1EY9A

Structure of s. nuclease stabilizing quadruple mutant t41i/p117g/h124l/s128a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey9A00
3LX0A 4NKLA 4K2KA 4K8IA 4KD4A 1JORA 4KHVA 2RDFA 3SK6A 1EYDA 3BDCA 4J1MA 4B9WA 5I9PA 4KJNA 1SYDA 3TP6A 4NMZA 3PMFA 5K5PA 4F7XA 5KIXA 4DF7A 2EY5A 2F0UA 2PW7A 1EY4A 4YIJA 5KEEA 3D6CA 4PMBA 4QF4A 1EY8A 5C3XA 4EVOA 1SNPA 1KDBA 5KYLA 1U9RA 2F0WA 3D4DA 2F3WA 1ENAA 3DMUA 5DEHA 2PW5A 4NP5A 2KQ3A 4ZUJA 5HGTA 2RBMA 1TT2A 4K2LA 5E1FA 2F0OA 3U9OA 5J39A 3P1HA 4ID6A 1NUCA 4KV6A 4DU9A 4RKLA 4EQNA 1NSNS 1A3UA 1EY0A 2EYPA 2RKSA 4LAAA 5EKKA 2PYKA 5IGGA 5ISRA 5NUCA 2EYHA 4ZQ3A 4B9XA 5C4ZA 1F2MA 4H7BA 1KAAA 3BDLA 3TP8A 3MEHA 3S9WA 1EZ8A 1EYCA 1SYEA 4MIUA 1KDAA 2M00A 3OWFA 2F0GA 5CV7A 3OMGA 1EY9A 2EYOA 5IGEA 1EY6A 4K5XA 3SXHA 3H6MA 2ENBA 2EY1A 5J22A 2EY2A 3HEJA 1A3TA 5IODA 1STHA 2EY6A 5C6AA 3NXWA 4ME5A 3NQTA 4OL7A 1STNA 3TP5A 2F0JA 2F0KA 2F0TA 2F0QA 2SOBA 2OXPA 1ENCA 4PMCA 5CV5A 5CR3A 5HURA 2F0FA 4PNYA 5CV8A 1AEXA 3SK4A 3E5SA 5C3WA 1EY7A 1STGA 3TP7A 2EXZA 3C1EA 4ODGA 4K8JA 3D8GA 4KY6A 5IIFA 5JAVA 5CV6A 2F0NA 5C5LA 3EROA 5JOBA 5C5MA 5I6WA 1JOQA 5KGUA 2QDBA 2KHSA 3QOJA 1TQOA 3D4WA 3HZXA 5IGDA 2F0EA 2EYJA 1TR5A 4IZ8A 3SK5A 3SK8A 1SYCA 5F2DA 2NUCA 3ITPA 1KABA 1SNDA 3MVVA 3RUZA 4QMGA 5DAUA 4HMJA 2F0VA 3NHHA 4N9PA 5CV9A 3SR1A 4EQPA 3NUCA 5CGKA 1STBA 1SYGA 4TRDA 5IGCA 1SNMA 1STAA 4HMIA 1EZ6A 4J6HA 2PZWA 4K5VA 1II3A 4IALA 4KY7A 3P75A 4K5WA 5EGTA 1SYFA 1JOKA 4QB4A 4N9TA 3T13A 1JOOA 2HQEA 3ERQA 2EYLA 4K14A 2EYFA 1SNCA 5C4HA 1A2TA 4WRDA 3SHLA 1KDCA 3V2TA 4DGZA 1EQVA 3EJIA 3R3OA 4DFAA 4EQOA 1SNQA 3C1FA 1RKNA 5I6YA 3MZ5A 3OSOA 2PQEA 5KRUA 5KYIA 4KTAA 5M9OA 4RKBA 5I9OA 4I65A 5CV4A 2F0MA 2LKVA 4KY5A 3QOLA 2SNMA 4HTHA 1A2UA 4ZUIA 4KD3A 1EYAA 2F0LA 2OF1A 3OMCA 5IGFA 3QB3A 2F3VA 2OEOA 5IGBA 4KJOA 2F0PA 4G57A 5EKLA 2WACA 4E6IA 3MHBA 3MXPA 1F2ZA 2F0SA 5J1ZA 3NK9A 4K6DA 2EYMA 2F0IA 3VA5A 3TMEA 5E3FA 5IOCA 2F0HA 1SYBA 2SNSA 1STYA 3DHQA 3NP8A 1A3VA 1EY5A 2PZTA 2O4XA 4NDXA 1IHZA 4S3SA 4R8NA 1F2YA 3EVQA 4F8MA 2PZUA 5CC4A 4WORA 4IUNA 3T16A 2F0DA 1SNOA
chains in the Genus database with same CATH superfamily
4K2KA 3PO2H 1BCPF 5DM63 1PYSB 5M3MG 2DJFC 5KNDA 2B2TC 3JAMi 2K5NA 1VQFA 1LT4D 2C35B 2ICEC 4JI6Q 3GTKB 3HKZB 1GUSA 2IL8A 4LF8L 2L55A 4DUYQ 3CQZB 1EWIA 3PO3H 5ISRA 1FD7D 2F1MA 4LF9Q 2QCPX 3PIPA 3KLSA 1XMOQ 2NZOA 3A7AB 5C44B 4ZK9B 2PMZE 1HXYD 3BDLA 1P16A 2Q8IB 2M00A 3OWFA 3RLOA 1I50H 2I46A 3KF8B 1K3BC 4IPGA 5IGEA 3H6MA 4RCOA 1TWFB 3NBHB 1LTTD 1STHA 2E2HB 4GLVB 3ND9A 2SOBA 3CCUA 4A3FG 3RZDB 2Z4IA 1E2VA 5I2XA 4OHJA 4ZAIA 2RHSB 4PZ8A 3C1EA 4XT3B 3D8GA 1YITA 2Z1CA 2RHQB 3CHBD 4TSSA 4FF4A 3JAME 1K73C 1OXXK 2WINB 5KRUA 3QR8A 4TQUS 2O5IC 2NTTA 4A3GG 1IBLQ 4M8AA 3G4SA 5M3FH 1SNMA 4A93H 2NB0A 3IFDA 3K58A 1RF2D 3TDQA 2D2CC 2HQEA 4C1NI 2Q2UA 1GVPA 2R92B 2YV5A 1RKNA 1XX8A 2NVQB 5IP9H 2F3IA 1H95A 1CFMA 4BBSB 3F2DA 2HUGA 4NPSA 1CT1D 4KKTA 1NMFA 1EQQA 1UE7A 3M4OB 2IY5B 3EN2A 4DV1L 1YNJC 1HTLD 2CW0C 4RA8A 4YCWA 1VCIA 2EDGA 2RDHA 3A56A 2F4VQ 2MFIA 1F2ZA 2HDMA 5JJZA 2QGQA 4JW0A 1YJWA 1YNND 5E3FA 2UUAL 3DHQA 4Y52H 2HT1A 2PZTA 1QG7A 3MTSA 4R8NA 5CC4A 4I7ZC 3AMUA 3GTPB 3R2TA 2HQLA 2VQFQ 2FINB 1CKNB 5G3LF 1X65A 2XGTA 3ULJA 1PH3A 1YZ6A 2Z9HA 4JI1Q 4H0LC 1SFOH 1QUQB 3BVGA 1YIJA 1RTOA 1SE2A 1PZID 3EQLC 1B7YB 5COYA 3UE1A 5HGTA 2RBMA 4DU9A 2F52A 2CWPA 1NJIC 2XSCA 4JBJA 4DV2Q 2I5HA 2A74C 5EPLA 3S24A 1Z6HA 2EOTA 2NN6H 1I4QA 1F9PA 3MEHA 4HCSA 3R8BA 3VYTA 1V43A 1JMCA 1HNZQ 4WJ4A 1JCKB 3OMGA 1EU4A 4IPCA 2KBNA 5J22A 2K5DA 4JI5Q 4IURA 1A3TA 3NWSA 3ND8A 2F0KA 5HURA 4LF5L 1Q90A 4C56C 4CKCA 2UXDL 1TWGB 1G51A 2I07B 3KJPA 1TIID 2K7VA 5CV6A 2K33A 1VQNA 3QOJA 1ASYA 1IL8A 3MEFA 5BN5A 1FJGQ 3MVVA 4X62Q 4A3MB 2UXBL 4RFBA 4O42A 5AJ3Q 1Y1WG 3TS2A 3FKIB 4RGOS 4BY7G 1SN8A 2CQAA 4P73A 5IP7H 3VA7A 2PZWA 3T51B 4PZ6A 3S1NH 3H3VH 3UDXA 4GOPC 1JOOA 3HOXH 3K59A 1A2TA 3I3CA 2K14A 4EQOA 1CI3M 2CFMA 3W3AA 3BZDB 5ELFA 4H44C 1QNUA 2NTSA 4DK6C 3I91A 2UXCL 3RR5A 4X66L 1L0WA 2KCNA 3MHBA 1GD7A 2JSOA 3CC2A 1K83B 3AU7A 3FRPB 3VA5A 5LL6X 2FMCA 5FJ8G 4DR3Q 1QB5D 2F0HA 1VS0A 1NE3A 4XXEA 1B8AA 1CZGA 1VF7A 2WAQG 2K75A 1H9RA 2N3SA 1JWSD 1EFID 1V1OA 5M5YB 3T1HL 1N33L 1FGBD 4L5SA 4GKKL 3ULLA 3GV3A 2NVXH 1SE8A 3A54A 1QZGA 2ES2A 3SDZA 5KEEA 1X56A 4I7AA 1KLUD 3WOEA 5KYLA 4LFBQ 1U9RA 4R1JA 3PIP3 3KDFB 2PW5A 1JJGA 3VR5A 2EJGC 3J7YW 3D4RA 3H0GB 1NSNS 3S14H 1I6HH 1WTPA 1PH2A 1A8VA 1SE3A 4FP5D 2A69D 3D0FA 3I4LA 4N8FA 1U5KA 3URYA 4DV5L 3HOUB 1JWMD 1STEA 1M1KC 1B1ZA 1DM0B 3IRBA 2UUCL 1ASZA 1IBMQ 3H09A 3TBIB 1EU3A 2EY1A 4B3RQ 1IBKL 4IUTA 2A68C 1PTOD 1MSHA 1WI5A 1BKBA 2B2YA 2WIIB 1VQJA 4QIWB 4JI2Q 1IL2A 4DV3L 2BOSA 3R93A 3HOYG 5C0XJ 4DR1Q 1EUJA 3NQIA 4YHHQ 1TWCB 3T1YQ 2E2JH 5FLXE 3I8ZA 1WCMG 3RN5A 5JJKA 2DNEA 3TSSA 4EQPA 1AZPA 5CV9A 2R7ZH 3CCRA 3CF5A 4BXXH 3A5UA 3MFGA 3CCLA 3U4VA 3C3LA 4A3DB 1LO5D 2BH8A 5E4XA 4J6HA 4B3ML 2HCIA 4XYOA 3HS0C 4BY1B 4A3JH 5C3EB 3ULPA 3T13A 3SHLA 4A3IG 3KYHC 2L5TA 1X3PA 4C1NK 4R8IA 1EFWA 3D31A 3FHWA 4KHPL 2VL6A 3I73A 5IY0A 4HIKA 1N32Q 3CCMA 4JVZA 2L4NA 3K5OA 1VQKA 1SR3A 5EPJA 3PO2G 2ASBA 3GTGB 1LYLA 4NXNQ 4R4CA 4GKJQ 5EJWA 1F77A 1HJPA 3R2IA 2BDNA 2J4XA 4K6DA 1JE5A 1IYJB 1HA5A 4QL5A 4NDXA 2JK8A 1ZYRD 4ALPA 3I56A 1B4OA 3M7NA 3BG3A 4JI4L 1IW7D 2N49A 2BDOA 4A3EH 3KF6B 2R6GA 1SRUA 1K28A 1XNRL 3I4MG 5D3IB 4CJ0B 2EY5A 5H1SE 2YU9H 3LGJA 1E0BA 2R7DA 1ENAA 1BR9A 1XPRA 4DV6Q 4UDUC 1CK1A 1D5XC 1TT2A 1I94L 1GUNA 2B63H 3TRZA 1DONA 3PUZA 1F2LA 5JJIA 2JA8H 2WV6D 1Q81C 1HNXQ 1F2MA 4JI3L 4HJ9A 3TP8A 3MWYW 4UPAA 4RCNA 3N6RA 4MHEA 4DR5L 4UP7A 2M9VA 3KLWA 5JVH3 4DR7L 5M3MB 4YY3Q 1HUMA 5IYBH 4BS9A 3NTIA 5JAVA 1JC7A 2E2IB 1F9SA 2CH4A 4PQXA 4AH6A 1I4GA 1CHQD 5KGUA 3J80E 1XPUA 3SK5A 1G2TA 2RQXA 4F88A 2K52A 2X6GA 3B6YA 2F0VA 5IP9G 5A2QL 3Q22A 3M3YH 2CVRA 2A1AA 2D0OA 3FDTA 5GAGC 4IFDG 3J81c 4BBRG 4K5VA 4A3FB 4IALA 1WTXA 3S16B 3P75A 4CHTB 2Z4HA 2IT1A 1QILA 3KOJA 3I4NH 2A5HA 4QB4A 1XMQL 1QNKA 4A3BH 1WTHA 1PA6A 2AUKA 1IXRA 1SNQA 1PVOA 5C4XH 5ELNA 4ILWA 1R9TB 2FXQA 1LTGD 1WTVA 2OF1A 2Q2IA 2TMPA 4A3GB 1WTRA 2F3VA 4DV7Q 2Q8TA 3CMAA 2Z0SA 3FVQA 2ZM6Q 1PLFA 1WD0A 1TY0A 3I7FA 5ELCA 3J7A5 1VQCA 2JYOA 1PHJA 3ERSX 2F4IA 1HZCA 5EBCA 3K5LA 1VQ5A 4K0KQ 4DN4M 1EOTA 5GAEC 1LT3D 1IKMA 1BCPD 3BJUA 3SK6A 2Q2HA 2JA7H 1FGUA 3HOVB 3CCEA 1IZ6A 1HNWL 4YIJA 3M9BA 1GUOA 1PRTB 2K1BA 4HJ5A 1PYBA 1PDQA 2F3WA 3CD6A 3S2DB 2JE6I 1QVGA 3I4OA 4K2LA 3BZCA 5FKAC 2RSOA 1DCZA 2EYPA 5EKKA 1UUPA 4EGVA 3WOFA 3A5ZB 2ZJRA 1VQ6A 1PZKD 3VDYA 1MJCA 3T56B 4V190 3Q0AA 3L2PA 4B08A 2L11A 2ENBA 1QE6A 4JI0Q 3HOWH 1AFPA 4P2CB 5IP7G 4LF7L 2R93B 2HD3A 1HPCA 5M5WB 1V1PA 3CRKC 4OO1I 2A73B 2NWGA 1TWHH 4K8JA 4ZRZA 4CBVA 1PMRA 3CKIB 1LACA 5GROA 3HOXG 4JBWA 2OCEA 1CQVA 4YCVA 4U673 3MXNB 1SNDA 3E0JA 3GO5A 4XT1B 4X64Q 1AE2A 1SYGA 1BO0A 3GTQB 2K6AA 3STBD 1NNXA 2DN8A 3FPPA 4R4IA 2G5DA 5LMUQ 1FL0A 4LFCQ 3SGIA 3K80C 2JXMB 3CRLC 1MHWC 1RODA 1GUWA 3EA6A 3EJIA 2KECA 2E5LL 3GP7A 3KBGA 1SMYD 2HCCA 1I4RA 4DAPA 5M9OA 5KNCA 1AW7A 4XDXA 1BF4A 1W6JA 3F2UA 1VQGA 4ZUIA 1Z47A 4JBMA 3QB3A 4JV5Q 4BY7B 4G57A 4NXML 1B44D 1UE1A 5BR8L 3CW2C 3MXPA 1MIUA 3CQZH 3AEVA 3CCQA 4LJZC 5C44H 4DV0Q 1UE6A 1A3VA 4X3KA 1F2YA 3ZJYC 2PZUA 1Y8OB 1XWEA 2RCFA 4A76A 1T5XD 2GVAA 1JORA 5G3LD 1GHJA 5I9PA 1XYIA 4JBKA 5M5XB 1TWFH 2E2HH 4FXDA 2A6ED 3TZDA 2YTYA 1ESFA 1K8AC 3K8AA 1VQIA 1HTPA 1GHKA 1EWCA 1UWVA 5J39A 2E2DC 1NUCA 1HHVA 1DOLA 2PNHA 2WAQB 3OHXC 1Y8PB 4LAAA 2EYHA 4DAVA 2B2VA 3GTMB 3WWVA 1ILQA 1EYCA 2K03A 5ELDA 4C2MB 2PQAB 2NN6I 4GS3A 2D5DA 4G7ZC 3LWEA 2QA4A 1O7IA 2MJ8A 4PV1C 4OL7A 3U50C 1CHPD 4BXXG 1UNSA 4P74A 2H5XA 3G7LA 2BE5C 3SK4A 4YCUA 2NYZD 2JJQA 4JK1C 4A3JG 2B2YC 4ULLA 3TP7A 3EBEA 1CQFA 2AUJD 5ELBA 2NVQH 5JEAG 2PPBC 4RGMA 4BBSH 2F0NA 1U4PA 2WB1B 4L5RC 1J5EL 1TQOA 1Q8KA 5E7NA 3M4OH 5IODA 1BVSA 4N9PA 1C8CA 1STBA 5LHY1 4DV1Q 1CSQA 4HR7B 1K8OA 3TS0A 2ZXOA 4OWTB 2K01A 4OO1H 1RHPA 5ELOA 5EAYA 5IWAQ 2UUAQ 3HOYB 2EYLA 4DR6L 1WVLA 3GTPH 4C3JH 4KHZA 2DY7A 3H3VI 3MZ5A 1WCMB 4HJAA 4A3KG 1PH4A 5CV4A 2SNMA 3J81L 2L0CA 2NZ1D 1E3PA 3L7ZC 1E2ZA 3GV6A 1EL0A 4Z9CB 3HP3A 2IPKD 4K6LA 4O2DA 2B8GA 1TY2A 4A3IB 2A6HD 3QWNA 4HEDA 4IPDA 5IYCG 1VQ7A 1Q8IA 3U58A 3PUVA 3FMCA 2F0DA 3KLRA 1N34L 1EYGA 4QQBX 2XWJB 4R4OA 1LLRD 2K50A 4LFAL 4B3SQ 4FNFA 1BBWA 1TS3A 2PW7A 2EIFA 1DYQA 1TWGH 2AQ2B 2UUBQ 1A62A 1EY8A 1RD9D 3MFYA 1HA6A 5IYBG 2UXDQ 3BZKA 4LF9L 2Y0SB 4OONA 5C4ZA 4DA2A 4A3MH 4IUUA 1OTCA 4FF2A 2F0GA 3S1QH 3I4MB 2UXBQ 1I50B 3M7GA 3HEJA 3W2DA 1O78A 1HCZA 4GN4B 3VR2A 2F0JA 3AQQA 1ENCA 3GD7A 4QY7A 