;  4WJ3 M;  4HAE A;  4U68 A;  4ABN A;  4C3H H;  4LF4 Q;  1BXT A;  3I72 A;  5T1I A;  4HR7 B;  3E9I A;  1N8R C;  3PO3 G;  4DUY L;  2JP1 A;  2NVX B;  1LTG D;  4YY3 Q;  4A93 B;  2IWH A;  3P75 A;  2KCN A;  5FLX L;  3A8J E;  3KF8 A;  4A3J H;  4NXM L;  4R4O A;  3NQI A;  1JR0 D;  5J1Z A;  1YJ9 A;  5C0X I;  3S2H H;  1EQT A;  2QW7 A;  3KF6 B;  1HR0 L;  1GHJ A;  1CHQ D;  3OTO Q;  5F2D A;  5G3L F;  1I4X A;  1K73 C;  2QCP X;  1ZYR C;  3F1Z A;  4C3J G;  1C8C A;  2ZTC A;  3LX0 A;  4ILW A;  1YBY A;  5M9O A;  2IX0 A;  4IFD G;  1F2Z A;  5C44 H;  2I0Q A;  1RHP A;  2EYH A;  3I2Z A;  2L0C A;  4LF6 L;  3UE0 A;  1AP0 A;  3TZU A;  5D3D A;  4JYA Q;  5KEE A;  4B3M L;  1SNP A;  2R7Z H;  1YVC A;  3HOX B;  1FNV A;  2F0W A;  2BOS A;  4A3I B;  4K6D A;  5ELC A;  5LMU L;  3KF8 B;  1SJH D;  4KD3 A;  3E9H A;  5I9O A;  1I5F A;  3CAM A;  3S1R H;  2OWO A;  3QB3 A;  4K2K A;  1K8G A;  4DXF A;  2NVT B;  1FR3 A;  1ILP A;  4LJZ C;  4NP5 A;  2AUJ D;  2ZTE A;  4GN4 B;  4QUC A;  2NVX H;  1PDQ A;  1GUN A;  4RGT A;  5A2Q L;  5J39 A;  1NMG A;  2BA0 A;  2AUK A;  4DK3 C;  5M3M B;  2F0L A;  1FNU A;  1D8L A;  4MTK A;  5IP9 G;  3JAM L;  2YTX A;  2E2D C;  2LXK A;  4C3I B;  1PTO B;  5T1G A;  1XPU A;  2H5X A;  1STG A;  1MSH A;  2K33 A;  1V43 A;  3MTS A;  3DUZ A;  5ELO A;  3E0J A;  4GN5 A;  3GTK H;  1XXG A;  1F9R A;  1O80 A;  2UU9 Q;  4O1N A;  1Q86 C;  1Y1V B;  3PUW A;  2TMP A;  4XYQ A;  4BXX H;  4MN3 A;  3KBX A;  4ZAI A;  1KD1 C;  1TT2 A;  3G4S A;  4V0B A;  2ID0 A;  4ULL A;  2RBM A;  4RH6 A;  3C1F A;  4P71 A;  4C56 C;  4X3U A;  1VQ8 A;  2H1E A;  3CCV A;  2KEC A;  4ZUJ A;  4DV0 Q;  1GUT A;  2L11 A;  3UDI A;  3CC4 A;  4ZYS A;  4BY1 G;  3RMH A;  1A2T A;  2F52 A;  4DR1 Q;  1X3F A;  1OO9 B;  1DM0 B;  3TP8 A;  4A3K G;  2NVT H;  1DYQ A;  3VA5 A;  1TWG H;  4L5T A;  2NYZ D;  1SE2 A;  3A74 A;  2MUY A;  4BS9 A;  4X3K A;  3CMA A;  2JK8 A;  1EQQ A;  2FIN B;  3ERS X;  3BZD B;  1J9O A;  2A6E D;  1I3Q B;  1XMO Q;  3BVM A;  4NKL A;  2J0T D;  1VQA A;  1A3V A;  5CV5 A;  4BBR B;  2UXC L;  4K2L A;  3H3V I;  1PTO H;  3FMC A;  5CV4 A;  3CD6 A;  1DOL A;  3K7U C;  3PF4 A;  3L0O A;  4DK1 A;  3M85 A;  1M8A A;  2ENB A;  4UY8 C;  1QCB D;  2G9H D;  3HOV G;  2ZJR A;  4C2M H;  3BVZ A;  1Y1V H;  1FVI A;  1JJC B;  4KN4 C;  4R8N A;  1SRO A;  3S1N H;  4J6H A;  1S5E D;  2RCF A;  4BA1 I;  4HIK A;  5IGG A;  2L12 A;  1WD1 A;  4QCL A;  3UI2 A;  3CCE A;  5GAH C;  4IO9 A;  1TS3 A;  1YHQ A;  1HFG A;  4IUN A;  3GTO B;  3SR1 A;  1F2L A;  2D9U A;  2PZU A;  3WWV A;  1RCV D;  2Q8R E;  4PG3 A;  1ESR A;  4UPA A;  1STY A;  2HCC A;  1Z6H A;  1SYC A;  4AH6 A;  2R61 A;  4V19 0;  2BCO A;  1LUZ A;  4DR5 Q;  5ELE A;  1WTP A;  3FDT A;  1CM9 A;  1YNN D;  3TZD A;  1UEB A;  3NEL A;  1P8L A;  5TSS A;  1EY0 A;  4A3D G;  1HCZ A;  4WJW A;  3MZ5 A;  1I3Q H;  1EY8 A;  1RL2 A;  2JEB I;  5ELF A;  4BBR H;  1S5B D;  1Y1W B;  1I6H B;  2ES2 A;  4CKB A;  2NWG A;  2B2V A;  4IQZ A;  3D8G A;  2KHS A;  4K14 A;  4DUZ Q;  1VQ5 A;  4JOI A;  3GTM B;  3VR3 A;  1XTD A;  3RD4 A;  4EQO A;  3PIP A;  1F2Y A;  2PI2 A;  2YTY A;  1UE1 A;  3ITP A;  3NBI A;  1PFB A;  5D14 A;  3CCR A;  4OIK A;  5FO9 B;  2Q8I B;  5H1S E;  4YCU A;  2HHH L;  5EBD A;  1SYD A;  4R8I A;  3MHB A;  3K5O A;  2PQA A;  4RCN A;  4BBS G;  3EQL C;  2IL8 A;  3PO2 G;  4FYD A;  2VUM H;  2VS1 A;  3QJY A;  3EIV A;  2SDF A;  2E74 C;  4K5V A;  1KL9 A;  2EDG A;  4A3C H;  3RLF A;  2EY2 A;  3L7Z C;  3EN2 A;  1IYU A;  3UDF A;  2R92 H;  3K5L A;  5J3B A;  4LNQ A;  1T5X D;  4XXE A;  1QVG A;  1E1O A;  3S14 H;  4FF4 A;  1Q82 C;  3PO3 B;  4DAY A;  4QB4 A;  5BN4 A;  3T1H L;  2UUB Q;  1AEX A;  4XTC S;  1I6H H;  2D0P A;  2XRS D;  1STE A;  5KND A;  3K81 C;  1B2T A;  2Z0S A;  3GTM H;  1G29 1;  2ZXP A;  2PQA B;  4LF5 L;  4PMW A;  1UE6 A;  4DV7 Q;  4X66 Q;  4DV1 L;  1EIY B;  1EWC A;  1KAB A;  4OWW B;  3PIO A;  1EY6 A;  3S15 B;  2PNH A;  2PMZ E;  4KKS A;  1TWA H;  4C3J B;  1HQM C;  1SR3 A;  4JVZ A;  1AH9 A;  1IYJ B;  3GQB A;  2UXD Q;  1HFN A;  2ICI A;  1SND A;  3OMG A;  1A0I A;  2ICE C;  3PGZ A;  4LAA A;  3VR4 A;  2Z6K A;  1Q1B A;  4JBW A;  2B39 A;  4AQY L;  4DAY B;  5I6Y A;  5KGU A;  2F0T A;  1RTO A;  1HHV A;  5IP7 H;  4IPH A;  2YYZ A;  3RZD H;  4BA2 I;  3CF5 