1EY9A

Structure of s. nuclease stabilizing quadruple mutant t41i/p117g/h124l/s128a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey9A00
1II3A 1TR5A 1EY5A 1EY7A 3MEHA 5IGFA 4KJOA 2F0SA 1A2TA 4F8MA 2EY1A 2RKSA 3DMUA 1EY9A 2EY6A 2PW7A 3OSOA 3P1HA 2F0UA 4WORA 3LX0A 1STBA 3PMFA 5EKKA 3OMGA 4RKBA 5KYIA 3D4WA 3VA5A 3SK4A 2F0KA 3NHHA 2EYMA 5EKLA 1EYCA 5IOCA 1A3UA 2PYKA 3C1FA 5HURA 5I9OA 5KEEA 2EYJA 4YIJA 5KYLA 1KDCA 2F0DA 3EJIA 4KHVA 4N9PA 4PNYA 5I9PA 1EY8A 5J39A 2F0LA 4NDXA 5CC4A 2EY2A 4QMGA 4QB4A 3TP6A 2O4XA 3C1EA 4NKLA 3U9OA 5IODA 1EY6A 3D6CA 1F2ZA 1KAAA 5M9OA 5I6WA 3SK8A 4RKLA 1KDAA 1SNMA 1SYCA 5IGGA 4OL7A 1STAA 4HMIA 2HQEA 4ID6A 1STNA 2KHSA 4B9XA 5HGTA 1STGA 3ITPA 1F2YA 4K8IA 4LAAA 3NP8A 1JOKA 2RDFA 2LKVA 4I65A 4KY5A 1JORA 2OXPA 4TRDA 4EQNA 2F0FA 2PZWA 1EQVA 2F0PA 3EROA 2PZUA 5IGBA 1NUCA 5I6YA 2PZTA 2F0OA 2EY5A 2F0HA 2QDBA 4ZUIA 3ERQA 4K14A 4KTAA 4ZUJA 3TP5A 3BDCA 1IHZA 4KY7A 2F0NA 5JAVA 2EYOA 2F0JA 5CV4A 2F0VA 2PQEA 5DEHA 4KJNA 5IGEA 2RBMA 3V2TA 1ENAA 2F0QA 2F0IA 5E3FA 1KDBA 4R8NA 5C4HA 5IIFA 1STHA 3SK6A 1SNQA 1SYBA 4J6HA 3QOJA 5CR3A 3QOLA 2SNMA 4ODGA 5CV5A 3H6MA 5EGTA 5J1ZA 4EQOA 5J22A 2PW5A 2M00A 4KV6A 4B9WA 4PMBA 1F2MA 3HEJA 1SNPA 2F0WA 2F3VA 2KQ3A 5KGUA 2EYHA 3S9WA 2F0EA 1A3TA 4K8JA 1EZ6A 4WRDA 5C5LA 4DGZA 4NP5A 4IUNA 4G57A 3T13A 4K5VA 2F0GA 4IALA 1RKNA 1EY0A 2F3WA 4IZ8A 3R3OA 3RUZA 5CV8A 1SYEA 2F0MA 5CV9A 5C3XA 1KABA 5JOBA 1AEXA 1NSNS 5C5MA 1A3VA 5IGDA 5KRUA 4EVOA 1ENCA 1JOOA 3P75A 4NMZA 4K5XA 3OMCA 3OWFA 5IGCA 3BDLA 2OEOA 1STYA 5C6AA 2EYPA 3NUCA 3TP7A 4ME5A 5KIXA 2ENBA 3MHBA 2WACA 4DU9A 3D8GA 3MXPA 1SNOA 5CV7A 5E1FA 3T16A 4KD3A 4DF7A 2SOBA 4K2LA 4S3SA 4J1MA 5C4ZA 1JOQA 2SNSA 4K6DA 5K5PA 4QF4A 4HTHA 4F7XA 3E5SA 4MIUA 3MZ5A 1SNCA 1SYFA 4HMJA 4KD4A 5NUCA 4H7BA 3SHLA 5C3WA 1SYDA 3NQTA 5DAUA 3HZXA 3SK5A 3D4DA 1A2UA 1EYAA 4E6IA 2OF1A 3DHQA 1U9RA 3NK9A 4ZQ3A 3MVVA 3NXWA 5F2DA 3TP8A 1EY4A 1SYGA 3EVQA 3QB3A 4N9TA 4DFAA 4KY6A 4PMCA 1EYDA 1TQOA 2F0TA 4K5WA 1TT2A 5CV6A 2NUCA 2EYLA 4K2KA 3SXHA 4EQPA 5ISRA 3SR1A 1EZ8A 2EYFA 3TMEA 1SNDA 5CGKA 2EXZA
chains in the Genus database with same CATH superfamily
2WP8J 2R92H 5C4JH 1A2TA 1GHKA 1J6QA 1H9SA 1LO5D 4YHHQ 3G4SA 2HDMA 3HKZE 1VF5C 4BY1B 1PA6A 3PIO3 1NY4A 2WAQB 1HH2P 1K8AC 2PYKA 3C1FA 1LABA 4A93H 2WV6D 3KK7A 3CQZH 1HR0L 3VR6A 3Q0AA 3S1MB 4RMFA 2O4XA 5GQOA 3KLRA 2XN9C 1KNAA 3E6ZX 3OIQA 1HCZA 4O2DA 1K8GA 3GTQB 2OQ0A 1VDZA 1X65A 5C4JB 2PNRC 4DV6L 2JA8H 4CJ1B 2HQEA 5HGTA 1A63A 1PRTD 2VXWA 4NW2A 3HOWH 1B7YB 2UXBQ 2VQFL 1JOKA 4HIDA 3AFQA 3TBIB 5BN4A 1VQ9A 2K1BA 1F77A 3EROA 3R8BA 3DUZA 4K6LA 4XT3B 1VQ7A 1WTVA 2ZJRA 1HPCA 1S5ED 1JB3A 3S17H 1HUMA 1P16A 2UU9Q 2QEJC 3F8TA 3RD4A 2UXDQ 1YHAA 2A5HA 4DK3C 3VYUA 2A6HC 5I2YA 1RCVD 2SNMA 2A1AA 3CHBD 4ME3A 3CKIB 2AQ2B 5JJLA 1L1OB 3CCUA 1SNPA 4KKSA 3HOXG 1V1PA 4IUTA 3EA6A 2F0EA 4WRDA 4DGZA 4LF5Q 1R9TH 2F0MA 4JI5L 1KTKA 5IGDA 1A3VA 1QZGA 4BY7H 1B2TA 4XTCS 1OTCA 3WOEA 3JAME 1PXUA 2MPMA 3PO3B 1ASYA 1VMPA 3MHBA 2E75C 2X6GA 1CKNB 3PF4A 2CW0D 2VY3A 4MNOA 1TWAH 3H15A 4BXXG 1UWVA 4J1MA 1JOQA 4DR3L 4DR3Q 2R92G 4XDXA 2OTJA 4YCVA 3PQIA 3K8AA 1EQRA 4L5TA 5FLXL 4ZYSA 1W6JA 2L55A 4LUOA 3EN2A 2EJMA 4MHEA 3AU7A 2VQEL 1EYAA 4A75A 4ZQ3A 1N9WA 3QR8A 2JA7H 1K9MC 2UUCL 4JBKA 1TQOA 4IPDA 1SROA 3F2CA 3UE0A 1F9SA 3VDYA 4R8NA 3OIPA 3KDFB 5IE8A 3H3VC 4G7OC 1EY7A 3NTHA 4JVZA 1EEFD 5FLXE 2J4XA 1SMYD 1BBWA 1EY9A 4NXMQ 4A3JH 2IJ0A 1SAPA 5IT9c 3TS2A 4KKTA 4DAYA 3RN5A 5KYIA 1B4OA 3NHHA 1N8RC 2A73B 4IFDH 1EYCA 1A6XA 4KK7A 1RTNA 2FMMA 3PUVA 1QB5D 3BG3A 2B2UA 2IX3A 4DAVA 1TVXA 3HOYB 1F2ZA 2Z8LA 2H5XA 5FLXc 1EIYB 1PTOB 2K7VA 1TWFH 4LJZC 5JPNC 1I4HA 1Q90A 3X3MA 3HGBA 2V4DA 3MEFA 1QNUA 4A3IB 4KY5A 2LXJA 1AE3A 1ILQA 4JI0Q 4JOIC 2E2DC 1G51A 2PQAB 4X3TA 3HOXH 2R93G 4K14A 3H0GB 3GO5A 1U4MA 5JAVA 1Z47A 3FVQA 4RGMA 3T53B 3J80L 4IUQA 3CPWA 2JA9A 1ENAA 5IIFA 4F87A 2XIWA 3A74A 2WB1E 1XTDA 2OTLA 1HHVA 4RFBA 2Q2TA 3QWNA 1YJNA 3MA2B 2L4NA 1FNVA 5D3DA 1RODA 1SFOH 3J81c 4DR7Q 1Z9FA 1V1PB 2WB1B 4A93B 5C3EH 1B70B 5CV9A 1JMCA 4PG3A 3HOUG 3TEHB 3S1QH 4DR6Q 4DXFA 5DM63 3GTGB 1BOSA 4LFAQ 3E9HA 3PCOB 1YNND 4DU9A 1HJPA 1SNOA 1V1QA 1UEAB 4AIMA 4CGYB 5AJ3L 1VQ8A 4G4KA 2ZXRA 2E5LL 4OO1G 4QF4A 3MWYW 3HP3A 1YBYA 1UAPA 4H7BA 2N8NA 3NQTA 4DV6Q 1TY2A 3DHQA 3S1MH 1XXGA 5IYCH 3KF8B 4A3DH 3QB3A 1C9OA 1TT2A 1BR9A 2A6HD 2ZT9C 4J6HA 1Q1BA 1H9MA 2RHSB 4QL5A 5D3IB 2L15A 2FFKB 2WIIB 4RH6A 2KOLA 1PFBA 2G5DA 4IPCA 4HJ9A 3GQBA 1KIXA 4FF1A 1I4PA 3KLWA 1O7LA 2EYJA 3LWEA 4R4CA 4KHVA 5E4XA 4C3JH 2L5TA 3M7GA 1EIGA 4IUUA 4RKLA 4XYQA 2MP1A 2ICIA 2IX0A 4ALPA 4L5QA 4B3SQ 3F2UA 1KLUD 3J7AV 1W2BA 3UI2A 1WI5A 4V0BA 2FMCA 2NYZD 4PV1C 1N36Q 2LSSA 3MC0B 1HA6A 1IYJB 1JB7A 4RGOS 4HJ5A 3BDCA 2QDLA 1B44D 2F0VA 3M3YB 4HIMA 3CCJA 3NENA 1HUNA 1EWCA 1DJRD 4X3KA 2JA8G 3ND9A 4NXML 3RZOB 4EQOA 5LL6S 3EFXD 5C4XG 4GOPB 3W2DA 5I2XA 1ZEQX 2ID0A 2KQ3A 5A2QE 4TKOB 1SMYC 1GUSA 1XNRL 3S9WA 2EDGA 2VB3X 1VQJA 2YV5A 1Q1EA 1EU3A 1WTPA 3I4NG 2GVBA 2H1EA 4KI0A 4IZ8A 1SE3A 5C0XH 4DXGA 5FK9C 3O13A 3NE5B 3JAMi 1N36L 3MAQA 4GKJL 3A8JE 4K0KQ 4DNRB 2KECA 4OGQC 3PO2B 1MIUA 2NVQB 3FEWX 3BS1A 3CCEA 3RMHA 1Z7TA 2JEAI 5I4DA 4L5SA 5M3FB 1ZXTA 4UHVA 3MZ5A 3H0GH 3MXGA 2NN6H 3RLNA 3CC7A 1AZPA 4LF5L 3NXWA 3T1YQ 2Q2UA 1QZHA 3VYRA 1PTOH 3CCQA 3SXHA 1K83H 2NUCA 3PO2H 5J3BA 1JJCB 3M4PA 2K5WA 4XT1B 1WD1A 4QJFA 1BQQT 2XTIA 3OOCA 2K05A 4F8MA 3BU2A 4L8JA 3W1BA 4RHSA 2ZJQA 1STBA 1JJGA 3M4OH 2EYMA 4RWSC 1VF7A 2RDGA 4DN4M 2HIVA 1RDPD 2B3GA 4YWMA 4A3KH 3CD6A 2UU9L 2KEEA 2D2CC 4HCSA 3G6EA 2HHHQ 2VQFQ 5M9OA 4JI8Q 4G7ZC 1WVLA 2RCNA 1YNNC 2PMZE 2F4IA 5EKIA 3K5OA 2C9OA 1HTPA 4BBRB 4I65A 4DAPA 3KBGA 1AFPA 2CQAA 4JV5L 4DV4L 1NR4A 3PUYA 2YU9B 4RCNA 3IAYA 1LT5D 1I6VC 5C0XJ 3PV0A 4AQYQ 2ASBA 4OO1I 1Q8IA 2KCNA 2F0JA 3I4NH 1G291 3GTJH 1CZWA 1IBLL 1PLFA 4P74A 1Y8PB 3BZCA 2OWOA 1KC8C 1IBKL 1STHA 4GLVB 3T1HQ 1HNZL 1OO9B 1SEBD 4LF8L 1WTWA 4LF4Q 4DV3Q 1KRSA 2XWBB 1PH8A 4YY3L 1CZGA 2UXCL 2D9UA 3STBC 2L1BA 4XQNA 1JWUD 4DR7L 1TWCH 1YHBA 5CV8A 3CCSA 5IT9E 3K7AH 4OX9Q 2B2VA 4A3CG 3LGJA 1X54A 2L0CA 3K57A 1HRJA 2JE6I 1QOHA 1HA5A 1K3RA 4DV5Q 1IYUA 3A5ZB 4C3HB 2H4OA 3OWEB 2FHTA 2RQXA 1LM0A 2Y0SG 4UPAA 1L0WA 4A3EH 3L7ZC 1QG7A 4A3IG 4LF6L 3PIPA 1LTID 4KD4A 4ILWA 5FJ8H 3HOZG 2K5DA 4XXEA 1PFMA 4FO2A 4FF2A 4A3GG 2DNCA 2IWHA 1EYDA 2BH2A 3I55A 1Z6HA 1R4QB 5A2QL 3SR1A 3CMAA 2RKSA 5M3MG 1SNDA 4X65Q 1WYDA 1TWAB 3JAMc 4V190 1CA6A 4DAYB 2R7ZB 1MD2D 4R9WA 2R6GA 5EPJA 1BBUA 1YNXA 2AWNA 1HXYD 3FKIB 4RKBA 4X64L 5M3FH 3H3VI 3HOXB 1BDOA 4POFA 1SE4A 2MQHA 1HFGA 5ELDA 1E2WA 3NELA 1KDAA 2A69C 2PI2A 4OO1H 5IGGA 4X66L 4XYOA 4LFCQ 4AH6A 4LAAA 3WDNA 4GLXA 2YYZA 3AFPA 4XQQA 1PH4A 1DYQA 1PH1A 1VQHA 4KTAA 5LL6X 2Z1CA 5KNCA 1LLRD 3GP7A 4C1NK 4FNFA 2F0QA 4BA1I 1D5ZC 2RA4A 3AEVA 3PSIA 2R92B 3QOLA 1QJOA 1S5BD 4ZAIA 4A3LG 4KV6A 4DNTB 1F2MA 4MTNA 4P72A 1J5EQ 3S1NH 1QCBD 2DNEA 3BVMA 4K8JA 4YY3Q 2F1MA 1EY0A 1RJTA 4UAIA 1KABA 1PYBA 1PMRA 4PZ8A 5D65A 2K5NA 1BCPC 3CRKC 2RCFA 5ELNA 2KVMA 4IUPA 2K52A 1EQTA 4TVAB 1HNWQ 4IPGA 5JJZA 2SNSA 1CK1A 2R3ZA 4HMJA 4DV7Q 3KF8A 3F2DA 3G6JB 4A3FB 2LS01 4BBRG 3K7AB 4AYBG 5M3FG 4R4TA 2K14A 1BBXC 4KY6A 1FJGQ 2EXDA 2F0TA 4EQPA 4AQYL 1XPOA 4B3TQ 2RSOA 1S5CD 4IALA 2E2IB 2EXZA 2R7ZG 3DM1A 4JYAQ 1T9HA 1EY5A 4BBSB 1D2BA 1SXTA 1VS0A 4LFBL 1JE4A 2LFNA 3P1HA 3GDEA 3J80c 3D4RA 3ONAB 3STBD 2NVYB 4POGA 4PZ6A 3BDOA 4Z9CB 1VQNA 1Q46A 3GTJB 4ZRZA 1S40A 3U9SA 4YIJA 1FVIA 1L0YB 1EEID 4LF9L 5IYDH 4QB4A 2NWGA 1HZ9A 3MTSA 4JI7Q 3K0XA 1SBBB 3QJYA 1SYCA 1YVCA 5AJ3Q 3G7LA 2WINB 3RN2A 4DUYQ 2NVXB 5ELOA 3E0JA 2IPKD 2JA6H 1JORA 1C0AA 4EQNA 3N6RA 5EPKA 4P71A 4LW1A 2K4KA 5IGBA 2NVTB 1BVSA 3ERQA 2LY7A 4LFCL 3TP5A 4X66Q 1C7YA 1X3PA 2R7FA 3GV6A 2M2LA 3CAMA 1WJJA 1E24A 2F0IA 2I07B 3RZOH 4IOAA 3UDXA 5C44B 1TS2A 5DLQE 2MUYA 5JEAJ 1EUJA 4DK0A 1U5KA 2Q8TA 1X3GA 2K01A 1F2LA 4GN3B 1VQDA 5KGUA 1ONLA 3VR4A 3ND8A 1TWHB 5GADC 2ZM6L 2F0GA 2ZM6Q 1XMOQ 4GKJQ 2JK8A 4JPBW 5GAHC 2O5JC 3TQYA 4EVOA 3P75A 2DY8A 1IKMA 5ELFA 1BF4A 2BDNA 4IURA 4CDCC 1YITA 1T5EA 4X64Q 3NUCA 3TZUA 2GN5A 2HCIA 2NVQH 4H44C 2A69D 3KLSA 4P2CB 2HIXA 5KNDA 4FXKC 1MI2A 1F9QA 4IUVA 1IBMQ 5JPMC 2B29A 2PMZB 2XWJB 3NWSA 4DK1A 3SHLA 1PTOC 1I4RA 5DNFA 4YCWA 4E6IA 2RDHA 1VQ5A 1ICFB 4B3RQ 2CH4W 3NTKA 2I5HA 1K3BC 2MO1A 4C3JG 4A3KB 1YNJD 2B63G 3FRPB 5CGKA 4HEDA 1TWGB 5EJWA 4A3IH 2HUGA 5M5WB 1UE7A 1LT3D 2AHOB 3A54A 2PW7A 5T1GA 5IP9H 4RHRA 2Q2HA 5AFWA 5JVH3 1H95A 1IZ6A 3I70A 2B2WA 3GTGH 3U50C 4OEMB 4BA2I 5C4XB 5M3MH 1DM0B 1OXSC 2EY2A 4UP7A 4LF4L 4DV2L 1LTSD 4N8FA 3CF5A 3D6CA 