2WKDA 1AEXA 3E5SA 3M4QA 5FO7B 1EQRA 2EXZA 3GQBA 1MI2A 3I4NG 4JCVE 3GTLB 3IAYA 1FNUA 4A3BG 2QDBA 2UU9L 1T9HA 3VYRA 3PIOA 5F2DA 5C4XG 3RUZA 4QMGA 3VR3A 1IYUA 3Q8DA 4DNTB 2MGSA 1QJOA 2ZJQA 2UXCQ 3L0OA 4CGYB 4X66Q 2K5QA 5I4DA 2GA4B 1M90C 3G6JB 4IJLA 1SNCA 3QJYA 1YHQA 2A8VA 5M5YH 3C1FA 2QKIC 4GOPB 1GUGA 3H94A 4AQYQ 2LKVA 4MTNA 1E2WA 1N33Q 4A3CH 4GKKQ 5IYDH 2K5VA 3NWTA 2R7FA 4AYBB 1D1KA 1BBUA 4R4QA 4BBRB 2WACA 2VS1A 2F4VL 1H9SB 1GM5A 4GNXA 3K7AB 3NK9A 1KD1C 2EYMA 3CCJA 4FDBA 2NZHA 1DGSA 1G2SA 4IO9A 1Z7TA 4C3IG 2I0QA 1HR0W 3T16A 1S5DD 1ICFB 4DV5Q 4KD4A 1KXLA 4J1MA 1S3OA 4QGUA 3K5NA 2VUMG 1IBKQ 5C0XI 1JB7A 3EFXD 2DJGC 2JA6B 3NELA 4OIKA 2QF7A 3HOWG 1I3QB 4DV3Q 1V8QA 4CJ1B 1VQAA 1VQDA 3NBIA 1A0IA 1TVXA 2C9OA 1K3RA 1TWCH 4KV6A 1C48A 2K5WA 1X3FA 1FVIA 1JR0D 3I2ZA 2YTXA 2NVTB 4TVAB 4LW1A 3ER0A 4MIUA 4C3HG 1HNZL 4LUOA 4A3DH 2RSNA 2JEBI 4BY1H 1Q7YC 1O7LA 1Y14B 1B3AA 4B3MQ 5C6AA 3MXUA 2D62A 2F0QA 1PH6A 1EEID 5JPNC 1STGA 3J81i 4DR2L 3MA2B 1JE4A 2H1EA 4KHPQ 1D6EC 2K28A 1JOQA 2KHSA 3FEWX 2LXJA 3D4WA 3TREA 1SYCA 4X62L 1LABA 5DAUA 3GTGH 4HMJA 1JQYD 4JOIA 2XN9C 4UHVA 2JA5G 1KC8C 2VW9A 2B2UA 2Z6KC 2XVSA 2EXDA 3NE5B 1PZJD 3HKZG 5LMNW 2X69A 3BVZA 3U4ZA 2EYFA 4IUPA 1DZ1A 3PUYA 3HOXB 2LY7A 4RAUC 3E9HA 4JI4Q 3STBC 1O7YA 2TSSA 4LUVA 5GADC 1XNRQ 1VF5C 4JC0A 3NTKA 4E6IA 1U4RA 4G7HC 2F0SA 3L9AX 1E1OA 1PRTF 4DR3L 3S1RB 1TU2B 2HDLA 4JI7L 1QVFA 1STYA 2NVYB 1G91A 1ICWA 4OXPA 3UI2A 3HOZG 3DLLA 1HZ9A 2PMZB 4X65Q 4JI3Q 2KUMA 1L0YB 4HCEA 5M3MH 4UP8A 4DR5Q 4DNRB 4GN5A 2ID0A 4IJHA 1S5BD 1FNWA 3OWEB 1G6PA 3F2BA 2ZXPA 2MP1A 3J7AV 4BA2I 1YBYA 2E2IH 1TS2A 1YVCA 3QIAA 3PSIA 3P20A 1X54A 3RD4A 4LF6L 4QUFA 1TWAB 1N36L 2O5JC 1ET6A 3W1BA 4ID6A 4EQNA 4DR4Q 1U4MA 4FXGC 3E6ZX 3DEOA 5IGGA 3NBHA 3UDIA 3S14B 1MJEA 5FLMH 5D3DA 3PO3G 5CORA 4DV4L 5C0XH 2B2WC 1JICA 3W1GA 2EYOA 2AWNA 4WJ3M 4FO2A 3S16H 1GXDC 4LMQD 2RDGA 2FJ2A 4ME5A 4JI2L 2F0TA 4IUQA 5CV5A 4DPGA 1DOMA 2F0FA 4ZKCB 1EY7A 3HKZE 1XMQQ 1YNJD 4OO1G 2CW0D 3CAMA 2EJMA 1R9TH 1M8AA 3PIO3 5C5LA 4ABNA 5C5MA 3RMHA 2KCCA 1RIPA 4C3JG 4UAIA 4B3TQ 3DXJC 4A3GH 1TR5A 1DD2A 1O7ZA 2NUCA 3KLSX 4KK7A 1Q82C 3RNUA 1LM0A 5IGCA 4DK1A 1L0XB 1YI2A 1IYVA 4HSPA 4CJ2C 5BN4A 2FFKB 3E3XA 2I5LX 3IL8A 5M3FG 4A93G 4A3JB 2MQHA 5EQ0A 1K0RA 2IJ0A 2QILA 2XIWA 4HJ8A 2PCFB 1RCVD 2MNAA 2KCTA 4KN4C 5I9OA 1LT6D 2LS01 1SE4A 1N32L 3AYHB 3HOVH 2IHEA 2ATWA 3SEBA 2F0LA 4G4KA 1VDZA 4GN3B 2BA0A 4XTCS 5IGFA 1YJNA 3G71A 1YHAA 4GZYC 2J0TD 2CKZB 1HNWQ 3S2DH 2BA1A 1C9OA 3OTOL 1OO9B 3CXCA 4MNOA 1CKNA 5DLQE 2F0IA 5C4JH 1WOCA 3ZYYX 5IOCA 2ZXRA 2OQKA 1PH5A 4YWLA 2CQOA 1KHIA 1QUQA 2LMCB 1HRJA 4A3KB 1Y1VH 2JP1A 4Y7NB 3NTHA 4A3MG 2AQ1B 1HH2P 3PMFA 1K0SA 4MN3A 5FO8B 3D6CA 3S15B 3K81C 2R93H 4JPBW 5M5WH 4NP5A 5K36H 4LF7Q 2KHIA 2V4DA 2F0OA 4JI8L 1KIXA 3DEPA 3JAML 1BNZA 1HNXL 1RJTA 3J81j 5D14A 4QCLA 3GTQH 4CKBA 5CV7A 1CSPA 1YEZA 2I5MX 3SXHA 1HUNA 2HHHL 2NN6G 1QOHA 4U68A 1YNNC 1XPOA 1WJJA 2EJFC 2IX0A 1FNVA 1A6XA 1D1IA 1STNA 3G48A 1WD1A 1ML0D 3UDFA 1SLJA 2L12A 4KMUC 3M85A 3RLFA 4JYAL 3O13A 4XQNA 1EOVA 3RLNA 4M1UB 4ODGA 2MUYA 2E5LQ 3A0JA 3WDNA 1BOSA 2RVLA 1EWHA 3MXGA 2F0EA 2EYJA 4AIMA 4BY7H 1KABA 1U4LA 1S40A 4IOCA 4A3CG 2VNUD 2C5CA 4DXGA 4NXMQ 5IYDG 1C7YA 4OX9L 3JC66 1EZ6A 4PZ7A 2SEBD 5BR8Q 2CH4W 4A3LH 1QCBD 1V9PA 2B3GA 1OXVA 1Q1BA 4GNXB 4I65A 3S2HH 2VB3X 2DUDA 5JJLA 2K4KA 2MPMA 2KVMA 3DUZA 1X55A 2OTJA 3HRZC 1VQBA 3GTJB 1CM9A 1HR0L 3W5OA 5FJ8H 1A63A 3S17B 3BU2A 2XNAC 3IFTA 2A68D 2AMCB 2OTLA 4GNXC 1ONLA 1EEFD 3DM3A 1BDOA 4P75A 3ICEA 2B8FA 4HAEA 3MAQA 1WTQA 1XNQL 1EYDA 2XWBB 3BDCA 5TSSA 1G6ZA 4APVA 3NSWA 1Y1WB 3Q24A 4A3DG 1B3QA 3F8TA 4PMBA 3GTKH 5C3XA 4CDDC 2YYZA 1Q3LA 2FHTA 4YWMA 1PH7A 3F2CA 1MSGA 5EPKA 4C3IB 4LF8Q 1A3UA 4DUZL 1CA5A 5ELEA 2IWHA 1J5EQ 4H7BA 4O1NA 3H15A 3T4AC 1VQLA 1VMPA 3NENA 4YWKA 3KFUA 2FMMA 3SVMA 4JI0L 2VUMB 2R61A 4K5XA 1AZQA 1YHBA 1VQ9A 4IFDI 3RZDH 3HOYH 3Q23A 3TZUA 5CYUA 1AP0A 4UY8C 1B70B 4V0BA 4PG3A 3CC4A 1E7ZA 1WCMH 2PNRC 4DR6Q 4KY6A 1SEBD 5IIFA 3A55A 1CKOA 3OW7A 3EROA 3RZOB 5I6WA 1HQRD 4C3HB 5LMNL 1W6KA 4X64L 3CP0A 3SR1A 1PTOB 5IT9c 1WTOA 4RH6A 1J9OA 4F87A 4HIMA 2CWAA 3A74A 2AKWB 2R7ZG 1MD2D 4A3IH 3RN2A 2A69C 4QIWE 4EQ5A 1JOKA 2B2UC 3CMEA 2D0PA 1MBYA 4K14A 2R92H 3D6WA 3KK7A 3UE0A 1KDCA 1SDFA 3S1MB 2ZTCA 3BVMA 1PTOC 2K32A 1N34Q 1X3QA 1PFSA 4LFAQ 3CCSA 2JA5B 3HKSA 4JV5L 3PGZA 5T1GA 2JN4A 4KJOA 4LF4L 2GVBA 5A2QE 1DOKA 2WP8J 3OOCA 3PQIA 3CC7A 2QDLA 4A4IA 4GLXA 3KJOA 3KF6A 2EZVA 4DV0L 5FO9B 2VQEL 4DAMA 4S3SA 3K57A 3EVQA 4IFDJ 2XRSD 4NKLA 3I4MH 1D5ZC 1AH9A 1S5CD 4B9WA 5FLMG 1Y69U 3A8IE 3BDOA 2IW3A 1D8LA 3GDEA 5C0XG 1EY4A 4A3EG 5JPMC 2F0WA 3D4DA 5HGQA 5DEHA 3PUXA 3GTLH 4CDCC 4FVMA 1X3GA 4R9WA 1BBXC 5FLXL 5L37A 3ONAB 3GTOB 3HOZB 4B9XA 2E76C 3T53B 2B63G 3S9WA 5GQOA 2UU9Q 2JA8G 1R4PB 4R4TA 2SDFA 3PO2B 1EY6A 1KL9A 1SXTA 2AHOB 4RG1A 2EY6A 3NXWA 1ZYRC 3A7LA 1UEAB 3NQTA 2KJXA 1UE5A 4LF5Q 4JI6L 1IW7C 2DY8A 4DUYL 1H9MA 1VQ8A 1XMOL 4LK1C 2H4OA 1L2FA 1OXUA 4DK0A 1ET9A 3PO3B 4JG2A 1H9JA 5IGDA 1G291 2BCOA 4IFDH 3H91A 4XQQA 4BBRH 3FKIH 4IPHA 3HOVG 4DAYA 3DWQA 1Y8NB 3CPFA 4ZYSA 1T5EA 3K7AH 1ENFA 3V05A 1NTGA 5IE8A 1HFNA 5IWAL 2ZJPA 1HFGA 1I4XA 1B9MA 3OIQA 4J8QA 3V2TA 4DGZA 3A8KE 2MO1A 3OSOA 4DK3C 4XQJA 4XYQA 4C3JB 2F03A 1S5FD 4RKBA 5JVG3 2OWOA 2F0MA 4KY5A 3QOLA 1IKLA 1A2UA 1Y1VG 1JJ2A 2OEOA 1IBLL 2JA6H 2CHBD 2L15A 1I3QH 1K83H 1XTCD 2F0PA 5EKLA 3VR4A 1UAPA 1WTWA 1LV9A 5M3FB 4A93B 1PRTD 3J7AF 1Q46A 2R93G 3TEHB 1I6VC 2YTVA 1TXYA 3NPPA 5K36G 2NVTH 1BXTA 2PI2A 2KEDA 3T1HQ 4LNQA 4KN7C 4B3SL 2L9HA 5T1IA 2HIVA 1SROA 2O2LD 5K5PA 2XTIA 4DF7A 1NR2A 1U0LA 1R4QB 4KKUA 5EBDA 1TKWB 5FK9C 2UUBL 2JA7G 4EVOA 3HGBA 4HIDA 2KENA 3H0GH 4DR2Q 1D2BA 4RKLA 3J80L 1JT8A 2G9DA 2G9HD 1EY0A 3BYTB 2PYKA 1KLGD 1B9NA 4DXFA 3HOUH 1NAPA 1BCPB 1DXMA 1EZ8A 2VQFL 1KDAA 1Q86C 3HG9A 3L3OC 1X3EA 3JAMc 1NY4A 2UUCQ 1S5ED 3S1QB 1ZXTA 4JI1L 1X9NA 3M4YA 1CZWA 1SFOB 4L5QA 4PNYA 3MXNA 2PI2E 2Z8LA 5CV8A 3MC0B 5CMDA 1BCPC 3M4PA 4A3LG 4IUVA 3BS1A 1PV4A 4DV2L 3CPWA 2P5ZX 4IZ8A 3SK8A 2Z6BA 1D5MC 3ITPA 1PFMA 3I90A 1V1PB 3OIPA 4JI5L 5DNFA 1KRTA 3OPOA 4QJFA 5C3EH 2M2LA 3S1RH 1KRSA 1P8LA 1NMGA 1W3SA 5EGTA 1GKHA 2NVYH 1E24A 1B53A 4JI7Q 4FXKC 2CCZA 2QW7A 1F9RA 4LWCA 3R3OA 5I6YA 1QVCA 5IT9L 4KTAA 4AQYL 3AB9A 4CDFC 1C4QA 2ALYB 4EX5A 1N8RC 4KD3A 1FJGL 3PF4A 1QWYA 1PXUA 5AJ3L 1PYWD 1L1OA 3I72A 2K04A 5JEAJ 1LTID 1GOZA 1TWAH 4ZCKA 3CU7A 4P71A 4LF6Q 2E8GA 3CCVA 1N36Q 3S1NB 1VMCA 2SNSA 4J15A 2WB1G 3K0YA 2BE5D 5C44G 4IUNA 5J1ZA 4L6TB 4DV4Q 4K8IA 4Q0FA 2RDFA 4ME3A 2B2TA 1SYDA 3K7UC 2D9UA 4WJWA 3TP6A 1F9QA 2L1BA 3X3MA 2F0UA 3J81E 1DJRD 2QEXA 2KOLA 4QF4A 4A75A 3H3VC 1PFNA 1SMYC 2KQ3A 1N9WA 2PQAA 2WFWA 3FP9A 2E74C 3DWPA 4CKEA 3KBXA 1XTDA 2RKSA 1I94Q 2OQ0A 2EQSA 5NUCA 1SSOA 4ZQ3A 1A15A 1RL2A 1VQHA 4N8X1 4POFA 2KA7A 1E1TA 4IN3A 4DR7Q 1TS5A 2NVXB 3K5MA 1ZKOA 4LFBL 1MGSA 2LFNA 4PMCA 1K9MC 5JEAH 1PH1A 2BH2A 1CA6A 1CUKA 1SAPA 3KF8A 4OIJA 1SMXA 2WAQE 1OXTA 1TS4A 2HIXA 1BQQT 2R92G 2A6EC 2ZTDA 1AN8A 1I6HB 1WFQA 4BBSG 1WYDA 1OXSC 2B2VC 1IBML 4TRDA 2ICIA 1Q1EA 1PFBA 4B3RL 1E22A 4RMFA 4A3FH 1EIYB 2MO0A 4H02A 3OTOQ 1I5FA 2IHFA 2RF4A 1SYFA 4OWWB 1NBWA 1KTKA 3E0EA 1JWUD 4A3KH 2Y0SG 4DFAA 4DR1L 4X3TA 4OELB 4BWGB 4YHHL 3T1YL 1CKMA 4Y7NH 3VR6A 1XJVA 2WB1E 5D65A 4DKAC 1LTAD 4HTHA 2E2JB 5A35A 3PCOB 4WFN3 3OYYA 3S15H 5IGBA 4MTKA 3J80i 2R7ZB 3N52A 3E9IA 5FOBB 5IYCH 2OT2A 4JI8Q 1SYBA 1KAWA 4XIGS 2IX1A 2N78A 1I4HA 3U9SA 4F8MA 5I2YA 4X65L 1PH8A 4UP9A 4WORA 1YNXA 2KCMA 1JB3A 4L5TA 3OW2A 1SNOA 2ZTEA 4KKSA 1EIFA 4KHVA 2B29A 4NMZA 4NB3A 2HHHQ 4F7XA 5KIXA 3QO2A 3A8JE 2LSSA 2Q8RE 2R3ZA 4NXNL 4GKJL 5LL6S 3LNNA 1KDBA 4HN7A 1O80A 4QUCA 1Q12A 4JYAQ 3U9OA 4DR4L 1LTSD 2K05A 3QG1A 1FR3A 1B2TA 2MHVA 1GO3E 4DNIA 4L63B 2KEEA 1KAAA 1SYEA 5FLXc 2B39A 3KUPA 2KHJA 3AFQA 4FF1A 4A3EB 4AYBG 2EY2A 2A6HC 2N8NA 4IOAA 1PTOF 3FKIG 4OX9Q 3C46A 3DM1A 3TP5A 2OXPA 1KNEA 5CR3A 1BUVT 2YU9B 1EQTA 5C3WA 4DV6L 1J6QA 1M4VA 4G7OC 2JQOA 2GN5A 4OEMB 4DAYB 2Y0SE 1ILPA 5CBAE 2QEJC 1X32A 4RHSA 2B63B 4B3TL 2N55A 4CDEC 1HQMC 3HZXA 2JA8B 1K8MA 5DM73 1XXGA 5CBEE 3GTJH 1MKHA 2EVBA 4RGNA 2LXKA 4YY3L 3S17H 1JJCB 1STAA 3K0XA 4GOPA 3HFZB 1HR0Q 1II3A 4RWSC 2JA6G 4X6AH 1ESRA 1I4PA 2XRQD 2A19A 2VZAA 3F1ZA 4ZLTF 2DNCA 4PMWA 1EQVA 2DGYA 5KYIA 2PQEA 1H9SA 2Q2TA 5BN3A 1D7QA 3P7JA 4ZKBB 2K5HA 1Y1WH 5IT9E 1XNQQ 1NR4A 4RGTA 4OWXB 1LUZA 4HIOA 4TKOB 4X3UA 2EPBA 1VQPA 3M3YB 3VYUA 3K6OA 3G6EA 3TQYA 2N88A 1HZAA 2IX3A 4C3IH 4MZ9A 4HJ7A 3C2PA 3TMEA 3VYSA 4IQZA 3UDGA 3NP8A 3I4NB 4DUZQ 1EY5A 1X6OA 5C4JB 2VY3A 3FPUB 3H0GG 4A3BB 3BYYB 5KNBA 2PO4A 2EE1A 1GJXA 5E4WC 3LX0A 2J7ZA 5M5XH 2VUMH 5C4XB 1Y1VB 2E75C 5J3BA 3HOUG 1GUTA 1PRTC 4KJNA 3J7ZC 1SBBB 4DV7L 4FYDA 3EIVA 4X3SA 4AYBE 2AQ3B 2ZM6L 1SNPA 2WKCA 3DMUA 4ZUJA 1RDPD 5E1FA 1SJHD 3X3NA 1PH9A 3P1HA 4POGA 3RZOH 1C0AA 1SJED 3GTMH 4L8JA 4C3HH 3I55A 1KNAA 4K0KL 4C2MH 1PTOH 1VQEA 5LMNQ 2Z6KA 3KDFA 4LUZA 3SE0A 3J80c 1CTMA 1EY9A 1ZEQX 1YJ9A 4KLKA 1G8ZD 4NW2A 2JA7B 2ZT9C 5GAHC 4OGQC 3IKJA 4BY1G 4P72A 5C3EG 1J8IA 3S1MH 1EIGA 3Q6SA 1V1QA 2NBFA 2RA4A 5JOBA 4O0AA 2JA5H 1FYCA 3PV0A 1NCVA 1RTNA 3NHHA 5CGKA 3NUCA 3LWUA 4RHRA 5AFWA 1Z9FA 1LTLA 5EKIA 4LF4Q 4HMIA 1LT5D 4KY7A 1K8GA 4K5WA 1H9KA 3HOWB 2V1CC 3NEMA 4H13C 4N9TA 1S4ZA 1S72A 3ERQA 1QZHA 3V96A 3D3RA 5C4HA 4WRDA 2X6LA 1L1OB 2VQEQ 1LTBD 3AFPA 1LTRD 1TWHB 5HY6A 1VQMA 1KQSA 1VQ4A 1EYAA 3OMCA 3S2HB 2VB2X 1UEBA 1VQOA 1W2BA 4HSVA 3DWAA 3TN2A 2RCNA 4JOIC 3PUWA 5LMUL 1L1OC 4LFCL 2AWOA 1EIHA 3GTOH 3HOZH 4FF3A 3PF5A 4Q5VA 1B50A 4BA1I 4GLAC 1AE3A 2O4XA 3I70A 1IHZA 2B2WA 2JEAI 2VXWA 2JA9A 4KI0A 1HZBA