A;  3D4D A;  2IY5 B;  4GNX C;  1I4G A;  2KEE A;  3PF5 A;  2KUM A;  3M4P A;  4KY6 A;  4P2C B;  1X9N A;  1D5X C;  3LWU A;  3HKZ E;  1XMQ Q;  3DM1 A;  4YCV A;  1A63 A;  2L4N A;  1VMP A;  2UUA L;  1JIC A;  2KOL A;  3U50 C;  4Y7N B;  4DN4 M;  4ZKC B;  1I94 L;  1YHA A;  3I3C A;  3I8Z A;  1BKB A;  3KBG A;  4CHT B;  5M5W H;  3VYR A;  3W3A A;  2PO4 A;  3S15 H;  3OOC A;  4GKK Q;  1KC8 C;  5C4X H;  3SHL A;  3G71 A;  2BH8 A;  3C1E A;  3F2B A;  1VCI A;  2HT1 A;  1J6Q A;  2SOB A;  3IRB A;  4LFA Q;  4BY7 G;  2I5L X;  5C3E G;  1KAW A;  4WJ4 A;  1I50 B;  4XYO A;  4N9T A;  4WRD A;  3TP6 A;  3ONA B;  1WI5 A;  1JJG A;  2AQ1 B;  1O78 A;  1X32 A;  1JQY D;  4I7Z C;  3NTI A;  3ULP A;  3GTL B;  3TS0 A;  5EBC A;  1S5D D;  1WCM G;  3QG1 A;  3I91 A;  5IT9 E;  1VQE A;  3RN2 A;  3CHB D;  2A8V A;  4DV5 Q;  1PFN A;  4MIU A;  3HOZ G;  3PSI A;  3R8B A;  1MBY A;  2NN6 H;  2F4V L;  4Y7N H;  1L0X B;  3Q22 A;  1PTO F;  1Q7Y C;  4DR2 L;  1YJN A;  2A19 A;  4OO1 I;  5I6W A;  2ALY B;  2K1B A;  2K14 A;  1S4Z A;  3HOV B;  4DV2 Q;  3BG3 A;  3EBE A;  4IPD A;  1K83 B;  3HP3 A;  4AYB B;  5C3X A;  4R4T A;  5JEA H;  2EQS A;  3D4R A;  1XTC D;  4MHE A;  1Y8O B;  5IGD A;  2VW9 A;  4IUR A;  4XIG S;  2K01 A;  3OWF A;  1G2S A;  2L15 A;  1BBU A;  4ZQ3 A;  1FYC A;  1NUC A;  2DY7 A;  4JI4 L;  5LHY 1;  2FMC A;  5C0X G;  3M3Y B;  2CQA A;  1B9M A;  5KNB A;  1DGS A;  3TDQ A;  3S2D B;  4QMG A;  1HTL D;  1BDO A;  2Z9H A;  5C4Z A;  4DR3 Q;  1IBK L;  4GLV B;  3GTL H;  3IFD A;  4UAI A;  4A3G G;  4IOA A;  2IHF A;  3ND8 A;  1BBW A;  1BR9 A;  3T1Y Q;  4HJ9 A;  1BBX C;  3AB9 A;  3NWT A;  1SMY D;  1UE5 A;  3GTG H;  4KJO A;  1AE2 A;  2JN4 A;  4NW2 A;  5CV6 A;  3V05 A;  3FPP A;  1WTW A;  3TS2 A;  4IPG A;  1FGU A;  1DXM A;  3Q24 A;  2E2H B;  1SNO A;  2WII B;  2OTL A;  1WTV A;  3SEB A;  2KCT A;  2Z4H A;  3HOW B;  4FF2 A;  2N49 A;  3CRL C;  1JMC A;  3CRK C;  1VQG A;  1EIF A;  4DAP A;  1CUK A;  1EIH A;  2Z6B A;  2JA7 B;  4IJL A;  4BBS B;  1KNA A;  4QL5 A;  3W1B A;  3PO2 B;  1OXS C;  4ID6 A;  1PH1 A;  2PYK A;  2B29 A;  3D6C A;  2R3Z A;  2EJM A;  4DK6 C;  1K8A C;  1QVC A;  1VQ6 A;  1GUG A;  3NHH A;  3Q0A A;  3C46 A;  1X3G A;  5LMN Q;  2GN5 A;  2B2T C;  3J80 E;  2VQE Q;  2JA5 B;  4POG A;  1CKN A;  4O2D A;  1PMR A;  3HKS A;  5CV9 A;  4F8M A;  1EEF D;  1J5E L;  1PLF A;  1KRT A;  2XTI A;  4CJ0 B;  3P20 A;  1V1O A;  3U58 A;  2E5L Q;  5JVH 3;  1EYD A;  3HOW H;  1DOM A;  1K9M C;  1KAA A;  4TVA B;  2JYO A;  2CKZ B;  3SK4 A;  5AJ3 Q;  1SYF A;  1PH7 A;  1DD2 A;  4ZKB B;  2QA4 A;  5EKL A;  3AQQ A;  3QOL A;  3T4A C;  2JA7 H;  1BNZ A;  1NCV A;  2MP1 A;  1JE5 A;  4FXG C;  1I6V C;  1E2Z A;  2IT1 A;  3S16 H;  1PZJ D;  1U4M A;  4A3F H;  4JI2 Q;  2EYF A;  5FLM G;  2CVR A;  5FKA C;  5ELD A;  1V1P A;  1XX8 A;  3J81 E;  3AYH B;  1CKN B;  1D1I A;  5EGT A;  4A3B G;  2NZO A;  1U4P A;  5IT9 L;  4EVO A;  3KJO A;  4LF8 L;  1Q90 A;  1A3U A;  4JI7 Q;  3TRZ A;  3I4L A;  4J1M A;  2D5D A;  3NPP A;  5JPM C;  3U4V A;  1R9T B;  1WVL A;  2XWJ B;  1ICF B;  1KQS A;  2JA5 H;  2B8G A;  4EX5 A;  1N34 L;  1VQC A;  2UUC L;  4LFC L;  4LF9 Q;  2MNA A;  1E0B A;  1W6J A;  3NUC A;  3GTP B;  5EKI A;  3CCS A;  1N33 L;  2D62 A;  4DR6 L;  2QIL A;  1ENA A;  4CDD C;  4G7Z C;  5E4X A;  4GS3 A;  1GXD C;  3I7F A;  2YU9 H;  2GVA A;  1V1P B;  4PMB A;  3J80 i;  2XVS A;  3O13 A;  3H15 A;  5FJ8 H;  1VDZ A;  4KN7 C;  5EJW A;  4JI3 Q;  3NP8 A;  1UNS A;  3D0F A;  3MA2 B;  2E2I B;  4BY7 B;  4X65 Q;  5C3E B;  1STN A;  4KV6 A;  2WIN B;  4PZ7 A;  3MVV A;  2C35 B;  1HJP A;  4M1U B;  4DV6 L;  2IHE A;  2Y0S E;  2B63 B;  2WFW A;  1IYV A;  3X3M A;  3HOU G;  3D6W A;  2CQO A;  2VB3 X;  2F3V A;  2H4O A;  3KOJ A;  3OHX C;  4HMJ A;  1K8O A;  3KJP A;  1XNQ Q;  3M7N A;  1G91 A;  1IW7 D;  5C0X J;  1TII D;  1II3 A;  4I7A A;  3CPW A;  3HOZ B;  3J81 i;  2K5N A;  2NBF A;  2B3G A;  1IL8 A;  3F8T A;  1LTL A;  3N6R A;  2UUB L;  2A69 D;  2F0J A;  1STH A;  2CHB D;  1A62 A;  4ZRZ A;  3LGJ A;  1QZH A;  4OGQ C;  3AMU A;  2Q2U A;  1CK1 A;  4JI1 L;  3TQY A;  5C4H A;  1LAB A;  3A5U A;  3MXU A;  1LT3 D;  3IL8 A;  5JOB A;  2JA6 H;  1LTB D;  5IYB G;  4HJ5 A;  3MEF A;  4JI0 L;  3BDL A;  1C4Q A;  2QF7 A;  2OTJ A;  1JCK B;  5IWA L;  4DV3 