2VUMH 3C46A 3HG9A 4CHTB 1IBKQ 3F1ZA 1BCPD 4HMIA 3P20A 3CU7A 3W3AA 4A3MG 1SFOB 5FJ8G 1DGSA 4DV3L 3SVMA 5IP7G 1UUPA 1N32L 4AYBE 2F0PA 2PZUA 1RHPA 4CDFC 1E3PA 1Y8OB 3HOYG 3PIOA 1SRUA 1LTRD 4JI5Q 1EIFA 1DOLA 1RTOA 1O7ZA 1TWCB 1BCPB 2EYOA 3J80i 1HNWL 1NE3A 1CT1D 4JI3L 5BR8L 4ZKCB 2ZJPA 5C4HA 5KNBA 5FOBB 3I4OA 5IWAQ 4A3JG 3I72A 2JEBI 1Q86C 4EGVA 2M00A 4DR5L 1GKHA 2IW3A 4FXGC 2F0WA 1PV4A 2B2TA 2JYOA 2AMCB 2HQLA 3D6WA 4UP9A 1V43A 1G2SA 4LK1C 1LUZA 3RUZA 1TU2B 4LF8Q 3CC2A 1JT8A 2CKZB 1JICA 1EWIA 2Z9HA 1IYVA 3I4MG 5EBDA 1JE5A 2YTYA 5BR8Q 4KMUC 4KD3A 1Y8NB 2ZXOA 4DV4Q 1QUQB 1B9NA 1Q7YC 4JI2L 5JJIA 4WFN3 1IKLA 1QVCA 5DAUA 3HZXA 4GLAC 2N88A 3KFUA 1U9RA 1SMXA 1B9MA 2VS1A 3QIAA 4JBMA 4YWLA 1Y69U 1WCMG 4C3HH 3GTOB 5C5MA 4DV1Q 2KHJA 1MSGA 5EAYA 3J81i 3IFDA 3GTLH 2JXMB 3OPOA 3N52A 3V96A 1KL9A 5EKKA 3OMGA 2HDLA 1D1KA 3K5MA 2QEXA 1CI3M 5IOCA 1A3UA 4GN4B 1JR0D 1IXRA 4N9PA 1OXUA 3FKIG 1IBML 3SGIA 3L3OC 5FO9B 4BY1G 5EQ0A 4PMWA 1SNMA 4JI1Q 1STAA 4ID6A 2EIFA 3S15B 4M8AA 3HKZB 1F9PA 1BXTA 1CFMA 4BBRH 2EPBA 3I3CA 4Y7NH 4KHPQ 2UXDL 1PTOD 3OW7A 5IYDG 4Q5VA 1MBYA 2E8GA 3I90A 3A7AB 4NXNQ 4BS9A 3LNNA 1KDBA 5LMUL 4IO9A 5HGQA 4A3DB 1YNJC 4WJWA 1SNQA 4GNXB 2DGYA 3TZDA 5J22A 2I5LX 4B9WA 4B08A 5C5LA 2Z4HA 4Y7NB 2VZAA 4NXNL 4G57A 4H0LC 3H91A 5ELBA 5LMNW 4K5XA 3GTQH 3HOZH 1G2TA 5C6AA 2OCEA 3CCRA 2XNAC 3RLOA 3S2DB 2R7DA 2RHQB 4ME5A 5KIXA 4IPHA 5M5WH 1B8AA 4MTKA 5E1FA 3D0FA 3T16A 4QIWE 2BE5D 3CPFA 4BBSH 3R93A 1CM9A 1NR2A 1J8IA 1LTGD 4HAEA 2E2HH 4LF9Q 2GA4B 4WJ4A 2D62A 2BH8A 3BJUA 1BNZA 2WAQE 2AQ1B 1FGBD 2E5LQ 4IJLA 1Q3LA 3TP8A 2PPBC 3G48A 5JEAG 4JI8L 3TMEA 4DPGA 4IFDI 3GTKH 5GAGC 5IGFA 5FO8B 1RL2A 3AQQA 2Z6KA 1GOZA 4ULLA 4MN3A 2F0UA 3A55A 1BCPF 2CFMA 3OYYA 3Q22A 5BN3A 2EVBA 4A3JB 3VA5A 4JG2A 3DLLA 4NPSA 2IX1A 4RCOA 2F03A 4DR6L 3S14B 1OXVA 1UNSA 2NTTA 2ATWA 3DWPA 1RD9D 4P73A 2B63H 4KHZA 4NKLA 1PFSA 1HFNA 2YTXA 5I6WA 2XRQD 1E7ZA 1AW7A 1FJGL 3I8ZA 1BO0A 1GUNA 5LMNQ 4A3LH 3U4ZA 3FPUB 1CKOA 4DNIA 4DV7L 1NUCA 4B3ML 5I6YA 2PZTA 5E4WC 1KHIA 2N3SA 1KNEA 4JBJA 2FINB 4B3RL 1IHZA 3M4YA 2HT1A 1E22A 4YCUA 5IGEA 4TQUS 3NEMA 2IY5B 3NBIA 3HOUH 5CR3A 4ODGA 3H6MA 5IP7H 5IY0A 1LTTD 3J7AF 2JJQA 1JJ2A 4NP5A 4IUNA 2FXQA 1U4RA 2VL6A 1RKNA 3R3OA 1YJ9A 2QW7A 1KD1C 5JOBA 1JOOA 3KYHC 1PH5A 2TMPA 4HJ8A 4HCEA 1VQFA 4GKKQ 1VQBA 1VQMA 3ULLA 3GTPB 3BVGA 2UUBQ 3D8GA 3MXPA 4DV0Q 2O2LD 4H13C 3TSSA 4JI0L 1I6HH 2E76C 2V1CC 3TS0A 1CQVA 1SYDA 2YU9H 3CCVA 2PI2E 4MZ9A 1K8OA 3ERSX 2IT1A 1ESRA 4C1NI 1HZBA 1B50A 1J9OA 3S15H 1U4LA 2L12A 4DAMA 4GN5A 2K6AA 4IOCA 2C5CA 1K0RA 2HCCA 2B2WC 4C3IB 4A3CH 1CSQA 2DJGC 3RNUA 1EU4A 5EKLA 5C44G 4RAUC 4GNXC 5TSSA 1PHJA 4CKBA 5KEEA 5KYLA 5M3MB 1N34Q 2CHBD 4JW0A 3TP6A 3C1EA 4R4QA 2NZOA 2G9HD 4X65L 1TWGH 3VYTA 4B3SL 2F3IA 2JA5H 1STGA 2AUJD 2BE5C 1QE6A 4JI2Q 4DR5Q 2ALYB 5FO7B 2F0FA 4JYAL 2JA6B 3CXCA 3RZDB 2F0OA 3D31A 3S17B 2B2TC 1WCMH 4C3HG 5L37A 4OX9L 1N33L 1YJWA 1XMOL 1ESFA 1TXYA 3J81E 3HS0C 3J7ZC 3BZKA 3F2BA 2X6LA 5C0XG 3M3YH 1CTMA 3GTKB 1K8MA 1UE1A 3QOJA 3HOVB 1KLGD 3IFTA 4BWGB 1NMGA 1XWEA 4PMBA 1JWSD 2TSSA 4HR7B 4U68A 2PCFB 3WOFA 2L9HA 3K81C 4A3EB 1LT6D 1VQKA 1EIHA 3J7YW 2Q8RE 2A6EC 3FKIH 2EZVA 1AEXA 3H0GG 4QGUA 4NMZA 4R1JA 4L63B 1WTXA 1PH2A 3S2HB 1TS5A 4JC0A 3PIP3 2AWOA 1V9PA 3HOVH 2NVXH 2LXKA 4KLKA 2D0OA 4DF7A 1TWFB 4K2LA 4IFDJ 2JP1A 3K80C 1N32Q 1HZAA 4JK1C 1O7YA 3GTLB 1CKNA 1D7QA 4CJ0B 1WOCA 3I4MB 3FP9A 1I3QH 2K28A 5FLMG 1WTQA 2K5QA 2JA6G 1YI2A 2IHFA 3S2HH 3HOUB 2A8VA 1SYGA 1UE6A 4K5WA 1X3QA 1MJCA 1BKBA 3MEHA 1LYLA 2GVAA 2F0SA 3J80E 3OTOQ 1QNKA 3BYYB 4HJAA 2JA5G 1WFQA 3NWTA 2HD3A 2PO4A 5C0XI 2JA7G 3CP0A 1E1TA 3PUXA 1M4VA 5I9PA 1PFNA 4GOPC 1LACA 5CC4A 3GTOH 1EWHA 4JCVE 4DUZL 3Q24A 1EY6A 1DXMA 1W3SA 3HKSA 3QO2A 3RR5A 1U0LA 1N33Q 2VUMB 4OL7A 3PGZA 3K5NA 2UUAL 3T1YL 1TWHH 2LKVA 2G9DA 4O0AA 3I91A 1FNWA 5FKAC 1OXXK 2EY5A 2F0HA 2KA7A 5LMUQ 1AH9A 4JI1L 1VQCA 2A19A 2MHVA 4C2MH 4GNXA 2RBMA 1K83B 4NB3A 2CWPA 2MFIA 1VMCA 2D0PA 2WAQG 1EFWA 2VNUD 1N34L 2L11A 1VQPA 1XNQQ 1QWYA 4P75A 5EPLA 2F3VA 3PO2G 3BYTB 2R93H 2F4VQ 1PH7A 3T13A 4JI7L 4N8X1 4A3EG 3DXJC 3W1GA 1W6KA 1L1OC 2K75A 4LUZA 1FNUA 1NNXA 2CVRA 2I0QA 1HNXL 3OWFA 1GXDC 4DR2Q 3DEPA 1VCIA 4X3UA 4A3GH 1WD0A 4UY8C 3GV3A 2UUAQ 4DV0L 2WACA 3URYA 1I50H 5K36H 2K5VA 4C3IH 3GD7A 5LHY1 1X3EA 1GM5A 4RA8A 4HTHA 4DV1L 1K0SA 3AMUA 3SDZA 4DUYL 1O7IA 2NZHA 2UUBL 2NVTH 3L2PA 4A3BG 4HJ7A 2MGSA 3Q23A 2UXBL 4X3SA 1MHWC 4LWCA 4N9TA 4FP5D 1G91A 2E2IH 1I4XA 4K2KA 1LTBD 1PDQA 3V05A 3KJPA 1QILA 2B2VC 4H02A 1WTHA 1ENFA 4KJOA 3D3RA 1NMFA 3WWVA 2YTVA 2B2YC 2JN4A 4L5RC 1X55A 4WORA 3LX0A 3T4AC 3A7LA 4HIOA 3A56A 3S14H 5IYCG 4EQ5A 3ER0A 1NCVA 3UDFA 2A6ED 1EYGA 1G6PA 5I9OA 4TSSA 2B63B 3GTMH 3S24A 5IT9L 1Y1WG 4LF6Q 4HSPA 1LV9A 1EFID 3U9OA 1SSOA 1OXTA 3UDGA 2E74C 3SK8A 3MFYA 1SE2A 1Y1VB 4FDBA 4OWWB 4B9XA 2E2JH 4LFBQ 1D5MC 2BDOA 2IL8A 3FPPA 2NN6G 3HFZB 2BCOA 2ZXPA 4OWTB 1EL0A 2OXPA 4QIWB 3I4MH 1A0IA 1JQYD 4QQBX 5A35A 1X32A 3NBHA 1D1IA 4DR1Q 1GVPA 2KJXA 2Q8IB 1X9NA 2F0NA 3CCMA 3DWQA 5DEHA 4DV2Q 1X56A 2WFWA 1C48A 3E3XA 1L1OA 5EGTA 2Y0SB 2PW5A 4DR4Q 3HOWB 1SJHD 1TIID 4C3IG 1M1KC 1XYIA 3H3VH 4A3KG 1FR3A 2B2YA 1KAWA 2K50A 3T51B 4CBVA 4A3BH 4JV5Q 1XX8A 1STYA 2KUMA 1I4GA 4KN7C 1YIJA 1XMQQ 3K5LA 5M5YB 1DONA 3TREA 3I7FA 5JEAH 1XNRQ 1MGSA 1DOKA 1J5EL 2WKDA 4BY1H 3AB9A 4ZK9B 1GJXA 4F88A 4JBWA 5K5PA 1ZYRD 4X6AH 3FDTA 4F7XA 2AUKA 1A15A 1H9JA 3A8KE 5CBAE 1VQAA 3C3LA 3SK5A 1A2UA 1PZKD 4PZ7A 5F2DA 4A3MB 2B8FA 3NPPA 3K59A 3PUZA 2RSNA 1F9RA 2Z6BA 1KRTA 3I56A 1Q8KA 1FL0A 1E2VA 3KF6A 4LUVA 1QVFA 1IW7D 1S3OA 1II3A 3C2PA 2QKIC 3ICEA 2EY1A 5FLMH 2Z4IA 3DMUA 5JJKA 3KJOA 3OSOA 4BY7G 4FF4A 1VQEA 2KHIA 3SK4A 2F0KA 3RZDH 3CRLC 5D14A 3K0YA 1K73C 3EJIA 2F0DA 1R9TB 4PNYA 1B3QA 2F0LA 1AE2A 4NDXA 1A8VA 4CDDC 2JA7B 1KQSA 1C8CA 1ML0D 3TDQA 1CA5A 2JA8B 1XTCD 1I50B 2OQKA 5JVG3 4DR4L 4JI6Q 5DM73 2XGTA 4KHPL 4CKCA 3NP8A 2PQAA 1YZ6A 3S1RH 1QVGA 2X69A 2PZWA 1E1OA 1SLJA 1EQVA 4CJ2C 2CCZA 3AYHB 4ZUIA 4GZYC 1O78A 1HR0W 3G71A 3NBHB 3PO3H 4OONA 4HSVA 1NAPA 2J0TD 3GTMB 1RIPA 5G3LD 3S2DH 4IJHA 2N55A 1LTAD 1Q12A 1YEZA 3S1RB 3HEJA 1TS4A 1PH9A 1JC7A 1UEBA 3U58A 4HN7A 1S5DD 2UXCQ 2QCPX 2DJFC 2UUCQ 1NSNS 5GROA 3CMEA 4FF3A 1L0XB 4B3MQ 4O42A 4WJ3M 4R4OA 2KCMA 1U4PA 1S5FD 2EYPA 2PNHA 1G6ZA 4QUFA 4ZLTF 5CYUA 3K6OA 3MFGA 3KUPA 4S3SA 4LF7L 2Z0SA 1IL2A 4QY7A 2AQ3B 4YWKA 3E5SA 4MIUA 1CSPA 1IBLQ 5M5XB 4RGTA 3Q6SA 2R61A 2HHHL 5LMNL 1B3AA 2KBNA 5C44H 2FJ2A 1XJVA 1XPUA 5IODA 2B39A 3TRZA 1Y14B 1Y1VH 4M1UB 2EYFA 4TRDA 4UDUC 2E2JB 4BXXH 3M85A 2KCCA 1HR0Q 3GTPH 4RG1A 1H9KA 4FVMA 4R8IA 1GHJA 2OT2A 2DY7A 4GS3A 3D4WA 4CDEC 2XSCA 1PH3A 4K0KL 1P8LA 1FGUA 5HURA 1RF2D 5J39A 3H94A 2QF7A 4A3FG 1MSHA 1FD7D 2M9VA 3HOYH 4QMGA 3FMCA 1B1ZA 4JI3Q 4BBSG 1D6EC 2QILA 1VQIA 1STNA 4LNQA 3NQIA 3ITPA 2CH4A 1I6HB 1ET6A 1HQMC 4OWXB 2XRSD 2RDFA 4JOIA 1B53A 1ZYRC 1Q82C 1SDFA 3E0EA 3OW2A 1VQOA 1GO3E 2Z6KC 1ZKOA 2BA0A 2EE1A 1Y1WH 4PQXA 4A3BB 2VQEQ 1CHQD 2VB2X 3V2TA 3I4NB 4HIKA 5E3FA 5CBEE 1HNXQ 1X6OA 2B2UC 1CKMA 2BOSA 3SK6A 1SYBA 3OHXC 2NB0A 3A0JA 1IW7C 3IRBA 1TKWB 1EOVA 3LWUA 1VQ4A 1GUTA 2A68C 1A3TA 4DK6C 1EZ6A 2Y0SE 1MKHA 2VW9A 2BA1A 4GKKL 3FHWA 2NVYH 1SYEA 1XNQL 4I7AA 5KRUA 3ULJA 4J8QA 5COYA 1PRTB 5IGCA 4BY7B 3DEOA 3BDLA 4C3JB 2MJ8A 3NSWA 5IYBH 1WTRA 2F4VL 5H1SE 1M90C 2N49A 1QUQA 1LT4D 3H09A 3Q8DA 2I46A 2IHEA 1Y1VG 4L6TB 1PZJD 3OTOL 5ELEA 1T5XD 3EBEA 1I94Q 1LTLA 5C3EG 1SR3A 3UE1A 1C4QA 4XIGS 1SNCA 1NTGA 5NUCA 4FXDA 4FYDA 2AKWB 3S16B 1V8QA 2OF1A 4UP8A 3EVQA 1EOTA 1PVOA 3A8IE 4A93G 2EYLA 1GUWA 5CV4A 3BVZA 2EOTA 2ES2A 2CQOA 1PTOF 2EY6A 2QA4A 1VQ6A 3R2IA 3HOWG 2Q2IA 4DV5L 1BUVT 1HTLD 2D5DA 2XVSA 2ZTEA 2EJGC 1EY8A 1DCZA 2WKCA 2K33A 3T1HL 3I4LA 1ILPA 1Q81C 1H9RA 4K8IA 1G8ZD 4YHHL 2EJFC 4OIKA 2KCTA 2DUDA 1I3QB 2CWAA 2MO0A 5T1IA 1HNZQ 4X62Q 4DR1L 3JC66 5M5XH 5EBCA 3M4OB 4ZUJA 4XQJA 3DM3A 4KY7A 1MJEA 4QCLA 1XMQL 1AZQA 4LFAL 3SE0A 1NBWA 2JSOA 1AP0A 4QUCA 3B6YA 2K32A 3CQZB 1DD2A 3HRZC 3DWAA 5CV5A 3M7NA 2WB1G 4C56C 4A76A 5IYBG 3A5UA 4JI4L 2K03A 4CKEA 5G3LF 2KENA 3MXNB 1JCKB 4G7HC 1CUKA 3K7UC 3PO3G 5C3XA 4X62L 4IQZA 1VQGA 4JI4Q 4DKAC 5CORA 4J15A 4C2MB 4IFDG 5C4XH 4A3MH 3HOZB 3MXUA 3TP7A 4B3TL 4A3GB 5CV7A 1PRTC 4ZKBB 4ZCKA 1A62A 1PYWD 5C4ZA 3J81j 1K28A 3L0OA 1JWMD 4U673 5C3EB 2R93B 1Y1WB 1O80A 2MNAA 2RVLA 4O1NA 5C3WA 2E2HB 3S1QB 2O5IC 3VYSA 3NTIA 4A4IA 3J7A5 4LF7Q 3R2TA 1M8AA 1EY4A 3PUWA 3J81L 1TY0A 1UE5A 1NJIC 5CV6A 5M5YH 3U4VA 5ISRA 4I7ZC 2EQSA 1X3FA 2SEBD 3VR5A 3X3NA 4RGNA 1R4PB 1TR5A 4APVA 3MXNA 3HKZG 4DR2L 3S1NB 2A74C 1PYSB 1L2FA 2A68D 1FYCA 1HZCA 4ABNA 3PMFA 3VA7A 1WTOA 3VR2A 3EQLC 2B8GA 1E0BA 2DN8A 3CC4A 3M9BA 5CMDA 1KDCA 3HOVG 1WCMB 2JQOA 5BN5A 3S16H 1VQLA 2ZTDA 2SDFA 1I94L 1KAAA 1CQFA 2JA5B 4Y52H 4JI6L 2KHSA 1F2YA 2CW0C 2P5ZX 5IP9G 1XPRA 1AN8A 1ASZA 4OHJA 3VR3A 3EIVA 1SJED 1ICWA 1PRTF 5K36G 4A3FH 3T56B 2QDBA 3UDIA 5GAEC 3KLSX 1DZ1A 2NTSA 1GD7A 2VUMG 2PQEA 4KJNA 4OXPA 4LMQD 4DUZQ 3CW2C 2NBFA 1EQQA 3RLFA 2QGQA 5J1ZA 3TN2A 1V1OA 1HQRD 5ELCA 1DOMA 1E2ZA 1TS3A 2F52A 3KF6B 2ICEC 2EYHA 1S4ZA 4GOPA 2R7ZH 3QG1A 2RF4A 1H9SB 4KKUA 4K5VA 3E9IA 3KBXA 1SE8A 2F3WA 1CHPD 2N78A 3IL8A 3JAML 1ET9A 1ENCA 3SEBA 3P7JA 3OMCA 3PF5A 2NZ1D 2OEOA 3I73A 2NN6I 4A3DG 2ENBA 1KXLA 3W5OA 1IL8A 4OIJA 4AYBB 3IKJA 5E7NA 2I5MX 2ZTCA 1S72A 2SOBA 3CCLA 2C35B 3ULPA 4IN3A 3BZDB 4K6DA 4R4IA 4OELB 1PH6A 3KOJA 1GUGA 4KN4C 5IWAL 1SYFA 4DA2A 3K58A 5HY6A 1YHQA 2KEDA 1GUOA 1I5FA 4Q0FA 1STEA 3D4DA 2K5HA 1I4QA 1SN8A 2LMCB 3NK9A 3L9AX 3ZYYX 3MVVA 4EX5A 3KDFA 1D8LA 1D5XC 3M4QA 4PMCA 2J7ZA 1PZID 3ZJYC 3I2ZA 1EZ8A 4DFAA 2K04A
