1EY9A

Structure of s. nuclease stabilizing quadruple mutant t41i/p117g/h124l/s128a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey9A00
4B9XA 1TQOA 5KRUA 4E6IA 3BDCA 1SNMA 2F3VA 4KY5A 2OF1A 4PMCA 3EJIA 3QOLA 3OMCA 4EQOA 2EYJA 2EY1A 4I65A 1JOOA 4NKLA 5KEEA 4LAAA 4F8MA 3EVQA 4KV6A 3VA5A 4DFAA 4HTHA 5EKLA 4K8JA 5CV8A 5IGDA 2EXZA 1EY7A 1SYCA 2PW7A 5IODA 2F0HA 1STBA 2RDFA 1KDCA 3D6CA 2SNMA 1NSNS 1STNA 4K14A 1TR5A 2EY5A 2F0VA 4PMBA 4RKBA 2EY6A 5CV4A 3TP6A 5J1ZA 5IGGA 4HMJA 5HGTA 4ID6A 5CV7A 3TP5A 4ZUJA 1JOQA 4IZ8A 1JORA 1F2MA 2F0MA 1KDAA 4K8IA 5JAVA 4EVOA 3HZXA 3SK6A 4B9WA 3SR1A 3S9WA 4IALA 5C6AA 5C3XA 2QDBA 4YIJA 1SNCA 5IOCA 1II3A 2EYPA 4QB4A 5DEHA 5EKKA 1SYGA 4N9TA 3MEHA 3ERQA 5F2DA 4DU9A 5IGFA 3D4WA 3SXHA 5KYLA 1A3UA 4EQPA 5KIXA 1KABA 1EY9A 3HEJA 4HMIA 1EQVA 1ENCA 3C1FA 4KJOA 1SYEA 4K6DA 1NUCA 3SK5A 4KJNA 4TRDA 3NXWA 1SYBA 1SNQA 1A2TA 1EY0A 2ENBA 3NUCA 3R3OA 4WRDA 3V2TA 5IGBA 5KYIA 2F0IA 3OWFA 4ZQ3A 5C3WA 5HURA 4ME5A 4K2LA 5NUCA 2WACA 5CV9A 2F0SA 1TT2A 1SNPA 1EYCA 4KD4A 1STGA 1SYDA 1STYA 2PQEA 2SNSA 4ODGA 5C4ZA 5I6YA 3D4DA 2F0QA 3U9OA 2HQEA 4QMGA 4H7BA 2PZWA 4KY7A 1EZ6A 2RBMA 4K5VA 3DHQA 3MZ5A 5DAUA 5JOBA 3TMEA 1RKNA 5CC4A 4NMZA 2NUCA 4J6HA 4OL7A 4R8NA 1EYDA 3SHLA 3SK8A 1AEXA 2F0DA 3DMUA 1A2UA 3MVVA 5IGEA 1KAAA 2SOBA 4NP5A 1F2ZA 3P75A 3NK9A 3NP8A 5I6WA 2F0EA 2RKSA 3EROA 3TP8A 4DF7A 5I9OA 5C5MA 4MIUA 4DGZA 3NQTA 2O4XA 4KY6A 3T16A 5ISRA 2PZUA 3QOJA 3QB3A 4RKLA 4S3SA 2KHSA 1SNDA 4WORA 5C4HA 5CGKA 4EQNA 1F2YA 5K5PA 1SNOA 3TP7A 1EYAA 3LX0A 2F0LA 2EYFA 2OXPA 2EYMA 3SK4A 5E1FA 3T13A 4NDXA 5IGCA 1JOKA 4KD3A 5CR3A 2F0NA 5J39A 2F0JA 3P1HA 2PW5A 2EYHA 3NHHA 5E3FA 5C5LA 3C1EA 2LKVA 2EYLA 3MXPA 3RUZA 3H6MA 3PMFA 2PYKA 2F0TA 4N9PA 4F7XA 2F0WA 4IUNA 1EY5A 1IHZA 3E5SA 2PZTA 4K2KA 4K5XA 4KHVA 2F0OA 1EZ8A 1ENAA 5KGUA 4K5WA 5J22A 3BDLA 3MHBA 3ITPA 4G57A 2F3WA 2KQ3A 1EY6A 2F0KA 1STAA 4KTAA 2F0PA 4PNYA 1U9RA 2F0UA 5EGTA 2OEOA 5CV6A 4ZUIA 1KDBA 1STHA 3D8GA 4J1MA 2F0FA 5IIFA 4QF4A 3OMGA 1A3TA 2EYOA 2F0GA 1EY8A 2M00A 1SYFA 1EY4A 5M9OA 5I9PA 2EY2A 5CV5A 1A3VA 3OSOA