Q;  2VNU D;  2PPB C;  4HSV A;  1BCP B;  3PUZ A;  1YNX A;  3VYU A;  1LTA D;  4JPB W;  2B63 H;  1HNX Q;  2NVQ B;  2B2W C;  1NAP A;  1IBL Q;  1H9S A;  4C1N K;  4LFB L;  2F0H A;  2MQH A;  3AFQ A;  1AZP A;  2AKW B;  1GD7 A;  4B3R Q;  4X62 Q;  3J80 L;  4LUO A;  4JBK A;  4OXP A;  4OX9 Q;  4JK1 C;  5M3F B;  4A93 H;  3FKI B;  2EYL A;  3TSS A;  1JE4 A;  1M1K C;  1MGS A;  4TQU S;  3L9A X;  1OTC A;  1JC7 A;  2ZM6 Q;  5HGQ A;  5KIX A;  2XSC A;  2AWN A;  5FLX c;  3ER0 A;  1EYA A;  1A8V A;  1X56 A;  4KMU C;  1W6K A;  5EPL A;  2NZ1 D;  4RKB A;  4YHH L;  4P74 A;  1QNU A;  1N36 L;  1MJC A;  1UWV A;  5DM7 3;  1IBM L;  5IY0 A;  4M8A A;  1H9S B;  1B7Y B;  1EU3 A;  4FVM A;  1SSO A;  4QJF A;  1OXU A;  4OWT B;  2DJG C;  5NUC A;  4GKK L;  3J81 L;  3WOE A;  1VQO A;  3LNN A;  1X3P A;  5COR A;  1F9S A;  2XRQ D;  4HTH A;  5JJK A;  1E24 A;  5IIF A;  3E0E A;  2B2V C;  3D31 A;  3HOX H;  4A3I H;  2J4X A;  1MJE A;  1STB A;  3A55 A;  1XNR Q;  4JOI C;  1Q46 A;  2JSO A;  3EA6 A;  1U4R A;  3SGI A;  2X6L A;  1GVP A;  4H0L C;  1PYB A;  4MZ9 A;  3P7J A;  3U9O A;  1T9H A;  5GAG C;  2RF4 A;  5M3F H;  2BH2 A;  2O4X A;  5IYC G;  3GV3 A;  3FKI H;  4A3E G;  1WJJ A;  1HNZ L;  1OXV A;  2E8G A;  3FRP B;  5BR8 L;  5M3M H;  3TP5 A;  3GTJ B;  1B70 B;  3K6O A;  4C3I H;  1HZA A;  4DAM A;  2RA4 A;  1CT1 D;  1ENF A;  4FXD A;  3WOF A;  2B2W A;  3JAM c;  4APV A;  1FJG Q;  2NB0 A;  5HUR A;  5HGT A;  3ULL A;  3GV6 A;  1C7Y A;  2TSS A;  2K6A A;  2GVB A;  3DEO A;  3E3X A;  3CCM A;  1I4Q A;  5IGE A;  2UXB Q;  1DOK A;  5JAV A;  2F0E A;  1YI2 A;  4A3L G;  3K5M A;  1TS5 A;  5LMN W;  4B3S Q;  3I4N G;  1B8A A;  1HNW L;  3I90 A;  3OPO A;  2IW3 A;  4P73 A;  2WAQ G;  2LKV A;  1SXT A;  1LV9 A;  1ONL A;  2F0S A;  1QG7 A;  1M4V A;  4A3B B;  4IZ8 A;  4OO1 G;  1PRT D;  1J8I A;  1NMF A;  2O5J C;  2B2U A;  1BO0 A;  1B1Z A;  3GDE A;  1SYE A;  2E2J B;  3W1G A;  4DR7 L;  4GKJ Q;  1D7Q A;  2RDG A;  3PV0 A;  3CCJ A;  1Z7T A;  2GA4 B;  3ZJY C;  2HIX A;  3HOY B;  1EYG A;  1FD7 D;  4LK1 C;  2OQK A;  5COY A;  2WB1 G;  1ENC A;  3A56 A;  1X3Q A;  3HGB A;  1PYS B;  3T1Y L;  3SK6 A;  2KA7 A;  1N32 Q;  4PV1 C;  2JA8 B;  1WOC A;  2SNM A;  1KIX A;  2CW0 D;  2Z6K C;  4A3M G;  2EY1 A;  3BVG A;  2WV6 D;  3BYY B;  2VQF Q;  3RLN A;  1OXT A;  2EXZ A;  2V1C C;  2VZA A;  2SEB D;  2AQ2 B;  4OEL B;  4DNI A;  1EQV A;  4JI6 L;  2R93 G;  2LY7 A;  4KHZ A;  1G2T A;  1JWU D;  3HZX A;  2KHI A;  4Q0F A;  5L37 A;  1ASZ A;  4UHV A;  3VYS A;  1XYI A;  2Q2I A;  1HTP A;  3NEN A;  1EY7 A;  2EXD A;  1CZW A;  4NXN Q;  4X64 Q;  2HD3 A;  3GTO H;  4CDC C;  2RVL A;  4O0A A;  4IFD J;  3KUP A;  4F7X A;  4B3T Q;  1IW7 C;  3L3O C;  3F2D A;  3KDF A;  5ISR A;  1QB5 D;  3I4M G;  2K05 A;  1IXR A;  2F03 A;  4DR4 L;  1CTM A;  4JI5 Q;  2A69 C;  1CQV A;  2EOT A;  3HOY H;  5K36 G;  3K7A B;  1K0S A;  4A4I A;  1I4R A;  2JE6 I;  1GJX A;  1Y1W H;  4KHP L;  4G57 A;  2JA8 H;  2PW5 A;  1AN8 A;  1D5Z C;  1NR4 A;  4CKE A;  5C4J B;  2N78 A;  3H0G G;  4DUY Q;  1E22 A;  1NNX A;  4RA8 A;  2QDL A;  3BDO A;  1SNC A;  1S5C D;  1KHI A;  1MIU A;  4QF4 A;  4P72 A;  1KRS A;  2R6G A;  4K5W A;  4NXM Q;  1VQI A;  4XQJ A;  2PI2 E;  1QVF A;  3RN5 A;  3IAY A;  3KDF B;  4ALP A;  2AQ3 B;  2CH4 A;  1JB7 A;  2F0V A;  5IYD G;  1HR0 Q;  2EYM A;  1U5K A;  3Q6S A;  3WDN A;  3M9B A;  3A8I E;  1KLG D;  2KJX A;  1VF5 C;  3Q23 A;  1YNJ D;  4RGM A;  3BJU A;  3DM3 A;  3M7G A;  2R7F A;  4HIM A;  3T13 A;  3QOJ A;  2RCN A;  1BCP D;  4JI8 L;  3DEP A;  1SYG A;  2EE1 A;  5DM6 3;  4RGO S;  2L9H A;  1S72 A;  1KDC A;  5IE8 A;  3Q8D A;  4DXG A;  4LF6 Q;  4X6A H;  4LF7 L;  2LFN A;  2NN6 I;  4HSP A;  4B3M Q;  4FF3 A;  2EZV A;  3PO3 H;  1JOQ A;  3W2D A;  4ZCK A;  2NVY B;  5LMU Q;  3CCQ A;  2OF1 A;  5EPK A;  2ZTD A;  1PH8 A;  4I65 A;  3TRE A;  5CGK A;  4R4Q A;  2F0Q A;  1B3Q A;  4HJ7 A;  4C3H G;  1G8Z D;  4DV4 L;  1HH2 P;  4ME3 A;  2MFI A;  1E7Z A;  1H9J A;  4DAV A;  1AFP A;  1QWY A;  3CME A;  1GKH A;  2BE5 D;  3OIP A;  1C48 A;  2CWP A;  4C3J H;  3HFZ B;  3PUX A;  4A3J G;  2WKC A;  5GAD C;  3SK5 A;  4JBM A;  4IFD H;  3AFP A;  1CQF A;  1Q81 C;  1A15 A;  4XQN A;  4JV5 L;  1LLR D;  1AE3 A;  1QIL A;  1JWS D;  1QUQ A;  4K8J A;  5ELN A;  4LMQ D;  1YJW