chains in the Genus database with same CATH topology
4K2KA 1BCPF 5DM63 5KNDA 2B2TC 1LT4D 2ICEC 3GTKB 3HKZB 1GUSA 2IL8A 2L55A 3CQZB 5ISRA 1FD7D 2F1MA 2QCPX 3KLSA 3A7AB 5C44B 4ZK9B 1HXYD 3BDLA 2Q8IB 2M00A 3OWFA 2I46A 5IGEA 3H6MA 4RCOA 1TWFB 1LTTD 1STHA 2E2HB 3ND9A 2SOBA 3RZDB 2Z4IA 1E2VA 5I2XA 4OHJA 4ZAIA 3C1EA 4XT3B 3D8GA 2Z1CA 3CHBD 4TSSA 4FF4A 3JAME 1OXXK 2WINB 5KRUA 4TQUS 2O5IC 2NTTA 4M8AA 1SNMA 2NB0A 3IFDA 3K58A 1RF2D 3TDQA 2D2CC 2HQEA 4C1NI 2R92B 1RKNA 1XX8A 2NVQB 1CFMA 4BBSB 2HUGA 1CT1D 4KKTA 3M4OB 1YNJC 1HTLD 2CW0C 4RA8A 1VCIA 2EDGA 2RDHA 3A56A 1F2ZA 2HDMA 5JJZA 1YNND 5E3FA 3DHQA 2PZTA 1QG7A 3MTSA 4R8NA 5CC4A 4I7ZC 3AMUA 3GTPB 3R2TA 2FINB 5G3LF 4H0LC 3BVGA 1RTOA 1SE2A 1PZID 3EQLC 5COYA 5HGTA 2RBMA 4DU9A 2XSCA 2A74C 5EPLA 4HCSA 1Z6HA 2EOTA 1I4QA 3VYTA 1F9PA 2NN6H 3MEHA 3R8BA 1V43A 1JCKB 3OMGA 1EU4A 5J22A 2K5DA 4IURA 1A3TA 3NWSA 3ND8A 2F0KA 5HURA 1Q90A 4C56C 4CKCA 1TWGB 2I07B 1TIID 2K7VA 5CV6A 2K33A 3QOJA 1IL8A 5BN5A 3MVVA 4A3MB 4RFBA 4O42A 3FKIB 4RGOS 2CQAA 3VA7A 2PZWA 3T51B 1JOOA 3K59A 1A2TA 3I3CA 4EQOA 1CI3M 3W3AA 3BZDB 5ELFA 4H44C 1QNUA 2NTSA 3I91A 2KCNA 3MHBA 2JSOA 1K83B 3AU7A 3FRPB 3VA5A 5LL6X 2FMCA 1QB5D 2F0HA 4XXEA 1CZGA 1VF7A 1H9RA 1JWSD 1EFID 1V1OA 5M5YB 1FGBD 3GV3A 3A54A 3SDZA 5KEEA 1KLUD 3WOEA 5KYLA 1U9RA 3PIP3 2PW5A 3VR5A 2EJGC 3J7YW 3D4RA 3H0GB 1NSNS 1WTPA 1SE3A 4FP5D 2A69D 3I4LA 3URYA 3HOUB 1JWMD 1STEA 1B1ZA 1DM0B 3H09A 3TBIB 1EU3A 2EY1A 4IUTA 2A68C 1PTOD 1MSHA 2B2YA 2WIIB 4QIWB 2BOSA 3R93A 5C0XJ 3NQIA 1TWCB 5FLXE 3I8ZA 2DNEA 3TSSA 4EQPA 1AZPA 5CV9A 3MFGA 3C3LA 4A3DB 1LO5D 5E4XA 4J6HA 2HCIA 4XYOA 3HS0C 4BY1B 5C3EB 3T13A 3SHLA 2L5TA 1X3PA 4C1NK 4R8IA 3D31A 3I73A 2L4NA 3K5OA 5EPJA 3GTGB 5EJWA 1F77A 3R2IA 2BDNA 2J4XA 4K6DA 1HA5A 4NDXA 1ZYRD 1B4OA 3M7NA 3BG3A 1IW7D 2BDOA 2R6GA 5D3IB 4CJ0B 2EY5A 1E0BA 1ENAA 1BR9A 4UDUC 1CK1A 1D5XC 1TT2A 1GUNA 1DONA 3PUZA 1F2LA 2WV6D 1F2MA 3TP8A 3MWYW 4RCNA 3N6RA 4MHEA 2M9VA 5JVH3 5M3MB 1HUMA 4BS9A 3NTIA 5JAVA 1JC7A 2E2IB 1F9SA 4PQXA 1I4GA 1CHQD 5KGUA 3J80E 3SK5A 1G2TA 2RQXA 4F88A 2X6GA 5A2QL 2F0VA 3Q22A 2CVRA 3FDTA 4IFDG 4K5VA 4A3FB 4IALA 1WTXA 3S16B 3P75A 4CHTB 2Z4HA 2IT1A 1QILA 2A5HA 4QB4A 1QNKA 2AUKA 1SNQA 4ILWA 1R9TB 1LTGD 1WTVA 2OF1A 2TMPA 4A3GB 1WTRA 2F3VA 2Q8TA 3FVQA 1PLFA 1WD0A 1TY0A 5ELCA 2JYOA 2F4IA 5EBCA 3K5LA 4DN4M 1EOTA 1LT3D 1IKMA 1BCPD 3SK6A 3HOVB 4YIJA 1GUOA 1PRTB 2K1BA 1PDQA 2F3WA 3S2DB 2JE6I 4K2LA 5FKAC 2RSOA 1DCZA 2EYPA 5EKKA 1UUPA 4EGVA 3WOFA 1PZKD 3T56B 4V190 3Q0AA 4B08A 2L11A 2ENBA 1QE6A 1AFPA 4P2CB 2R93B 1HPCA 5M5WB 1V1PA 3CRKC 4OO1I 2A73B 2NWGA 4K8JA 4ZRZA 4CBVA 1PMRA 3CKIB 1LACA 4JBWA 1CQVA 4U673 1SNDA 3E0JA 3GO5A 4XT1B 1SYGA 1BO0A 3GTQB 2K6AA 3FPPA 2DN8A 2JXMB 3CRLC 1RODA 1GUWA 3EA6A 3EJIA 2KECA 3GP7A 3KBGA 1SMYD 2HCCA 1I4RA 4DAPA 5M9OA 5KNCA 1AW7A 4XDXA 1BF4A 1W6JA 3F2UA 4ZUIA 1Z47A 3QB3A 4BY7B 4G57A 1B44D 3MXPA 4LJZC 1A3VA 4X3KA 1F2YA 2PZUA 1Y8OB 1XWEA 1T5XD 1JORA 5G3LD 1GHJA 5I9PA 1XYIA 5M5XB 4FXDA 2A6ED 3TZDA 1ESFA 1HTPA 1GHKA 1EWCA 5J39A 2E2DC 1NUCA 1HHVA 1DOLA 2WAQB 1Y8PB 3OHXC 4LAAA 2EYHA 4DAVA 2B2VA 3GTMB 1ILQA 1EYCA 2K03A 5ELDA 4C2MB 2NN6I 2D5DA 4G7ZC 3LWEA 2MJ8A 4PV1C 4OL7A 1CHPD 1UNSA 3G7LA 2BE5C 3SK4A 2NYZD 4JK1C 2B2YC 4ULLA 3TP7A 1CQFA 2AUJD 5ELBA 5JEAG 2PPBC 4RGMA 2F0NA 1U4PA 2WB1B 1TQOA 5IODA 4N9PA 1C8CA 1STBA 5LHY1 4HR7B 1K8OA 2ZXOA 2K01A 4OO1H 1RHPA 3HOYB 2EYLA 1WVLA 4KHZA 2DY7A 3MZ5A 1WCMB 5CV4A 2SNMA 3J81L 2L0CA 2NZ1D 3L7ZC 1E2ZA 3GV6A 1EL0A 4Z9CB 3HP3A 2IPKD 4K6LA 2B8GA 1TY2A 4A3IB 2A6HD 3QWNA 4HEDA 1Q8IA 3PUVA 3FMCA 2F0DA 3KLRA 2XWJB 1LLRD 4FNFA 1TS3A 2PW7A 1DYQA 2AQ2B 1EY8A 1RD9D 3MFYA 1HA6A 2Y0SB 5C4ZA 4DA2A 4IUUA 4FF2A 2F0GA 3I4MB 1I50B 3M7GA 3HEJA 3W2DA 1O78A 1HCZA 3VR2A 2F0JA 1ENCA 3GD7A 2WKDA 1AEXA 3E5SA 5FO7B 2EXZA 3GQBA 1MI2A 3GTLB 3IAYA 1FNUA 2QDBA 3VYRA 5F2DA 3RUZA 4QMGA 3VR3A 1IYUA 4DNTB 2MGSA 1QJOA 4CGYB 2K5QA 5I4DA 2GA4B 3G6JB 1SNCA 3QJYA 3C1FA 2QKIC 1GUGA 3H94A 2LKVA 1E2WA 3NWTA 4AYBB 1D1KA 4BBRB 2WACA 1H9SB 3K7AB 3NK9A 2EYMA 1G2SA 1Z7TA 4C3IG 3T16A 1S5DD 4KD4A 4J1MA 3K5NA 5C0XI 3EFXD 2JA6B 4OIKA 2QF7A 1I3QB 1V8QA 4CJ1B 3NBIA 2C9OA 1TVXA 4KV6A 1C48A 2K5WA 1JR0D 2NVTB 4MIUA 4C3HG 2RSNA 2JEBI 1O7LA 1B3AA 5C6AA 3MXUA 2D62A 2F0QA 1EEID 5JPNC 1STGA 3MA2B 1JE4A 2H1EA 1D6EC 2K28A 1JOQA 2KHSA 3FEWX 3D4WA 1SYCA 1LABA 5DAUA 4HMJA 1JQYD 2XN9C 2B2UA 2XVSA 3NE5B 1PZJD 2X69A 3BVZA 2EYFA 4IUPA 1DZ1A 3PUYA 3HOXB 2LY7A 4RAUC 1O7YA 2TSSA 1VF5C 3NTKA 4E6IA 1U4RA 4G7HC 2F0SA 3L9AX 1PRTF 3S1RB 1TU2B 2HDLA 1STYA 2NVYB 1G91A 1ICWA 3UI2A 2PMZB 2KUMA 1L0YB 4HCEA 4DNRB 2ID0A 1S5BD 1FNWA 3OWEB 2ZXPA 2MP1A 3J7AV 4BA2I 1TS2A 3QIAA 3P20A 3RD4A 4QUFA 1TWAB 2O5JC 1ET6A 4ID6A 4EQNA 1U4MA 4FXGC 3DEOA 3E6ZX 5IGGA 3NBHA 3S14B 5D3DA 5CORA 5C0XH 2B2WC 1JICA 2EYOA 2AWNA 4FO2A 1GXDC 4LMQD 2RDGA 2FJ2A 4ME5A 2F0TA 4IUQA 5CV5A 1DOMA 2F0FA 4ZKCB 1EY7A 1YNJD 4OO1G 2CW0D 2EJMA 1M8AA 3PIO3 5C5LA 4ABNA 5C5MA 3RMHA 2KCCA 4C3JG 4UAIA 3DXJC 1TR5A 1DD2A 1O7ZA 2NUCA 3KLSX 4KK7A 5IGCA 4DK1A 1L0XB 1IYVA 4HSPA 4CJ2C 5BN4A 2FFKB 3IL8A 4A3JB 5EQ0A 2IJ0A 2QILA 2XIWA 2PCFB 1RCVD 4KN4C 5I9OA 1LT6D 2LS01 1SE4A 3SEBA 2F0LA 4G4KA 1VDZA 2BA0A 4XTCS 5IGFA 4GZYC 2J0TD 2BA1A 1OO9B 2F0IA 3ZYYX 5IOCA 2ZXRA 2LMCB 1HRJA 4A3KB 2JP1A 4Y7NB 3NTHA 2AQ1B 3PMFA 4MN3A 5FO8B 3D6CA 3S15B 4NP5A 5K36H 2V4DA 2F0OA 3DEPA 3JAML 1BNZA 1RJTA 5D14A 4QCLA 4CKBA 5CV7A 3SXHA 1HUNA 2NN6G 1QOHA 4U68A 1YNNC 2EJFC 2IX0A 1FNVA 1A6XA 1D1IA 1STNA 1WD1A 1ML0D 2L12A 4KMUC 3M85A 3RLFA 3O13A 4XQNA 4M1UB 4ODGA 2MUYA 3WDNA 1BOSA 2RVLA 1EWHA 3MXGA 2F0EA 2EYJA 1KABA 1U4LA 2VNUD 2C5CA 4DXGA 1EZ6A 2SEBD 1QCBD 1OXVA 1Q1BA 4I65A 2VB3X 2MPMA 2KVMA 3DUZA 3HRZC 3GTJB 1CM9A 3S17B 2XNAC 3IFTA 2A68D 1ONLA 1EEFD 1BDOA 2B8FA 4HAEA 3MAQA 1WTQA 1EYDA 2XWBB 3BDCA 5TSSA 1G6ZA 3NSWA 1Y1WB 3Q24A 4PMBA 5C3XA 2YYZA 1Q3LA 2FHTA 1MSGA 5EPKA 4C3IB 1A3UA 1CA5A 5ELEA 2IWHA 4H7BA 4O1NA 3T4AC 1VMPA 2FMMA 3SVMA 2VUMB 2R61A 4K5XA 1AZQA 4IFDI 3Q23A 3TZUA 5CYUA 1AP0A 4V0BA 2PNRC 4KY6A 1SEBD 5IIFA 3A55A 3OW7A 3EROA 3RZOB 5I6WA 1HQRD 4C3HB 1W6KA 3SR1A 1PTOB 1WTOA 4RH6A 1J9OA 4F87A 1MD2D 2A69C 1JOKA 2B2UC 4K14A 1MBYA 3D6WA 3KK7A 1KDCA 1SDFA 3S1MB 3BVMA 1PTOC 2K32A 1X3QA 2JA5B 5T1GA 4KJOA 5A2QE 1DOKA 2WP8J 3OOCA 2EZVA 5FO9B 4S3SA 3K57A 3EVQA 4IFDJ 2XRSD 4NKLA 1D5ZC 1S5CD 4B9WA 1Y69U 3A8IE 3BDOA 2IW3A 5C0XG 1EY4A 5JPMC 2F0WA 3D4DA 5DEHA 3PUXA 4FVMA 4R9WA 1BBXC 5FLXL 3ONAB 3GTOB 3HOZB 4B9XA 2E76C 3T53B 3S9WA 1R4PB 2SDFA 3PO2B 1EY6A 1SXTA 2EY6A 3NXWA 1ZYRC 3A7LA 1UEAB 3NQTA 2KJXA 1IW7C 2DY8A 1H9MA 4LK1C 2H4OA 1OXUA 4DK0A 1ET9A 3PO3B 1H9JA 5IGDA 1G291 2BCOA 4IFDH 3H91A 4XQQA 4DAYA 3DWQA 1Y8NB 4ZYSA 1T5EA 1ENFA 3V05A 1HFNA 1HFGA 1I4XA 1B9MA 3OIQA 4J8QA 3V2TA 4DGZA 3A8KE 3OSOA 4XQJA 4XYQA 4C3JB 2F03A 1S5FD 4RKBA 5JVG3 2F0MA 4KY5A 3QOLA 1IKLA 1A2UA 2OEOA 2CHBD 1XTCD 2F0PA 5EKLA 3VR4A 1UAPA 1WTWA 1LV9A 5M3FB 4A93B 1PRTD 3J7AF 1I6VC 3NPPA 5K36G 1BXTA 2KEDA 4KN7C 2L9HA 5T1IA 2O2LD 5K5PA 4DF7A 1NR2A 5FK9C 1R4QB 4KKUA 5EBDA 1TKWB 4EVOA 3HGBA 1D2BA 4RKLA 3J80L 2G9DA 2G9HD 1EY0A 3BYTB 2PYKA 1KLGD 1B9NA 4DXFA 1NAPA 1BCPB 1DXMA 1EZ8A 1KDAA 3HG9A 3L3OC 1S5ED 3S1QB 1ZXTA 3M4YA 1CZWA 1SFOB 4PNYA 3MXNA 2Z8LA 5CV8A 3MC0B 5CMDA 1BCPC 4IUVA 3BS1A 4IZ8A 3SK8A 1D5MC 3ITPA 1PFMA 3I90A 1V1PB 3OIPA 5DNFA 3OPOA 2M2LA 5EGTA 1B53A 4FXKC 1F9RA 3R3OA 5I6YA 5IT9L 4KTAA 3AB9A 1C4QA 4KD3A 1QWYA 1PXUA 1PYWD 3I72A 2K04A 5JEAJ 1LTID 1GOZA 3CU7A 3S1NB 1VMCA 2SNSA 3K0YA 2BE5D 4IUNA 5J1ZA 