chains in the Genus database with same CATH superfamily
1HJPA 3FPUB 2JK8A 1XMOL 1EWHA 4JC0A 3K5LA 5FO8B 3OPOA 1JOOA 1LTSD 1VQGA 2XGTA 2D0PA 3VA5A 1SLJA 2C9OA 5M5WB 2Z1CA 3T51B 3T1YL 4RFBA 4YHHQ 3M3YB 3R2TA 5IGGA 1Y1VB 3I2ZA 4HMJA 3MWYW 3HOXG 1JOQA 4BY7B 1LT5D 3IFTA 1PVOA 3JAMc 4EVOA 3GTMH 2OT2A 4IALA 1GOZA 2B2VC 3CCUA 2CQOA 2RA4A 3I8ZA 1VQKA 3EQLC 1I50B 3HEJA 4JOIC 2ZJPA 4A75A 2IW3A 4JVZA 1GUNA 1E2WA 4KJNA 1NNXA 4TQUS 2J0TD 3E3XA 4UHVA 1RDPD 1CA5A 4A3DB 5FLXE 3D4DA 5A2QL 4IURA 2JA8G 1E1TA 4WJWA 1WTHA 4EQ5A 4A3BH 4OL7A 2RCFA 5BN3A 1CUKA 2NVYB 3OYYA 4C56C 4CDEC 4ZAIA 4OWTB 4FXDA 3J7A5 3TP8A 5CORA 2N49A 1ICFB 1B8AA 4MTNA 4A3MG 1V1OA 5JJIA 1X32A 3M4OH 4GOPC 2N55A 1EYAA 3T13A 2EYMA 2K1BA 1V1PB 3EBEA 4JI2L 1E0BA 1TWCH 1LTAD 2QDLA 3FEWX 4Z9CB 2VQEQ 2KUMA 2NVQB 2XN9C 4KKTA 4X62L 2UUCL 3KLRA 3CPWA 3CCVA 3D4RA 4K0KL 1K83B 1S4ZA 1SEBD 1YJWA 1DOMA 3STBD 4BA2I 1LT6D 3CU7A 1STAA 4KTAA 3HOWB 3HG9A 1VQBA 4UP8A 4A3IG 1KDBA 4RGNA 5EJWA 1M4VA 1J5EL 4QIWE 2XNAC 1U4MA 3VYTA 3KF8B 1Y8OB 1VQOA 4APVA 2Z4IA 1Y1WG 1YHBA 2OF1A 1WTRA 4EQOA 4R4CA 1K73C 3RMHA 5IYDH 4YCVA 2K04A 3CRLC 3J7ZC 3DWAA 4AQYL 1XMQQ 5LMNL 3DXJC 1Q1EA 5JVH3 2EY5A 2DGYA 1PXUA 1U4LA 3K0YA 4CKBA 4KI0A 3AYHB 2B63H 2DY7A 5E4WC 1SMXA 2IX3A 1VQAA 1L1OB 3GTOB 1EQQA 2R7ZB 4LUOA 4X66Q 2Q8IB 3I4OA 2JEAI 4JBWA 3ERQA 1R4PB 5FO9B 1XYIA 1JCKB 2HQLA 1EY9A 1QILA 2EOTA 5C4JH 1X6OA 1BBWA 5IGBA 3K81C 4QIWB 4UY8C 2EPBA 4ZQ3A 1XPOA 4BY1G 4RGOS 2R93G 4X3UA 5FLXc 1TT2A 2O5IC 3M9BA 2ASBA 2Z6KC 3X3NA 5GAHC 2L11A 1VQ8A 3STBC 1I6HB 5AFWA 1B70B 1H9KA 3KBGA 2X6LA 4KY7A 4CGYB 3S17B 1PTOD 1IBKQ 2L9HA 3QWNA 2XIWA 4CDFC 1I4GA 3SHLA 1VQ4A 1A2UA 1F2ZA 1TVXA 5I6WA 4DR6Q 5M5YB 1PTOB 5C5MA 4DGZA 1XPUA 3UDXA 1Y1VH 4LFBQ 4WORA 3S24A 4KN7C 3F8TA 2LY7A 1WVLA 3GTMB 1CHPD 5IGCA 4KD3A 2O2LD 4QJFA 5C5LA 4BWGB 5LMNQ 1S40A 4XT3B 4RA8A 5I2YA 3QG1A 2PZTA 2Z6BA 1AE2A 3TS0A 1PDQA 1STEA 1X3GA 5J22A 1I3QH 1BCPF 4C1NK 1QUQB 1OTCA 3A8JE 2GVBA 5LMNW 