chains in the Genus database with same CATH topology
2WP8J 1A2TA 1GHKA 1LO5D 1H9SA 2HDMA 1VF5C 4BY1B 3PIO3 2WAQB 2PYKA 3C1FA 1LABA 2WV6D 3KK7A 3VR6A 3Q0AA 3S1MB 2O4XA 3KLRA 2XN9C 1KNAA 3E6ZX 3OIQA 1HCZA 3GTQB 1VDZA 5C4JB 2PNRC 4CJ1B 2HQEA 5HGTA 1PRTD 2VXWA 4NW2A 1JOKA 3TBIB 5BN4A 2K1BA 1F77A 3EROA 3R8BA 3DUZA 4K6LA 4XT3B 1WTVA 1HPCA 1S5ED 1JB3A 1HUMA 2QEJC 3RD4A 2A5HA 3VYUA 2A6HC 5I2YA 1RCVD 2SNMA 3CHBD 3CKIB 2AQ2B 1SNPA 4KKSA 1V1PA 4IUTA 3EA6A 2F0EA 4WRDA 4DGZA 2F0MA 1KTKA 5IGDA 1A3VA 1B2TA 4XTCS 3WOEA 3JAME 1PXUA 2MPMA 3PO3B 1VMPA 3MHBA 2E75C 2X6GA 2CW0D 4J1MA 1JOQA 4XDXA 5FLXL 4ZYSA 1W6JA 2L55A 2EJMA 4MHEA 3AU7A 1EYAA 4ZQ3A 1TQOA 1F9SA 4R8NA 3OIPA 3H3VC 4G7OC 1EY7A 3NTHA 1EEFD 5FLXE 2J4XA 1SMYD 1EY9A 2IJ0A 1SAPA 4KKTA 4DAYA 5KYIA 1B4OA 3NHHA 2A73B 4IFDH 1EYCA 1A6XA 4KK7A 1RTNA 2FMMA 3PUVA 1QB5D 3BG3A 2B2UA 2IX3A 4DAVA 1TVXA 3HOYB 1F2ZA 2Z8LA 1PTOB 2K7VA 4LJZC 5JPNC 1I4HA 1Q90A 3X3MA 3HGBA 2V4DA 1QNUA 4A3IB 4KY5A 1ILQA 2E2DC 4X3TA 4K14A 3H0GB 3GO5A 1U4MA 5JAVA 1Z47A 3FVQA 4RGMA 3T53B 3J80L 4IUQA 1ENAA 5IIFA 4F87A 2XIWA 1HHVA 4RFBA 3QWNA 3MA2B 2L4NA 1FNVA 5D3DA 1RODA 1V1PB 2WB1B 4A93B 5CV9A 4DXFA 5DM63 3GTGB 1BOSA 1YNND 4DU9A 1SNOA 1UEAB 4CGYB 4G4KA 2ZXRA 4OO1G 4QF4A 3MWYW 3HP3A 1UAPA 4H7BA 3NQTA 1TY2A 3DHQA 1XXGA 3QB3A 1TT2A 1BR9A 2A6HD 2ZT9C 4J6HA 1Q1BA 1H9MA 5D3IB 2FFKB 2WIIB 4RH6A 2KOLA 1PFBA 3GQBA 4FF1A 1I4PA 1O7LA 2EYJA 3LWEA 5E4XA 4KHVA 2L5TA 3M7GA 1EIGA 4IUUA 4RKLA 4XYQA 2MP1A 2ICIA 2IX0A 3F2UA 1KLUD 3J7AV 3UI2A 4V0BA 2FMCA 2NYZD 4PV1C 3MC0B 1HA6A 4RGOS 3BDCA 1B44D 2F0VA 3M3YB 1HUNA 1EWCA 1DJRD 4X3KA 3ND9A 3RZOB 4EQOA 5LL6S 3EFXD 3W2DA 5I2XA 1ZEQX 2ID0A 2KQ3A 5A2QE 4TKOB 1SMYC 1GUSA 3S9WA 2EDGA 2VB3X 1Q1EA 1EU3A 1WTPA 2H1EA 4KI0A 4IZ8A 1SE3A 5C0XH 4DXGA 5FK9C 3O13A 3NE5B 3MAQA 3A8JE 4DNRB 2KECA 4OGQC 3PO2B 2NVQB 3FEWX 3BS1A 3RMHA 1Z7TA 2JEAI 5I4DA 5M3FB 1ZXTA 3MZ5A 3MXGA 2NN6H 1AZPA 3NXWA 3VYRA 1PTOH 3SXHA 2NUCA 2K5WA 4XT1B 1WD1A 1BQQT 3OOCA 2K05A 4F8MA 4L8JA 4RHSA 1STBA 2EYMA 4RWSC 1VF7A 2RDGA 4DN4M 1RDPD 2KEEA 2D2CC 4HCSA 5M9OA 4G7ZC 1WVLA 1YNNC 2F4IA 5EKIA 3K5OA 2C9OA 1HTPA 4BBRB 4I65A 4DAPA 3KBGA 1AFPA 2CQAA 1NR4A 3PUYA 2YU9B 3IAYA 4RCNA 1LT5D 1I6VC 5C0XJ 3PV0A 4OO1I 1Q8IA 2KCNA 2F0JA 1G291 1CZWA 1PLFA 1Y8PB 1STHA 1OO9B 1SEBD 1WTWA 2XWBB 1CZGA 2D9UA 2L1BA 4XQNA 1JWUD 5CV8A 5IT9E 2B2VA 2L0CA 3K57A 1HRJA 2JE6I 1QOHA 1HA5A 1IYUA 4C3HB 2H4OA 3OWEB 2FHTA 2RQXA 3L7ZC 1QG7A 1LTID 4KD4A 4ILWA 2K5DA 4XXEA 1PFMA 4FO2A 4FF2A 2DNCA 2IWHA 1EYDA 1Z6HA 1R4QB 5A2QL 3SR1A 2RKSA 1SNDA 1TWAB 4V190 1CA6A 2R7ZB 1MD2D 4R9WA 2R6GA 5EPJA 2AWNA 1HXYD 3FKIB 4RKBA 3HOXB 1BDOA 1SE4A 1HFGA 5ELDA 1E2WA 1KDAA 2A69C 4OO1H 5IGGA 4XYOA 4LAAA 3WDNA 2YYZA 4XQQA 1DYQA 4KTAA 5LL6X 2Z1CA 5KNCA 1LLRD 3GP7A 4C1NK 4FNFA 2F0QA 4BA1I 1D5ZC 2RA4A 2R92B 3QOLA 1QJOA 1S5BD 4ZAIA 4KV6A 4DNTB 1F2MA 1QCBD 2DNEA 3BVMA 4K8JA 2F1MA 1EY0A 1RJTA 4UAIA 1KABA 1PMRA 5D65A 1BCPC 3CRKC 2KVMA 4IUPA 1EQTA 5JJZA 2SNSA 1CK1A 2R3ZA 4HMJA 3KF8A 3G6JB 4A3FB 2LS01 3K7AB 1BBXC 4KY6A 2F0TA 4EQPA 2RSOA 1S5CD 4IALA 2E2IB 2EXZA 3DM1A 4BBSB 1EY5A 1D2BA 1SXTA 1JE4A 2LFNA 3P1HA 3D4RA 3ONAB 2NVYB 3BDOA 4Z9CB 3GTJB 4ZRZA 3U9SA 4YIJA 1L0YB 1EEID 4QB4A 2NWGA 3MTSA 1SBBB 3QJYA 1SYCA 3G7LA 2WINB 2NVXB 3E0JA 2IPKD 1JORA 4EQNA 3N6RA 5EPKA 5IGBA 2NVTB 3ERQA 2LY7A 3TP5A 1X3PA 3GV6A 2M2LA 2F0IA 2I07B 5C44B 1TS2A 2MUYA 5JEAJ 4DK0A 2Q8TA 2K01A 1F2LA 5KGUA 1ONLA 3VR4A 3ND8A 1TWHB 2F0GA 2O5JC 4EVOA 3P75A 2DY8A 1IKMA 5ELFA 1BF4A 2BDNA 4IURA 1T5EA 3NUCA 3TZUA 2HCIA 4H44C 2A69D 3KLSA 4P2CB 5KNDA 4FXKC 1MI2A 1F9QA 4IUVA 5JPMC 2PMZB 2XWJB 3NWSA 4DK1A 3SHLA 1PTOC 1I4RA 5DNFA 4E6IA 2RDHA 3NTKA 4C3JG 4A3KB 1YNJD 3FRPB 5CGKA 4HEDA 1TWGB 5EJWA 2HUGA 5M5WB 1LT3D 3A54A 2PW7A 5T1GA 4RHRA 5AFWA 5JVH3 3I70A 2B2WA 4BA2I 5C4XB 1DM0B 1OXSC 2EY2A 1LTSD 3D6CA 3C46A 3HG9A 4CHTB 1BCPD 4HMIA 3P20A 3CU7A 3W3AA 1SFOB 3SVMA 1UUPA 2F0PA 2PZUA 1RHPA 1Y8OB 1LTRD 1DOLA 1RTOA 1O7ZA 1TWCB 1BCPB 2EYOA 1CT1D 4ZKCB 5C4HA 5KNBA 5FOBB 3I72A 2JEBI 4EGVA 2M00A 2IW3A 4FXGC 2F0WA 2B2TA 2JYOA 3D6WA 1V43A 1G2SA 4LK1C 3RUZA 1TU2B 1JICA 1IYVA 5EBDA 4KMUC 4KD3A 1Y8NB 2ZXOA 1B9NA 4WFN3 1IKLA 5DAUA 3HZXA 2N88A 1U9RA 1B9MA 3QIAA 1Y69U 3GTOB 5C5MA 1MSGA 3IFDA 2JXMB 3OPOA 3N52A 3V96A 5EKKA 3OMGA 2HDLA 1D1KA 3K5MA 1CI3M 5IOCA 1A3UA 1JR0D 4N9PA 1OXUA 3L3OC 5FO9B 5EQ0A 4PMWA 1SNMA 1STAA 4ID6A 3S15B 4M8AA 3HKZB 1F9PA 1BXTA 1CFMA 2EPBA 3I3CA 1PTOD 3OW7A 4Q5VA 1MBYA 3I90A 3A7AB 4BS9A 3LNNA 1KDBA 4A3DB 1YNJC 4WJWA 1SNQA 3TZDA 5J22A 4B9WA 4B08A 5C5LA 2Z4HA 4Y7NB 4G57A 4H0LC 3H91A 5ELBA 4K5XA 1G2TA 5C6AA 2XNAC 3S2DB 4ME5A 5KIXA 5E1FA 3T16A 2BE5D 3R93A 1CM9A 1NR2A 1J8IA 1LTGD 4HAEA 2GA4B 2D62A 1BNZA 2AQ1B 1FGBD 1Q3LA 3TP8A 2PPBC 5JEAG 3TMEA 4IFDI 5IGFA 5FO8B 1GOZA 4ULLA 4MN3A 2F0UA 3A55A 1BCPF 3Q22A 5BN3A 2EVBA 4A3JB 3VA5A 2IX1A 4RCOA 2F03A 3S14B 1OXVA 1UNSA 2NTTA 3DWPA 1RD9D 4KHZA 4NKLA 1HFNA 5I6WA 2XRQD 1AW7A 3I8ZA 1BO0A 1GUNA 3FPUB 1NUCA 5I6YA 2PZTA 5E4WC 1KNEA 2FINB 1IHZA 3M4YA 5IGEA 4TQUS 3NBIA 5CR3A 4ODGA 3H6MA 1LTTD 3J7AF 4NP5A 4IUNA 1U4RA 1RKNA 3R3OA 5JOBA 1JOOA 2TMPA 4HCEA 3GTPB 3BVGA 3D8GA 3MXPA 2O2LD 4H13C 3TSSA 2E76C 1CQVA 1SYDA 1K8OA 2IT1A 1ESRA 4C1NI 1B50A 1J9OA 1U4LA 2L12A 2K6AA 2C5CA 2HCCA 2B2WC 4C3IB 1EU4A 5EKLA 4RAUC 5TSSA 5KYLA 5M3MB 4CKBA 5KEEA 2CHBD 3TP6A 3C1EA 2G9HD 3VYTA 1STGA 2AUJD 2BE5C 1QE6A 5FO7B 2F0FA 2JA6B 3RZDB 2F0OA 3D31A 3S17B 2B2TC 4C3HG 1ESFA 3J81E 3HS0C 2X6LA 5C0XG 1CTMA 3GTKB 1K8MA 3QOJA 3HOVB 1KLGD 3IFTA 4BWGB 1XWEA 4PMBA 1JWSD 2TSSA 4HR7B 4U68A 2PCFB 3WOFA 2L9HA 4A3EB 1LT6D 1EIHA 3J7YW 2Q8RE 2A6EC 2EZVA 1AEXA 4NMZA 1WTXA 4L63B 3S2HB 1TS5A 3PIP3 2AWOA 4DF7A 1TWFB 4K2LA 4IFDJ 2JP1A 4JK1C 1O7YA 3GTLB 4CJ0B 3I4MB 2K28A 1WTQA 2K5QA 3HOUB 1SYGA 4K5WA 1X3QA 3MEHA 3J80E 2F0SA 1QNKA 3BYYB 3NWTA 2PO4A 5C0XI 3PUXA 1M4VA 5I9PA 1PFNA 1LACA 5CC4A 1EWHA 3Q24A 1EY6A 1DXMA 3QO2A 2VUMB 4OL7A 3K5NA 2LKVA 2G9DA 3I91A 1FNWA 5FKAC 1OXXK 2EY5A 2F0HA 2KA7A 2MHVA 2RBMA 1K83B 1VMCA 2VNUD 2L11A 1QWYA 5EPLA 2F3VA 3BYTB 3T13A 3DXJC 1W6KA 1FNUA 2CVRA 3OWFA 1GXDC 3DEPA 1VCIA 4X3UA 1WD0A 3GV3A 2WACA 3URYA 5K36H 3GD7A 5LHY1 4RA8A 4HTHA 3AMUA 3SDZA 2MGSA 3Q23A 4X3SA 4N9TA 4FP5D 1G91A 1I4XA 4K2KA 1LTBD 1PDQA 3V05A 1QILA 2B2VC 1ENFA 4KJOA 3D3RA 2B2YC 4WORA 3LX0A 3T4AC 3A7LA 3A56A 1NCVA 2A6ED 5I9OA 4TSSA 2B63B 5IT9L 4HSPA 1LV9A 1EFID 3U9OA 1SSOA 1OXTA 2E74C 3SK8A 3MFYA 1SE2A 1Y1VB 4B9XA 1D5MC 2BDOA 2IL8A 3FPPA 2NN6G 2BCOA 2ZXPA 1EL0A 2OXPA 4QIWB 1JQYD 5A35A 1X32A 3NBHA 1D1IA 2KJXA 2Q8IB 2F0NA 3DWQA 5DEHA 1C48A 5EGTA 2Y0SB 2PW5A 3HOWB 1SJHD 1TIID 4C3IG 1XYIA 1FR3A 2B2YA 3T51B 4CBVA 1XX8A 1STYA 2KUMA 1I4GA 4KN7C 3K5LA 5M5YB 1DONA 5JEAH 1MGSA 1DOKA 2WKDA 3AB9A 4ZK9B 1GJXA 4F88A 4JBWA 5K5PA 1ZYRD 3FDTA 4F7XA 2AUKA 1A15A 1H9JA 3A8KE 5CBAE 3C3LA 3SK5A 1A2UA 1PZKD 5F2DA 4A3MB 2B8FA 3NPPA 3K59A 3PUZA 2RSNA 1F9RA 1E2VA 1IW7D 1II3A 3C2PA 2QKIC 2EY1A 2Z4IA 3DMUA 3OSOA 4FF4A 3SK4A 2F0KA 3CRLC 5D14A 3K0YA 3EJIA 2F0DA 1R9TB 4PNYA 2F0LA 4NDXA 2JA7B 1C8CA 1ML0D 3TDQA 1CA5A 2JA8B 1XTCD 1I50B 5JVG3 5DM73 4CKCA 3NP8A 2X69A 2PZWA 1EQVA 4CJ2C 4ZUIA 4GZYC 1O78A 4HSVA 1NAPA 2J0TD 3GTMB 5G3LD 2N55A 1LTAD 1Q12A 3S1RB 3HEJA 1TS4A 1JC7A 4HN7A 1S5DD 2QCPX 1NSNS 4FF3A 1L0XB 4O42A 1U4PA 1S5FD 2EYPA 1G6ZA 4QUFA 4ZLTF 5CYUA 3K6OA 3MFGA 3KUPA 4S3SA 2AQ3B 3E5SA 4MIUA 5M5XB 4RGTA 3Q6SA 2R61A 1B3AA 2FJ2A 5IODA 2B39A 4TRDA 2EYFA 4M1UB 4UDUC 2E2JB 3M85A 2KCCA 1H9KA 4FVMA 4R8IA 1GHJA 2OT2A 2DY7A 