A;  4CGY B;  3NSW A;  1G6P A;  4JBJ A;  4BY1 B;  1IL2 A;  3SDZ A;  2A6E C;  4A3K B;  1OXX K;  1TWC B;  1HRJ A;  4KTA A;  2B2Y A;  5C44 G;  5IGB A;  1L0Y B;  1D6E C;  4LF4 L;  2AWO A;  1EIG A;  5D65 A;  4JW0 A;  5C5L A;  2FMM A;  3S9W A;  2K52 A;  2NVY H;  2XN9 C;  4A3E B;  2G9D A;  1TS2 A;  2R7Z G;  4YY3 L;  1B53 A;  5IP9 H;  3UE1 A;  1G51 A;  3CPF A;  2XIW A;  2RHQ B;  3NTK A;  3ND9 A;  1V9P A;  1JWM D;  2K5Q A;  5GQO A;  5FOB B;  2PW7 A;  4KLK A;  3DWP A;  1VQJ A;  3NXW A;  3G6E A;  5BN5 A;  1QUQ B;  2KHJ A;  4HJ8 A;  1YZ6 A;  2ZJP A;  3H94 A;  3VDY A;  4FO2 A;  2UXC Q;  2K7V A;  3M4Y A;  3OTO L;  2QGQ A;  4CJ2 C;  4LUV A;  1Q1E A;  2XNA C;  3BDC A;  4DKA C;  3RZO B;  3K80 C;  4LUZ A;  4CBV A;  4OIJ A;  2K32 A;  4F87 A;  1I50 H;  1QNK A;  3I4N B;  3URY A;  3FVQ A;  1YNN C;  3A7A B;  1CA5 A;  2WAQ B;  4JYA L;  4ZK9 B;  5CR3 A;  1TS4 A;  4BY1 H;  3I73 A;  4A3K H;  4BXX G;  3U4Z A;  1TY2 A;  4AYB E;  2CW0 C;  4H13 C;  4IOC A;  1R4Q B;  2RKS A;  4UP7 A;  4A3D B;  2CH4 W;  1Z47 A;  2WB1 B;  4KKU A;  1XJV A;  5C5M A;  3T51 B;  1MSG A;  3J7A 5;  2CWA A;  3CKI B;  4HJA A;  5LL6 S;  5CBE E;  5J22 A;  5M5Y B;  4DA2 A;  1K3R A;  4XDX A;  3HOV H;  1I4P A;  3NK9 A;  1K8M A;  1S40 A;  1K83 H;  2G5D A;  3S17 B;  3G48 A;  3I55 A;  2IX1 A;  4PQX A;  1E1T A;  2UU9 L;  1H9K A;  2M9V A;  3CC7 A;  3BYT B;  3W5O A;  2CFM A;  4IUU A;  1B9N A;  1RD9 D;  3RUZ A;  2F0G A;  2I5M X;  1KXL A;  3M3Y H;  2D0O A;  3S2D H;  1Y1V G;  4RHS A;  4DV0 L;  1VQB A;  2M2L A;  2HHH Q;  4XT1 B;  2J7Z A;  2SNS A;  4L5Q A;  3ERO A;  2DJF C;  3I4M B;  4DR1 L;  3S1Q B;  4Z9C B;  2RHS B;  4A3D H;  3H6M A;  3K0Y A;  5D3I B;  1C0A A;  3KLS X;  2L1B A;  1XMO L;  2E2H H;  3HRZ C;  3KYH C;  5FO7 B;  1D5M C;  1TXY A;  3OSO A;  4QIW B;  3DLL A;  3H0G B;  1NR2 A;  2ZT9 C;  3K58 A;  3T1H Q;  1PFS A;  2DNC A;  3MXN A;  1IKM A;  4ODG A;  1PZI D;  4HID A;  2A73 B;  1K3B C;  4WOR A;  1YNJ C;  4RGN A;  4BBR G;  2ZXR A;  1ZKO A;  1BCP C;  2KCM A;  5A35 A;  1FNW A;  5IOC A;  4EGV A;  4BBS H;  3CW2 C;  1WYD A;  2KCC A;  1S5F D;  4K0K Q;  4DV1 Q;  3PO2 H;  1A2U A;  2MO1 A;  1EQR A;  2A68 D;  2RQX A;  1QOH A;  1LT6 D;  1SE3 A;  4KK7 A;  1H95 A;  4TKO B;  1ILQ A;  1PRT B;  4EQN A;  3TBI B;  4HCE A;  2KED A;  3AU7 A;  2VB2 X;  3R3O A;  4DR5 L;  4AQY Q;  3L2P A;  1VF7 A;  4FXK C;  3MXN B;  3UDG A;  1TWH B;  2VUM G;  1RIP A;  1CI3 M;  5EAY A;  1HR0 W;  1SEB D;  3PUV A;  4A3C G;  3A7L A;  5E1F A;  4DGZ A;  1X3E A;  2R92 G;  3CQZ B;  4QY7 A;  4DUZ L;  1CFM A;  1Y8P B;  2CCZ A;  1E3P A;  3MXG A;  5IGC A;  3HEJ A;  5I2Y A;  4DF7 A;  1KLU D;  1I4H A;  1PYW D;  4YWL A;  4TSS A;  1SBB B;  1PV4 A;  1A6X A;  2UUA Q;  2IPK D;  1E2V A;  2N3S A;  1I94 Q;  1Q12 A;  4A3J B;  1WFQ A;  3FHW A;  4YCW A;  2F0U A;  3S2H B;  3MAQ A;  1G6Z A;  3I70 A;  5JJI A;  2K04 A;  4EQP A;  1BUV T;  1DZ1 A;  3J81 j;  2WKD A;  3NEM A;  3TEH B;  2I07 B;  4L8J A;  5G3L D;  2MGS A;  4K5X A;  5I2X A;  1VMC A;  2NZH A;  1PZK D;  1RDP D;  5IT9 c;  3I56 A;  2AMC B;  1R9T H;  3KF6 A;  1WCM B;  4G4K A;  1VQK A;  4JG2 A;  4DNR B;  2R7Z B;  3GTP H;  3B6Y A;  3R2I A;  5IP7 G;  1SJE D;  3CQZ H;  2F0O A;  4CDF C;  3S1R B;  3OWE B;  4DV7 L;  3A54 A;  2PZW A;  5EQ0 A;  4X66 L;  1L1O A;  2F4V Q;  2BDN A;  1SDF A;  4DFA A;  1EZ6 A;  4PNY A;  1YHB A;  4RKL A;  3T53 B;  4DR2 Q;  1A3T A;  3K59 A;  3DWQ A;  5K5P A;  2E2I H;  3STB D;  4R1J A;  1PH5 A;  1TVX A;  3MFG A;  4BY7 H;  5C3E H;  3H3V C;  2E75 C;  4RWS C;  1HZC A;  2UXD L;  2FHT A;  1JOK A;  3R2T A;  3GTK B;  1P16 A;  2LSS A;  1SMY C;  2L55 A;  4B9W A;  3HS0 C;  2F0P A;  5C4X G;  3BZK A;  3F2C A;  4A3G B;  3HKZ G;  2QEJ C;  1V1Q A;  1WCM H;  4MTN A;  2Z4I A;  4JI4 Q;  1SE4 A;  4B9X A;  3HOZ H;  5FK9 C;  4R4I A;  1L1O B;  2EJF C;  3FPU B;  1ML0 D;  4PMC A;  1N9W A;  1IBK Q;  1H9M A;  1XMQ L;  2OCE A;  2RDF A;  1E2W A;  2ZXO A;  4YWK A;  1CA6 A;  4RG1 A;  1K0R A;  1HZ9 A;  4F88 A;  1TWG B;  2JEA I;  1VQ9 A;  5I4D A;  1O7Z A;  1PFM A;  2B2U C;  4L63 B;  4RAU C;  2HDM A;  4RMF A;  1H9R A;  3H09 A;  4HIO A;  2NN6 G;  2F0D A;  3D4W A;  3MEH A;  1Y8N B;  1WTO A;  2B8F A;  4DU9 A;  1WTQ A;  3BS1 A;  4LFA L;  2E76 C;  4KI0 A;  