3G48A 4BA1I 4IFDI 1O7ZA 3JAML 2ZT9C 4WJ4A 1SXTA 2EJFC 4NXNL 1RHPA 4XDXA 4KY5A 1FNVA 2YTVA 2K6AA 4H44C 3NENA 4BXXH 5C44H 3MXNB 5KNDA 3TN2A 3NSWA 4DV2Q 2RDFA 1FL0A 1FNUA 3TZUA 3GTGH 2ZM6L 4CJ1B 5HGTA 3TP5A 2NN6H 4YWKA 3K7AB 4DR2Q 1D6EC 3DEOA 4O0AA 1F2MA 1KDAA 3H09A 3D6WA 3SK6A 3HP3A 3HKZG 3NWSA 2Q2TA 5C3XA 1UAPA 2NVQH 4GN4B 5IP9G 4EGVA 4DR6L 1YBYA 4DR3Q 4R4TA 1QNUA 4XQJA 1HFNA 5F2DA 4DAVA 1FYCA 1KNEA 2JQOA 3E0JA 1Q7YC 4CDDC 1EQVA 4YWLA 2VUMH 3R3OA 1J9OA 5KYIA 4OO1H 3KLSA 1LTID 2HUGA 4JI0Q 3EFXD 1HUNA 1SNPA 2EXDA 2KJXA 2SNSA 4JI4Q 3PO2B 1LV9A 4X64Q 1SAPA 3E6ZX 3OTOQ 2JA6G 3UDIA 4DV1Q 2HT1A 3KUPA 1X55A 5EAYA 2A6ED 2EJGC 1E7ZA 1S5ED 2JXMB 2ALYB 1QVGA 3DWPA 1AFPA 3NK9A 4B3RL 1TWGH 4K0KQ 1A15A 3NQTA 2B39A 1T9HA 2K75A 4YCUA 3HOZG 1JB3A 3QOJA 1HNWL 3NTIA 4EQNA 4P73A 4MN3A 2ID0A 2J4XA 4IQZA 1QUQA 3MXGA 4KLKA 1ESFA 2B2VA 3CMEA 1N34L 3PMFA 2PYKA 2K01A 2QCPX 4IUNA 4UP9A 4IOAA 1ML0D 1ENAA 3Q0AA 4G57A 2F3WA 3PGZA 2R92G 1A62A 2R7ZG 3J7YW 2IPKD 4A3JB 1K8GA 1VQ5A 5M3MB 3URYA 4QY7A 5IE8A 4R4OA 3S2DH 3OMGA 1SROA 2KHJA 3A56A 4OEMB 4DR1Q 2PI2A 1VF7A 3AMUA 5KRUA 3Q8DA 1X3PA 3VYUA 1SMYC 2EYJA 3W5OA 2JA7H 3S15B 2K50A 2K7VA 2RVLA 3EVQA 2UUAL 1EY7A 4HEDA 1EIYB 3C3LA 1QVCA 1OO9B 2SNMA 3ND9A 3OTOL 4PMBA 1I94Q 3U9SA 4JI1Q 2B8FA 2JJQA 5EPJA 3V96A 2VZAA 1UNSA 4OO1I 4LNQA 3S14H 1SE3A 1L1OC 1EFID 4B3RQ 2QGQA 1IW7C 1U4PA 4DU9A 4X64L 4HSVA 3ZYYX 2F4IA 1I4RA 1RCVD 4KJOA 4C3HH 2LXKA 3AFPA 3OWEB 4LK1C 1B44D 1ENFA 1WJJA 5HURA 2A5HA 1D7QA 3M4PA 1LT4D 1STYA 3GTLH 1PRTC 3I4NH 4OGQC 1E24A 1OXTA 2UU9Q 1KTKA 1OXXK 1KC8C 1K3RA 2WP8J 3S1RB 4IUVA 4CKCA 4C3IH 3MVVA 2KCMA 1Z6HA 2JA8B 5C0XH 3BVZA 5LL6X 4GLAC 1XJVA 3T4AC 3HOUH 3OOCA 5K36G 1LTLA 2E74C 2KHSA 5C4HA 4CHTB 1F2YA 2PI2E 2KA7A 1XNRL 4OXPA 2OQKA 4Y7NB 2EYFA 4JG2A 4HR7B 1BBUA 4NDXA 5CR3A 5KNCA 4DV2L 3P1HA 5C3EH 2VQEL 5JJLA 2A69D 1DGSA 1HA5A 3ONAB 2MQHA 2BH8A 3A0JA 1Q1BA 1TWCB 2BE5D 2ES2A 2FHTA 3CMAA 3I72A 3S2HB 3BDLA 2D0OA 2CW0D 1BUVT 1RIPA 2XRSD 3KYHC 3OIPA 1X3QA 2VNUD 1UE7A 3HOXB 4LF9Q 