3D4WA 2XSCA 5HURA 1RF2D 5J39A 3H94A 2QF7A 1MSHA 1FD7D 2M9VA 4QMGA 3FMCA 1B1ZA 1D6EC 2QILA 1STNA 3NQIA 3ITPA 1I6HB 1ET6A 1HQMC 2XRSD 2RDFA 1B53A 1ZYRC 1SDFA 1ZKOA 2BA0A 2EE1A 4PQXA 4A3BB 1CHQD 2VB2X 3V2TA 3I4NB 5E3FA 5CBEE 2B2UC 2BOSA 3SK6A 1SYBA 3OHXC 2NB0A 1IW7C 1TKWB 3LWUA 1GUTA 2A68C 1A3TA 1EZ6A 2BA1A 1SYEA 5KRUA 4J8QA 5COYA 1PRTB 5IGCA 4BY7B 3DEOA 3BDLA 4C3JB 2MJ8A 3NSWA 1WTRA 1LT4D 3H09A 2I46A 4L6TB 1PZJD 5ELEA 1T5XD 1C4QA 4XIGS 1SNCA 5NUCA 4FXDA 4FYDA 3S16B 1V8QA 2OF1A 3EVQA 1EOTA 3A8IE 2EYLA 1GUWA 5CV4A 3BVZA 2EOTA 1PTOF 2EY6A 3R2IA 1BUVT 1HTLD 2D5DA 2XVSA 2EJGC 1EY8A 1DCZA 2WKCA 2K33A 3I4LA 1ILPA 1H9RA 4K8IA 1G8ZD 2EJFC 4OIKA 1I3QB 5T1IA 5EBCA 3M4OB 4ZUJA 4XQJA 4KY7A 4QCLA 1AZQA 3SE0A 1AP0A 2JSOA 4QUCA 2K32A 3CQZB 1DD2A 3HRZC 3DWAA 5CV5A 3M7NA 4C56C 2K03A 4CKEA 5G3LF 1JCKB 4G7HC 5C3XA 4IQZA 5CORA 4C2MB 4IFDG 3HOZB 3MXUA 3TP7A 4A3GB 5CV7A 1PRTC 4ZKBB 1PYWD 5C4ZA 1JWMD 4U673 5C3EB 2R93B 1Y1WB 1O80A 2RVLA 4O1NA 5C3WA 2E2HB 3S1QB 2O5IC 3VYSA 3NTIA 3R2TA 1M8AA 1EY4A 3PUWA 3J81L 1TY0A 5CV6A 5ISRA 4I7ZC 2SEBD 3VR5A 3X3NA 4RGNA 1R4PB 1TR5A 3MXNA 3S1NB 2A74C 2A68D 1FYCA 4ABNA 3PMFA 3VA7A 1WTOA 3VR2A 3EQLC 2B8GA 1E0BA 2DN8A 5CMDA 1KDCA 1WCMB 5BN5A 2SDFA 1KAAA 1CQFA 2JA5B 2KHSA 1F2YA 2CW0C 1AN8A 4OHJA 3VR3A 1SJED 1ICWA 1PRTF 5K36G 3T56B 2QDBA 3KLSX 1DZ1A 2NTSA 2PQEA 4KJNA 4LMQD 2NBFA 3RLFA 5J1ZA 3TN2A 1V1OA 1HQRD 5ELCA 1DOMA 1E2ZA 1TS3A 2ICEC 2EYHA 1S4ZA 3QG1A 1H9SB 4KKUA 4K5VA 3KBXA 2F3WA 1CHPD 3IL8A 3JAML 1ET9A 1ENCA 3SEBA 3P7JA 3OMCA 2NZ1D 2OEOA 3I73A 2NN6I 2ENBA 1IL8A 4OIJA 4AYBB 3IKJA 2SOBA 4IN3A 3BZDB 4K6DA 1GUGA 4KN4C 3K58A 1SYFA 4DA2A 2KEDA 1GUOA 4Q0FA 1STEA 3D4DA 1I4QA 2LMCB 3NK9A 3L9AX 3ZYYX 3MVVA 1D5XC 4PMCA 2J7ZA 1PZID 1EZ8A 4DFAA 2K04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1II3 A;  1TR5 A;  1EY5 A;  1EY7 A;  3MEH A;  5IGF A;  4KJO A;  2F0S A;  1A2T A;  4F8M A;  2EY1 A;  2RKS A;  3DMU A;  1EY9 A;  2EY6 A;  2PW7 A;  3OSO A;  3P1H A;  2F0U A;  4WOR A;  3LX0 A;  1STB A;  3PMF A;  5EKK A;  3OMG A;  4RKB A;  5KYI A;  3D4W A;  3VA5 A;  3SK4 A;  2F0K A;  3NHH A;  2EYM A;  5EKL A;  1EYC A;  5IOC A;  1A3U A;  2PYK A;  3C1F A;  5HUR A;  5I9O A;  5KEE A;  2EYJ A;  4YIJ A;  5KYL A;  1KDC A;  2F0D A;  3EJI A;  4KHV A;  4N9P A;  4PNY A;  5I9P A;  1EY8 A;  5J39 A;  2F0L A;  4NDX A;  5CC4 A;  2EY2 A;  4QMG A;  4QB4 A;  3TP6 A;  2O4X A;  3C1E A;  4NKL A;  3U9O A;  5IOD A;  1EY6 A;  3D6C A;  1F2Z A;  1KAA A;  5M9O A;  5I6W A;  3SK8 A;  4RKL A;  1KDA A;  1SNM A;  1SYC A;  5IGG A;  4OL7 A;  1STA A;  4HMI A;  2HQE A;  4ID6 A;  1STN A;  2KHS A;  4B9X A;  5HGT A;  1STG A;  3ITP A;  1F2Y A;  4K8I A;  4LAA A;  3NP8 A;  1JOK A;  2RDF A;  2LKV A;  4I65 A;  4KY5 A;  1JOR A;  2OXP A;  4TRD A;  4EQN A;  2F0F A;  2PZW A;  1EQV A;  2F0P A;  3ERO A;  2PZU A;  5IGB A;  1NUC A;  5I6Y A;  2PZT A;  2F0O A;  2EY5 A;  2F0H A;  2QDB A;  4ZUI A;  3ERQ A;  4K14 A;  4KTA A;  4ZUJ A;  3TP5 A;  3BDC A;  1IHZ A;  4KY7 A;  2F0N A;  5JAV A;  2EYO A;  2F0J A;  5CV4 A;  2F0V A;  2PQE A;  5DEH A;  4KJN A;  5IGE A;  2RBM A;  3V2T A;  1ENA A;  2F0Q A;  2F0I A;  5E3F A;  1KDB A;  4R8N A;  5C4H A;  5IIF A;  1STH A;  3SK6 A;  1SNQ A;  1SYB A;  4J6H A;  3QOJ A;  5CR3 A;  3QOL A;  2SNM A;  4ODG A;  5CV5 A;  3H6M A;  5EGT A;  5J1Z A;  4EQO A;  5J22 A;  2PW5 A;  2M00 A;  4KV6 A;  4B9W A;  4PMB A;  1F2M A;  3HEJ A;  1SNP A;  2F0W A;  2F3V A;  2KQ3 A;  5KGU A;  2EYH A;  3S9W A;  2F0E A;  1A3T A;  4K8J A;  1EZ6 A;  4WRD A;  5C5L A;  4DGZ A;  4NP5 A;  4IUN A;  4G57 A;  3T13 A;  4K5V A;  2F0G A;  4IAL A;  1RKN A;  1EY0 A;  2F3W A;  4IZ8 A;  3R3O A;  3RUZ A;  5CV8 A;  1SYE A;  2F0M A;  5CV9 A;  5C3X A;  1KAB A;  5JOB A;  1AEX A;  1NSN S;  5C5M A;  1A3V A;  5IGD A;  5KRU A;  4EVO A;  1ENC A;  1JOO A;  3P75 A;  4NMZ A;  4K5X A;  3OMC A;  3OWF A;  5IGC A;  3BDL A;  2OEO A;  1STY A;  5C6A A;  2EYP A;  3NUC A;  3TP7 A;  4ME5 A;  5KIX A;  2ENB A;  3MHB A;  2WAC A;  4DU9 A;  3D8G A;  3MXP A;  1SNO A;  5CV7 A;  5E1F A;  3T16 A;  4KD3 A;  4DF7 A;  2SOB A;  4K2L A;  4S3S A;  4J1M A;  5C4Z A;  1JOQ A;  2SNS A;  4K6D A;  5K5P A;  4QF4 A;  4HTH A;  4F7X A;  3E5S A;  4MIU A;  3MZ5 A;  1SNC A;  1SYF A;  4HMJ A;  4KD4 A;  5NUC A;  4H7B A;  3SHL A;  5C3W A;  1SYD A;  3NQT A;  5DAU A;  3HZX A;  3SK5 A;  3D4D A;  1A2U A;  1EYA A;  4E6I A;  2OF1 A;  3DHQ A;  1U9R A;  3NK9 A;  4ZQ3 A;  3MVV A;  3NXW A;  5F2D A;  3TP8 A;  1EY4 A;  1SYG A;  3EVQ A;  3QB3 A;  4N9T A;  4DFA A;  4KY6 A;  4PMC A;  1EYD A;  1TQO A;  2F0T A;  4K5W A;  1TT2 A;  5CV6 A;  2NUC A;  2EYL A;  4K2K A;  3SXH A;  4EQP A;  5ISR A;  3SR1 A;  1EZ8 A;  2EYF A;  3TME A;  1SND A;  5CGK A;  2EXZ A; 
#chains in the Genus database with same CATH topology
 2WP8 J;  2R92 H;  5C4J H;  1A2T A;  1GHK A;  1J6Q A;  1H9S A;  1LO5 D;  4YHH Q;  3G4S A;  2HDM A;  3HKZ E;  1VF5 C;  4BY1 B;  1PA6 A;  3PIO 3;  1NY4 A;  2WAQ B;  1HH2 P;  1K8A C;  2PYK A;  3C1F A;  1LAB A;  4A93 H;  2WV6 D;  3KK7 A;  3CQZ H;  1HR0 L;  3VR6 A;  3Q0A A;  3S1M B;  4RMF A;  2O4X A;  5GQO A;  3KLR A;  2XN9 C;  1KNA A;  3E6Z X;  3OIQ A;  1HCZ A;  4O2D A;  1K8G A;  3GTQ B;  2OQ0 A;  1VDZ A;  1X65 A;  5C4J B;  2PNR C;  4DV6 L;  2JA8 H;  4CJ1 B;  2HQE A;  5HGT A;  1A63 A;  1PRT D;  2VXW A;  4NW2 A;  3HOW H;  1B7Y B;  2UXB Q;  2VQF L;  1JOK A;  4HID A;  3AFQ A;  3TBI B;  5BN4 A;  1VQ9 A;  2K1B A;  1F77 A;  3ERO A;  3R8B A;  3DUZ A;  4K6L A;  4XT3 B;  1VQ7 A;  1WTV A;  2ZJR A;  1HPC A;  1S5E D;  1JB3 A;  3S17 H;  1HUM A;  1P16 A;  2UU9 Q;  2QEJ C;  3F8T A;  3RD4 A;  2UXD Q;  1YHA A;  2A5H A;  4DK3 C;  3VYU A;  2A6H C;  5I2Y A;  1RCV D;  2SNM A;  2A1A A;  3CHB D;  4ME3 A;  3CKI B;  2AQ2 B;  5JJL A;  1L1O B;  3CCU A;  1SNP A;  4KKS A;  3HOX G;  1V1P A;  4IUT A;  3EA6 A;  2F0E A;  4WRD A;  4DGZ A;  4LF5 Q;  1R9T H;  2F0M A;  4JI5 L;  1KTK A;  5IGD A;  1A3V A;  1QZG A;  4BY7 H;  1B2T A;  4XTC S;  1OTC A;  3WOE A;  3JAM E;  1PXU A;  2MPM A;  3PO3 B;  1ASY A;  1VMP A;  3MHB A;  2E75 C;  2X6G A;  1CKN B;  3PF4 A;  2CW0 D;  2VY3 A;  4MNO A;  1TWA H;  3H15 A;  4BXX G;  1UWV A;  4J1M A;  1JOQ A;  4DR3 L;  4DR3 Q;  2R92 G;  4XDX A;  2OTJ A;  4YCV A;  3PQI A;  3K8A A;  1EQR A;  4L5T A;  5FLX L;  4ZYS A;  1W6J A;  2L55 A;  4LUO A;  3EN2 A;  2EJM A;  4MHE A;  3AU7 A;  2VQE L;  1EYA A;  4A75 A;  4ZQ3 A;  1N9W A;  3QR8 A;  2JA7 H;  1K9M C;  2UUC L;  4JBK A;  1TQO A;  4IPD A;  1SRO A;  3F2C A;  3UE0 A;  1F9S A;  3VDY A;  4R8N A;  3OIP A;  3KDF B;  5IE8 A;  3H3V C;  4G7O C;  1EY7 A;  3NTH A;  4JVZ A;  1EEF D;  5FLX E;  2J4X A;  1SMY D;  1BBW A;  1EY9 A;  4NXM Q;  4A3J H;  2IJ0 A;  1SAP A;  5IT9 c;  3TS2 A;  4KKT A;  4DAY A;  3RN5 A;  5KYI A;  1B4O A;  3NHH A;  1N8R C;  2A73 B;  4IFD H;  1EYC A;  1A6X A;  4KK7 A;  1RTN A;  2FMM A;  3PUV A;  1QB5 D;  3BG3 A;  2B2U A;  2IX3 A;  4DAV A;  1TVX A;  3HOY B;  1F2Z A;  2Z8L A;  2H5X A;  5FLX c;  1EIY B;  1PTO B;  2K7V A;  1TWF H;  4LJZ C;  5JPN C;  1I4H A;  1Q90 A;  3X3M A;  3HGB A;  2V4D A;  3MEF A;  1QNU A;  4A3I B;  4KY5 A;  2LXJ A;  1AE3 A;  1ILQ A;  4JI0 Q;  4JOI C;  2E2D C;  1G51 A;  2PQA B;  4X3T A;  3HOX H;  2R93 G;  4K14 A;  3H0G B;  3GO5 A;  1U4M A;  5JAV A;  1Z47 A;  3FVQ A;  4RGM A;  3T53 B;  3J80 L;  4IUQ A;  3CPW A;  2JA9 A;  1ENA A;  5IIF A;  4F87 A;  2XIW A;  3A74 A;  2WB1 E;  1XTD A;  2OTL A;  1HHV A;  4RFB A;  2Q2T A;  3QWN A;  1YJN A;  3MA2 B;  2L4N A;  1FNV A;  5D3D A;  1ROD A;  1SFO H;  3J81 c;  4DR7 Q;  1Z9F A;  1V1P B;  2WB1 B;  4A93 B;  5C3E H;  1B70 B;  5CV9 A;  1JMC A;  4PG3 A;  3HOU G;  3TEH B;  3S1Q H;  4DR6 Q;  4DXF A;  5DM6 3;  3GTG B;  1BOS A;  4LFA Q;  3E9H A;  3PCO B;  1YNN D;  4DU9 A;  1HJP A;  1SNO A;  1V1Q A;  1UEA B;  4AIM A;  4CGY B;  5AJ3 L;  1VQ8 A;  4G4K A;  2ZXR A;  2E5L L;  4OO1 G;  4QF4 A;  3MWY W;  3HP3 A;  1YBY A;  1UAP A;  4H7B A;  2N8N A;  3NQT A;  4DV6 Q;  1TY2 A;  3DHQ A;  3S1M H;  1XXG A;  5IYC H;  3KF8 B;  4A3D H;  3QB3 A;  1C9O A;  1TT2 A;  1BR9 A;  2A6H D;  2ZT9 C;  4J6H A;  1Q1B A;  1H9M A;  2RHS B;  4QL5 A;  5D3I B;  2L15 A;  2FFK B;  2WII B;  4RH6 A;  2KOL A;  1PFB A;  2G5D A;  4IPC A;  4HJ9 A;  3GQB A;  1KIX A;  4FF1 A;  1I4P A;  3KLW A;  1O7L A;  2EYJ A;  3LWE A;  4R4C A;  4KHV A;  5E4X A;  4C3J H;  2L5T A;  3M7G A;  1EIG A;  4IUU A;  4RKL A;  4XYQ A;  2MP1 A;  2ICI A;  2IX0 A;  4ALP A;  4L5Q A;  4B3S Q;  3F2U A;  1KLU D;  3J7A V;  1W2B A;  3UI2 A;  