4L6TB 4K8IA 4Q0FA 2RDFA 2B2TA 1SYDA 3TP6A 2D9UA 4WJWA 1F9QA 2L1BA 3X3MA 2F0UA 3J81E 1DJRD 2KOLA 4QF4A 3H3VC 1PFNA 1SMYC 2KQ3A 2E74C 3DWPA 4CKEA 3KBXA 2RKSA 5NUCA 1SSOA 4ZQ3A 1A15A 2KA7A 4IN3A 1TS5A 2NVXB 3K5MA 1ZKOA 1MGSA 2LFNA 4PMCA 5JEAH 1CA6A 1SAPA 3KF8A 4OIJA 1OXTA 1TS4A 1BQQT 2A6EC 1AN8A 1I6HB 1OXSC 2B2VC 4TRDA 2ICIA 1Q1EA 1PFBA 1SYFA 1KTKA 1JWUD 4DFAA 4X3TA 4BWGB 3VR6A 5D65A 1LTAD 4HTHA 2E2JB 5A35A 4WFN3 5IGBA 2R7ZB 3N52A 5FOBB 2OT2A 1SYBA 4XIGS 2IX1A 1I4HA 3U9SA 4F8MA 5I2YA 4WORA 1JB3A 1SNOA 4KKSA 4KHVA 4NMZA 4F7XA 5KIXA 3QO2A 3A8JE 2Q8RE 2R3ZA 5LL6S 3LNNA 1KDBA 4HN7A 1O80A 4QUCA 1Q12A 3U9OA 1LTSD 2K05A 3QG1A 1FR3A 1B2TA 2MHVA 4L63B 2KEEA 1KAAA 1SYEA 2B39A 3KUPA 4FF1A 4A3EB 2EY2A 2A6HC 1PTOF 3C46A 3DM1A 3TP5A 2OXPA 1KNEA 5CR3A 1BUVT 2YU9B 1EQTA 5C3WA 1M4VA 4G7OC 1ILPA 5CBAE 2QEJC 1X32A 4RHSA 2B63B 2N55A 1HQMC 3HZXA 2JA8B 1K8MA 5DM73 1XXGA 5CBEE 2EVBA 4RGNA 1STAA 1II3A 4RWSC 1ESRA 1I4PA 2XRQD 4ZLTF 2DNCA 4PMWA 1EQVA 5KYIA 2PQEA 1H9SA 5BN3A 3P7JA 4ZKBB 5IT9E 1NR4A 4RGTA 4TKOB 4X3UA 2EPBA 3M3YB 3VYUA 3K6OA 2N88A 2IX3A 3C2PA 3TMEA 3VYSA 4IQZA 3NP8A 3I4NB 1EY5A 5C4JB 3FPUB 4A3BB 3BYYB 5KNBA 2PO4A 2EE1A 1GJXA 5E4WC 3LX0A 2J7ZA 5C4XB 1Y1VB 2E75C 1GUTA 1PRTC 4KJNA 1SBBB 4FYDA 4X3SA 2AQ3B 1SNPA 2WKCA 3DMUA 4ZUJA 1RDPD 5E1FA 1SJHD 3X3NA 3P1HA 1SJED 4L8JA 1KNAA 1PTOH 3SE0A 1CTMA 1EY9A 1ZEQX 1G8ZD 4NW2A 2JA7B 2ZT9C 4OGQC 3IKJA 1J8IA 1EIGA 3Q6SA 2NBFA 2RA4A 5JOBA 1FYCA 3PV0A 1NCVA 1RTNA 3NHHA 5CGKA 3NUCA 3LWUA 4RHRA 5AFWA 5EKIA 4HMIA 1LT5D 4KY7A 4K5WA 1H9KA 3HOWB 4H13C 4N9TA 1S4ZA 3ERQA 3V96A 3D3RA 5C4HA 4WRDA 2X6LA 1LTBD 1LTRD 1TWHB 1EYAA 3OMCA 3S2HB 2VB2X 4HSVA 3DWAA 3TN2A 3PUWA 2AWOA 1EIHA 4FF3A 4Q5VA 1B50A 4BA1I 2O4XA 3I70A 1IHZA 2B2WA 2JEAI 2VXWA 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LX0 A;  4NKL A;  4K2K A;  4K8I A;  4KD4 A;  1JOR A;  4KHV A;  2RDF A;  3SK6 A;  1EYD A;  3BDC A;  4J1M A;  4B9W A;  5I9P A;  4KJN A;  1SYD A;  3TP6 A;  4NMZ A;  3PMF A;  5K5P A;  4F7X A;  5KIX A;  4DF7 A;  2EY5 A;  2F0U A;  2PW7 A;  1EY4 A;  4YIJ A;  5KEE A;  3D6C A;  4PMB A;  4QF4 A;  1EY8 A;  5C3X A;  4EVO A;  1SNP A;  1KDB A;  5KYL A;  1U9R A;  2F0W A;  3D4D A;  2F3W A;  1ENA A;  3DMU A;  5DEH A;  2PW5 A;  4NP5 A;  2KQ3 A;  4ZUJ A;  5HGT A;  2RBM A;  1TT2 A;  4K2L A;  5E1F A;  2F0O A;  3U9O A;  5J39 A;  3P1H A;  4ID6 A;  1NUC A;  4KV6 A;  4DU9 A;  4RKL A;  4EQN A;  1NSN S;  1A3U A;  1EY0 A;  2EYP A;  2RKS A;  4LAA A;  5EKK A;  2PYK A;  5IGG A;  5ISR A;  5NUC A;  2EYH A;  4ZQ3 A;  4B9X A;  5C4Z A;  1F2M A;  4H7B A;  1KAA A;  3BDL A;  3TP8 A;  3MEH A;  3S9W A;  1EZ8 A;  1EYC A;  1SYE A;  4MIU A;  1KDA A;  2M00 A;  3OWF A;  2F0G A;  5CV7 A;  3OMG A;  1EY9 A;  2EYO A;  5IGE A;  1EY6 A;  4K5X A;  3SXH A;  3H6M A;  2ENB A;  2EY1 A;  5J22 A;  2EY2 A;  3HEJ A;  1A3T A;  5IOD A;  1STH A;  2EY6 A;  5C6A A;  3NXW A;  4ME5 A;  3NQT A;  4OL7 A;  1STN A;  3TP5 A;  2F0J A;  2F0K A;  2F0T A;  2F0Q A;  2SOB A;  2OXP A;  1ENC A;  4PMC A;  5CV5 A;  5CR3 A;  5HUR A;  2F0F A;  4PNY A;  5CV8 A;  1AEX A;  3SK4 A;  3E5S A;  5C3W A;  1EY7 A;  1STG A;  3TP7 A;  2EXZ A;  3C1E A;  4ODG A;  4K8J A;  3D8G A;  4KY6 A;  5IIF A;  5JAV A;  5CV6 A;  2F0N A;  5C5L A;  3ERO A;  5JOB A;  5C5M A;  5I6W A;  1JOQ A;  5KGU A;  2QDB A;  2KHS A;  3QOJ A;  1TQO A;  3D4W A;  3HZX A;  5IGD A;  2F0E A;  2EYJ A;  1TR5 A;  4IZ8 A;  3SK5 A;  3SK8 A;  1SYC A;  5F2D A;  2NUC A;  3ITP A;  1KAB A;  1SND A;  3MVV A;  3RUZ A;  4QMG A;  5DAU A;  4HMJ A;  2F0V A;  3NHH A;  4N9P A;  5CV9 A;  3SR1 A;  4EQP A;  3NUC A;  5CGK A;  1STB A;  1SYG A;  4TRD A;  5IGC A;  1SNM A;  1STA A;  4HMI A;  1EZ6 A;  4J6H A;  2PZW A;  4K5V A;  1II3 A;  4IAL A;  4KY7 A;  3P75 A;  4K5W A;  5EGT A;  1SYF A;  1JOK A;  4QB4 A;  4N9T A;  3T13 A;  1JOO A;  2HQE A;  3ERQ A;  2EYL A;  4K14 A;  2EYF A;  1SNC A;  5C4H A;  1A2T A;  4WRD A;  3SHL A;  1KDC A;  3V2T A;  4DGZ A;  1EQV A;  3EJI A;  3R3O A;  4DFA A;  4EQO A;  1SNQ A;  3C1F A;  1RKN A;  5I6Y A;  3MZ5 A;  3OSO A;  2PQE A;  5KRU A;  5KYI A;  4KTA A;  5M9O A;  4RKB A;  5I9O A;  4I65 A;  5CV4 A;  2F0M A;  2LKV A;  4KY5 A;  3QOL A;  2SNM A;  4HTH A;  1A2U A;  4ZUI A;  4KD3 A;  1EYA A;  2F0L A;  2OF1 A;  3OMC A;  5IGF A;  3QB3 A;  2F3V A;  2OEO A;  5IGB A;  4KJO A;  2F0P A;  4G57 A;  5EKL A;  2WAC A;  4E6I A;  3MHB A;  3MXP A;  1F2Z A;  2F0S A;  5J1Z A;  3NK9 A;  4K6D A;  2EYM A;  2F0I A;  3VA5 A;  3TME A;  5E3F A;  5IOC A;  2F0H A;  1SYB A;  2SNS A;  1STY A;  3DHQ A;  3NP8 A;  1A3V A;  1EY5 A;  2PZT A;  2O4X A;  4NDX A;  1IHZ A;  4S3S A;  4R8N A;  1F2Y A;  3EVQ A;  4F8M A;  2PZU A;  5CC4 A;  4WOR A;  4IUN A;  3T16 A;  2F0D A;  1SNO A; 
#chains in the Genus database with same CATH topology
 4K2K A;  3PO2 H;  1BCP F;  5DM6 3;  1PYS B;  5M3M G;  2DJF C;  5KND A;  2B2T C;  3JAM i;  2K5N A;  1VQF A;  1LT4 D;  2C35 B;  2ICE C;  4JI6 Q;  3GTK B;  3HKZ B;  1GUS A;  2IL8 A;  4LF8 L;  2L55 A;  4DUY Q;  3CQZ B;  1EWI A;  3PO3 H;  5ISR A;  1FD7 D;  2F1M A;  4LF9 Q;  2QCP X;  3PIP A;  3KLS A;  1XMO Q;  2NZO A;  3A7A B;  5C44 B;  4ZK9 B;  2PMZ E;  1HXY D;  3BDL A;  1P16 A;  2Q8I B;  2M00 A;  3OWF A;  3RLO A;  1I50 H;  2I46 A;  3KF8 B;  1K3B C;  4IPG A;  5IGE A;  3H6M A;  4RCO A;  1TWF B;  3NBH B;  1LTT D;  1STH A;  2E2H B;  4GLV B;  3ND9 A;  2SOB A;  3CCU A;  4A3F G;  3RZD B;  2Z4I A;  1E2V A;  5I2X A;  4OHJ A;  4ZAI A;  2RHS B;  4PZ8 A;  3C1E A;  4XT3 B;  3D8G A;  1YIT A;  2Z1C A;  2RHQ B;  3CHB D;  4TSS A;  4FF4 A;  3JAM E;  1K73 C;  1OXX K;  2WIN B;  5KRU A;  3QR8 A;  4TQU S;  2O5I C;  2NTT A;  4A3G G;  1IBL Q;  4M8A A;  3G4S A;  5M3F H;  1SNM A;  4A93 H;  2NB0 A;  3IFD A;  3K58 A;  1RF2 D;  3TDQ A;  2D2C C;  2HQE A;  4C1N I;  2Q2U A;  1GVP A;  2R92 B;  2YV5 A;  1RKN A;  1XX8 A;  2NVQ B;  5IP9 H;  2F3I A;  1H95 A;  1CFM A;  4BBS B;  3F2D A;  2HUG A;  4NPS A;  1CT1 D;  4KKT A;  1NMF A;  1EQQ A;  1UE7 A;  3M4O B;  2IY5 B;  3EN2 A;  4DV1 L;  1YNJ C;  1HTL D;  2CW0 C;  4RA8 A;  4YCW A;  1VCI A;  2EDG A;  2RDH A;  3A56 A;  2F4V Q;  2MFI A;  1F2Z A;  2HDM A;  5JJZ A;  2QGQ A;  4JW0 A;  1YJW A;  1YNN D;  5E3F A;  2UUA L;  3DHQ A;  4Y52 H;  2HT1 A;  2PZT A;  1QG7 A;  3MTS A;  4R8N A;  5CC4 A;  4I7Z C;  3AMU A;  3GTP B;  3R2T A;  2HQL A;  2VQF Q;  2FIN B;  1CKN B;  5G3L F;  1X65 A;  2XGT A;  3ULJ A;  1PH3 A;  1YZ6 A;  2Z9H A;  4JI1 Q;  4H0L C;  1SFO H;  1QUQ B;  3BVG A;  1YIJ A;  1RTO A;  1SE2 A;  1PZI D;  3EQL C;  1B7Y B;  5COY A;  3UE1 A;  5HGT A;  2RBM A;  4DU9 A;  2F52 A;  2CWP A;  1NJI C;  2XSC A;  4JBJ A;  4DV2 Q;  2I5H A;  2A74 C;  5EPL A;  3S24 A;  1Z6H A;  2EOT A;  2NN6 H;  1I4Q A;  1F9P A;  3MEH A;  4HCS A;  3R8B A;  3VYT A;  1V43 A;  1JMC A;  1HNZ Q;  4WJ4 A;  1JCK B;  3OMG A;  1EU4 A;  4IPC A;  2KBN A;  5J22 A;  2K5D A;  4JI5 Q;  4IUR A;  1A3T A;  3NWS A;  3ND8 A;  2F0K A;  5HUR A;  4LF5 L;  1Q90 A;  4C56 C;  4CKC A;  2UXD L;  1TWG B;  1G51 A;  2I07 B;  3KJP A;  1TII D;  2K7V A;  5CV6 A;  2K33 A;  1VQN A;  3QOJ A;  1ASY A;  1IL8 A;  3MEF A;  5BN5 A;  1FJG Q;  3MVV A;  4X62 Q;  4A3M B;  2UXB L;  4RFB A;  4O42 A;  5AJ3 Q;  1Y1W G;  3TS2 A;  3FKI B;  4RGO S;  4BY7 G;  1SN8 A;  2CQA A;  4P73 A;  5IP7 H;  3VA7 A;  2PZW A;  3T51 B;  4PZ6 A;  3S1N H;  3H3V H;  3UDX A;  4GOP C;  1JOO A;  3HOX H;  3K59 A;  1A2T A;  3I3C A;  2K14 A;  4EQO A;  1CI3 M;  2CFM A;  3W3A A;  3BZD B;  5ELF A;  4H44 C;  1QNU A;  2NTS A;  4DK6 C;  3I91 A;  2UXC L;  3RR5 A;  4X66 L;  1L0W A;  2KCN A;  3MHB A;  1GD7 A;  2JSO A;  3CC2 A;  1K83 B;  3AU7 A;  3FRP B;  3VA5 A;  5LL6 X;  2FMC A;  5FJ8 G;  4DR3 Q;  1QB5 D;  2F0H A;  1VS0 A;  1NE3 A;  4XXE A;  1B8A A;  1CZG A;  1VF7 A;  2WAQ G;  2K75 A;  1H9R A;  2N3S A;  1JWS D;  1EFI D;  1V1O A;  5M5Y B;  3T1H L;  1N33 L;  1FGB D;  4L5S A;  4GKK L;  3ULL A;  3GV3 A;  2NVX H;  1SE8 A;  3A54 A;  1QZG A;  2ES2 A;  3SDZ A;  5KEE A;  1X56 A;  4I7A A;  1KLU D;  3WOE A;  5KYL A;  4LFB Q;  1U9R A;  4R1J A;  3PIP 3;  3KDF B;  2PW5 A;  1JJG A;  3VR5 A;  2EJG C;  3J7Y W;  3D4R A;  3H0G B;  1NSN S;  3S14 H;  1I6H H;  1WTP A;  1PH2 A;  1A8V A;  1SE3 A;  4FP5 D;  2A69 D;  3D0F A;  3I4L A;  4N8F A;  1U5K A;  3URY A;  4DV5 L;  3HOU B;  1JWM D;  1STE A;  1M1K C;  1B1Z A;  1DM0 B;  3IRB A;  2UUC L;  1ASZ A;  1IBM Q;  3H09 A;  3TBI B;  1EU3 A;  2EY1 A;  4B3R Q;  1IBK L;  4IUT A;  2A68 C;  1PTO D;  1MSH A;  1WI5 A;  1BKB A;  2B2Y A;  2WII