1SRUA 1J5EQ 2AUKA 1SDFA 4A3KB 1A3TA 3PO2H 1QZHA 4PV1C 3HOVG 4DN4M 3R8BA 4E6IA 3BDCA 2F3VA 1G2SA 2B2UA 1DCZA 1K0RA 4JI5L 1PH4A 2PMZB 5JEAH 2A6EC 1PYWD 1K8AC 1VCIA 4P71A 5IODA 3CCSA 2HHHL 4FF1A 5CV4A 3U58A 1HNWQ 4IFDH 3FPPA 1F77A 3DEPA 3UDGA 2XTIA 3NBHA 1S5FD 3H91A 1ASZA 2K32A 4FXGC 3J81c 5C3EB 1N32L 2RF4A 3UE0A 4A3JG 1SSOA 4A76A 3RLOA 1VQDA 1KABA 1W6KA 4K6DA 3SK5A 4LJZC 1SJED 4AQYQ 4A3DH 4R1JA 2VY3A 2K5QA 2WFWA 4DR7L 2CVRA 1SFOB 4JI8L 1TIID 2N78A 4FP5D 3K5MA 5IYCG 1F2LA 2NVYH 4LF7L 4ME3A 3DUZA 4YWMA 3P7JA 2FJ2A 1K0SA 1E1OA 2B2WA 3UI2A 5DAUA 2A68C 1PFNA 5JJZA 2VS1A 2EVBA 1I6HH 3DMUA 3RZDH 5IT9c 1I4HA 3SGIA 1IBLL 1D8LA 2K14A 3Q22A 5CBEE 4HCEA 1BCPD 1JWUD 2FXQA 2RHQB 1I94L 4BY7H 3A74A 4DAMA 1O7YA 3HOVH 1B1ZA 4R4IA 4WJ3M 2UUAQ 1C0AA 3PO2G 1UWVA 5IYBH 1SR3A 1U0LA 2I46A 2ZTEA 3I70A 1U4RA 3C1EA 1I6VC 5I2XA 3I56A 5LMUQ 4RHRA 4OO1G 3E0EA 2F0WA 1GUOA 1HZ9A 1VQHA 4L5SA 3CW2C 3KF8A 4Q0FA 4K5WA 4JI3Q 2XWJB 1NR2A 4LFAL 3BVGA 4PNYA 5EGTA 1RL2A 4ZUIA 3AB9A 1HCZA 3CCLA 5C3EG 4U673 4HIOA 1YHQA 3RN2A 1VQ9A 2IX0A 4IPDA 3I4NB 2UXDL 3NTHA 1DD2A 4C3IB 4AH6A 1HTLD 1WD1A 3ERSX 4NKLA 4RMFA 4HJ5A 1EQTA 2CHBD 3CQZH 5CV8A 4BXXG 1PH8A 1SYCA 1KDCA 1YIJA 2B2TC 2FINB 1STNA 4K14A 5IIFA 4A3GH 2AWNA 1F9QA 1S72A 5CV7A 2VQFL 3VA7A 2UXCL 1MD2D 1TKWB 2SEBD 4ZRZA 2P5ZX 4DV6Q 1BBXC 1K3BC 4M8AA 2K52A 2VB2X 3PUWA 1V8QA 1W6JA 5IGFA 3D4WA 4HJ8A 1ONLA 4ZKCB 1XMQL 1P8LA 2M9VA 2TSSA 1F9RA 5C0XI 1SNQA 2I07B 2NZOA 4DV3Q 3OWFA 2DUDA 3RZOB 2JA5H 1TS5A 4DR2L 3PIO3 2ATWA 4QUCA 4DKAC 3I3CA 4DR5Q 1CTMA 4H7BA 3TSSA 5C44B 2EZVA 4LMQD 4V0BA 5C0XJ 5FJ8G 1GKHA 4X65L 1CKMA 1FR3A 3K5OA 3JAME 5JVG3 3PO3H 4KY6A 2JA7G 4HIMA 4RKLA 1XMOQ 4GOPB 3VR5A 2NVTB 4P2CB 5M5XB 4LF4Q 4GS3A 5C4XB 4MTKA 2PO4A 2JE6I 2Y0SG 1C4QA 1AN8A 3NHHA 3H3VH 2G5DA 2X69A 4ABNA 1VQEA 2PQAB 3VYSA 3GTOH 2F52A 3QJYA 4A93H 1JQYD 2PQAA 1O80A 3VYRA 3DM1A 4H13C 4A93G 2UXDQ 4TKOB 4R4QA 2MPMA 1B9MA 1EIFA 2NBFA 2ZXRA 4BBRG 3G7LA 1A6XA 1G8ZD 5J3BA 1HQMC 3GO5A 1GUWA 2OCEA 3PQIA 2DN8A 1IYJB 2HDLA 2NVXH 