1WI5 A;  4V0B A;  2FMC A;  2NYZ D;  4PV1 C;  1N36 Q;  2LSS A;  3MC0 B;  1HA6 A;  1IYJ B;  1JB7 A;  4RGO S;  4HJ5 A;  3BDC A;  2QDL A;  1B44 D;  2F0V A;  3M3Y B;  4HIM A;  3CCJ A;  3NEN A;  1HUN A;  1EWC A;  1DJR D;  4X3K A;  2JA8 G;  3ND9 A;  4NXM L;  3RZO B;  4EQO A;  5LL6 S;  3EFX D;  5C4X G;  4GOP B;  3W2D A;  5I2X A;  1ZEQ X;  2ID0 A;  2KQ3 A;  5A2Q E;  4TKO B;  1SMY C;  1GUS A;  1XNR L;  3S9W A;  2EDG A;  2VB3 X;  1VQJ A;  2YV5 A;  1Q1E A;  1EU3 A;  1WTP A;  3I4N G;  2GVB A;  2H1E A;  4KI0 A;  4IZ8 A;  1SE3 A;  5C0X H;  4DXG A;  5FK9 C;  3O13 A;  3NE5 B;  3JAM i;  1N36 L;  3MAQ A;  4GKJ L;  3A8J E;  4K0K Q;  4DNR B;  2KEC A;  4OGQ C;  3PO2 B;  1MIU A;  2NVQ B;  3FEW X;  3BS1 A;  3CCE A;  3RMH A;  1Z7T A;  2JEA I;  5I4D A;  4L5S A;  5M3F B;  1ZXT A;  4UHV A;  3MZ5 A;  3H0G H;  3MXG A;  2NN6 H;  3RLN A;  3CC7 A;  1AZP A;  4LF5 L;  3NXW A;  3T1Y Q;  2Q2U A;  1QZH A;  3VYR A;  1PTO H;  3CCQ A;  3SXH A;  1K83 H;  2NUC A;  3PO2 H;  5J3B A;  1JJC B;  3M4P A;  2K5W A;  4XT1 B;  1WD1 A;  4QJF A;  1BQQ T;  2XTI A;  3OOC A;  2K05 A;  4F8M A;  3BU2 A;  4L8J A;  3W1B A;  4RHS A;  2ZJQ A;  1STB A;  1JJG A;  3M4O H;  2EYM A;  4RWS C;  1VF7 A;  2RDG A;  4DN4 M;  2HIV A;  1RDP D;  2B3G A;  4YWM A;  4A3K H;  3CD6 A;  2UU9 L;  2KEE A;  2D2C C;  4HCS A;  3G6E A;  2HHH Q;  2VQF Q;  5M9O A;  4JI8 Q;  4G7Z C;  1WVL A;  2RCN A;  1YNN C;  2PMZ E;  2F4I A;  5EKI A;  3K5O A;  2C9O A;  1HTP A;  4BBR B;  4I65 A;  4DAP A;  3KBG A;  1AFP A;  2CQA A;  4JV5 L;  4DV4 L;  1NR4 A;  3PUY A;  2YU9 B;  4RCN A;  3IAY A;  1LT5 D;  1I6V C;  5C0X J;  3PV0 A;  4AQY Q;  2ASB A;  4OO1 I;  1Q8I A;  2KCN A;  2F0J A;  3I4N H;  1G29 1;  3GTJ H;  1CZW A;  1IBL L;  1PLF A;  4P74 A;  1Y8P B;  3BZC A;  2OWO A;  1KC8 C;  1IBK L;  1STH A;  4GLV B;  3T1H Q;  1HNZ L;  1OO9 B;  1SEB D;  4LF8 L;  1WTW A;  4LF4 Q;  4DV3 Q;  1KRS A;  2XWB B;  1PH8 A;  4YY3 L;  1CZG A;  2UXC L;  2D9U A;  3STB C;  2L1B A;  4XQN A;  1JWU D;  4DR7 L;  1TWC H;  1YHB A;  5CV8 A;  3CCS A;  5IT9 E;  3K7A H;  4OX9 Q;  2B2V A;  4A3C G;  3LGJ A;  1X54 A;  2L0C A;  3K57 A;  1HRJ A;  2JE6 I;  1QOH A;  1HA5 A;  1K3R A;  4DV5 Q;  1IYU A;  3A5Z B;  4C3H B;  2H4O A;  3OWE B;  2FHT A;  2RQX A;  1LM0 A;  2Y0S G;  4UPA A;  1L0W A;  4A3E H;  3L7Z C;  1QG7 A;  4A3I G;  4LF6 L;  3PIP A;  1LTI D;  4KD4 A;  4ILW A;  5FJ8 H;  3HOZ G;  2K5D A;  4XXE A;  1PFM A;  4FO2 A;  4FF2 A;  4A3G G;  2DNC A;  2IWH A;  1EYD A;  2BH2 A;  3I55 A;  1Z6H A;  1R4Q B;  5A2Q L;  3SR1 A;  3CMA A;  2RKS A;  5M3M G;  1SND A;  4X65 Q;  1WYD A;  1TWA B;  3JAM c;  4V19 0;  1CA6 A;  4DAY B;  2R7Z B;  1MD2 D;  4R9W A;  2R6G A;  5EPJ A;  1BBU A;  1YNX A;  2AWN A;  1HXY D;  3FKI B;  4RKB A;  4X64 L;  5M3F H;  3H3V I;  3HOX B;  1BDO A;  4POF A;  1SE4 A;  2MQH A;  1HFG A;  5ELD A;  1E2W A;  3NEL A;  1KDA A;  2A69 C;  2PI2 A;  4OO1 H;  5IGG A;  4X66 L;  4XYO A;  4LFC Q;  4AH6 A;  4LAA A;  3WDN A;  4GLX A;  2YYZ A;  3AFP A;  4XQQ A;  1PH4 A;  1DYQ A;  1PH1 A;  1VQH A;  4KTA A;  5LL6 X;  2Z1C A;  5KNC A;  1LLR D;  3GP7 A;  4C1N K;  4FNF A;  2F0Q A;  4BA1 I;  1D5Z C;  2RA4 A;  3AEV A;  3PSI A;  2R92 B;  3QOL A;  1QJO A;  1S5B D;  4ZAI A;  4A3L G;  4KV6 A;  4DNT B;  1F2M A;  4MTN A;  4P72 A;  1J5E Q;  3S1N H;  1QCB D;  2DNE A;  3BVM A;  4K8J A;  4YY3 Q;  2F1M A;  1EY0 A;  1RJT A;  4UAI A;  1KAB A;  1PYB A;  1PMR A;  4PZ8 A;  5D65 A;  2K5N A;  1BCP C;  3CRK C;  2RCF A;  5ELN A;  2KVM A;  4IUP A;  2K52 A;  1EQT A;  4TVA B;  1HNW Q;  4IPG A;  5JJZ A;  2SNS A;  1CK1 A;  2R3Z A;  4HMJ A;  4DV7 Q;  3KF8 A;  3F2D A;  3G6J B;  4A3F B;  2LS0 1;  4BBR G;  3K7A B;  4AYB G;  5M3F G;  4R4T A;  2K14 A;  1BBX C;  4KY6 A;  1FJG Q;  2EXD A;  2F0T A;  4EQP A;  4AQY L;  1XPO A;  4B3T Q;  2RSO A;  1S5C D;  4IAL A;  2E2I B;  2EXZ A;  2R7Z G;  3DM1 A;  4JYA Q;  1T9H A;  1EY5 A;  4BBS B;  1D2B A;  1SXT A;  1VS0 A;  4LFB L;  1JE4 A;  2LFN A;  3P1H A;  3GDE A;  3J80 c;  3D4R A;  3ONA B;  3STB D;  2NVY B;  4POG A;  4PZ6 A;  3BDO A;  4Z9C B;  1VQN A;  1Q46 A;  3GTJ B;  4ZRZ A;  1S40 A;  3U9S A;  4YIJ A;  1FVI A;  1L0Y B;  1EEI D;  4LF9 L;  5IYD H;  4QB4 A;  2NWG A;  1HZ9 A;  3MTS A;  4JI7 Q;  3K0X A;  1SBB B;  3QJY A;  1SYC A;  1YVC A;  5AJ3 Q;  3G7L A;  2WIN B;  3RN2 A;  4DUY Q;  2NVX B;  5ELO A;  3E0J A;  2IPK D;  2JA6 H;  1JOR A;  1C0A A;  4EQN A;  3N6R A;  5EPK A;  4P71 A;  4LW1 A;  2K4K A;  5IGB A;  2NVT B;  1BVS A;  3ERQ A;  2LY7 A;  4LFC L;  3TP5 A;  4X66 Q;  1C7Y A;  1X3P A;  2R7F A;  3GV6 A;  2M2L A;  3CAM A;  1WJJ A;  1E24 A;  2F0I A;  2I07 B;  3RZO H;  4IOA A;  3UDX A;  5C44 B;  1TS2 A;  5DLQ E;  2MUY A;  5JEA J;  1EUJ A;  4DK0 A;  1U5K A;  2Q8T A;  1X3G A;  2K01 A;  1F2L A;  4GN3 B;  1VQD A;  5KGU A;  1ONL A;  3VR4 A;  3ND8 A;  1TWH B;  5GAD C;  2ZM6 L;  2F0G A;  2ZM6 Q;  1XMO Q;  4GKJ Q;  2JK8 A;  4JPB W;  5GAH C;  2O5J C;  3TQY A;  4EVO A;  3P75 A;  2DY8 A;  1IKM A;  5ELF A;  1BF4 A;  2BDN A;  4IUR A;  4CDC C;  1YIT A;  1T5E A;  4X64 Q;  3NUC A;  3TZU A;  2GN5 A;  2HCI A;  2NVQ H;  4H44 C;  2A69 D;  3KLS A;  4P2C B;  2HIX A;  5KND A;  4FXK C;  1MI2 A;  1F9Q A;  4IUV A;  1IBM Q;  5JPM C;  2B29 A;  2PMZ B;  2XWJ B;  3NWS A;  4DK1 A;  3SHL A;  1PTO C;  1I4R A;  5DNF A;  4YCW A;  4E6I A;  2RDH A;  1VQ5 A;  1ICF B;  4B3R Q;  2CH4 W;  3NTK A;  2I5H A;  1K3B C;  2MO1 A;  4C3J G;  4A3K B;  1YNJ D;  2B63 G;  3FRP B;  5CGK A;  4HED A;  1TWG B;  5EJW A;  4A3I H;  2HUG A;  5M5W B;  1UE7 A;  1LT3 D;  2AHO B;  3A54 A;  2PW7 A;  5T1G A;  5IP9 H;  4RHR A;  2Q2H A;  5AFW A;  5JVH 3;  1H95 A;  1IZ6 A;  3I70 A;  2B2W A;  3GTG H;  3U50 C;  4OEM B;  4BA2 I;  5C4X B;  5M3M H;  1DM0 B;  1OXS C;  2EY2 A;  4UP7 A;  4LF4 L;  4DV2 L;  1LTS D;  4N8F A;  3CF5 A;  3D6C A;  2VUM H;  3C46 A;  3HG9 A;  4CHT B;  1IBK Q;  3F1Z A;  1BCP D;  4HMI A;  3P20 A;  3CU7 A;  3W3A A;  4A3M G;  1SFO B;  5FJ8 G;  1DGS A;  4DV3 L;  3SVM A;  5IP7 G;  1UUP A;  1N32 L;  4AYB E;  2F0P A;  2PZU A;  1RHP A;  4CDF C;  1E3P A;  1Y8O B;  3HOY G;  3PIO A;  1SRU A;  1LTR D;  4JI5 Q;  1EIF A;  1DOL A;  1RTO A;  1O7Z A;  1TWC B;  1BCP B;  2EYO A;  3J80 i;  1HNW L;  1NE3 A;  1CT1 D;  4JI3 L;  5BR8 L;  4ZKC B;  2ZJP A;  5C4H A;  5KNB A;  5FOB B;  3I4O A;  5IWA Q;  4A3J G;  3I72 A;  2JEB I;  1Q86 C;  4EGV A;  2M00 A;  4DR5 L;  1GKH A;  2IW3 A;  4FXG C;  2F0W A;  1PV4 A;  2B2T A;  2JYO A;  2AMC B;  2HQL A;  3D6W A;  4UP9 A;  1V43 A;  1G2S A;  4LK1 C;  1LUZ A;  3RUZ A;  1TU2 B;  4LF8 Q;  3CC2 A;  1JT8 A;  2CKZ B;  1JIC A;  1EWI A;  2Z9H A;  1IYV A;  3I4M G;  5EBD A;  1JE5 A;  2YTY A;  5BR8 Q;  4KMU C;  4KD3 A;  1Y8N B;  2ZXO A;  4DV4 Q;  1QUQ B;  1B9N A;  1Q7Y C;  4JI2 L;  5JJI A;  4WFN 3;  1IKL A;  1QVC A;  5DAU A;  3HZX A;  4GLA C;  2N88 A;  3KFU A;  1U9R A;  1SMX A;  1B9M A;  2VS1 A;  3QIA A;  4JBM A;  4YWL A;  1Y69 U;  1WCM G;  4C3H H;  3GTO B;  5C5M A;  4DV1 Q;  2KHJ A;  1MSG A;  5EAY A;  3J81 i;  3IFD A;  3GTL H;  2JXM B;  3OPO A;  3N52 A;  3V96 A;  1KL9 A;  5EKK A;  3OMG A;  2HDL A;  1D1K A;  3K5M A;  2QEX A;  1CI3 M;  5IOC A;  1A3U A;  4GN4 B;  1JR0 D;  1IXR A;  4N9P A;  1OXU A;  3FKI G;  1IBM L;  3SGI A;  3L3O C;  5FO9 B;  4BY1 G;  5EQ0 A;  4PMW A;  1SNM A;  4JI1 Q;  1STA A;  4ID6 A;  2EIF A;  3S15 B;  4M8A A;  3HKZ B;  1F9P A;  1BXT A;  1CFM A;  4BBR H;  2EPB A;  3I3C A;  4Y7N H;  4KHP Q;  2UXD L;  1PTO D;  3OW7 A;  5IYD G;  4Q5V A;  1MBY A;  2E8G A;  3I90 A;  3A7A B;  4NXN Q;  4BS9 A;  3LNN A;  1KDB A;  5LMU L;  4IO9 A;  5HGQ A;  4A3D B;  1YNJ C;  4WJW A;  1SNQ A;  4GNX B;  2DGY A;  3TZD A;  5J22 A;  2I5L X;  4B9W A;  4B08 A;  5C5L A;  2Z4H A;  4Y7N B;  2VZA A;  4NXN L;  4G57 A;  4H0L C;  3H91 A;  5ELB A;  5LMN W;  4K5X A;  3GTQ H;  3HOZ H;  1G2T A;  5C6A A;  2OCE A;  3CCR A;  2XNA C;  3RLO A;  3S2D B;  2R7D A;  2RHQ B;  4ME5 A;  5KIX A;  4IPH A;  5M5W H;  1B8A A;  4MTK A;  5E1F A;  3D0F A;  3T16 A;  4QIW E;  2BE5 D;  3CPF A;  4BBS H;  3R93 A;  1CM9 A;  1NR2 A;  1J8I A;  1LTG D;  4HAE A;  2E2H H;  4LF9 Q;  2GA4 B;  4WJ4 A;  2D62 A;  2BH8 A;  3BJU A;  1BNZ A;  2WAQ E;  2AQ1 B;  1FGB D;  2E5L Q;  4IJL A;  1Q3L A;  3TP8 A;  2PPB C;  3G48 A;  5JEA G;  4JI8 L;  3TME A;  4DPG A;  4IFD I;  3GTK H;  5GAG C;  5IGF A;  5FO8 B;  1RL2 A;  3AQQ A;  2Z6K A;  1GOZ A;  4ULL A;  4MN3 A;  2F0U A;  3A55 A;  1BCP F;  2CFM A;  3OYY A;  3Q22 A;  5BN3 A;  2EVB A;  4A3J B;  3VA5 A;  4JG2 A;  3DLL A;  4NPS