B;  1VQJ A;  4QIW B;  4JI2 Q;  1IL2 A;  4DV3 L;  2BOS A;  3R93 A;  3HOY G;  5C0X J;  4DR1 Q;  1EUJ A;  3NQI A;  4YHH Q;  1TWC B;  3T1Y Q;  2E2J H;  5FLX E;  3I8Z A;  1WCM G;  3RN5 A;  5JJK A;  2DNE A;  3TSS A;  4EQP A;  1AZP A;  5CV9 A;  2R7Z H;  3CCR A;  3CF5 A;  4BXX H;  3A5U A;  3MFG A;  3CCL A;  3U4V A;  3C3L A;  4A3D B;  1LO5 D;  2BH8 A;  5E4X A;  4J6H A;  4B3M L;  2HCI A;  4XYO A;  3HS0 C;  4BY1 B;  4A3J H;  5C3E B;  3ULP A;  3T13 A;  3SHL A;  4A3I G;  3KYH C;  2L5T A;  1X3P A;  4C1N K;  4R8I A;  1EFW A;  3D31 A;  3FHW A;  4KHP L;  2VL6 A;  3I73 A;  5IY0 A;  4HIK A;  1N32 Q;  3CCM A;  4JVZ A;  2L4N A;  3K5O A;  1VQK A;  1SR3 A;  5EPJ A;  3PO2 G;  2ASB A;  3GTG B;  1LYL A;  4NXN Q;  4R4C A;  4GKJ Q;  5EJW A;  1F77 A;  1HJP A;  3R2I A;  2BDN A;  2J4X A;  4K6D A;  1JE5 A;  1IYJ B;  1HA5 A;  4QL5 A;  4NDX A;  2JK8 A;  1ZYR D;  4ALP A;  3I56 A;  1B4O A;  3M7N A;  3BG3 A;  4JI4 L;  1IW7 D;  2N49 A;  2BDO A;  4A3E H;  3KF6 B;  2R6G A;  1SRU A;  1K28 A;  1XNR L;  3I4M G;  5D3I B;  4CJ0 B;  2EY5 A;  5H1S E;  2YU9 H;  3LGJ A;  1E0B A;  2R7D A;  1ENA A;  1BR9 A;  1XPR A;  4DV6 Q;  4UDU C;  1CK1 A;  1D5X C;  1TT2 A;  1I94 L;  1GUN A;  2B63 H;  3TRZ A;  1DON A;  3PUZ A;  1F2L A;  5JJI A;  2JA8 H;  2WV6 D;  1Q81 C;  1HNX Q;  1F2M A;  4JI3 L;  4HJ9 A;  3TP8 A;  3MWY W;  4UPA A;  4RCN A;  3N6R A;  4MHE A;  4DR5 L;  4UP7 A;  2M9V A;  3KLW A;  5JVH 3;  4DR7 L;  5M3M B;  4YY3 Q;  1HUM A;  5IYB H;  4BS9 A;  3NTI A;  5JAV A;  1JC7 A;  2E2I B;  1F9S A;  2CH4 A;  4PQX A;  4AH6 A;  1I4G A;  1CHQ D;  5KGU A;  3J80 E;  1XPU A;  3SK5 A;  1G2T A;  2RQX A;  4F88 A;  2K52 A;  2X6G A;  3B6Y A;  2F0V A;  5IP9 G;  5A2Q L;  3Q22 A;  3M3Y H;  2CVR A;  2A1A A;  2D0O A;  3FDT A;  5GAG C;  4IFD G;  3J81 c;  4BBR G;  4K5V A;  4A3F B;  4IAL A;  1WTX A;  3S16 B;  3P75 A;  4CHT B;  2Z4H A;  2IT1 A;  1QIL A;  3KOJ A;  3I4N H;  2A5H A;  4QB4 A;  1XMQ L;  1QNK A;  4A3B H;  1WTH A;  1PA6 A;  2AUK A;  1IXR A;  1SNQ A;  1PVO A;  5C4X H;  5ELN A;  4ILW A;  1R9T B;  2FXQ A;  1LTG D;  1WTV A;  2OF1 A;  2Q2I A;  2TMP A;  4A3G B;  1WTR A;  2F3V A;  4DV7 Q;  2Q8T A;  3CMA A;  2Z0S A;  3FVQ A;  2ZM6 Q;  1PLF A;  1WD0 A;  1TY0 A;  3I7F A;  5ELC A;  3J7A 5;  1VQC A;  2JYO A;  1PHJ A;  3ERS X;  2F4I A;  1HZC A;  5EBC A;  3K5L A;  1VQ5 A;  4K0K Q;  4DN4 M;  1EOT A;  5GAE C;  1LT3 D;  1IKM A;  1BCP D;  3BJU A;  3SK6 A;  2Q2H A;  2JA7 H;  1FGU A;  3HOV B;  3CCE A;  1IZ6 A;  1HNW L;  4YIJ A;  3M9B A;  1GUO A;  1PRT B;  2K1B A;  4HJ5 A;  1PYB A;  1PDQ A;  2F3W A;  3CD6 A;  3S2D B;  2JE6 I;  1QVG A;  3I4O A;  4K2L A;  3BZC A;  5FKA C;  2RSO A;  1DCZ A;  2EYP A;  5EKK A;  1UUP A;  4EGV A;  3WOF A;  3A5Z B;  2ZJR A;  1VQ6 A;  1PZK D;  3VDY A;  1MJC A;  3T56 B;  4V19 0;  3Q0A A;  3L2P A;  4B08 A;  2L11 A;  2ENB A;  1QE6 A;  4JI0 Q;  3HOW H;  1AFP A;  4P2C B;  5IP7 G;  4LF7 L;  2R93 B;  2HD3 A;  1HPC A;  5M5W B;  1V1P A;  3CRK C;  4OO1 I;  2A73 B;  2NWG A;  1TWH H;  4K8J A;  4ZRZ A;  4CBV A;  1PMR A;  3CKI B;  1LAC A;  5GRO A;  3HOX G;  4JBW A;  2OCE A;  1CQV A;  4YCV A;  4U67 3;  3MXN B;  1SND A;  3E0J A;  3GO5 A;  4XT1 B;  4X64 Q;  1AE2 A;  1SYG A;  1BO0 A;  3GTQ B;  2K6A A;  3STB D;  1NNX A;  2DN8 A;  3FPP A;  4R4I A;  2G5D A;  5LMU Q;  1FL0 A;  4LFC Q;  3SGI A;  3K80 C;  2JXM B;  3CRL C;  1MHW C;  1ROD A;  1GUW A;  3EA6 A;  3EJI A;  2KEC A;  2E5L L;  3GP7 A;  3KBG A;  1SMY D;  2HCC A;  1I4R A;  4DAP A;  5M9O A;  5KNC A;  1AW7 A;  4XDX A;  1BF4 A;  1W6J A;  3F2U A;  1VQG A;  4ZUI A;  1Z47 A;  4JBM A;  3QB3 A;  4JV5 Q;  4BY7 B;  4G57 A;  4NXM L;  1B44 D;  1UE1 A;  5BR8 L;  3CW2 C;  3MXP A;  1MIU A;  3CQZ H;  3AEV A;  3CCQ A;  4LJZ C;  5C44 H;  4DV0 Q;  1UE6 A;  1A3V A;  4X3K A;  1F2Y A;  3ZJY C;  2PZU A;  1Y8O B;  1XWE A;  2RCF A;  4A76 A;  1T5X D;  2GVA A;  1JOR A;  5G3L D;  1GHJ A;  5I9P A;  1XYI A;  4JBK A;  5M5X B;  1TWF H;  2E2H H;  4FXD A;  2A6E D;  3TZD A;  2YTY A;  1ESF A;  1K8A C;  3K8A A;  1VQI A;  1HTP A;  1GHK A;  1EWC A;  1UWV A;  5J39 A;  2E2D C;  1NUC A;  1HHV A;  1DOL A;  2PNH A;  2WAQ B;  3OHX C;  1Y8P B;  4LAA A;  2EYH A;  4DAV A;  2B2V A;  3GTM B;  3WWV A;  1ILQ A;  1EYC A;  2K03 A;  5ELD A;  4C2M B;  2PQA B;  2NN6 I;  4GS3 A;  2D5D A;  4G7Z C;  3LWE A;  2QA4 A;  1O7I A;  2MJ8 A;  4PV1 C;  4OL7 A;  3U50 C;  1CHP D;  4BXX G;  1UNS A;  4P74 A;  2H5X A;  3G7L A;  2BE5 C;  3SK4 A;  4YCU A;  2NYZ D;  2JJQ A;  4JK1 C;  4A3J G;  2B2Y C;  4ULL A;  3TP7 A;  3EBE A;  1CQF A;  2AUJ D;  5ELB A;  2NVQ H;  5JEA G;  2PPB C;  4RGM A;  4BBS H;  2F0N A;  1U4P A;  2WB1 B;  4L5R C;  1J5E L;  1TQO A;  1Q8K A;  5E7N A;  3M4O H;  5IOD A;  1BVS A;  4N9P A;  1C8C A;  1STB A;  5LHY 1;  4DV1 Q;  1CSQ A;  4HR7 B;  1K8O A;  3TS0 A;  2ZXO A;  4OWT B;  2K01 A;  4OO1 H;  1RHP A;  5ELO A;  5EAY A;  5IWA Q;  2UUA Q;  3HOY B;  2EYL A;  4DR6 L;  1WVL A;  3GTP H;  4C3J H;  4KHZ A;  2DY7 A;  3H3V I;  3MZ5 A;  1WCM B;  4HJA A;  4A3K G;  1PH4 A;  5CV4 A;  2SNM A;  3J81 L;  2L0C A;  2NZ1 D;  1E3P A;  3L7Z C;  1E2Z A;  3GV6 A;  1EL0 A;  4Z9C B;  3HP3 A;  2IPK D;  4K6L A;  4O2D A;  2B8G A;  1TY2 A;  4A3I B;  2A6H D;  3QWN A;  4HED A;  4IPD A;  5IYC G;  1VQ7 A;  1Q8I A;  3U58 A;  3PUV A;  3FMC A;  2F0D A;  3KLR A;  1N34 L;  1EYG A;  4QQB X;  2XWJ B;  4R4O A;  1LLR D;  2K50 A;  4LFA L;  4B3S Q;  4FNF A;  1BBW A;  1TS3 A;  2PW7 A;  2EIF A;  1DYQ A;  1TWG H;  2AQ2 B;  2UUB Q;  1A62 A;  1EY8 A;  1RD9 D;  3MFY A;  1HA6 A;  5IYB G;  2UXD Q;  3BZK A;  4LF9 L;  2Y0S B;  4OON A;  5C4Z A;  4DA2 A;  4A3M H;  4IUU A;  1OTC A;  4FF2 A;  2F0G A;  3S1Q H;  3I4M B;  2UXB Q;  1I50 B;  3M7G A;  3HEJ A;  3W2D A;  1O78 A;  1HCZ A;  4GN4 B;  3VR2 A;  2F0J A;  3AQQ A;  1ENC A;  3GD7 A;  4QY7 A;  2WKD A;  1AEX A;  3E5S A;  3M4Q A;  5FO7 B;  1EQR A;  2EXZ A;  3GQB A;  1MI2 A;  3I4N G;  4JCV E;  3GTL B;  3IAY A;  1FNU A;  4A3B G;  2QDB A;  2UU9 L;  1T9H A;  3VYR A;  3PIO A;  5F2D A;  5C4X G;  3RUZ A;  4QMG A;  3VR3 A;  1IYU A;  3Q8D A;  4DNT B;  2MGS A;  1QJO A;  2ZJQ A;  2UXC Q;  3L0O A;  4CGY B;  4X66 Q;  2K5Q A;  5I4D A;  2GA4 B;  1M90 C;  3G6J B;  4IJL A;  1SNC A;  3QJY A;  1YHQ A;  2A8V A;  5M5Y H;  3C1F A;  2QKI C;  4GOP B;  1GUG A;  3H94 A;  4AQY Q;  2LKV A;  4MTN A;  1E2W A;  1N33 Q;  4A3C H;  4GKK Q;  5IYD H;  2K5V A;  3NWT A;  2R7F A;  4AYB B;  1D1K A;  1BBU A;  4R4Q A;  4BBR B;  2WAC A;  2VS1 A;  2F4V L;  1H9S B;  1GM5 A;  4GNX A;  3K7A B;  3NK9 A;  1KD1 C;  2EYM A;  3CCJ A;  4FDB A;  2NZH A;  1DGS A;  1G2S A;  4IO9 A;  1Z7T A;  4C3I G;  2I0Q A;  1HR0 W;  3T16 A;  1S5D D;  1ICF B;  4DV5 Q;  4KD4 A;  1KXL A;  4J1M A;  1S3O A;  4QGU A;  3K5N A;  2VUM G;  1IBK Q;  5C0X I;  1JB7 A;  3EFX D;  2DJG C;  2JA6 B;  3NEL A;  4OIK A;  2QF7 A;  3HOW G;  1I3Q B;  4DV3 Q;  1V8Q A;  4CJ1 B;  1VQA A;  1VQD A;  3NBI A;  1A0I A;  1TVX A;  2C9O A;  1K3R A;  1TWC H;  4KV6 A;  1C48 A;  2K5W A;  1X3F A;  1FVI A;  1JR0 D;  3I2Z A;  2YTX A;  2NVT B;  4TVA B;  4LW1 A;  3ER0 A;  4MIU A;  4C3H G;  1HNZ L;  4LUO A;  4A3D H;  2RSN A;  2JEB I;  4BY1 H;  1Q7Y C;  1O7L A;  1Y14 B;  1B3A A;  4B3M Q;  5C6A A;  3MXU A;  2D62 A;  2F0Q A;  1PH6 A;  1EEI D;  5JPN C;  1STG A;  3J81 i;  4DR2 L;  3MA2 B;  1JE4 A;  2H1E A;  4KHP Q;  1D6E C;  2K28 A;  1JOQ A;  2KHS A;  3FEW X;  2LXJ A;  3D4W A;  3TRE A;  1SYC A;  4X62 L;  1LAB A;  5DAU A;  3GTG H;  4HMJ A;  1JQY D;  4JOI A;  2XN9 C;  4UHV A;  2JA5 G;  1KC8 C;  2VW9 A;  2B2U A;  2Z6K C;  2XVS A;  2EXD A;  3NE5 B;  1PZJ D;  3HKZ G;  5LMN W;  2X69 A;  3BVZ A;  3U4Z A;  2EYF A;  4IUP A;  1DZ1 A;  3PUY A;  3HOX B;  2LY7 A;  4RAU C;  3E9H A;  4JI4 Q;  3STB C;  1O7Y A;  2TSS A;  4LUV A;  5GAD C;  1XNR Q;  1VF5 C;  4JC0 A;  3NTK A;  4E6I A;  1U4R A;  4G7H C;  2F0S A;  3L9A X;  1E1O A;  1PRT F;  4DR3 L;  3S1R B;  1TU2 B;  2HDL A;  4JI7 L;  1QVF A;  1STY A;  2NVY B;  1G91 A;  1ICW A;  4OXP A;  3UI2 A;  3HOZ G;  3DLL A;  1HZ9 A;  2PMZ B;  4X65 Q;  4JI3 Q;  2KUM A;  1L0Y B;  4HCE A;  5M3M H;  4UP8 A;  4DR5 Q;  4DNR B;  4GN5 A;  2ID0 A;  4IJH A;  1S5B D;  1FNW A;  3OWE B;  1G6P A;  3F2B A;  2ZXP A;  2MP1 A;  3J7A V;  4BA2 I;  1YBY A;  2E2I H;  1TS2 A;  1YVC A;  3QIA A;  3PSI A;  3P20 A;  1X54 A;  3RD4 A;  4LF6 L;  4QUF A;  1TWA B;  1N36 L;  2O5J C;  1ET6 A;  3W1B A;  4ID6 A;  4EQN A;  4DR4 Q;  1U4M A;  4FXG C;  3E6Z X;  3DEO A;  5IGG A;  3NBH A;  3UDI A;  3S14 B;  1MJE A;  5FLM H;  