2A1A A;  2FJ2 A;  1PVO A;  2NVQ H;  1SAP A;  2JJQ A;  1D2B A;  5DNF A;  5C0X H;  3J7Y W;  2X69 A;  4C2M B;  4NDX A;  1EUJ A;  1PH4 A;  5JEA G;  1HA5 A;  3S1N B;  4J15 A;  4A3G H;  1U4L A;  3J7A V;  1LTI D;  4ZLT F;  1YEZ A;  1U9R A;  4N8X 1;  3J80 c;  2OT2 A;  1LT4 D;  2F0K A;  4DV5 L;  5ELB A;  2HQL A;  4C1N I;  4AIM A;  3BU2 A;  1YIT A;  5CBA E;  1LT5 D;  1WTH A;  2JXM B;  2PQE A;  5EPJ A;  1CKO A;  4UP8 A;  2ATW A;  3ICE A;  4JC0 A;  5GRO A;  2LS0 1;  2XWB B;  1J5E Q;  2A68 C;  1RTN A;  2OQ0 A;  4RCO A;  4DV2 L;  2QKI C;  4G7H C;  1ROD A;  3G7L A;  3H91 A;  1SRU A;  3PIP 3;  1CSP A;  4POF A;  4GN3 B;  3GP7 A;  3QO2 A;  3J81 c;  2KEN A;  2JQO A;  3DMU A;  1SNQ A;  4YWM A;  1LTR D;  4RHR A;  4AYB G;  2I5H A;  2K03 A;  1HA6 A;  3KK7 A;  4ME5 A;  1MKH A;  2K5D A;  1EWI A;  2Z8L A;  1F9Q A;  1EL0 A;  2F3W A;  3CP0 A;  4DR3 L;  1JB3 A;  2DY8 A;  3PMF A;  5EKK A;  3GTJ H;  1EOV A;  2A5H A;  3NBH A;  3PUY A;  2VUM B;  4LWC A;  4DK0 A;  1GM5 A;  1T5E A;  4LF8 Q;  4KY5 A;  4H7B A;  2KVM A;  4GLX A;  1QE6 A;  1ESF A;  1LO5 D;  1MHW C;  3QR8 A;  5CV8 A;  2R92 B;  3V96 A;  3ERQ A;  2Q8T A;  1N34 Q;  3S14 B;  2UUC Q;  1UUP A;  4LFC Q;  3F2U A;  2A6H D;  1X55 A;  2JA9 A;  3K57 A;  1N33 Q;  1U0L A;  4DR6 Q;  1S3O A;  4XT3 B;  3C2P A;  4UP9 A;  5GAE C;  3HOW G;  2DNE A;  5FLM H;  3CU7 A;  4HN7 A;  4E6I A;  3H3V H;  2EYP A;  3NBH B;  2N8N A;  3PIO 3;  1ZEQ X;  4A3B H;  1NBW A;  2L5T A;  1PRT F;  3D3R A;  3OIQ A;  2D2C C;  3HOU B;  1IZ6 A;  1YIJ A;  3A5Z B;  2E2J H;  2K4K A;  1TY0 A;  5KNC A;  2LXJ A;  1TWA B;  2JA7 G;  3GTQ B;  1Q3L A;  1NSN S;  2EJG C;  1GUO A;  2HCI A;  2KQ3 A;  4B08 A;  4DV6 Q;  1UEA B;  4CJ1 B;  4A3F G;  2HQE A;  4KY7 A;  2Q2T A;  5LMN L;  2K28 A;  4A76 A;  2ASB A;  3RNU A;  3CCL A;  1EFW A;  2VQE L;  4OON A;  2HDL A;  4UDU C;  3K0X A;  1PH6 A;  4FDB A;  3RZD B;  3M4O B;  2IJ0 A;  1BOS A;  1QJO A;  5JJZ A;  2E5L L;  5E3F A;  4XQQ A;  5JVG 3;  4IFD I;  1RJT A;  2PMZ B;  3STB C;  1B50 A;  1W3S A;  3NQT A;  1SFO B;  2JA5 G;  5M5X B;  2B2Y C;  3EVQ A;  1VQN A;  1O7Y A;  1ASY A;  5E7N A;  2EVB A;  5AJ3 L;  4H02 A;  1NY4 A;  1Z9F A;  3RLO A;  4OHJ A;  1D1K A;  4R9W A;  4JI1 Q;  5CMD A;  1PH9 A;  4K0K L;  2YV5 A;  1R4P B;  1Y69 U;  1SNM A;  4JI2 L;  5M5W B;  1VQD A;  2F0F A;  4QGU A;  5FO8 B;  3HOU H;  3S1M B;  4JI0 Q;  1GUW A;  1EY4 A;  5IWA Q;  5FJ8 G;  2PZT A;  3GTQ H;  1NE3 A;  5C4X B;  5DAU A;  1PXU A;  1SN8 A;  3HKZ B;  3K7A H;  4JI7 L;  1CHP D;  1XPO A;  1O7L A;  1BF4 A;  1VQL A;  1EU4 A;  1FL0 A;  2XGT A;  1EZ8 A;  1GHK A;  4KHV A;  4LFB Q;  5JEA J;  1FGB D;  5AFW A;  4U67 3;  4G7O C;  4IPC A;  1UAP A;  5C4J H;  4LF9 L;  3M4O H;  1SE8 A;  3R93 A;  3V2T A;  5KRU A;  2O2L D;  1LAC A;  4GLA C;  1X65 A;  2P5Z X;  4WFN 3;  4MNO A;  4HED A;  1PA6 A;  3T16 A;  1L0W A;  1SFO H;  2WAC A;  3NWS A;  5M5X H;  3DXJ C;  1DJR D;  5IYB H;  1CZG A;  4NMZ A;  4YIJ A;  2K50 A;  3MWY W;  2EYO A;  4YHH Q;  3E5S A;  2I46 A;  1Q8I A;  2Y0S G;  1PTO D;  1MI2 A;  4JI3 L;  1N36 Q;  1BCP F;  2C5C A;  2F0I A;  4BWG B;  1ET6 A;  3KFU A;  1IBM Q;  4X65 L;  1EEI D;  5JPN C; 
#chains in the Genus database with same CATH homology
 1WTX A;  3EJI A;  4QUF A;  2RDH A;  4J8Q A;  1IHZ A;  3SVM A;  2K5W A;  2X6G A;  3J7A F;  5E4W C;  1SYB A;  2EY5 A;  2M00 A;  1TQO A;  3VR5 A;  4RFB A;  1DON A;  5LL6 X;  2NTT A;  1F2M A;  1RF2 D;  1ICW A;  2NTS A;  3TME A;  3GTG B;  4TRD A;  5IOD A;  4FF1 A;  2F0N A;  2VXW A;  4H44 C;  1EFI D;  1HUM A;  1PRT C;  2MHV A;  1TWF B;  4KJN A;  2F0M A;  3VR6 A;  1GOZ A;  3A8K E;  2OEO A;  5C3W A;  3X3N A;  2OXP A;  3LWE A;  5IGF A;  1WTR A;  5C6A A;  1EY9 A;  3SK8 A;  1AZQ A;  1ZYR D;  5CV7 A;  4A3M B;  2N55 A;  1B44 D;  2A6H C;  4DNT B;  2F1M A;  3TN2 A;  3U9S A;  4KKT A;  3VYT A;  2R93 B;  5CC4 A;  2HUG A;  1JOR A;  4C3I G;  3MC0 B;  3VA7 A;  4HMI A;  3KLR A;  5FLX E;  5DEH A;  2C9O A;  5KYI A;  3MFY A;  3IFT A;  4OO1 H;  4KD4 A;  1TU2 B;  2PNR C;  3C3L A;  2F4I A;  1KDA A;  4ZUI A;  4CKC A;  1EWH A;  4O42 A;  3S16 B;  4A3F B;  3E6Z X;  4FP5 D;  2EYJ A;  3QWN A;  1LTT D;  4Q5V A;  4K8I A;  4IN3 A;  3MXP A;  2NUC A;  4HCS A;  2O5I C;  2A74 C;  4X3S A;  3K5N A;  