A;  2IX1 A;  4RCO A;  2F03 A;  4DR6 L;  3S14 B;  1OXV A;  1UNS A;  2NTT A;  2ATW A;  3DWP A;  1RD9 D;  4P73 A;  2B63 H;  4KHZ A;  4NKL A;  1PFS A;  1HFN A;  2YTX A;  5I6W A;  2XRQ D;  1E7Z A;  1AW7 A;  1FJG L;  3I8Z A;  1BO0 A;  1GUN A;  5LMN Q;  4A3L H;  3U4Z A;  3FPU B;  1CKO A;  4DNI A;  4DV7 L;  1NUC A;  4B3M L;  5I6Y A;  2PZT A;  5E4W C;  1KHI A;  2N3S A;  1KNE A;  4JBJ A;  2FIN B;  4B3R L;  1IHZ A;  3M4Y A;  2HT1 A;  1E22 A;  4YCU A;  5IGE A;  4TQU S;  3NEM A;  2IY5 B;  3NBI A;  3HOU H;  5CR3 A;  4ODG A;  3H6M A;  5IP7 H;  5IY0 A;  1LTT D;  3J7A F;  2JJQ A;  1JJ2 A;  4NP5 A;  4IUN A;  2FXQ A;  1U4R A;  2VL6 A;  1RKN A;  3R3O A;  1YJ9 A;  2QW7 A;  1KD1 C;  5JOB A;  1JOO A;  3KYH C;  1PH5 A;  2TMP A;  4HJ8 A;  4HCE A;  1VQF A;  4GKK Q;  1VQB A;  1VQM A;  3ULL A;  3GTP B;  3BVG A;  2UUB Q;  3D8G A;  3MXP A;  4DV0 Q;  2O2L D;  4H13 C;  3TSS A;  4JI0 L;  1I6H H;  2E76 C;  2V1C C;  3TS0 A;  1CQV A;  1SYD A;  2YU9 H;  3CCV A;  2PI2 E;  4MZ9 A;  1K8O A;  3ERS X;  2IT1 A;  1ESR A;  4C1N I;  1HZB A;  1B50 A;  1J9O A;  3S15 H;  1U4L A;  2L12 A;  4DAM A;  4GN5 A;  2K6A A;  4IOC A;  2C5C A;  1K0R A;  2HCC A;  2B2W C;  4C3I B;  4A3C H;  1CSQ A;  2DJG C;  3RNU A;  1EU4 A;  5EKL A;  5C44 G;  4RAU C;  4GNX C;  5TSS A;  1PHJ A;  4CKB A;  5KEE A;  5KYL A;  5M3M B;  1N34 Q;  2CHB D;  4JW0 A;  3TP6 A;  3C1E A;  4R4Q A;  2NZO A;  2G9H D;  4X65 L;  1TWG H;  3VYT A;  4B3S L;  2F3I A;  2JA5 H;  1STG A;  2AUJ D;  2BE5 C;  1QE6 A;  4JI2 Q;  4DR5 Q;  2ALY B;  5FO7 B;  2F0F A;  4JYA L;  2JA6 B;  3CXC A;  3RZD B;  2F0O A;  3D31 A;  3S17 B;  2B2T C;  1WCM H;  4C3H G;  5L37 A;  4OX9 L;  1N33 L;  1YJW A;  1XMO L;  1ESF A;  1TXY A;  3J81 E;  3HS0 C;  3J7Z C;  3BZK A;  3F2B A;  2X6L A;  5C0X G;  3M3Y H;  1CTM A;  3GTK B;  1K8M A;  1UE1 A;  3QOJ A;  3HOV B;  1KLG D;  3IFT A;  4BWG B;  1NMG A;  1XWE A;  4PMB A;  1JWS D;  2TSS A;  4HR7 B;  4U68 A;  2PCF B;  3WOF A;  2L9H A;  3K81 C;  4A3E B;  1LT6 D;  1VQK A;  1EIH A;  3J7Y W;  2Q8R E;  2A6E C;  3FKI H;  2EZV A;  1AEX A;  3H0G G;  4QGU A;  4NMZ A;  4R1J A;  4L63 B;  1WTX A;  1PH2 A;  3S2H B;  1TS5 A;  4JC0 A;  3PIP 3;  2AWO A;  1V9P A;  3HOV H;  2NVX H;  2LXK A;  4KLK A;  2D0O A;  4DF7 A;  1TWF B;  4K2L A;  4IFD J;  2JP1 A;  3K80 C;  1N32 Q;  1HZA A;  4JK1 C;  1O7Y A;  3GTL B;  1CKN A;  1D7Q A;  4CJ0 B;  1WOC A;  3I4M B;  3FP9 A;  1I3Q H;  2K28 A;  5FLM G;  1WTQ A;  2K5Q A;  2JA6 G;  1YI2 A;  2IHF A;  3S2H H;  3HOU B;  2A8V A;  1SYG A;  1UE6 A;  4K5W A;  1X3Q A;  1MJC A;  1BKB A;  3MEH A;  1LYL A;  2GVA A;  2F0S A;  3J80 E;  3OTO Q;  1QNK A;  3BYY B;  4HJA A;  2JA5 G;  1WFQ A;  3NWT A;  2HD3 A;  2PO4 A;  5C0X I;  2JA7 G;  3CP0 A;  1E1T A;  3PUX A;  1M4V A;  5I9P A;  1PFN A;  4GOP C;  1LAC A;  5CC4 A;  3GTO H;  1EWH A;  4JCV E;  4DUZ L;  3Q24 A;  1EY6 A;  1DXM A;  1W3S A;  3HKS A;  3QO2 A;  3RR5 A;  1U0L A;  1N33 Q;  2VUM B;  4OL7 A;  3PGZ A;  3K5N A;  2UUA L;  3T1Y L;  1TWH H;  2LKV A;  2G9D A;  4O0A A;  3I91 A;  1FNW A;  5FKA C;  1OXX K;  2EY5 A;  2F0H A;  2KA7 A;  5LMU Q;  1AH9 A;  4JI1 L;  1VQC A;  2A19 A;  2MHV A;  4C2M H;  4GNX A;  2RBM A;  1K83 B;  4NB3 A;  2CWP A;  2MFI A;  1VMC A;  2D0P A;  2WAQ G;  1EFW A;  2VNU D;  1N34 L;  2L11 A;  1VQP A;  1XNQ Q;  1QWY A;  4P75 A;  5EPL A;  2F3V A;  3PO2 G;  3BYT B;  2R93 H;  2F4V Q;  1PH7 A;  3T13 A;  4JI7 L;  4N8X 1;  4A3E G;  3DXJ C;  3W1G A;  1W6K A;  1L1O C;  2K75 A;  4LUZ A;  1FNU A;  1NNX A;  2CVR A;  2I0Q A;  1HNX L;  3OWF A;  1GXD C;  4DR2 Q;  3DEP A;  1VCI A;  4X3U A;  4A3G H;  1WD0 A;  4UY8 C;  3GV3 A;  2UUA Q;  4DV0 L;  2WAC A;  3URY A;  1I50 H;  5K36 H;  2K5V A;  4C3I H;  3GD7 A;  5LHY 1;  1X3E A;  1GM5 A;  4RA8 A;  4HTH A;  4DV1 L;  1K0S A;  3AMU A;  3SDZ A;  4DUY L;  1O7I A;  2NZH A;  2UUB L;  2NVT H;  3L2P A;  4A3B G;  4HJ7 A;  2MGS A;  3Q23 A;  2UXB L;  4X3S A;  1MHW C;  4LWC A;  4N9T A;  4FP5 D;  1G91 A;  2E2I H;  1I4X A;  4K2K A;  1LTB D;  1PDQ A;  3V05 A;  3KJP A;  1QIL A;  2B2V C;  4H02 A;  1WTH A;  1ENF A;  4KJO A;  3D3R A;  1NMF A;  3WWV A;  2YTV A;  2B2Y C;  2JN4 A;  4L5R C;  1X55 A;  4WOR A;  3LX0 A;  3T4A C;  3A7L A;  4HIO A;  3A56 A;  3S14 H;  5IYC G;  4EQ5 A;  3ER0 A;  1NCV A;  3UDF A;  2A6E D;  1EYG A;  1G6P A;  5I9O A;  4TSS A;  2B63 B;  3GTM H;  3S24 A;  5IT9 L;  1Y1W G;  4LF6 Q;  4HSP A;  1LV9 A;  1EFI D;  3U9O A;  1SSO A;  1OXT A;  3UDG A;  2E74 C;  3SK8 A;  3MFY A;  1SE2 A;  1Y1V B;  4FDB A;  4OWW B;  4B9X A;  2E2J H;  4LFB Q;  1D5M C;  2BDO A;  2IL8 A;  3FPP A;  2NN6 G;  3HFZ B;  2BCO A;  2ZXP A;  4OWT B;  1EL0 A;  2OXP A;  4QIW B;  3I4M H;  1A0I A;  1JQY D;  4QQB X;  5A35 A;  1X32 A;  3NBH A;  1D1I A;  4DR1 Q;  1GVP A;  2KJX A;  2Q8I B;  1X9N A;  2F0N A;  3CCM A;  3DWQ A;  5DEH A;  4DV2 Q;  1X56 A;  2WFW A;  1C48 A;  3E3X A;  1L1O A;  5EGT A;  2Y0S B;  2PW5 A;  4DR4 Q;  3HOW B;  1SJH D;  1TII D;  4C3I G;  1M1K C;  1XYI A;  3H3V H;  4A3K G;  1FR3 A;  2B2Y A;  1KAW A;  2K50 A;  3T51 B;  4CBV A;  4A3B H;  4JV5 Q;  1XX8 A;  1STY A;  2KUM A;  1I4G A;  4KN7 C;  1YIJ A;  1XMQ Q;  3K5L A;  5M5Y B;  1DON A;  3TRE A;  3I7F A;  5JEA H;  1XNR Q;  1MGS A;  1DOK A;  1J5E L;  2WKD A;  4BY1 H;  3AB9 A;  4ZK9 B;  1GJX A;  4F88 A;  4JBW A;  5K5P A;  1ZYR D;  4X6A H;  3FDT A;  4F7X A;  2AUK A;  1A15 A;  1H9J A;  3A8K E;  5CBA E;  1VQA A;  3C3L A;  3SK5 A;  1A2U A;  1PZK D;  4PZ7 A;  5F2D A;  4A3M B;  2B8F A;  3NPP A;  3K59 A;  3PUZ A;  2RSN A;  1F9R A;  2Z6B A;  1KRT A;  3I56 A;  1Q8K A;  1FL0 A;  1E2V A;  3KF6 A;  4LUV A;  1QVF A;  1IW7 D;  1S3O A;  1II3 A;  3C2P A;  2QKI C;  3ICE A;  2EY1 A;  5FLM H;  2Z4I A;  3DMU A;  5JJK A;  3KJO A;  3OSO A;  4BY7 G;  4FF4 A;  1VQE A;  2KHI A;  3SK4 A;  2F0K A;  3RZD H;  3CRL C;  5D14 A;  3K0Y A;  1K73 C;  3EJI A;  2F0D A;  1R9T B;  4PNY A;  1B3Q A;  2F0L A;  1AE2 A;  4NDX A;  1A8V A;  4CDD C;  2JA7 B;  1KQS A;  1C8C A;  1ML0 D;  3TDQ A;  1CA5 A;  2JA8 B;  1XTC D;  1I50 B;  2OQK A;  5JVG 3;  4DR4 L;  4JI6 Q;  5DM7 3;  2XGT A;  4KHP L;  4CKC A;  3NP8 A;  2PQA A;  1YZ6 A;  3S1R H;  1QVG A;  2X69 A;  2PZW A;  1E1O A;  1SLJ A;  1EQV A;  4CJ2 C;  2CCZ A;  3AYH B;  4ZUI A;  4GZY C;  1O78 A;  1HR0 W;  3G71 A;  3NBH B;  3PO3 H;  4OON A;  4HSV A;  1NAP A;  2J0T D;  3GTM B;  1RIP A;  5G3L D;  3S2D H;  4IJH A;  2N55 A;  1LTA D;  1Q12 A;  1YEZ A;  3S1R B;  3HEJ A;  1TS4 A;  1PH9 A;  1JC7 A;  1UEB A;  3U58 A;  4HN7 A;  1S5D D;  2UXC Q;  2QCP X;  2DJF C;  2UUC Q;  1NSN S;  5GRO A;  3CME A;  4FF3 A;  1L0X B;  4B3M Q;  4O42 A;  4WJ3 M;  4R4O A;  2KCM A;  1U4P A;  1S5F D;  2EYP A;  2PNH A;  1G6Z A;  4QUF A;  4ZLT F;  5CYU A;  3K6O A;  3MFG A;  3KUP A;  4S3S A;  4LF7 L;  2Z0S A;  1IL2 A;  4QY7 A;  2AQ3 B;  4YWK A;  3E5S A;  4MIU A;  1CSP A;  1IBL Q;  5M5X B;  4RGT A;  3Q6S A;  2R61 A;  2HHH L;  5LMN L;  1B3A A;  2KBN A;  5C44 H;  2FJ2 A;  1XJV A;  1XPU A;  5IOD A;  2B39 A;  3TRZ A;  1Y14 B;  1Y1V H;  4M1U B;  2EYF A;  4TRD A;  4UDU C;  2E2J B;  4BXX H;  3M85 A;  2KCC A;  1HR0 Q;  3GTP H;  4RG1 A;  1H9K A;  4FVM A;  4R8I A;  1GHJ A;  2OT2 A;  2DY7 A;  4GS3 A;  3D4W A;  4CDE C;  2XSC A;  1PH3 A;  4K0K L;  1P8L A;  1FGU A;  5HUR A;  1RF2 D;  5J39 A;  3H94 A;  2QF7 A;  4A3F G;  1MSH A;  1FD7 D;  2M9V A;  3HOY H;  4QMG A;  3FMC A;  1B1Z A;  4JI3 Q;  4BBS G;  1D6E C;  2QIL A;  1VQI A;  1STN A;  4LNQ A;  3NQI A;  3ITP A;  2CH4 A;  1I6H B;  1ET6 A;  1HQM C;  4OWX B;  2XRS D;  2RDF A;  4JOI A;  1B53 A;  1ZYR C;  1Q82 C;  1SDF A;  3E0E A;  3OW2 A;  1VQO A;  1GO3 E;  2Z6K C;  1ZKO A;  2BA0 A;  2EE1 A;  1Y1W H;  4PQX A;  4A3B B;  2VQE Q;  1CHQ D;  2VB2 X;  3V2T A;  3I4N B;  4HIK A;  5E3F A;  5CBE E;  1HNX Q;  1X6O A;  2B2U C;  1CKM A;  2BOS A;  3SK6 A;  1SYB A;  3OHX C;  2NB0 A;  3A0J A;  1IW7 C;  3IRB A;  1TKW B;  1EOV A;  3LWU A;  1VQ4 A;  1GUT A;  2A68 C;  1A3T A;  4DK6 C;  1EZ6 A;  2Y0S E;  1MKH A;  2VW9 A;  2BA1 A;  4GKK L;  3FHW A;  2NVY H;  1SYE A;  1XNQ L;  4I7A A;  5KRU A;  3ULJ A;  4J8Q A;  5COY A;  1PRT B;  5IGC A;  4BY7 B;  3DEO A;  3BDL A;  4C3J B;  2MJ8 A;  3NSW A;  5IYB H;  1WTR A;  2F4V L;  5H1S E;  1M90 C;  2N49 A;  1QUQ A;  1LT4 D;  3H09 A;  3Q8D A;  2I46 A;  2IHE A;  1Y1V G;  4L6T B;  1PZJ D;  3OTO L;  5ELE A;  1T5X D;  3EBE A;  1I94 Q;  1LTL A;  5C3E G;  1SR3 A;  3UE1 A;  1C4Q A;  4XIG S;  1SNC A;  1NTG A;  5NUC A;  4FXD A;  4FYD A;  2AKW B;  3S16 B;  1V8Q A;  2OF1 A;  