5D3D A;  3PO3 G;  5COR A;  4DV4 L;  5C0X H;  2B2W C;  1JIC A;  3W1G A;  2EYO A;  2AWN A;  4WJ3 M;  4FO2 A;  3S16 H;  1GXD C;  4LMQ D;  2RDG A;  2FJ2 A;  4ME5 A;  4JI2 L;  2F0T A;  4IUQ A;  5CV5 A;  4DPG A;  1DOM A;  2F0F A;  4ZKC B;  1EY7 A;  3HKZ E;  1XMQ Q;  1YNJ D;  4OO1 G;  2CW0 D;  3CAM A;  2EJM A;  1R9T H;  1M8A A;  3PIO 3;  5C5L A;  4ABN A;  5C5M A;  3RMH A;  2KCC A;  1RIP A;  4C3J G;  4UAI A;  4B3T Q;  3DXJ C;  4A3G H;  1TR5 A;  1DD2 A;  1O7Z A;  2NUC A;  3KLS X;  4KK7 A;  1Q82 C;  3RNU A;  1LM0 A;  5IGC A;  4DK1 A;  1L0X B;  1YI2 A;  1IYV A;  4HSP A;  4CJ2 C;  5BN4 A;  2FFK B;  3E3X A;  2I5L X;  3IL8 A;  5M3F G;  4A93 G;  4A3J B;  2MQH A;  5EQ0 A;  1K0R A;  2IJ0 A;  2QIL A;  2XIW A;  4HJ8 A;  2PCF B;  1RCV D;  2MNA A;  2KCT A;  4KN4 C;  5I9O A;  1LT6 D;  2LS0 1;  1SE4 A;  1N32 L;  3AYH B;  3HOV H;  2IHE A;  2ATW A;  3SEB A;  2F0L A;  4G4K A;  1VDZ A;  4GN3 B;  2BA0 A;  4XTC S;  5IGF A;  1YJN A;  3G71 A;  1YHA A;  4GZY C;  2J0T D;  2CKZ B;  1HNW Q;  3S2D H;  2BA1 A;  1C9O A;  3OTO L;  1OO9 B;  3CXC A;  4MNO A;  1CKN A;  5DLQ E;  2F0I A;  5C4J H;  1WOC A;  3ZYY X;  5IOC A;  2ZXR A;  2OQK A;  1PH5 A;  4YWL A;  2CQO A;  1KHI A;  1QUQ A;  2LMC B;  1HRJ A;  4A3K B;  1Y1V H;  2JP1 A;  4Y7N B;  3NTH A;  4A3M G;  2AQ1 B;  1HH2 P;  3PMF A;  1K0S A;  4MN3 A;  5FO8 B;  3D6C A;  3S15 B;  3K81 C;  2R93 H;  4JPB W;  5M5W H;  4NP5 A;  5K36 H;  4LF7 Q;  2KHI A;  2V4D A;  2F0O A;  4JI8 L;  1KIX A;  3DEP A;  3JAM L;  1BNZ A;  1HNX L;  1RJT A;  3J81 j;  5D14 A;  4QCL A;  3GTQ H;  4CKB A;  5CV7 A;  1CSP A;  1YEZ A;  2I5M X;  3SXH A;  1HUN A;  2HHH L;  2NN6 G;  1QOH A;  4U68 A;  1YNN C;  1XPO A;  1WJJ A;  2EJF C;  2IX0 A;  1FNV A;  1A6X A;  1D1I A;  1STN A;  3G48 A;  1WD1 A;  1ML0 D;  3UDF A;  1SLJ A;  2L12 A;  4KMU C;  3M85 A;  3RLF A;  4JYA L;  3O13 A;  4XQN A;  1EOV A;  3RLN A;  4M1U B;  4ODG A;  2MUY A;  2E5L Q;  3A0J A;  3WDN A;  1BOS A;  2RVL A;  1EWH A;  3MXG A;  2F0E A;  2EYJ A;  4AIM A;  4BY7 H;  1KAB A;  1U4L A;  1S40 A;  4IOC A;  4A3C G;  2VNU D;  2C5C A;  4DXG A;  4NXM Q;  5IYD G;  1C7Y A;  4OX9 L;  3JC6 6;  1EZ6 A;  4PZ7 A;  2SEB D;  5BR8 Q;  2CH4 W;  4A3L H;  1QCB D;  1V9P A;  2B3G A;  1OXV A;  1Q1B A;  4GNX B;  4I65 A;  3S2H H;  2VB3 X;  2DUD A;  5JJL A;  2K4K A;  2MPM A;  2KVM A;  3DUZ A;  1X55 A;  2OTJ A;  3HRZ C;  1VQB A;  3GTJ B;  1CM9 A;  1HR0 L;  3W5O A;  5FJ8 H;  1A63 A;  3S17 B;  3BU2 A;  2XNA C;  3IFT A;  2A68 D;  2AMC B;  2OTL A;  4GNX C;  1ONL A;  1EEF D;  3DM3 A;  1BDO A;  4P75 A;  3ICE A;  2B8F A;  4HAE A;  3MAQ A;  1WTQ A;  1XNQ L;  1EYD A;  2XWB B;  3BDC A;  5TSS A;  1G6Z A;  4APV A;  3NSW A;  1Y1W B;  3Q24 A;  4A3D G;  1B3Q A;  3F8T A;  4PMB A;  3GTK H;  5C3X A;  4CDD C;  2YYZ A;  1Q3L A;  2FHT A;  4YWM A;  1PH7 A;  3F2C A;  1MSG A;  5EPK A;  4C3I B;  4LF8 Q;  1A3U A;  4DUZ L;  1CA5 A;  5ELE A;  2IWH A;  1J5E Q;  4H7B A;  4O1N A;  3H15 A;  3T4A C;  1VQL A;  1VMP A;  3NEN A;  4YWK A;  3KFU A;  2FMM A;  3SVM A;  4JI0 L;  2VUM B;  2R61 A;  4K5X A;  1AZQ A;  1YHB A;  1VQ9 A;  4IFD I;  3RZD H;  3HOY H;  3Q23 A;  3TZU A;  5CYU A;  1AP0 A;  4UY8 C;  1B70 B;  4V0B A;  4PG3 A;  3CC4 A;  1E7Z A;  1WCM H;  2PNR C;  4DR6 Q;  4KY6 A;  1SEB D;  5IIF A;  3A55 A;  1CKO A;  3OW7 A;  3ERO A;  3RZO B;  5I6W A;  1HQR D;  4C3H B;  5LMN L;  1W6K A;  4X64 L;  3CP0 A;  3SR1 A;  1PTO B;  5IT9 c;  1WTO A;  4RH6 A;  1J9O A;  4F87 A;  4HIM A;  2CWA A;  3A74 A;  2AKW B;  2R7Z G;  1MD2 D;  4A3I H;  3RN2 A;  2A69 C;  4QIW E;  4EQ5 A;  1JOK A;  2B2U C;  3CME A;  2D0P A;  1MBY A;  4K14 A;  2R92 H;  3D6W A;  3KK7 A;  3UE0 A;  1KDC A;  1SDF A;  3S1M B;  2ZTC A;  3BVM A;  1PTO C;  2K32 A;  1N34 Q;  1X3Q A;  1PFS A;  4LFA Q;  3CCS A;  2JA5 B;  3HKS A;  4JV5 L;  3PGZ A;  5T1G A;  2JN4 A;  4KJO A;  4LF4 L;  2GVB A;  5A2Q E;  1DOK A;  2WP8 J;  3OOC A;  3PQI A;  3CC7 A;  2QDL A;  4A4I A;  4GLX A;  3KJO A;  3KF6 A;  2EZV A;  4DV0 L;  5FO9 B;  2VQE L;  4DAM A;  4S3S A;  3K57 A;  3EVQ A;  4IFD J;  2XRS D;  4NKL A;  3I4M H;  1D5Z C;  1AH9 A;  1S5C D;  4B9W A;  5FLM G;  1Y69 U;  3A8I E;  3BDO A;  2IW3 A;  1D8L A;  3GDE A;  5C0X G;  1EY4 A;  4A3E G;  5JPM C;  2F0W A;  3D4D A;  5HGQ A;  5DEH A;  3PUX A;  3GTL H;  4CDC C;  4FVM A;  1X3G A;  4R9W A;  1BBX C;  5FLX L;  5L37 A;  3ONA B;  3GTO B;  3HOZ B;  4B9X A;  2E76 C;  3T53 B;  2B63 G;  3S9W A;  5GQO A;  2UU9 Q;  2JA8 G;  1R4P B;  4R4T A;  2SDF A;  3PO2 B;  1EY6 A;  1KL9 A;  1SXT A;  2AHO B;  4RG1 A;  2EY6 A;  3NXW A;  1ZYR C;  3A7L A;  1UEA B;  3NQT A;  2KJX A;  1UE5 A;  4LF5 Q;  4JI6 L;  1IW7 C;  2DY8 A;  4DUY L;  1H9M A;  1VQ8 A;  1XMO L;  4LK1 C;  2H4O A;  1L2F A;  1OXU A;  4DK0 A;  1ET9 A;  3PO3 B;  4JG2 A;  1H9J A;  5IGD A;  1G29 1;  2BCO A;  4IFD H;  3H91 A;  4XQQ A;  4BBR H;  3FKI H;  4IPH A;  3HOV G;  4DAY A;  3DWQ A;  1Y8N B;  3CPF A;  4ZYS A;  1T5E A;  3K7A H;  1ENF A;  3V05 A;  1NTG A;  5IE8 A;  1HFN A;  5IWA L;  2ZJP A;  1HFG A;  1I4X A;  1B9M A;  3OIQ A;  4J8Q A;  3V2T A;  4DGZ A;  3A8K E;  2MO1 A;  3OSO A;  4DK3 C;  4XQJ A;  4XYQ A;  4C3J B;  2F03 A;  1S5F D;  4RKB A;  5JVG 3;  2OWO A;  2F0M A;  4KY5 A;  3QOL A;  1IKL A;  1A2U A;  1Y1V G;  1JJ2 A;  2OEO A;  1IBL L;  2JA6 H;  2CHB D;  2L15 A;  1I3Q H;  1K83 H;  1XTC D;  2F0P A;  5EKL A;  3VR4 A;  1UAP A;  1WTW A;  1LV9 A;  5M3F B;  4A93 B;  1PRT D;  3J7A F;  1Q46 A;  2R93 G;  3TEH B;  1I6V C;  2YTV A;  1TXY A;  3NPP A;  5K36 G;  2NVT H;  1BXT A;  2PI2 A;  2KED A;  3T1H Q;  4LNQ A;  4KN7 C;  4B3S L;  2L9H A;  5T1I A;  2HIV A;  1SRO A;  2O2L D;  5K5P A;  2XTI A;  4DF7 A;  1NR2 A;  1U0L A;  1R4Q B;  4KKU A;  5EBD A;  1TKW B;  5FK9 C;  2UUB L;  2JA7 G;  4EVO A;  3HGB A;  4HID A;  2KEN A;  3H0G H;  4DR2 Q;  1D2B A;  4RKL A;  3J80 L;  1JT8 A;  2G9D A;  2G9H D;  1EY0 A;  3BYT B;  2PYK A;  1KLG D;  1B9N A;  4DXF A;  3HOU H;  1NAP A;  1BCP B;  1DXM A;  1EZ8 A;  2VQF L;  1KDA A;  1Q86 C;  3HG9 A;  3L3O C;  1X3E A;  3JAM c;  1NY4 A;  2UUC Q;  1S5E D;  3S1Q B;  1ZXT A;  4JI1 L;  1X9N A;  3M4Y A;  1CZW A;  1SFO B;  4L5Q A;  4PNY A;  3MXN A;  2PI2 E;  2Z8L A;  5CV8 A;  3MC0 B;  5CMD A;  1BCP C;  3M4P A;  4A3L G;  4IUV A;  3BS1 A;  1PV4 A;  4DV2 L;  3CPW A;  2P5Z X;  4IZ8 A;  3SK8 A;  2Z6B A;  1D5M C;  3ITP A;  1PFM A;  3I90 A;  1V1P B;  3OIP A;  4JI5 L;  5DNF A;  1KRT A;  3OPO A;  4QJF A;  5C3E H;  2M2L A;  3S1R H;  1KRS A;  1P8L A;  1NMG A;  1W3S A;  5EGT A;  1GKH A;  2NVY H;  1E24 A;  1B53 A;  4JI7 Q;  4FXK C;  2CCZ A;  2QW7 A;  1F9R A;  4LWC A;  3R3O A;  5I6Y A;  1QVC A;  5IT9 L;  4KTA A;  4AQY L;  3AB9 A;  4CDF C;  1C4Q A;  2ALY B;  4EX5 A;  1N8R C;  4KD3 A;  1FJG L;  3PF4 A;  1QWY A;  1PXU A;  5AJ3 L;  1PYW D;  1L1O A;  3I72 A;  2K04 A;  5JEA J;  1LTI D;  1GOZ A;  1TWA H;  4ZCK A;  3CU7 A;  4P71 A;  4LF6 Q;  2E8G A;  3CCV A;  1N36 Q;  3S1N B;  1VMC A;  2SNS A;  4J15 A;  2WB1 G;  3K0Y A;  2BE5 D;  5C44 G;  4IUN A;  5J1Z A;  4L6T B;  4DV4 Q;  4K8I A;  4Q0F A;  2RDF A;  4ME3 A;  2B2T A;  1SYD A;  3K7U C;  2D9U A;  4WJW A;  3TP6 A;  1F9Q A;  2L1B A;  3X3M A;  2F0U A;  3J81 E;  1DJR D;  2QEX A;  2KOL A;  4QF4 A;  4A75 A;  3H3V C;  1PFN A;  1SMY C;  2KQ3 A;  1N9W A;  2PQA A;  2WFW A;  3FP9 A;  2E74 C;  3DWP A;  4CKE A;  3KBX A;  1XTD A;  2RKS A;  1I94 Q;  2OQ0 A;  2EQS A;  5NUC A;  1SSO A;  4ZQ3 A;  1A15 A;  1RL2 A;  1VQH A;  4N8X 1;  4POF A;  2KA7 A;  1E1T A;  4IN3 A;  4DR7 Q;  1TS5 A;  2NVX B;  3K5M A;  1ZKO A;  4LFB L;  1MGS A;  2LFN A;  4PMC A;  1K9M C;  5JEA H;  1PH1 A;  2BH2 A;  1CA6 A;  1CUK A;  1SAP A;  3KF8 A;  4OIJ A;  1SMX A;  2WAQ E;  1OXT A;  1TS4 A;  2HIX A;  1BQQ T;  2R92 G;  2A6E C;  2ZTD A;  1AN8 A;  1I6H B;  1WFQ A;  4BBS G;  1WYD A;  1OXS C;  2B2V C;  1IBM L;  4TRD A;  2ICI A;  1Q1E A;  1PFB A;  4B3R L;  1E22 A;  4RMF A;  4A3F H;  1EIY B;  2MO0 A;  4H02 A;  3OTO Q;  1I5F A;  2IHF A;  2RF4 A;  1SYF A;  4OWW B;  1NBW A;  1KTK A;  3E0E A;  1JWU D;  4A3K H;  2Y0S G;  4DFA A;  4DR1 L;  4X3T A;  4OEL B;  4BWG B;  4YHH L;  3T1Y L;  1CKM A;  4Y7N H;  3VR6 A;  1XJV A;  2WB1 E;  5D65 A;  4DKA C;  1LTA D;  4HTH A;  2E2J B;  5A35 A;  3PCO B;  4WFN 3;  3OYY A;  3S15 H;  5IGB A;  4MTK A;  3J80 i;  2R7Z B;  3N52 A;  3E9I A;  5FOB B;  5IYC H;  2OT2 A;  4JI8 Q;  1SYB A;  1KAW A;  4XIG S;  2IX1 A;  2N78 A;  1I4H A;  3U9S A;  4F8M A;  5I2Y A;  4X65 L;  1PH8 A;  4UP9 A;  4WOR A;  1YNX A;  2KCM A;  1JB3 A;  4L5T