1UE5A 4IFDG 4PMCA 4JYAL 3A5UA 2AWOA 3CCQA 4ZCKA 1PHJA 1BVSA 4DUYQ 3I73A 5FK9C 1HR0L 1I4QA 2VL6A 2BCOA 1XWEA 4GNXC 1QB5D 4H02A 3EN2A 2F0VA 1JR0D 3ICEA 1E3PA 2NTTA 1Y1WB 1X3FA 4CDCC 2BH2A 4LUVA 2E5LQ 3CHBD 4A4IA 3FVQA 1IXRA 4JW0A 5E7NA 1II3A 5DEHA 4O42A 5LMUL 5BR8L 2QA4A 3FRPB 1TWFB 2ZXOA 2R7FA 5IY0A 5M3MG 5M3MH 2F03A 1CT1D 4GLVB 2N3SA 2IY5B 1H9SA 3MXNA 4U68A 1SN8A 1ZYRC 3G6EA 2A1AA 4POFA 3GTJH 1SYEA 4LFAQ 3TZDA 2Z8LA 4FYDA 4DNTB 2E2IB 2X6GA 3GV3A 4G7OC 4GKKL 4WFN3 2F0SA 1Q8KA 2B2TA 3M7GA 2C5CA 3MXUA 2A6HD 4PG3A 3S1RH 2PZWA 1L2FA 1RTNA 2L0CA 3ND8A 4OELB 3GTQB 5C44G 1I5FA 1M1KC 3NP8A 2DNCA 3MC0B 3T16A 5ISRA 1Y8PB 5D3IB 3G4SA 1CHQD 5E1FA 3J81i 2MFIA 1PH5A 3L3OC 2JA6B 2HCIA 3H94A 3MFGA 4A3DG 3KDFB 2PW5A 4ALPA 1MHWC 4HAEA 3A8KE 5LL6S 2R7ZH 2EE1A 2NYZD 4KHZA 4JPBW 1CSQA 2BDOA 4RWSC 1EY5A 1IHZA 4A3JH 4MNOA 5ELDA 2B2YA 4DXFA 1HZCA 2Q2UA 2HIXA 2QEXA 1QWYA 3S1NH 2AHOB 1WTVA 2F0UA 1VQNA 4FF2A 2K05A 4GOPA 1DONA 4IJHA 4G7ZC 2LFNA 2UUBQ 3PUVA 1EY8A 3GV6A 1GVPA 4B9XA 3PCOB 4M1UB 4BY7G 3CQZB 1X56A 3SVMA 2ZTDA 3EJIA 1Y1VG 3CKIB 5A2QE 1EWIA 1UUPA 2K5NA 4RHSA 4F8MA 4DV7L 1BO0A 5D14A 3S17H 3U50C 3U4ZA 2Z0SA 2I5MX 2A6HC 3MEFA 2NVTH 1KAWA 2EY6A 4Q5VA 2WAQE 1O7LA 1WD0A 1MBYA 4X65Q 1EEID 4L63B 3S9WA 1EU4A 5IOCA 2VUMG 2V1CC 3I7FA 2CFMA 4IPCA 2L12A 4RAUC 1IBKL 2K5HA 1YNXA 3BYTB 1XTDA 1Q8IA 1SMYD 1V43A 1Q82C 2OQ0A 3ZJYC 2WAQB 5KYLA 4LF6Q 1VQLA 4DK6C 5IT9E 3H3VI 1TWFH 4IUUA 3K6OA 1DOLA 3Q24A 1FJGL 4DK3C 3S1NB 2D2CC 1KXLA 5C3WA 2H1EA 1Z47A 4IN3A 1PRTD 5K36H 1LYLA 2AQ1B 1IYVA 4A3GG 2XRQD 1S5CD 4XT1B 4AIMA 1TWHB 2HQEA 3GTKH 4QMGA 4A3CH 1EZ6A 1FGUA 1MSHA 4NPSA 3MZ5A 1EU3A 2JSOA 5JOBA 5AJ3Q 3NQIA 4OWWB 4NMZA 1PH7A 3GTLB 1M90C 4DV4L 3SK8A 1IW7D 1B4OA 3SDZA 5JEAG 2Z6KA 3OIQA 5M5XH 2MNAA 1EL0A 2E2DC 1D5ZC 1JJCB 3IAYA 4IUPA 3QB3A 1JMCA 1SNDA 1GUSA 3E9IA 1N33L 3K80C 4JI6L 2KEDA 2L5TA 4L6TB 1BCPB 5E3FA 2EYHA 5ELFA 4FVMA 3CC2A 2EYLA 1DXMA 2ZJRA 2C35B 3S14B 1JWSD 2E75C 4CJ0B 1ET6A 1V1QA 4DPGA 1U5KA 5IWAL 3S16H 4PZ7A 4L5TA 1FD7D 