4UP8 A;  3EVQ A;  1EOT A;  1PVO A;  3A8I E;  4A93 G;  2EYL A;  1GUW A;  5CV4 A;  3BVZ A;  2EOT A;  2ES2 A;  2CQO A;  1PTO F;  2EY6 A;  2QA4 A;  1VQ6 A;  3R2I A;  3HOW G;  2Q2I A;  4DV5 L;  1BUV T;  1HTL D;  2D5D A;  2XVS A;  2ZTE A;  2EJG C;  1EY8 A;  1DCZ A;  2WKC A;  2K33 A;  3T1H L;  3I4L A;  1ILP A;  1Q81 C;  1H9R A;  4K8I A;  1G8Z D;  4YHH L;  2EJF C;  4OIK A;  2KCT A;  2DUD A;  1I3Q B;  2CWA A;  2MO0 A;  5T1I A;  1HNZ Q;  4X62 Q;  4DR1 L;  3JC6 6;  5M5X H;  5EBC A;  3M4O B;  4ZUJ A;  4XQJ A;  3DM3 A;  4KY7 A;  1MJE A;  4QCL A;  1XMQ L;  1AZQ A;  4LFA L;  3SE0 A;  1NBW A;  2JSO A;  1AP0 A;  4QUC A;  3B6Y A;  2K32 A;  3CQZ B;  1DD2 A;  3HRZ C;  3DWA A;  5CV5 A;  3M7N A;  2WB1 G;  4C56 C;  4A76 A;  5IYB G;  3A5U A;  4JI4 L;  2K03 A;  4CKE A;  5G3L F;  2KEN A;  3MXN B;  1JCK B;  4G7H C;  1CUK A;  3K7U C;  3PO3 G;  5C3X A;  4X62 L;  4IQZ A;  1VQG A;  4JI4 Q;  4DKA C;  5COR A;  4J15 A;  4C2M B;  4IFD G;  5C4X H;  4A3M H;  3HOZ B;  3MXU A;  3TP7 A;  4B3T L;  4A3G B;  5CV7 A;  1PRT C;  4ZKB B;  4ZCK A;  1A62 A;  1PYW D;  5C4Z A;  3J81 j;  1K28 A;  3L0O A;  1JWM D;  4U67 3;  5C3E B;  2R93 B;  1Y1W B;  1O80 A;  2MNA A;  2RVL A;  4O1N A;  5C3W A;  2E2H B;  3S1Q B;  2O5I C;  3VYS A;  3NTI A;  4A4I A;  3J7A 5;  4LF7 Q;  3R2T A;  1M8A A;  1EY4 A;  3PUW A;  3J81 L;  1TY0 A;  1UE5 A;  1NJI C;  5CV6 A;  5M5Y H;  3U4V A;  5ISR A;  4I7Z C;  2EQS A;  1X3F A;  2SEB D;  3VR5 A;  3X3N A;  4RGN A;  1R4P B;  1TR5 A;  4APV A;  3MXN A;  3HKZ G;  4DR2 L;  3S1N B;  2A74 C;  1PYS B;  1L2F A;  2A68 D;  1FYC A;  1HZC A;  4ABN A;  3PMF A;  3VA7 A;  1WTO A;  3VR2 A;  3EQL C;  2B8G A;  1E0B A;  2DN8 A;  3CC4 A;  3M9B A;  5CMD A;  1KDC A;  3HOV G;  1WCM B;  2JQO A;  5BN5 A;  3S16 H;  1VQL A;  2ZTD A;  2SDF A;  1I94 L;  1KAA A;  1CQF A;  2JA5 B;  4Y52 H;  4JI6 L;  2KHS A;  1F2Y A;  2CW0 C;  2P5Z X;  5IP9 G;  1XPR A;  1AN8 A;  1ASZ A;  4OHJ A;  3VR3 A;  3EIV A;  1SJE D;  1ICW A;  1PRT F;  5K36 G;  4A3F H;  3T56 B;  2QDB A;  3UDI A;  5GAE C;  3KLS X;  1DZ1 A;  2NTS A;  1GD7 A;  2VUM G;  2PQE A;  4KJN A;  4OXP A;  4LMQ D;  4DUZ Q;  3CW2 C;  2NBF A;  1EQQ A;  3RLF A;  2QGQ A;  5J1Z A;  3TN2 A;  1V1O A;  1HQR D;  5ELC A;  1DOM A;  1E2Z A;  1TS3 A;  2F52 A;  3KF6 B;  2ICE C;  2EYH A;  1S4Z A;  4GOP A;  2R7Z H;  3QG1 A;  2RF4 A;  1H9S B;  4KKU A;  4K5V A;  3E9I A;  3KBX A;  1SE8 A;  2F3W A;  1CHP D;  2N78 A;  3IL8 A;  3JAM L;  1ET9 A;  1ENC A;  3SEB A;  3P7J A;  3OMC A;  3PF5 A;  2NZ1 D;  2OEO A;  3I73 A;  2NN6 I;  4A3D G;  2ENB A;  1KXL A;  3W5O A;  1IL8 A;  4OIJ A;  4AYB B;  3IKJ A;  5E7N A;  2I5M X;  2ZTC A;  1S72 A;  2SOB A;  3CCL A;  2C35 B;  3ULP A;  4IN3 A;  3BZD B;  4K6D A;  4R4I A;  4OEL B;  1PH6 A;  3KOJ A;  1GUG A;  4KN4 C;  5IWA L;  1SYF A;  4DA2 A;  3K58 A;  5HY6 A;  1YHQ A;  2KED A;  1GUO A;  1I5F A;  4Q0F A;  1STE A;  3D4D A;  2K5H A;  1I4Q A;  1SN8 A;  2LMC B;  3NK9 A;  3L9A X;  3ZYY X;  3MVV A;  4EX5 A;  3KDF A;  1D8L A;  1D5X C;  3M4Q A;  4PMC A;  2J7Z A;  1PZI D;  3ZJY C;  3I2Z A;  1EZ8 A;  4DFA A;  2K04 A; 
#chains in the Genus database with same CATH homology
 2WP8 J;  1A2T A;  1GHK A;  1LO5 D;  1H9S A;  2HDM A;  1VF5 C;  4BY1 B;  3PIO 3;  2WAQ B;  2PYK A;  3C1F A;  1LAB A;  2WV6 D;  3KK7 A;  3VR6 A;  3Q0A A;  3S1M B;  2O4X A;  3KLR A;  2XN9 C;  1KNA A;  3E6Z X;  3OIQ A;  1HCZ A;  3GTQ B;  1VDZ A;  5C4J B;  2PNR C;  4CJ1 B;  2HQE A;  5HGT A;  1PRT D;  2VXW A;  4NW2 A;  1JOK A;  3TBI B;  5BN4 A;  2K1B A;  1F77 A;  3ERO A;  3R8B A;  3DUZ A;  4K6L A;  4XT3 B;  1WTV A;  1HPC A;  1S5E D;  1JB3 A;  1HUM A;  2QEJ C;  3RD4 A;  2A5H A;  3VYU A;  2A6H C;  5I2Y A;  1RCV D;  2SNM A;  3CHB D;  3CKI B;  2AQ2 B;  1SNP A;  4KKS A;  1V1P A;  4IUT A;  3EA6 A;  2F0E A;  4WRD A;  4DGZ A;  2F0M A;  1KTK A;  5IGD A;  1A3V A;  1B2T A;  4XTC S;  3WOE A;  3JAM E;  1PXU A;  2MPM A;  3PO3 B;  1VMP A;  3MHB A;  2E75 C;  2X6G A;  2CW0 D;  4J1M A;  1JOQ A;  4XDX A;  5FLX L;  4ZYS A;  1W6J A;  2L55 A;  2EJM A;  4MHE A;  3AU7 A;  1EYA A;  4ZQ3 A;  1TQO A;  1F9S A;  4R8N A;  3OIP A;  3H3V C;  4G7O C;  1EY7 A;  3NTH A;  1EEF D;  5FLX E;  2J4X A;  1SMY D;  1EY9 A;  2IJ0 A;  1SAP A;  4KKT A;  4DAY A;  5KYI A;  1B4O A;  3NHH A;  2A73 B;  4IFD H;  1EYC A;  1A6X A;  4KK7 A;  1RTN A;  2FMM A;  3PUV A;  1QB5 D;  3BG3 A;  2B2U A;  2IX3 A;  4DAV A;  1TVX A;  3HOY B;  1F2Z A;  2Z8L A;  1PTO B;  2K7V A;  4LJZ C;  5JPN C;  1I4H A;  1Q90 A;  3X3M A;  3HGB A;  2V4D A;  1QNU A;  4A3I B;  4KY5 A;  1ILQ A;  2E2D C;  4X3T A;  4K14 A;  3H0G B;  3GO5 A;  1U4M A;  5JAV A;  1Z47 A;  3FVQ A;  4RGM A;  3T53 B;  3J80 L;  4IUQ A;  1ENA A;  5IIF A;  4F87 A;  2XIW A;  1HHV A;  4RFB A;  3QWN A;  3MA2 B;  2L4N A;  1FNV A;  5D3D A;  1ROD A;  1V1P B;  2WB1 B;  4A93 B;  5CV9 A;  4DXF A;  5DM6 3;  3GTG B;  1BOS A;  1YNN D;  4DU9 A;  1SNO A;  1UEA B;  4CGY B;  4G4K A;  2ZXR A;  4OO1 G;  4QF4 A;  3MWY W;  3HP3 A;  1UAP A;  4H7B A;  3NQT A;  1TY2 A;  3DHQ A;  1XXG A;  3QB3 A;  1TT2 A;  1BR9 A;  2A6H D;  2ZT9 C;  4J6H A;  1Q1B A;  1H9M A;  5D3I B;  2FFK B;  2WII B;  4RH6 A;  2KOL A;  1PFB A;  3GQB A;  4FF1 A;  1I4P A;  1O7L A;  2EYJ A;  3LWE A;  5E4X A;  4KHV A;  2L5T A;  3M7G A;  1EIG A;  4IUU A;  4RKL A;  4XYQ A;  2MP1 A;  2ICI A;  2IX0 A;  3F2U A;  1KLU D;  3J7A V;  3UI2 A;  4V0B A;  2FMC A;  2NYZ D;  4PV1 C;  3MC0 B;  1HA6 A;  4RGO S;  3BDC A;  1B44 D;  2F0V A;  3M3Y B;  1HUN A;  1EWC A;  1DJR D;  4X3K A;  3ND9 A;  3RZO B;  4EQO A;  5LL6 S;  3EFX D;  3W2D A;  5I2X A;  1ZEQ X;  2ID0 A;  2KQ3 A;  5A2Q E;  4TKO B;  1SMY C;  1GUS A;  3S9W A;  2EDG A;  2VB3 X;  1Q1E A;  1EU3 A;  1WTP A;  2H1E A;  4KI0 A;  4IZ8 A;  1SE3 A;  5C0X H;  4DXG A;  5FK9 C;  3O13 A;  3NE5 B;  3MAQ A;  3A8J E;  4DNR B;  2KEC A;  4OGQ C;  3PO2 B;  2NVQ B;  3FEW X;  3BS1 A;  3RMH A;  1Z7T A;  2JEA I;  5I4D A;  5M3F B;  1ZXT A;  3MZ5 A;  3MXG A;  2NN6 H;  1AZP A;  3NXW A;  3VYR A;  1PTO H;  3SXH A;  2NUC A;  2K5W A;  4XT1 B;  1WD1 A;  1BQQ T;  3OOC A;  2K05 A;  4F8M A;  4L8J A;  4RHS A;  1STB A;  2EYM A;  4RWS C;  1VF7 A;  2RDG A;  4DN4 M;  1RDP D;  2KEE A;  2D2C C;  4HCS A;  5M9O A;  4G7Z C;  1WVL A;  1YNN C;  2F4I A;  5EKI A;  3K5O A;  2C9O A;  1HTP A;  4BBR B;  4I65 A;  4DAP A;  3KBG A;  1AFP A;  2CQA A;  1NR4 A;  3PUY A;  2YU9 B;  3IAY A;  4RCN A;  1LT5 D;  1I6V C;  5C0X J;  3PV0 A;  4OO1 I;  1Q8I A;  2KCN A;  2F0J A;  1G29 1;  1CZW A;  1PLF A;  1Y8P B;  1STH A;  1OO9 B;  1SEB D;  1WTW A;  2XWB B;  1CZG A;  2D9U A;  2L1B A;  4XQN A;  1JWU D;  5CV8 A;  5IT9 E;  2B2V A;  2L0C A;  3K57 A;  1HRJ A;  2JE6 I;  1QOH A;  1HA5 A;  1IYU A;  4C3H B;  2H4O A;  3OWE B;  2FHT A;  2RQX A;  3L7Z C;  1QG7 A;  1LTI D;  4KD4 A;  4ILW A;  2K5D A;  4XXE A;  1PFM A;  4FO2 A;  4FF2 A;  2DNC A;  2IWH A;  1EYD A;  1Z6H A;  1R4Q B;  5A2Q L;  3SR1 A;  2RKS A;  1SND A;  1TWA B;  4V19 0;  1CA6 A;  2R7Z B;  1MD2 D;  4R9W A;  2R6G A;  5EPJ A;  2AWN A;  1HXY D;  3FKI B;  4RKB A;  3HOX B;  1BDO A;  1SE4 A;  1HFG A;  5ELD A;  1E2W A;  1KDA A;  2A69 C;  4OO1 H;  5IGG A;  4XYO A;  4LAA A;  3WDN A;  2YYZ A;  4XQQ A;  1DYQ A;  4KTA A;  5LL6 X;  2Z1C A;  5KNC A;  1LLR D;  3GP7 A;  4C1N K;  4FNF A;  2F0Q A;  4BA1 I;  1D5Z C;  2RA4 A;  2R92 B;  3QOL A;  1QJO A;  1S5B D;  4ZAI A;  4KV6 A;  4DNT B;  1F2M A;  1QCB D;  2DNE A;  3BVM A;  4K8J A;  2F1M A;  1EY0 A;  1RJT A;  4UAI A;  1KAB A;  1PMR A;  5D65 A;  1BCP C;  3CRK C;  2KVM A;  4IUP A;  1EQT A;  5JJZ A;  2SNS A;  1CK1 A;  2R3Z A;  4HMJ A;  3KF8 A;  3G6J B;  4A3F B;  2LS0 1;  3K7A B;  1BBX C;  4KY6 A;  2F0T A;  4EQP A;  2RSO A;  1S5C D;  4IAL A;  2E2I B;  2EXZ A;  3DM1 A;  4BBS B;  1EY5 A;  1D2B A;  1SXT A;  1JE4 A;  2LFN A;  3P1H A;  3D4R A;  3ONA B;  2NVY B;  3BDO A;  4Z9C B;  3GTJ B;  4ZRZ A;  3U9S A;  4YIJ A;  1L0Y B;  1EEI D;  4QB4 A;  2NWG A;  3MTS A;  1SBB B;  3QJY A;  1SYC A;  3G7L A;  2WIN B;  2NVX B;  3E0J A;  2IPK D;  1JOR A;  4EQN A;  3N6R A;  5EPK A;  5IGB A;  2NVT B;  3ERQ A;  2LY7 A;  3TP5 A;  1X3P A;  3GV6 A;  2M2L A;  2F0I A;  2I07 B;  5C44 B;  1TS2 A;  2MUY A;  5JEA J;  4DK0 A;  2Q8T A;  2K01 A;  1F2L A;  5KGU A;  1ONL A;  3VR4 A;  3ND8 A;  1TWH B;  2F0G A;  2O5J C;  4EVO A;  3P75 A;  2DY8 A;  1IKM A;  5ELF A;  1BF4 A;  2BDN A;  4IUR A;  1T5E A;  3NUC A;  3TZU A;  2HCI A;  4H44 C;  2A69 D;  3KLS A;  4P2C B;  5KND A;  4FXK C;  1MI2 A;  1F9Q A;  4IUV A;  5JPM C;  