A;  3OW2 A;  1SNO A;  2ZTE A;  4KKS A;  1EIF A;  4KHV A;  2B29 A;  4NMZ A;  4NB3 A;  2HHH Q;  4F7X A;  5KIX A;  3QO2 A;  3A8J E;  2LSS A;  2Q8R E;  2R3Z A;  4NXN L;  4GKJ L;  5LL6 S;  3LNN A;  1KDB A;  4HN7 A;  1O80 A;  4QUC A;  1Q12 A;  4JYA Q;  3U9O A;  4DR4 L;  1LTS D;  2K05 A;  3QG1 A;  1FR3 A;  1B2T A;  2MHV A;  1GO3 E;  4DNI A;  4L63 B;  2KEE A;  1KAA A;  1SYE A;  5FLX c;  2B39 A;  3KUP A;  2KHJ A;  3AFQ A;  4FF1 A;  4A3E B;  4AYB G;  2EY2 A;  2A6H C;  2N8N A;  4IOA A;  1PTO F;  3FKI G;  4OX9 Q;  3C46 A;  3DM1 A;  3TP5 A;  2OXP A;  1KNE A;  5CR3 A;  1BUV T;  2YU9 B;  1EQT A;  5C3W A;  4DV6 L;  1J6Q A;  1M4V A;  4G7O C;  2JQO A;  2GN5 A;  4OEM B;  4DAY B;  2Y0S E;  1ILP A;  5CBA E;  2QEJ C;  1X32 A;  4RHS A;  2B63 B;  4B3T L;  2N55 A;  4CDE C;  1HQM C;  3HZX A;  2JA8 B;  1K8M A;  5DM7 3;  1XXG A;  5CBE E;  3GTJ H;  1MKH A;  2EVB A;  4RGN A;  2LXK A;  4YY3 L;  3S17 H;  1JJC B;  1STA A;  3K0X A;  4GOP A;  3HFZ B;  1HR0 Q;  1II3 A;  4RWS C;  2JA6 G;  4X6A H;  1ESR A;  1I4P A;  2XRQ D;  2A19 A;  2VZA A;  3F1Z A;  4ZLT F;  2DNC A;  4PMW A;  1EQV A;  2DGY A;  5KYI A;  2PQE A;  1H9S A;  2Q2T A;  5BN3 A;  1D7Q A;  3P7J A;  4ZKB B;  2K5H A;  1Y1W H;  5IT9 E;  1XNQ Q;  1NR4 A;  4RGT A;  4OWX B;  1LUZ A;  4HIO A;  4TKO B;  4X3U A;  2EPB A;  1VQP A;  3M3Y B;  3VYU A;  3K6O A;  3G6E A;  3TQY A;  2N88 A;  1HZA A;  2IX3 A;  4C3I H;  4MZ9 A;  4HJ7 A;  3C2P A;  3TME A;  3VYS A;  4IQZ A;  3UDG A;  3NP8 A;  3I4N B;  4DUZ Q;  1EY5 A;  1X6O A;  5C4J B;  2VY3 A;  3FPU B;  3H0G G;  4A3B B;  3BYY B;  5KNB A;  2PO4 A;  2EE1 A;  1GJX A;  5E4W C;  3LX0 A;  2J7Z A;  5M5X H;  2VUM H;  5C4X B;  1Y1V B;  2E75 C;  5J3B A;  3HOU G;  1GUT A;  1PRT C;  4KJN A;  3J7Z C;  1SBB B;  4DV7 L;  4FYD A;  3EIV A;  4X3S A;  4AYB E;  2AQ3 B;  2ZM6 L;  1SNP A;  2WKC A;  3DMU A;  4ZUJ A;  1RDP D;  5E1F A;  1SJH D;  3X3N A;  1PH9 A;  3P1H A;  4POG A;  3RZO H;  1C0A A;  1SJE D;  3GTM H;  4L8J A;  4C3H H;  3I55 A;  1KNA A;  4K0K L;  4C2M H;  1PTO H;  1VQE A;  5LMN Q;  2Z6K A;  3KDF A;  4LUZ A;  3SE0 A;  3J80 c;  1CTM A;  1EY9 A;  1ZEQ X;  1YJ9 A;  4KLK A;  1G8Z D;  4NW2 A;  2JA7 B;  2ZT9 C;  5GAH C;  4OGQ C;  3IKJ A;  4BY1 G;  4P72 A;  5C3E G;  1J8I A;  3S1M H;  1EIG A;  3Q6S A;  1V1Q A;  2NBF A;  2RA4 A;  5JOB A;  4O0A A;  2JA5 H;  1FYC A;  3PV0 A;  1NCV A;  1RTN A;  3NHH A;  5CGK A;  3NUC A;  3LWU A;  4RHR A;  5AFW A;  1Z9F A;  1LTL A;  5EKI A;  4LF4 Q;  4HMI A;  1LT5 D;  4KY7 A;  1K8G A;  4K5W A;  1H9K A;  3HOW B;  2V1C C;  3NEM A;  4H13 C;  4N9T A;  1S4Z A;  1S72 A;  3ERQ A;  1QZH A;  3V96 A;  3D3R A;  5C4H A;  4WRD A;  2X6L A;  1L1O B;  2VQE Q;  1LTB D;  3AFP A;  1LTR D;  1TWH B;  5HY6 A;  1VQM A;  1KQS A;  1VQ4 A;  1EYA A;  3OMC A;  3S2H B;  2VB2 X;  1UEB A;  1VQO A;  1W2B A;  4HSV A;  3DWA A;  3TN2 A;  2RCN A;  4JOI C;  3PUW A;  5LMU L;  1L1O C;  4LFC L;  2AWO A;  1EIH A;  3GTO H;  3HOZ H;  4FF3 A;  3PF5 A;  4Q5V A;  1B50 A;  4BA1 I;  4GLA C;  1AE3 A;  2O4X A;  3I70 A;  1IHZ A;  2B2W A;  2JEA I;  2VXW A;  2JA9 A;  4KI0 A;  1HZB A; 
#chains in the Genus database with same CATH homology
 4K2K A;  1BCP F;  5DM6 3;  5KND A;  2B2T C;  1LT4 D;  2ICE C;  3GTK B;  3HKZ B;  1GUS A;  2IL8 A;  2L55 A;  3CQZ B;  5ISR A;  1FD7 D;  2F1M A;  2QCP X;  3KLS A;  3A7A B;  5C44 B;  4ZK9 B;  1HXY D;  3BDL A;  2Q8I B;  2M00 A;  3OWF A;  2I46 A;  5IGE A;  3H6M A;  4RCO A;  1TWF B;  1LTT D;  1STH A;  2E2H B;  3ND9 A;  2SOB A;  3RZD B;  2Z4I A;  1E2V A;  5I2X A;  4OHJ A;  4ZAI A;  3C1E A;  4XT3 B;  3D8G A;  2Z1C A;  3CHB D;  4TSS A;  4FF4 A;  3JAM E;  1OXX K;  2WIN B;  5KRU A;  4TQU S;  2O5I C;  2NTT A;  4M8A A;  1SNM A;  2NB0 A;  3IFD A;  3K58 A;  1RF2 D;  3TDQ A;  2D2C C;  2HQE A;  4C1N I;  2R92 B;  1RKN A;  1XX8 A;  2NVQ B;  1CFM A;  4BBS B;  2HUG A;  1CT1 D;  4KKT A;  3M4O B;  1YNJ C;  1HTL D;  2CW0 C;  4RA8 A;  1VCI A;  2EDG A;  2RDH A;  3A56 A;  1F2Z A;  2HDM A;  5JJZ A;  1YNN D;  5E3F A;  3DHQ A;  2PZT A;  1QG7 A;  3MTS A;  4R8N A;  5CC4 A;  4I7Z C;  3AMU A;  3GTP B;  3R2T A;  2FIN B;  5G3L F;  4H0L C;  3BVG A;  1RTO A;  1SE2 A;  1PZI D;  3EQL C;  5COY A;  5HGT A;  2RBM A;  4DU9 A;  2XSC A;  2A74 C;  5EPL A;  4HCS A;  1Z6H A;  2EOT A;  1I4Q A;  3VYT A;  1F9P A;  2NN6 H;  3MEH A;  3R8B A;  1V43 A;  1JCK B;  3OMG A;  1EU4 A;  5J22 A;  2K5D A;  4IUR A;  1A3T A;  3NWS A;  3ND8 A;  2F0K A;  5HUR A;  1Q90 A;  4C56 C;  4CKC A;  1TWG B;  2I07 B;  1TII D;  2K7V A;  5CV6 A;  2K33 A;  3QOJ A;  1IL8 A;  5BN5 A;  3MVV A;  4A3M B;  4RFB A;  4O42 A;  3FKI B;  4RGO S;  2CQA A;  3VA7 A;  2PZW A;  3T51 B;  1JOO A;  3K59 A;  1A2T A;  3I3C A;  4EQO A;  1CI3 M;  3W3A A;  3BZD B;  5ELF A;  4H44 C;  1QNU A;  2NTS A;  3I91 A;  2KCN A;  3MHB A;  2JSO A;  1K83 B;  3AU7 A;  3FRP B;  3VA5 A;  5LL6 X;  2FMC A;  1QB5 D;  2F0H A;  4XXE A;  1CZG A;  1VF7 A;  1H9R A;  1JWS D;  1EFI D;  1V1O A;  5M5Y B;  1FGB D;  3GV3 A;  3A54 A;  3SDZ A;  5KEE A;  1KLU D;  3WOE A;  5KYL A;  1U9R A;  3PIP 3;  2PW5 A;  3VR5 A;  2EJG C;  3J7Y W;  3D4R A;  3H0G B;  1NSN S;  1WTP A;  1SE3 A;  4FP5 D;  2A69 D;  3I4L A;  3URY A;  3HOU B;  1JWM D;  1STE A;  1B1Z A;  1DM0 B;  3H09 A;  3TBI B;  1EU3 A;  2EY1 A;  4IUT A;  2A68 C;  1PTO D;  1MSH A;  2B2Y A;  2WII B;  4QIW B;  2BOS A;  3R93 A;  5C0X J;  3NQI A;  1TWC B;  5FLX E;  3I8Z A;  2DNE A;  3TSS A;  4EQP A;  1AZP A;  5CV9 A;  3MFG A;  3C3L A;  4A3D B;  1LO5 D;  5E4X A;  4J6H A;  2HCI A;  4XYO A;  3HS0 C;  4BY1 B;  5C3E B;  3T13 A;  3SHL A;  2L5T A;  1X3P A;  4C1N K;  4R8I A;  3D31 A;  3I73 A;  2L4N A;  3K5O A;  5EPJ A;  3GTG B;  5EJW A;  1F77 A;  3R2I A;  2BDN A;  2J4X A;  4K6D A;  1HA5 A;  4NDX A;  1ZYR D;  1B4O A;  3M7N A;  3BG3 A;  1IW7 D;  2BDO A;  2R6G A;  5D3I B;  4CJ0 B;  2EY5 A;  1E0B A;  1ENA A;  1BR9 A;  4UDU C;  1CK1 A;  1D5X C;  1TT2 A;  1GUN A;  1DON A;  3PUZ A;  1F2L A;  2WV6 D;  1F2M A;  3TP8 A;  3MWY W;  4RCN A;  3N6R A;  4MHE A;  2M9V A;  5JVH 3;  5M3M B;  1HUM A;  4BS9 A;  3NTI A;  5JAV A;  1JC7 A;  2E2I B;  1F9S A;  4PQX A;  1I4G A;  1CHQ D;  5KGU A;  3J80 E;  3SK5 A;  1G2T A;  2RQX A;  4F88 A;  2X6G A;  5A2Q L;  2F0V A;  3Q22 A;  2CVR A;  3FDT A;  4IFD G;  4K5V A;  4A3F B;  4IAL A;  1WTX A;  3S16 B;  3P75 A;  4CHT B;  2Z4H A;  2IT1 A;  1QIL A;  2A5H A;  4QB4 A;  1QNK A;  2AUK A;  1SNQ A;  4ILW A;  1R9T B;  1LTG D;  1WTV A;  2OF1 A;  2TMP A;  4A3G B;  1WTR A;  2F3V A;  2Q8T A;  3FVQ A;  1PLF A;  1WD0 A;  1TY0 A;  5ELC A;  2JYO A;  2F4I A;  5EBC A;  3K5L A;  4DN4 M;  1EOT A;  1LT3 D;  1IKM A;  1BCP D;  3SK6 A;  3HOV B;  4YIJ A;  1GUO A;  1PRT B;  2K1B A;  1PDQ A;  2F3W A;  3S2D B;  2JE6 I;  4K2L A;  5FKA C;  2RSO A;  1DCZ A;  2EYP A;  5EKK A;  1UUP A;  4EGV A;  3WOF A;  1PZK D;  3T56 B;  4V19 0;  3Q0A A;  4B08 A;  2L11 A;  2ENB A;  1QE6 A;  1AFP A;  4P2C B;  2R93 B;  1HPC A;  5M5W B;  1V1P A;  3CRK C;  4OO1 I;  2A73 B;  2NWG A;  4K8J A;  4ZRZ A;  4CBV A;  1PMR A;  3CKI B;  1LAC A;  4JBW A;  1CQV A;  4U67 3;  1SND A;  3E0J A;  3GO5 A;  4XT1 B;  1SYG A;  1BO0 A;  3GTQ B;  2K6A A;  3FPP A;  2DN8 A;  2JXM B;  3CRL C;  1ROD A;  1GUW A;  3EA6 A;  3EJI A;  2KEC A;  3GP7 A;  3KBG A;  1SMY D;  2HCC A;  1I4R A;  4DAP A;  5M9O A;  5KNC A;  1AW7 A;  4XDX A;  1BF4 A;  1W6J A;  3F2U A;  4ZUI A;  1Z47 A;  3QB3 A;  4BY7 B;  4G57 A;  1B44 D;  3MXP A;  4LJZ C;  1A3V A;  4X3K A;  1F2Y A;  2PZU A;  1Y8O B;  1XWE A;  1T5X D;  1JOR A;  5G3L D;  1GHJ A;  5I9P A;  1XYI A;  5M5X B;  4FXD A;  2A6E D;  3TZD A;  1ESF A;  1HTP A;  1GHK A;  1EWC A;  5J39 A;  2E2D C;  1NUC A;  1HHV A;  1DOL A;  2WAQ B;  1Y8P B;  3OHX C;  4LAA A;  2EYH A;  4DAV A;  2B2V A;  3GTM B;  1ILQ A;  1EYC A;  2K03 A;  5ELD A;  4C2M B;  2NN6 I;  2D5D A;  4G7Z C;  3LWE A;  2MJ8 A;  4PV1 C;  4OL7 A;  1CHP D;  1UNS A;  3G7L A;  2BE5 C;  3SK4 A;  2NYZ D;  4JK1 C;  2B2Y C;  4ULL A;  3TP7 A;  1CQF A;  2AUJ D;  5ELB A;  5JEA G;  2PPB C;  4RGM A;  2F0N A;  1U4P A;  2WB1 B;  1TQO A;  5IOD A;  4N9P A;  1C8C A;  1STB A;  5LHY 1;  4HR7 B;  1K8O A;  2ZXO A;  2K01 A;  4OO1 H;  1RHP A;  3HOY B;  2EYL A;  1WVL A;  4KHZ A;  2DY7 A;  3MZ5 A;  1WCM B;  5CV4 A;  2SNM A;  3J81 L;  2L0C A;  2NZ1 D;  3L7Z C;  1E2Z A;  3GV6 A;  1EL0 A;  4Z9C B;  3HP3 A;  2IPK D;  4K6L A;  2B8G A;  1TY2 A;  4A3I B;  2A6H D;  3QWN A;  4HED A;  1Q8I A;  3PUV A;  3FMC A;  2F0D A;  3KLR A;  2XWJ B;  1LLR D;  4FNF A;  1TS3 