5IYBG 1J6QA 3HOYB 1CZWA 2RDHA 4AYBB 1QG7A 2F4VL 1UE6A 5IP9H 1F9PA 4N8X1 4KMUC 5BN4A 4GKJQ 3ER0A 4IFDJ 1JWMD 2RQXA 4JI3L 3TDQA 3F1ZA 3NWTA 4UPAA 3HS0C 2OXPA 4DNRB 1QVFA 3S15H 3HKZE 2Z9HA 1M8AA 3SEBA 2XVSA 2KCNA 1FJGQ 5HY6A 4JI0L 4HTHA 4B3TL 2PW7A 3HOVB 5FOBB 4EX5A 1NMFA 4NW2A 5IYCH 1EEFD 3RN5A 3PUZA 3BJUA 1PH9A 3PV0A 4BY1H 4BBRH 5GROA 1HTPA 2QDBA 2JYOA 4DUZL 4OX9L 3A5ZB 1R9TB 1N8RC 1X54A 3GTJB 3H0GB 5C4JB 2KBNA 3QO2A 1Y8NB 3F2BA 3HKSA 3J81j 4ZK9B 1K8OA 2LMCB 4TRDA 1SYBA 2ENBA 1PH6A 4DV3L 5EQ0A 4ME5A 1N36L 1HXYD 5CYUA 3CCEA 1A8VA 2WACA 5FO7B 5I6YA 1IL2A 1JB7A 3HOZH 3PO3G 1FVIA 1SE8A 4A3BB 1LLRD 3TRZA 4GZYC 5FJ8H 2IHEA 1EYDA 1LT3D 2SOBA 4NP5A 3PIPA 4POGA 2F0EA 5I9OA 1G2TA 4XIGS 3TS2A 2JEBI 1MJEA 1S5BD 2Q8TA 1LO5D 2Q2IA 1GHJA 4G4KA 2GA4B 1TXYA 4NB3A 1IBML 3J80c 1X3EA 1AP0A 1PZJD 1PH1A 4A3IH 2R93H 4B3SL 4UAIA 1PLFA 1NJIC 3I91A 1ILPA 4FF3A 4K2KA 2WB1E 4K5XA 1AH9A 5COYA 3CC7A 2E2IH 2AMCB 1K83H 3S2HH 1EY6A 4ILWA 1HHVA 4GLXA 4LFCL 2R3ZA 4X62Q 1CK1A 1J8IA 4K6LA 2OEOA 2L1BA 3D8GA 3H3VC 3W1GA 4JV5Q 4JOIA 3CC4A 3S16B 2NN6G 1YITA 2QEJC 3HOYH 3KOJA 2ICEC 2NZ1D 5EPKA 3BS1A 2B63G 2EQSA 4BS9A 2G9HD 1GD7A 2NN6I 4C3IG 2JP1A 1CKOA 5KEEA 3TQYA 3V05A 2G9DA 5EKLA 3AQQA 3I4LA 2EXZA 2F0HA 3I4NG 3D6CA 3PF5A 5H1SE 1NSNS 4RKBA 1ILQA 3TP6A 4FO2A 5ELBA 1HFGA 5EBDA 2YU9H 1MKHA 4YY3Q 1RTOA 2E5LL 5C6AA 3AU7A 1Z7TA 4C3HG 3NEMA 5DNFA 3M4QA 1QOHA 2PCFB 3UDFA 5T1GA 3I4MH 3S1QB 4HIDA 4R8IA 3T1HL 1HR0Q 1SFOH 1L1OA 3KFUA 4LW1A 2A69C 1D1KA 1GUTA 2E8GA 1PH2A 4HCSA 1DM0B 3K0XA 3OW7A 2DJFC 5CV9A 4FXKC 3RNUA 2B2WC 1X9NA 4L8JA 2R61A 4MHEA 2QILA 3W2DA 4K5VA 3ULPA 4A3MH 3E9HA 4GKJL 3BG3A 4JI2Q 4IPGA 2JA7B 5BR8Q 1EOTA 1XXGA 1ET9A 4X6AH 1WTQA 1H9MA 4R9WA 1PTOH 1FGBD 5CGKA 3SK4A 4HJ7A 1KRTA 4KHPL 2OTJA 5TSSA 1OXVA 2R92H 4XXEA 3KJPA 4FF4A 2ICIA 3AFQA 4F7XA 4HJAA 3K59A 4YY3L 2RSNA 4DR7Q 4DK1A 2WAQG 1U9RA 1N34Q 2A8VA 5JEAJ 2UU9L 2UUBL 1TWHH 4L5RC 1PRTB 2IWHA 1Q3LA 2M00A 1JICA 2FFKB 3S1MH 3A7AB 4C3JB 5HGQA 1SNMA 3S1MB 2A19A 1WTOA 1SE2A 1WYDA 2EIFA 