5KYL A;  2QDB A;  4N9P A;  4OL7 A;  1XWE A;  1TKW B;  5A2Q E;  2LMC B;  3JAM E;  2PCF B;  2IX3 A;  1KNE A;  3TP7 A;  3KLS A;  3HG9 A;  1KTK A;  2YU9 B;  1KDB A;  4K6L A;  1LTS D;  1ET9 A;  5CYU A;  3GO5 A;  2Z1C A;  3VR2 A;  2MPM A;  1IKL A;  1AW7 A;  1EOT A;  1HXY D;  4IUQ A;  5K36 H;  2RSN A;  1F77 A;  2BDO A;  2N88 A;  3T56 B;  5BN3 A;  2WP8 J;  3DHQ A;  2FFK B;  3OMC A;  3GD7 A;  3P1H A;  1EY5 A;  3OW7 A;  2EY6 A;  4L6T B;  1ZXT A;  3DWA A;  2DN8 A;  1F9P A;  1B4O A;  4IAL A;  2BE5 C;  3FEW X;  1WD0 A;  4C3H B;  3QIA A;  1V8Q A;  1HQR D;  2BA1 A;  3SXH A;  1DCZ A;  1JOO A;  2EPB A;  1B3A A;  4FNF A;  1STA A;  1PTO C;  2V4D A;  1RKN A;  4IUT A;  1EYC A;  1HUN A;  3N52 A;  5I9P A;  2RSO A;  4X3T A;  3G6J B;  2Y0S B;  3SE0 A;  3EFX D;  4S3S A;  4GZY C;  1TR5 A;  3ZYY X;  2JA6 B;  3NTH A;  1BQQ T;  1GUS A;  2B2T A;  3IKJ A;  3NE5 B;  2MJ8 A;  5C44 B;  1MD2 D;  4IUV A;  4IUP A;  1HPC A;  4HAE A;  4U68 A;  4ABN A;  1BXT A;  3I72 A;  5T1I A;  4HR7 B;  2JP1 A;  2NVX B;  1LTG D;  4A93 B;  2IWH A;  3P75 A;  2KCN A;  5FLX L;  3A8J E;  3KF8 A;  3NQI A;  1JR0 D;  5J1Z A;  5C0X I;  1EQT A;  1GHJ A;  1CHQ D;  5F2D A;  5G3L F;  1I4X A;  2QCP X;  1ZYR C;  4C3J G;  1C8C A;  3LX0 A;  4ILW A;  5M9O A;  2IX0 A;  4IFD G;  1F2Z A;  1RHP A;  2EYH A;  2L0C A;  1AP0 A;  3TZU A;  5D3D A;  5KEE A;  1SNP A;  3HOX B;  1FNV A;  2F0W A;  2BOS A;  4A3I B;  4K6D A;  5ELC A;  1SJH D;  4KD3 A;  5I9O A;  3QB3 A;  4K2K A;  4DXF A;  2NVT B;  1FR3 A;  1ILP A;  4LJZ C;  4NP5 A;  2AUJ D;  4QUC A;  1PDQ A;  1GUN A;  4RGT A;  5A2Q L;  5J39 A;  2BA0 A;  2AUK A;  5M3M B;  2F0L A;  1FNU A;  3JAM L;  2E2D C;  4C3I B;  1PTO B;  5T1G A;  1STG A;  1MSH A;  2K33 A;  1V43 A;  3MTS A;  3DUZ A;  3E0J A;  1XXG A;  1F9R A;  1O80 A;  4O1N A;  1Y1V B;  3PUW A;  2TMP A;  4XYQ A;  4MN3 A;  3KBX A;  4ZAI A;  1TT2 A;  4V0B A;  2ID0 A;  4ULL A;  2RBM A;  4RH6 A;  3C1F A;  4C56 C;  4X3U A;  2H1E A;  2KEC A;  4ZUJ A;  1GUT A;  2L11 A;  4ZYS A;  3RMH A;  1A2T A;  1OO9 B;  1DM0 B;  3TP8 A;  1DYQ A;  3VA5 A;  2NYZ D;  1SE2 A;  2MUY A;  4BS9 A;  4X3K A;  2FIN B;  3BZD B;  1J9O A;  2A6E D;  1I3Q B;  3BVM A;  4NKL A;  2J0T D;  5CV5 A;  1A3V A;  4BBR B;  4K2L A;  1PTO H;  3FMC A;  5CV4 A;  1DOL A;  4DK1 A;  3M85 A;  1M8A A;  2ENB A;  1QCB D;  2G9H D;  3BVZ A;  4KN4 C;  4R8N A;  4J6H A;  1S5E D;  4BA1 I;  5IGG A;  2L12 A;  1WD1 A;  4QCL A;  3UI2 A;  1TS3 A;  1HFG A;  4IUN A;  3GTO B;  3SR1 A;  1F2L A;  2D9U A;  2PZU A;  1RCV D;  2Q8R E;  1ESR A;  1STY A;  2HCC A;  1Z6H A;  1SYC A;  2R61 A;  4V19 0;  2BCO A;  5ELE A;  1WTP A;  3FDT A;  1CM9 A;  1YNN D;  3TZD A;  5TSS A;  1EY0 A;  1HCZ A;  4WJW A;  3MZ5 A;  1EY8 A;  2JEB I;  5ELF A;  1S5B D;  1Y1W B;  1I6H B;  4CKB A;  2NWG A;  2B2V A;  4IQZ A;  3D8G A;  2KHS A;  4K14 A;  3GTM B;  3VR3 A;  3RD4 A;  4EQO A;  1F2Y A;  3ITP A;  3NBI A;  1PFB A;  5D14 A;  4OIK A;  5FO9 B;  2Q8I B;  5EBD A;  1SYD A;  4R8I A;  3MHB A;  3K5O A;  4RCN A;  3EQL C;  2IL8 A;  4FYD A;  3QJY A;  2SDF A;  2E74 C;  4K5V A;  2EDG A;  3RLF A;  2EY2 A;  3L7Z C;  1IYU A;  3K5L A;  1T5X D;  4XXE A;  4FF4 A;  3PO3 B;  4DAY A;  4QB4 A;  5BN4 A;  1AEX A;  4XTC S;  2XRS D;  1STE A;  5KND A;  1B2T A;  1G29 1;  2ZXP A;  4PMW A;  1EWC A;  1KAB A;  1EY6 A;  3S15 B;  4KKS A;  4C3J B;  1HQM C;  3GQB A;  1HFN A;  2ICI A;  1SND A;  3OMG A;  3VR4 A;  2ICE C;  4LAA A;  1Q1B A;  4JBW A;  2B39 A;  5I6Y A;  5KGU A;  2F0T A;  1RTO A;  1HHV A;  2YYZ A;  3D4D A;  1I4G A;  2KEE A;  2KUM A;  4KY6 A;  4P2C B;  1D5X C;  3LWU A;  3DM1 A;  2L4N A;  1VMP A;  1JIC A;  2KOL A;  4Y7N B;  4DN4 M;  4ZKC B;  3I3C A;  3I8Z A;  3KBG A;  4CHT B;  3VYR A;  3W3A A;  2PO4 A;  3OOC A;  3SHL A;  3C1E A;  1VCI A;  2SOB A;  1I50 B;  4XYO A;  4N9T A;  4WRD A;  3TP6 A;  3ONA B;  2AQ1 B;  1O78 A;  1X32 A;  1JQY D;  4I7Z C;  3NTI A;  3GTL B;  5EBC A;  1S5D D;  3I91 A;  3QG1 A;  5IT9 E;  4BA2 I;  3CHB D;  1PFN A;  4MIU A;  3R8B A;  1MBY A;  2NN6 H;  1L0X B;  3Q22 A;  1PTO F;  4OO1 I;  5I6W A;  2K1B A;  1S4Z A;  3HOV B;  3BG3 A;  1K83 B;  3HP3 A;  4AYB B;  5C3X A;  5JEA H;  3D4R A;  1XTC D;  4MHE A;  1Y8O B;  5IGD A;  4IUR A;  4XIG S;  2K01 A;  3OWF A;  1G2S A;  