A;  2PW7 A;  1DYQ A;  2AQ2 B;  1EY8 A;  1RD9 D;  3MFY A;  1HA6 A;  2Y0S B;  5C4Z A;  4DA2 A;  4IUU A;  4FF2 A;  2F0G A;  3I4M B;  1I50 B;  3M7G A;  3HEJ A;  3W2D A;  1O78 A;  1HCZ A;  3VR2 A;  2F0J A;  1ENC A;  3GD7 A;  2WKD A;  1AEX A;  3E5S A;  5FO7 B;  2EXZ A;  3GQB A;  1MI2 A;  3GTL B;  3IAY A;  1FNU A;  2QDB A;  3VYR A;  5F2D A;  3RUZ A;  4QMG A;  3VR3 A;  1IYU A;  4DNT B;  2MGS A;  1QJO A;  4CGY B;  2K5Q A;  5I4D A;  2GA4 B;  3G6J B;  1SNC A;  3QJY A;  3C1F A;  2QKI C;  1GUG A;  3H94 A;  2LKV A;  1E2W A;  3NWT A;  4AYB B;  1D1K A;  4BBR B;  2WAC A;  1H9S B;  3K7A B;  3NK9 A;  2EYM A;  1G2S A;  1Z7T A;  4C3I G;  3T16 A;  1S5D D;  4KD4 A;  4J1M A;  3K5N A;  5C0X I;  3EFX D;  2JA6 B;  4OIK A;  2QF7 A;  1I3Q B;  1V8Q A;  4CJ1 B;  3NBI A;  2C9O A;  1TVX A;  4KV6 A;  1C48 A;  2K5W A;  1JR0 D;  2NVT B;  4MIU A;  4C3H G;  2RSN A;  2JEB I;  1O7L A;  1B3A A;  5C6A A;  3MXU A;  2D62 A;  2F0Q A;  1EEI D;  5JPN C;  1STG A;  3MA2 B;  1JE4 A;  2H1E A;  1D6E C;  2K28 A;  1JOQ A;  2KHS A;  3FEW X;  3D4W A;  1SYC A;  1LAB A;  5DAU A;  4HMJ A;  1JQY D;  2XN9 C;  2B2U A;  2XVS A;  3NE5 B;  1PZJ D;  2X69 A;  3BVZ A;  2EYF A;  4IUP A;  1DZ1 A;  3PUY A;  3HOX B;  2LY7 A;  4RAU C;  1O7Y A;  2TSS A;  1VF5 C;  3NTK A;  4E6I A;  1U4R A;  4G7H C;  2F0S A;  3L9A X;  1PRT F;  3S1R B;  1TU2 B;  2HDL A;  1STY A;  2NVY B;  1G91 A;  1ICW A;  3UI2 A;  2PMZ B;  2KUM A;  1L0Y B;  4HCE A;  4DNR B;  2ID0 A;  1S5B D;  1FNW A;  3OWE B;  2ZXP A;  2MP1 A;  3J7A V;  4BA2 I;  1TS2 A;  3QIA A;  3P20 A;  3RD4 A;  4QUF A;  1TWA B;  2O5J C;  1ET6 A;  4ID6 A;  4EQN A;  1U4M A;  4FXG C;  3DEO A;  3E6Z X;  5IGG A;  3NBH A;  3S14 B;  5D3D A;  5COR A;  5C0X H;  2B2W C;  1JIC A;  2EYO A;  2AWN A;  4FO2 A;  1GXD C;  4LMQ D;  2RDG A;  2FJ2 A;  4ME5 A;  2F0T A;  4IUQ A;  5CV5 A;  1DOM A;  2F0F A;  4ZKC B;  1EY7 A;  1YNJ D;  4OO1 G;  2CW0 D;  2EJM A;  1M8A A;  3PIO 3;  5C5L A;  4ABN A;  5C5M A;  3RMH A;  2KCC A;  4C3J G;  4UAI A;  3DXJ C;  1TR5 A;  1DD2 A;  1O7Z A;  2NUC A;  3KLS X;  4KK7 A;  5IGC A;  4DK1 A;  1L0X B;  1IYV A;  4HSP A;  4CJ2 C;  5BN4 A;  2FFK B;  3IL8 A;  4A3J B;  5EQ0 A;  2IJ0 A;  2QIL A;  2XIW A;  2PCF B;  1RCV D;  4KN4 C;  5I9O A;  1LT6 D;  2LS0 1;  1SE4 A;  3SEB A;  2F0L A;  4G4K A;  1VDZ A;  2BA0 A;  4XTC S;  5IGF A;  4GZY C;  2J0T D;  2BA1 A;  1OO9 B;  2F0I A;  3ZYY X;  5IOC A;  2ZXR A;  2LMC B;  1HRJ A;  4A3K B;  2JP1 A;  4Y7N B;  3NTH A;  2AQ1 B;  3PMF A;  4MN3 A;  5FO8 B;  3D6C A;  3S15 B;  4NP5 A;  5K36 H;  2V4D A;  2F0O A;  3DEP A;  3JAM L;  1BNZ A;  1RJT A;  5D14 A;  4QCL A;  4CKB A;  5CV7 A;  3SXH A;  1HUN A;  2NN6 G;  1QOH A;  4U68 A;  1YNN C;  2EJF C;  2IX0 A;  1FNV A;  1A6X A;  1D1I A;  1STN A;  1WD1 A;  1ML0 D;  2L12 A;  4KMU C;  3M85 A;  3RLF A;  3O13 A;  4XQN A;  4M1U B;  4ODG A;  2MUY A;  3WDN A;  1BOS A;  2RVL A;  1EWH A;  3MXG A;  2F0E A;  2EYJ A;  1KAB A;  1U4L A;  2VNU D;  2C5C A;  4DXG A;  1EZ6 A;  2SEB D;  1QCB D;  1OXV A;  1Q1B A;  4I65 A;  2VB3 X;  2MPM A;  2KVM A;  3DUZ A;  3HRZ C;  3GTJ B;  1CM9 A;  3S17 B;  2XNA C;  3IFT A;  2A68 D;  1ONL A;  1EEF D;  1BDO A;  2B8F A;  4HAE A;  3MAQ A;  1WTQ A;  1EYD A;  2XWB B;  3BDC A;  5TSS A;  1G6Z A;  3NSW A;  1Y1W B;  3Q24 A;  4PMB A;  5C3X A;  2YYZ A;  1Q3L A;  2FHT A;  1MSG A;  5EPK A;  4C3I B;  1A3U A;  1CA5 A;  5ELE A;  2IWH A;  4H7B A;  4O1N A;  3T4A C;  1VMP A;  2FMM A;  3SVM A;  2VUM B;  2R61 A;  4K5X A;  1AZQ A;  4IFD I;  3Q23 A;  3TZU A;  5CYU A;  1AP0 A;  4V0B A;  2PNR C;  4KY6 A;  1SEB D;  5IIF A;  3A55 A;  3OW7 A;  3ERO A;  3RZO B;  5I6W A;  1HQR D;  4C3H B;  1W6K A;  3SR1 A;  1PTO B;  1WTO A;  4RH6 A;  1J9O A;  4F87 A;  1MD2 D;  2A69 C;  1JOK A;  2B2U C;  4K14 A;  1MBY A;  3D6W A;  3KK7 A;  1KDC A;  1SDF A;  3S1M B;  3BVM A;  1PTO C;  2K32 A;  1X3Q A;  2JA5 B;  5T1G A;  4KJO A;  5A2Q E;  1DOK A;  2WP8 J;  3OOC A;  2EZV A;  5FO9 B;  4S3S A;  3K57 A;  3EVQ A;  4IFD J;  2XRS D;  4NKL A;  1D5Z C;  1S5C D;  4B9W A;  1Y69 U;  3A8I E;  3BDO A;  2IW3 A;  5C0X G;  1EY4 A;  5JPM C;  2F0W A;  3D4D A;  5DEH A;  3PUX A;  4FVM A;  4R9W A;  1BBX C;  5FLX L;  3ONA B;  3GTO B;  3HOZ B;  4B9X A;  2E76 C;  3T53 B;  3S9W A;  1R4P B;  2SDF A;  3PO2 B;  1EY6 A;  1SXT A;  2EY6 A;  3NXW A;  1ZYR C;  3A7L A;  1UEA B;  3NQT A;  2KJX A;  1IW7 C;  2DY8 A;  1H9M A;  4LK1 C;  2H4O A;  1OXU A;  4DK0 A;  1ET9 A;  3PO3 B;  1H9J A;  5IGD A;  1G29 1;  2BCO A;  4IFD H;  3H91 A;  4XQQ A;  4DAY A;  3DWQ A;  1Y8N B;  4ZYS A;  1T5E A;  1ENF A;  3V05 A;  1HFN A;  1HFG A;  1I4X A;  1B9M A;  3OIQ A;  4J8Q A;  3V2T A;  4DGZ A;  3A8K E;  3OSO A;  4XQJ A;  4XYQ A;  4C3J B;  2F03 A;  1S5F D;  4RKB A;  5JVG 3;  2F0M A;  4KY5 A;  3QOL A;  1IKL A;  1A2U A;  2OEO A;  2CHB D;  1XTC D;  2F0P A;  5EKL A;  3VR4 A;  1UAP A;  1WTW A;  1LV9 A;  5M3F B;  4A93 B;  1PRT D;  3J7A F;  1I6V C;  3NPP A;  5K36 G;  1BXT A;  2KED A;  4KN7 C;  2L9H A;  5T1I A;  2O2L D;  5K5P A;  4DF7 A;  1NR2 A;  5FK9 C;  1R4Q B;  4KKU A;  5EBD A;  1TKW B;  4EVO A;  3HGB A;  1D2B A;  4RKL A;  3J80 L;  2G9D A;  2G9H D;  1EY0 A;  3BYT B;  2PYK A;  1KLG D;  1B9N A;  4DXF A;  1NAP A;  1BCP B;  1DXM A;  1EZ8 A;  1KDA A;  3HG9 A;  3L3O C;  1S5E D;  3S1Q B;  1ZXT A;  3M4Y A;  1CZW A;  1SFO B;  4PNY A;  3MXN A;  2Z8L A;  5CV8 A;  3MC0 B;  5CMD A;  1BCP C;  4IUV A;  3BS1 A;  4IZ8 A;  3SK8 A;  1D5M C;  3ITP A;  1PFM A;  3I90 A;  1V1P B;  3OIP A;  5DNF A;  3OPO A;  2M2L A;  5EGT A;  1B53 A;  4FXK C;  1F9R A;  3R3O A;  5I6Y A;  5IT9 L;  4KTA A;  3AB9 A;  1C4Q A;  4KD3 A;  1QWY A;  1PXU A;  1PYW D;  3I72 A;  2K04 A;  5JEA J;  1LTI D;  1GOZ A;  3CU7 A;  3S1N B;  1VMC A;  2SNS A;  3K0Y A;  2BE5 D;  4IUN A;  5J1Z A;  4L6T B;  4K8I A;  4Q0F A;  2RDF A;  2B2T A;  1SYD A;  3TP6 A;  2D9U A;  4WJW A;  1F9Q A;  2L1B A;  3X3M A;  2F0U A;  3J81 E;  1DJR D;  2KOL A;  4QF4 A;  3H3V C;  1PFN A;  1SMY C;  2KQ3 A;  2E74 C;  3DWP A;  4CKE A;  3KBX A;  2RKS A;  5NUC A;  1SSO A;  4ZQ3 A;  1A15 A;  2KA7 A;  4IN3 A;  1TS5 A;  2NVX B;  3K5M A;  1ZKO A;  1MGS A;  2LFN A;  4PMC A;  5JEA H;  1CA6 A;  1SAP A;  3KF8 A;  4OIJ A;  1OXT A;  1TS4 A;  1BQQ T;  2A6E C;  1AN8 A;  1I6H B;  1OXS C;  2B2V C;  4TRD A;  2ICI A;  1Q1E A;  1PFB A;  1SYF A;  1KTK A;  1JWU D;  4DFA A;  4X3T A;  4BWG B;  3VR6 A;  5D65 A;  1LTA D;  4HTH A;  2E2J B;  5A35 A;  4WFN 3;  5IGB A;  2R7Z B;  3N52 A;  5FOB B;  2OT2 A;  1SYB A;  4XIG S;  2IX1 A;  1I4H A;  3U9S A;  4F8M A;  5I2Y A;  4WOR A;  1JB3 A;  1SNO A;  4KKS A;  4KHV A;  4NMZ A;  4F7X A;  5KIX A;  3QO2 A;  3A8J E;  2Q8R E;  2R3Z A;  5LL6 S;  3LNN A;  1KDB A;  4HN7 A;  1O80 A;  4QUC A;  1Q12 A;  3U9O A;  1LTS D;  2K05 A;  3QG1 A;  1FR3 A;  1B2T A;  2MHV A;  4L63 B;  2KEE A;  1KAA A;  1SYE A;  2B39 A;  3KUP A;  4FF1 A;  4A3E B;  2EY2 A;  2A6H C;  1PTO F;  3C46 A;  3DM1 A;  3TP5 A;  2OXP A;  1KNE A;  5CR3 A;  1BUV T;  2YU9 B;  1EQT A;  5C3W A;  1M4V A;  4G7O C;  1ILP A;  5CBA E;  2QEJ C;  1X32 A;  4RHS A;  2B63 B;  2N55 A;  1HQM C;  3HZX A;  2JA8 B;  1K8M A;  5DM7 3;  1XXG A;  5CBE E;  2EVB A;  4RGN A;  1STA A;  1II3 A;  4RWS C;  1ESR A;  1I4P A;  2XRQ D;  4ZLT F;  2DNC A;  4PMW A;  1EQV A;  5KYI A;  2PQE A;  1H9S A;  5BN3 A;  3P7J A;  4ZKB B;  5IT9 E;  1NR4 A;  4RGT A;  4TKO B;  4X3U A;  2EPB A;  3M3Y B;  3VYU A;  3K6O A;  2N88 A;  2IX3 A;  3C2P A;  3TME A;  3VYS A;  4IQZ A;  3NP8 A;  3I4N B;  1EY5 A;  5C4J B;  3FPU B;  4A3B B;  3BYY B;  5KNB A;  2PO4 A;  2EE1 A;  1GJX A;  5E4W C;  3LX0 A;  2J7Z A;  5C4X B;  1Y1V B;  2E75 C;  1GUT A;  1PRT C;  4KJN A;  1SBB B;  4FYD A;  4X3S A;  2AQ3 B;  1SNP A;  2WKC A;  3DMU A;  4ZUJ A;  1RDP D;  5E1F A;  1SJH D;  3X3N A;  3P1H A;  1SJE D;  4L8J A;  1KNA A;  1PTO H;  3SE0 A;  1CTM A;  1EY9 A;  1ZEQ X;  1G8Z D;  4NW2 A;  2JA7 B;  2ZT9 C;  4OGQ C;  3IKJ A;  1J8I A;  1EIG A;  3Q6S A;  2NBF A;  2RA4 A;  5JOB A;  1FYC A;  3PV0 A;  1NCV A;  1RTN A;  3NHH A;  5CGK A;  3NUC A;  3LWU A;  4RHR A;  5AFW A;  5EKI A;  4HMI A;  1LT5 D;  4KY7 A;  4K5W A;  1H9K A;  3HOW B;  4H13 C;  4N9T A;  1S4Z A;  3ERQ A;  3V96 A;  3D3R A;  5C4H A;  4WRD A;  2X6L A;  1LTB D;  1LTR D;  1TWH B;  1EYA A;  3OMC A;  3S2H B;  2VB2 X;  4HSV A;  3DWA A;  3TN2 A;  3PUW A;  2AWO A;  1EIH A;  4FF3 A;  4Q5V A;  1B50 A;  4BA1 I;  2O4X A;  3I70 A;  1IHZ A;  2B2W A;  2JEA I;  2VXW A;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...