2PMZ B;  2XWJ B;  3NWS A;  4DK1 A;  3SHL A;  1PTO C;  1I4R A;  5DNF A;  4E6I A;  2RDH A;  3NTK A;  4C3J G;  4A3K B;  1YNJ D;  3FRP B;  5CGK A;  4HED A;  1TWG B;  5EJW A;  2HUG A;  5M5W B;  1LT3 D;  3A54 A;  2PW7 A;  5T1G A;  4RHR A;  5AFW A;  5JVH 3;  3I70 A;  2B2W A;  4BA2 I;  5C4X B;  1DM0 B;  1OXS C;  2EY2 A;  1LTS D;  3D6C A;  3C46 A;  3HG9 A;  4CHT B;  1BCP D;  4HMI A;  3P20 A;  3CU7 A;  3W3A A;  1SFO B;  3SVM A;  1UUP A;  2F0P A;  2PZU A;  1RHP A;  1Y8O B;  1LTR D;  1DOL A;  1RTO A;  1O7Z A;  1TWC B;  1BCP B;  2EYO A;  1CT1 D;  4ZKC B;  5C4H A;  5KNB A;  5FOB B;  3I72 A;  2JEB I;  4EGV A;  2M00 A;  2IW3 A;  4FXG C;  2F0W A;  2B2T A;  2JYO A;  3D6W A;  1V43 A;  1G2S A;  4LK1 C;  3RUZ A;  1TU2 B;  1JIC A;  1IYV A;  5EBD A;  4KMU C;  4KD3 A;  1Y8N B;  2ZXO A;  1B9N A;  4WFN 3;  1IKL A;  5DAU A;  3HZX A;  2N88 A;  1U9R A;  1B9M A;  3QIA A;  1Y69 U;  3GTO B;  5C5M A;  1MSG A;  3IFD A;  2JXM B;  3OPO A;  3N52 A;  3V96 A;  5EKK A;  3OMG A;  2HDL A;  1D1K A;  3K5M A;  1CI3 M;  5IOC A;  1A3U A;  1JR0 D;  4N9P A;  1OXU A;  3L3O C;  5FO9 B;  5EQ0 A;  4PMW A;  1SNM A;  1STA A;  4ID6 A;  3S15 B;  4M8A A;  3HKZ B;  1F9P A;  1BXT A;  1CFM A;  2EPB A;  3I3C A;  1PTO D;  3OW7 A;  4Q5V A;  1MBY A;  3I90 A;  3A7A B;  4BS9 A;  3LNN A;  1KDB A;  4A3D B;  1YNJ C;  4WJW A;  1SNQ A;  3TZD A;  5J22 A;  4B9W A;  4B08 A;  5C5L A;  2Z4H A;  4Y7N B;  4G57 A;  4H0L C;  3H91 A;  5ELB A;  4K5X A;  1G2T A;  5C6A A;  2XNA C;  3S2D B;  4ME5 A;  5KIX A;  5E1F A;  3T16 A;  2BE5 D;  3R93 A;  1CM9 A;  1NR2 A;  1J8I A;  1LTG D;  4HAE A;  2GA4 B;  2D62 A;  1BNZ A;  2AQ1 B;  1FGB D;  1Q3L A;  3TP8 A;  2PPB C;  5JEA G;  3TME A;  4IFD I;  5IGF A;  5FO8 B;  1GOZ A;  4ULL A;  4MN3 A;  2F0U A;  3A55 A;  1BCP F;  3Q22 A;  5BN3 A;  2EVB A;  4A3J B;  3VA5 A;  2IX1 A;  4RCO A;  2F03 A;  3S14 B;  1OXV A;  1UNS A;  2NTT A;  3DWP A;  1RD9 D;  4KHZ A;  4NKL A;  1HFN A;  5I6W A;  2XRQ D;  1AW7 A;  3I8Z A;  1BO0 A;  1GUN A;  3FPU B;  1NUC A;  5I6Y A;  2PZT A;  5E4W C;  1KNE A;  2FIN B;  1IHZ A;  3M4Y A;  5IGE A;  4TQU S;  3NBI A;  5CR3 A;  4ODG A;  3H6M A;  1LTT D;  3J7A F;  4NP5 A;  4IUN A;  1U4R A;  1RKN A;  3R3O A;  5JOB A;  1JOO A;  2TMP A;  4HCE A;  3GTP B;  3BVG A;  3D8G A;  3MXP A;  2O2L D;  4H13 C;  3TSS A;  2E76 C;  1CQV A;  1SYD A;  1K8O A;  2IT1 A;  1ESR A;  4C1N I;  1B50 A;  1J9O A;  1U4L A;  2L12 A;  2K6A A;  2C5C A;  2HCC A;  2B2W C;  4C3I B;  1EU4 A;  5EKL A;  4RAU C;  5TSS A;  5KYL A;  5M3M B;  4CKB A;  5KEE A;  2CHB D;  3TP6 A;  3C1E A;  2G9H D;  3VYT A;  1STG A;  2AUJ D;  2BE5 C;  1QE6 A;  5FO7 B;  2F0F A;  2JA6 B;  3RZD B;  2F0O A;  3D31 A;  3S17 B;  2B2T C;  4C3H G;  1ESF A;  3J81 E;  3HS0 C;  2X6L A;  5C0X G;  1CTM A;  3GTK B;  1K8M A;  3QOJ A;  3HOV B;  1KLG D;  3IFT A;  4BWG B;  1XWE A;  4PMB A;  1JWS D;  2TSS A;  4HR7 B;  4U68 A;  2PCF B;  3WOF A;  2L9H A;  4A3E B;  1LT6 D;  1EIH A;  3J7Y W;  2Q8R E;  2A6E C;  2EZV A;  1AEX A;  4NMZ A;  1WTX A;  4L63 B;  3S2H B;  1TS5 A;  3PIP 3;  2AWO A;  4DF7 A;  1TWF B;  4K2L A;  4IFD J;  2JP1 A;  4JK1 C;  1O7Y A;  3GTL B;  4CJ0 B;  3I4M B;  2K28 A;  1WTQ A;  2K5Q A;  3HOU B;  1SYG A;  4K5W A;  1X3Q A;  3MEH A;  3J80 E;  2F0S A;  1QNK A;  3BYY B;  3NWT A;  2PO4 A;  5C0X I;  3PUX A;  1M4V A;  5I9P A;  1PFN A;  1LAC A;  5CC4 A;  1EWH A;  3Q24 A;  1EY6 A;  1DXM A;  3QO2 A;  2VUM B;  4OL7 A;  3K5N A;  2LKV A;  2G9D A;  3I91 A;  1FNW A;  5FKA C;  1OXX K;  2EY5 A;  2F0H A;  2KA7 A;  2MHV A;  2RBM A;  1K83 B;  1VMC A;  2VNU D;  2L11 A;  1QWY A;  5EPL A;  2F3V A;  3BYT B;  3T13 A;  3DXJ C;  1W6K A;  1FNU A;  2CVR A;  3OWF A;  1GXD C;  3DEP A;  1VCI A;  4X3U A;  1WD0 A;  3GV3 A;  2WAC A;  3URY A;  5K36 H;  3GD7 A;  5LHY 1;  4RA8 A;  4HTH A;  3AMU A;  3SDZ A;  2MGS A;  3Q23 A;  4X3S A;  4N9T A;  4FP5 D;  1G91 A;  1I4X A;  4K2K A;  1LTB D;  1PDQ A;  3V05 A;  1QIL A;  2B2V C;  1ENF A;  4KJO A;  3D3R A;  2B2Y C;  4WOR A;  3LX0 A;  3T4A C;  3A7L A;  3A56 A;  1NCV A;  2A6E D;  5I9O A;  4TSS A;  2B63 B;  5IT9 L;  4HSP A;  1LV9 A;  1EFI D;  3U9O A;  1SSO A;  1OXT A;  2E74 C;  3SK8 A;  3MFY A;  1SE2 A;  1Y1V B;  4B9X A;  1D5M C;  2BDO A;  2IL8 A;  3FPP A;  2NN6 G;  2BCO A;  2ZXP A;  1EL0 A;  2OXP A;  4QIW B;  1JQY D;  5A35 A;  1X32 A;  3NBH A;  1D1I A;  2KJX A;  2Q8I B;  2F0N A;  3DWQ A;  5DEH A;  1C48 A;  5EGT A;  2Y0S B;  2PW5 A;  3HOW B;  1SJH D;  1TII D;  4C3I G;  1XYI A;  1FR3 A;  2B2Y A;  3T51 B;  4CBV A;  1XX8 A;  1STY A;  2KUM A;  1I4G A;  4KN7 C;  3K5L A;  5M5Y B;  1DON A;  5JEA H;  1MGS A;  1DOK A;  2WKD A;  3AB9 A;  4ZK9 B;  1GJX A;  4F88 A;  4JBW A;  5K5P A;  1ZYR D;  3FDT A;  4F7X A;  2AUK A;  1A15 A;  1H9J A;  3A8K E;  5CBA E;  3C3L A;  3SK5 A;  1A2U A;  1PZK D;  5F2D A;  4A3M B;  2B8F A;  3NPP A;  3K59 A;  3PUZ A;  2RSN A;  1F9R A;  1E2V A;  1IW7 D;  1II3 A;  3C2P A;  2QKI C;  2EY1 A;  2Z4I A;  3DMU A;  3OSO A;  4FF4 A;  3SK4 A;  2F0K A;  3CRL C;  5D14 A;  3K0Y A;  3EJI A;  2F0D A;  1R9T B;  4PNY A;  2F0L A;  4NDX A;  2JA7 B;  1C8C A;  1ML0 D;  3TDQ A;  1CA5 A;  2JA8 B;  1XTC D;  1I50 B;  5JVG 3;  5DM7 3;  4CKC A;  3NP8 A;  2X69 A;  2PZW A;  1EQV A;  4CJ2 C;  4ZUI A;  4GZY C;  1O78 A;  4HSV A;  1NAP A;  2J0T D;  3GTM B;  5G3L D;  2N55 A;  1LTA D;  1Q12 A;  3S1R B;  3HEJ A;  1TS4 A;  1JC7 A;  4HN7 A;  1S5D D;  2QCP X;  1NSN S;  4FF3 A;  1L0X B;  4O42 A;  1U4P A;  1S5F D;  2EYP A;  1G6Z A;  4QUF A;  4ZLT F;  5CYU A;  3K6O A;  3MFG A;  3KUP A;  4S3S A;  2AQ3 B;  3E5S A;  4MIU A;  5M5X B;  4RGT A;  3Q6S A;  2R61 A;  1B3A A;  2FJ2 A;  5IOD A;  2B39 A;  4TRD A;  2EYF A;  4M1U B;  4UDU C;  2E2J B;  3M85 A;  2KCC A;  1H9K A;  4FVM A;  4R8I A;  1GHJ A;  2OT2 A;  2DY7 A;  3D4W A;  2XSC A;  5HUR A;  1RF2 D;  5J39 A;  3H94 A;  2QF7 A;  1MSH A;  1FD7 D;  2M9V A;  4QMG A;  3FMC A;  1B1Z A;  1D6E C;  2QIL A;  1STN A;  3NQI A;  3ITP A;  1I6H B;  1ET6 A;  1HQM C;  2XRS D;  2RDF A;  1B53 A;  1ZYR C;  1SDF A;  1ZKO A;  2BA0 A;  2EE1 A;  4PQX A;  4A3B B;  1CHQ D;  2VB2 X;  3V2T A;  3I4N B;  5E3F A;  5CBE E;  2B2U C;  2BOS A;  3SK6 A;  1SYB A;  3OHX C;  2NB0 A;  1IW7 C;  1TKW B;  3LWU A;  1GUT A;  2A68 C;  1A3T A;  1EZ6 A;  2BA1 A;  1SYE A;  5KRU A;  4J8Q A;  5COY A;  1PRT B;  5IGC A;  4BY7 B;  3DEO A;  3BDL A;  4C3J B;  2MJ8 A;  3NSW A;  1WTR A;  1LT4 D;  3H09 A;  2I46 A;  4L6T B;  1PZJ D;  5ELE A;  1T5X D;  1C4Q A;  4XIG S;  1SNC A;  5NUC A;  4FXD A;  4FYD A;  3S16 B;  1V8Q A;  2OF1 A;  3EVQ A;  1EOT A;  3A8I E;  2EYL A;  1GUW A;  5CV4 A;  3BVZ A;  2EOT A;  1PTO F;  2EY6 A;  3R2I A;  1BUV T;  1HTL D;  2D5D A;  2XVS A;  2EJG C;  1EY8 A;  1DCZ A;  2WKC A;  2K33 A;  3I4L A;  1ILP A;  1H9R A;  4K8I A;  1G8Z D;  2EJF C;  4OIK A;  1I3Q B;  5T1I A;  5EBC A;  3M4O B;  4ZUJ A;  4XQJ A;  4KY7 A;  4QCL A;  1AZQ A;  3SE0 A;  1AP0 A;  2JSO A;  4QUC A;  2K32 A;  3CQZ B;  1DD2 A;  3HRZ C;  3DWA A;  5CV5 A;  3M7N A;  4C56 C;  2K03 A;  4CKE A;  5G3L F;  1JCK B;  4G7H C;  5C3X A;  4IQZ A;  5COR A;  4C2M B;  4IFD G;  3HOZ B;  3MXU A;  3TP7 A;  4A3G B;  5CV7 A;  1PRT C;  4ZKB B;  1PYW D;  5C4Z A;  1JWM D;  4U67 3;  5C3E B;  2R93 B;  1Y1W B;  1O80 A;  2RVL A;  4O1N A;  5C3W A;  2E2H B;  3S1Q B;  2O5I C;  3VYS A;  3NTI A;  3R2T A;  1M8A A;  1EY4 A;  3PUW A;  3J81 L;  1TY0 A;  5CV6 A;  5ISR A;  4I7Z C;  2SEB D;  3VR5 A;  3X3N A;  4RGN A;  1R4P B;  1TR5 A;  3MXN A;  3S1N B;  2A74 C;  2A68 D;  1FYC A;  4ABN A;  3PMF A;  3VA7 A;  1WTO A;  3VR2 A;  3EQL C;  2B8G A;  1E0B A;  2DN8 A;  5CMD A;  1KDC A;  1WCM B;  5BN5 A;  2SDF A;  1KAA A;  1CQF A;  2JA5 B;  2KHS A;  1F2Y A;  2CW0 C;  1AN8 A;  4OHJ A;  3VR3 A;  1SJE D;  1ICW A;  1PRT F;  5K36 G;  3T56 B;  2QDB A;  3KLS X;  1DZ1 A;  2NTS A;  2PQE A;  4KJN A;  4LMQ D;  2NBF A;  3RLF A;  5J1Z A;  3TN2 A;  1V1O A;  1HQR D;  5ELC A;  1DOM A;  1E2Z A;  1TS3 A;  2ICE C;  2EYH A;  1S4Z A;  3QG1 A;  1H9S B;  4KKU A;  4K5V A;  3KBX A;  2F3W A;  1CHP D;  3IL8 A;  3JAM L;  1ET9 A;  1ENC A;  3SEB A;  3P7J A;  3OMC A;  2NZ1 D;  2OEO A;  3I73 A;  2NN6 I;  2ENB A;  1IL8 A;  4OIJ A;  4AYB B;  3IKJ A;  2SOB A;  4IN3 A;  3BZD B;  4K6D A;  1GUG A;  4KN4 C;  3K58 A;  1SYF A;  4DA2 A;  2KED A;  1GUO A;  4Q0F A;  1STE A;  3D4D A;  1I4Q A;  2LMC B;  3NK9 A;  3L9A X;  3ZYY X;  3MVV A;  1D5X C;  4PMC A;  2J7Z A;  1PZI D;  1EZ8 A;  4DFA A;  2K04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...