4ZQ3 A;  1FYC A;  1NUC A;  2DY7 A;  5LHY 1;  2FMC A;  5C0X G;  3M3Y B;  2CQA A;  1B9M A;  5KNB A;  3TDQ A;  3S2D B;  4QMG A;  1HTL D;  1BDO A;  5C4Z A;  3IFD A;  4UAI A;  3ND8 A;  1BR9 A;  1BBX C;  3AB9 A;  3NWT A;  1SMY D;  4KJO A;  4NW2 A;  5CV6 A;  3V05 A;  3FPP A;  1WTW A;  1DXM A;  3Q24 A;  2E2H B;  1SNO A;  2WII B;  1WTV A;  3SEB A;  2Z4H A;  3HOW B;  4FF2 A;  3CRL C;  3CRK C;  4DAP A;  1EIH A;  2JA7 B;  4BBS B;  1KNA A;  3PO2 B;  1OXS C;  4ID6 A;  2PYK A;  3D6C A;  2R3Z A;  2EJM A;  1GUG A;  3NHH A;  3Q0A A;  3C46 A;  2B2T C;  3J80 E;  2JA5 B;  1PMR A;  5CV9 A;  4F8M A;  1EEF D;  1PLF A;  4CJ0 B;  3P20 A;  1V1O A;  5JVH 3;  1EYD A;  1DOM A;  1KAA A;  2JYO A;  3SK4 A;  1SYF A;  1DD2 A;  4ZKB B;  5EKL A;  3QOL A;  3T4A C;  1BNZ A;  1NCV A;  2MP1 A;  4FXG C;  1I6V C;  1E2Z A;  2IT1 A;  1PZJ D;  1U4M A;  2EYF A;  2CVR A;  5FKA C;  5ELD A;  1V1P A;  1XX8 A;  3J81 E;  1D1I A;  5EGT A;  1U4P A;  5IT9 L;  4EVO A;  1Q90 A;  1A3U A;  3I4L A;  4J1M A;  2D5D A;  3NPP A;  5JPM C;  1R9T B;  1WVL A;  2XWJ B;  2B8G A;  1E0B A;  1W6J A;  3NUC A;  3GTP B;  5EKI A;  2D62 A;  2QIL A;  1ENA A;  4G7Z C;  5E4X A;  1GXD C;  1V1P B;  4PMB A;  2XVS A;  3O13 A;  1VDZ A;  4KN7 C;  5EJW A;  3NP8 A;  1UNS A;  3MA2 B;  2E2I B;  4BY7 B;  5C3E B;  1STN A;  4KV6 A;  2WIN B;  3MVV A;  4M1U B;  2B63 B;  1IYV A;  3X3M A;  3D6W A;  2VB3 X;  2F3V A;  2H4O A;  3OHX C;  4HMJ A;  1K8O A;  3M7N A;  1G91 A;  1IW7 D;  5C0X J;  1TII D;  1II3 A;  3HOZ B;  2NBF A;  1IL8 A;  3N6R A;  2A69 D;  2F0J A;  1STH A;  2CHB D;  4ZRZ A;  4OGQ C;  3AMU A;  1CK1 A;  5C4H A;  1LAB A;  3MXU A;  1LT3 D;  3IL8 A;  5JOB A;  1LTB D;  3BDL A;  1C4Q A;  2QF7 A;  1JCK B;  2VNU D;  2PPB C;  4HSV A;  1BCP B;  3PUZ A;  3VYU A;  1LTA D;  2NVQ B;  2B2W C;  1NAP A;  1H9S A;  4C1N K;  2F0H A;  1AZP A;  3J80 L;  4JK1 C;  5M3F B;  3FKI B;  2EYL A;  3TSS A;  1JE4 A;  1MGS A;  4TQU S;  3L9A X;  1JC7 A;  5KIX A;  2XSC A;  2AWN A;  1EYA A;  4KMU C;  5EPL A;  1W6K A;  2NZ1 D;  4RKB A;  1QNU A;  5DM7 3;  4M8A A;  1H9S B;  1EU3 A;  4FVM A;  1SSO A;  1OXU A;  5NUC A;  3J81 L;  3WOE A;  3LNN A;  1X3P A;  5COR A;  1F9S A;  2XRQ D;  4HTH A;  5IIF A;  2B2V C;  3D31 A;  2J4X A;  1STB A;  3A55 A;  2JSO A;  3EA6 A;  1U4R A;  2X6L A;  4H0L C;  3P7J A;  3U9O A;  2O4X A;  3GV3 A;  1OXV A;  3FRP B;  3GTJ B;  3TP5 A;  3K6O A;  2RA4 A;  1CT1 D;  1ENF A;  4FXD A;  3WOF A;  2B2W A;  2NB0 A;  5HUR A;  5HGT A;  3GV6 A;  2TSS A;  2K6A A;  3DEO A;  1I4Q A;  5IGE A;  1DOK A;  5JAV A;  2F0E A;  3K5M A;  1TS5 A;  3I90 A;  3OPO A;  2IW3 A;  2LKV A;  1SXT A;  1LV9 A;  1ONL A;  2F0S A;  1QG7 A;  1M4V A;  4A3B B;  4IZ8 A;  4OO1 G;  1PRT D;  1J8I A;  2O5J C;  2B2U A;  1BO0 A;  1B1Z A;  1SYE A;  2E2J B;  2RDG A;  3PV0 A;  1Z7T A;  2GA4 B;  3HOY B;  1FD7 D;  4LK1 C;  5COY A;  1ENC A;  3A56 A;  1X3Q A;  3HGB A;  3SK6 A;  2KA7 A;  4PV1 C;  2JA8 B;  2SNM A;  2CW0 D;  2EY1 A;  3BVG A;  2WV6 D;  3BYY B;  1OXT A;  2EXZ A;  2SEB D;  2AQ2 B;  1EQV A;  2LY7 A;  4KHZ A;  1G2T A;  1JWU D;  3HZX A;  4Q0F A;  3VYS A;  1XYI A;  1HTP A;  1EY7 A;  1CZW A;  2RVL A;  4IFD J;  3KUP A;  4F7X A;  1IW7 C;  3L3O C;  5ISR A;  1QB5 D;  2K05 A;  2F03 A;  1CTM A;  2A69 C;  1CQV A;  2EOT A;  5K36 G;  3K7A B;  1I4R A;  2JE6 I;  1GJX A;  4G57 A;  2PW5 A;  1AN8 A;  1D5Z C;  1NR4 A;  4CKE A;  5C4J B;  4RA8 A;  3BDO A;  1SNC A;  1S5C D;  4QF4 A;  2R6G A;  4K5W A;  4XQJ A;  3IAY A;  2AQ3 B;  2F0V A;  2EYM A;  3Q6S A;  3WDN A;  3A8I E;  1KLG D;  2KJX A;  1VF5 C;  3Q23 A;  1YNJ D;  4RGM A;  3M7G A;  3T13 A;  3QOJ A;  1BCP D;  3DEP A;  1SYG A;  2EE1 A;  5DM6 3;  4RGO S;  2L9H A;  1KDC A;  4DXG A;  2LFN A;  2NN6 I;  4HSP A;  4FF3 A;  2EZV A;  1JOQ A;  3W2D A;  2NVY B;  2OF1 A;  5EPK A;  4I65 A;  5CGK A;  2F0Q A;  4C3H G;  1G8Z D;  1H9J A;  4DAV A;  1AFP A;  1QWY A;  2BE5 D;  3OIP A;  1C48 A;  3PUX A;  2WKC A;  4IFD H;  3SK5 A;  1CQF A;  1A15 A;  4XQN A;  1LLR D;  1QIL A;  1JWS D;  4K8J A;  4LMQ D;  4CGY B;  3NSW A;  4BY1 B;  3SDZ A;  2A6E C;  4A3K B;  1OXX K;  1TWC B;  1HRJ A;  4KTA A;  2B2Y A;  5IGB A;  1L0Y B;  1D6E C;  2AWO A;  1EIG A;  5D65 A;  5C5L A;  2FMM A;  3S9W A;  4A3E B;  2XN9 C;  2G9D