3VR6A 3M85A 4RCNA 1N36Q 3FKIB 1XNQL 1P16A 4B3MQ 3RZDB 4K8JA 2PMZE 2MP1A 2A74C 3EA6A 1RF2D 2H4OA 4NXMQ 2JA6H 2GN5A 2WB1B 2XWBB 4DA2A 1G6PA 1IKLA 4DR3L 1NTGA 3R2IA 2WIIB 1VQPA 1KQSA 5M3FH 3MAQA 3HZXA 4LF8Q 1HPCA 4XQQA 4YIJA 5M3FB 4KKSA 4LUZA 3F2CA 4RH6A 1LABA 1CZGA 1SYGA 2YTYA 4P75A 1I50H 4N8FA 3C46A 1CKNB 2DNEA 2B29A 1BOSA 1Q90A 3SXHA 1B53A 3SE0A 3HOWH 4HIKA 4UP7A 2HCCA 1NUCA 4LFCQ 1H9SB 4MZ9A 2Q8RE 3S2DB 1CFMA 2BDNA 1RJTA 1C7YA 2MJ8A 1CA6A 1GHKA 1SE4A 3BYYB 1EYGA 3HOUG 3U9OA 4YHHL 3CCRA 3GTPB 5C0XG 4B3SQ 3DHQA 1UEBA 5L37A 5IGEA 2F0DA 2CW0C 1KAAA 3KF6B 3M4OB 3P75A 2KCTA 1PTOC 3F2UA 1TWGB 4MIUA 2O4XA 5IYDG 4HSPA 4RG1A 3I55A 1CSPA 2PZUA 2B3GA 1F9SA 4S3SA 2VB3X 4JBJA 4DV5L 1Y1WH 5G3LF 4BY1B 1QJOA 1WOCA 3CPFA 4KK7A 1YNNC 1PV4A 1HRJA 1PTOF 1VQ6A 1MI2A 3E5SA 1XNRQ 1TY2A 1VQJA 4L5QA 5ELCA 3CD6A 3WOEA 3G71A 1H95A 4DXGA 1XPRA 3MFYA 2KQ3A 2N8NA 1D5XC 3RD4A 1AE3A 2Y0SE 4J1MA 1V1PA 2E2JH 4I7AA 3HOXH 4DR5L 4DR4L 1EY4A 2E2JB 3IL8A 5I9PA 4JI7L 3RR5A 1YHAA 1BKBA 2I0QA 3WDNA 2JA5B 4IPHA 1Q81C 4DFAA 3T56B 1ASYA 1H9RA 4BBSB 3L9AX 1BR9A 1T5XD 5E4XA 1D2BA 4OIJA 1HNXQ 3J80i 1H9JA 4ID6A 5IWAQ 1KIXA 4IZ8A 1Q46A 4A3FH 2YV5A 2CCZA 4FNFA 5JJKA 4B9WA 4A3FB 3K57A 1SNCA 4A3KG 2E2HH 4BBRB 4LF6L 2AQ2B 4XYQA 2HD3A 1WCMB 4KHPQ 3DWQA 1DJRD 1HA6A 1S5DD 1IKMA 1EIGA 1IL8A 1LTRD 1WTXA 2M2LA 2HDMA 1E22A 2R7DA 3RLNA 2MO0A 3V2TA 3NUCA 2KENA 4A3EB 2IX1A 1VDZA 3LWUA 4IJLA 2YTXA 4ODGA 1EYCA 1STGA 4V190 1MJCA 4C2MH 2RBMA 5M5WH 4DV0L 5CC4A 2NUCA 4DAYA 4H0LC 3DLLA 4JI8Q 1EUJA 1V9PA 2Z4HA 3PO3B 1K8MA 1LTBD 3HOUB 1UE1A 3PUXA 4JI7Q 1W2BA 1ESRA 4JYAQ 1KHIA 2IHFA 3O13A 4HJ9A 1HR0W 4YCWA 3B6YA 1B2TA 2F0JA 3RUZA 3H15A 1RD9D 1TS2A 2E2HB 4N9PA 5IT9L 1IBMQ 1B7YB 3H0GG 2L55A 5FKAC 1ZEQX 3HRZC 4F87A 3D3RA 3UE1A 1HZBA 1WCMG 1SBBB 1GXDC 4RGMA 4OWXB 5CV6A 1BQQT 4A3KH 2FMCA 1SJHD 1WFQA 4OONA 1ICWA 5GADC 3K58A 4A3FG 3BZCA 5ELNA 2MHVA 3NBIA 3PIOA 1GO3E 1QCBD 2EJMA 4P72A 2CH4W 2EY1A 3FKIG 3NBHB 1LUZA 4LAAA 1ZYRD 3M3YH 3W1BA 1YNJD 4C3JG 5IGDA 2V4DA 1K9MC 3GDEA 