A;  1TS2 A;  1B53 A;  2XIW A;  3NTK A;  3ND9 A;  1JWM D;  2K5Q A;  5FOB B;  2PW7 A;  3DWP A;  3NXW A;  5BN5 A;  3H94 A;  4FO2 A;  2K7V A;  3M4Y A;  4CJ2 C;  1Q1E A;  2XNA C;  3BDC A;  3RZO B;  4CBV A;  4OIJ A;  2K32 A;  4F87 A;  1QNK A;  3I4N B;  3URY A;  3FVQ A;  1YNN C;  3A7A B;  1CA5 A;  2WAQ B;  4ZK9 B;  5CR3 A;  1TS4 A;  3I73 A;  1TY2 A;  2CW0 C;  4H13 C;  1R4Q B;  2RKS A;  4A3D B;  1Z47 A;  2WB1 B;  4KKU A;  5C5M A;  3T51 B;  1MSG A;  3CKI B;  5LL6 S;  5CBE E;  5J22 A;  5M5Y B;  4DA2 A;  4XDX A;  1I4P A;  3NK9 A;  1K8M A;  3S17 B;  2IX1 A;  4PQX A;  1H9K A;  2M9V A;  3BYT B;  4IUU A;  1B9N A;  1RD9 D;  3RUZ A;  2F0G A;  4RHS A;  2M2L A;  4XT1 B;  2J7Z A;  2SNS A;  3ERO A;  3I4M B;  3S1Q B;  4Z9C B;  3H6M A;  3K0Y A;  5D3I B;  3KLS X;  2L1B A;  3HRZ C;  5FO7 B;  1D5M C;  3OSO A;  4QIW B;  3H0G B;  1NR2 A;  2ZT9 C;  3K58 A;  2DNC A;  3MXN A;  1IKM A;  4ODG A;  1PZI D;  2A73 B;  4WOR A;  1YNJ C;  4RGN A;  2ZXR A;  1ZKO A;  1BCP C;  5A35 A;  1FNW A;  5IOC A;  4EGV A;  2KCC A;  1S5F D;  1A2U A;  2A68 D;  2RQX A;  1QOH A;  1LT6 D;  1SE3 A;  4KK7 A;  4TKO B;  1ILQ A;  1PRT B;  4EQN A;  3TBI B;  4HCE A;  2KED A;  3AU7 A;  2VB2 X;  3R3O A;  1VF7 A;  4FXK C;  1TWH B;  1CI3 M;  1SEB D;  3PUV A;  3A7L A;  5E1F A;  4DGZ A;  3CQZ B;  1CFM A;  1Y8P B;  3MXG A;  5IGC A;  3HEJ A;  5I2Y A;  4DF7 A;  1I4H A;  1KLU D;  1PYW D;  4TSS A;  1SBB B;  1A6X A;  2IPK D;  1E2V A;  1Q12 A;  4A3J B;  2F0U A;  3S2H B;  3MAQ A;  1G6Z A;  3I70 A;  2K04 A;  4EQP A;  1BUV T;  1DZ1 A;  2WKD A;  2I07 B;  4L8J A;  5G3L D;  2MGS A;  4K5X A;  5I2X A;  1VMC A;  1PZK D;  1RDP D;  1WCM B;  4G4K A;  4DNR B;  2R7Z B;  3R2I A;  1SJE D;  2F0O A;  3S1R B;  3OWE B;  3A54 A;  2PZW A;  5EQ0 A;  2BDN A;  4DFA A;  1SDF A;  1EZ6 A;  4PNY A;  4RKL A;  3T53 B;  1A3T A;  3K59 A;  3DWQ A;  5K5P A;  1TVX A;  3MFG A;  3H3V C;  2E75 C;  4RWS C;  2FHT A;  1JOK A;  3R2T A;  3GTK B;  1SMY C;  2L55 A;  4B9W A;  3HS0 C;  2F0P A;  4A3G B;  2QEJ C;  2Z4I A;  1SE4 A;  4B9X A;  5FK9 C;  2EJF C;  3FPU B;  1ML0 D;  4PMC A;  1H9M A;  2RDF A;  1E2W A;  2ZXO A;  1CA6 A;  4F88 A;  1TWG B;  2JEA I;  5I4D A;  1O7Z A;  1PFM A;  2B2U C;  4L63 B;  4RAU C;  2HDM A;  1H9R A;  3H09 A;  2NN6 G;  2F0D A;  3D4W A;  3MEH A;  1Y8N B;  1WTO A;  2B8F A;  4DU9 A;  1WTQ A;  3BS1 A;  2E76 C;  4KI0 A;  2FJ2 A;  1SAP A;  1D2B A;  5DNF A;  5C0X H;  3J7Y W;  2X69 A;  4C2M B;  4NDX A;  5JEA G;  1HA5 A;  3S1N B;  1U4L A;  3J7A V;  1LTI D;  4ZLT F;  1U9R A;  2OT2 A;  1LT4 D;  2F0K A;  5ELB A;  4C1N I;  5CBA E;  1LT5 D;  2JXM B;  2PQE A;  5EPJ A;  2LS0 1;  2XWB B;  2A68 C;  1RTN A;  4RCO A;  2QKI C;  4G7H C;  1ROD A;  3G7L A;  3H91 A;  3PIP 3;  3GP7 A;  3QO2 A;  3DMU A;  1SNQ A;  1LTR D;  4RHR A;  2K03 A;  1HA6 A;  3KK7 A;  4ME5 A;  2K5D A;  2Z8L A;  1F9Q A;  1EL0 A;  2F3W A;  1JB3 A;  2DY8 A;  3PMF A;  5EKK A;  2A5H A;  3NBH A;  3PUY A;  2VUM B;  4DK0 A;  1T5E A;  4KY5 A;  4H7B A;  2KVM A;  1QE6 A;  1ESF A;  1LO5 D;  5CV8 A;  2R92 B;  3V96 A;  3ERQ A;  2Q8T A;  3S14 B;  1UUP A;  3F2U A;  2A6H D;  3K57 A;  4XT3 B;  3C2P A;  2DNE A;  3CU7 A;  4HN7 A;  4E6I A;  2EYP A;  3PIO 3;  1ZEQ X;  2L5T A;  1PRT F;  3D3R A;  3OIQ A;  2D2C C;  3HOU B;  1TY0 A;  5KNC A;  1TWA B;  3GTQ B;  1Q3L A;  1NSN S;  2EJG C;  1GUO A;  2HCI A;  2KQ3 A;  4B08 A;  1UEA B;  4CJ1 B;  2HQE A;  4KY7 A;  2K28 A;  2HDL A;  4UDU C;  3RZD B;  3M4O B;  2IJ0 A;  1BOS A;  1QJO A;  5JJZ A;  5E3F A;  4XQQ A;  5JVG 3;  4IFD I;  1RJT A;  2PMZ B;  1B50 A;  3NQT A;  1SFO B;  5M5X B;  2B2Y C;  3EVQ A;  1O7Y A;  2EVB A;  4OHJ A;  1D1K A;  4R9W A;  5CMD A;  1R4P B;  1Y69 U;  1SNM A;  5M5W B;  2F0F A;  5FO8 B;  3S1M B;  1GUW A;  1EY4 A;  2PZT A;  5C4X B;  5DAU A;  1PXU A;  3HKZ B;  1CHP D;  1O7L A;  1BF4 A;  1EU4 A;  1EZ8 A;  1GHK A;  4KHV A;  5JEA J;  1FGB D;  5AFW A;  4U67 3;  4G7O C;  1UAP A;  3R93 A;  3V2T A;  5KRU A;  2O2L D;  1LAC A;  4WFN 3;  4HED A;  3T16 A;  2WAC A;  3NWS A;  3DXJ C;  1DJR D;  1CZG A;  4NMZ A;  4YIJ A;  3MWY W;  2EYO A;  3E5S A;  2I46 A;  1Q8I A;  1PTO D;  1MI2 A;  1BCP F;  2C5C A;  2F0I A;  4BWG B;  1ET6 A;  1EEI D;  5JPN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...