2K5VA 4XYOA 1Y69U 1C48A 4DV5Q 1NAPA 2CQAA 1N32Q 1HNZL 4GKKQ 4DUZQ 1VMPA 5G3LD 5JAVA 1R9TH 3D31A 4TVAB 2LXJA 4DNIA 1EQRA 3SR1A 4CBVA 1YNND 2OTLA 3QIAA 3CCMA 2VXWA 3A7LA 3Q23A 1NMGA 1IZ6A 1A3UA 4A3LG 4JK1C 5KIXA 4CKEA 3CRKC 4GNXA 3FP9A 2MGSA 3A55A 4IO9A 3KJOA 1I3QB 4J15A 1Y14B 1CKNA 4AYBE 4F88A 5C4ZA 2OWOA 2IL8A 4IUTA 2KECA 3TMEA 4DAPA 4X3KA 1PA6A 3C2PA 1JE4A 2D62A 2HIVA 3D0FA 4R8NA 4ZLTF 1JJGA 1AEXA 4C2MB 2JA9A 4XTCS 3EROA 4DF7A 2TMPA 3I90A 2KEEA 1VQCA 1KNAA 4RGTA 3PUYA 4X3TA 2ZTCA 3AEVA 2ZM6Q 2ZJQA 3MTSA 3JC66 4GN5A 4HN7A 1VQFA 4QL5A 1YNJC 1BCPC 3I4MB 1EIHA 2LKVA 5BN5A 3Q6SA 3R93A 1NY4A 1PFBA 2F0OA 1EZ8A 2NZHA 3N52A 2UUCQ 1L0XB 2CKZB 3ITPA 4C1NI 5EPLA 3ULLA 4ZYSA 1KL9A 1E2VA 2KOLA 2VW9A 5A35A 5CBAE 3GTKB 5I4DA 3FHWA 4ULLA 2EYOA 5M3FG 3HKZB 3L7ZC 5CV5A 1A3VA 3GTPH 2WV6D 1TQOA 3RZOH 4X66L 2K33A 5DM73 5FLMH 3QOLA 1EWCA 1NCVA 1AW7A 2BE5C 1AZPA 1ZXTA 2AKWB 2B63B 2IT1A 4CJ2C 1Q86C 4NXML 4PZ6A 3BU2A 1N33Q 4DV0Q 4G7HC 1JJ2A 1VQ7A 4JI6Q 3J80E 1I4PA 5J1ZA 1WTPA 4B08A 1N9WA 2JN4A 1PRTF 4A3IB 4DUYL 1Z9FA 2GVAA 1XX8A 1LACA 3VR3A 2NWGA 4LF8L 1UEAB 2YU9B 1WI5A 1YZ6A 2H5XA 4QB4A 2NB0A 2VQFQ 2D5DA 4IOCA 3N6RA 2PNRC 5AJ3L 1YI2A 5FLXL 3A54A 2YYZA 1HZAA 3CP0A 1MGSA 1KRSA 4HMIA 1O78A 4DV6L 4LF7Q 2O5JC 4B3ML 3A8IE 4FDBA 3NXWA 1XTCD 3IFDA 1A2TA 2K4KA 4QGUA 3VDYA 4LFBL 4WRDA 2F0IA 4LF5L 4JBKA 3T53B 1IBLQ 1TU2B 2I5LX 2DY8A 1SYDA 2PQEA 4A3MB 3VR2A 2WKCA 2NVXB 1R4QB 2F0QA 3GTQH 4LF9L 1PYSB 3M7NA 1GJXA 1DZ1A 4IUQA 3WOFA 4O1NA 2F4VQ 2F1MA 4QUFA 4BBSH 1MIUA 3NE5B 3L2PA 4A3BG 1T5EA 1TWAB 1C8CA 2RKSA 3J81E 4Y7NH 2JA8H 4JI5Q 4DK0A 1NBWA 1HNZQ 1WCMH 2KCCA 1B9NA 5IP7G 3H6MA 4TSSA 2B2UC 4A3EG 1LTGD 3EIVA 1VQIA 3KBXA 1BNZA 1QE6A 2F0KA 2A68D 2F0PA 3PF4A 2RHSB 5IP7H 3J7AV 4C3HB 3BZDB 3K7UC 1SYFA 3OHXC 1A63A 1ZKOA 5D65A 2RDGA 3OMCA 1VMCA 1YJ9A 3LNNA 3NTKA 2UXCQ 2E76C 5DLQE 1JC7A 4C3JH 1CI3M 3GTGB 4BBSG 5FLMG 2L4NA 2MO1A 3BZKA 1G6ZA 2JA5G 2ZXPA 1NE3A 1TS3A 3JAMi 2MUYA 1G291 1OXUA 4ZUJA 1KD1C 1CQVA 2XSCA 1JORA 3FDTA 2BA0A 3K5NA 3HOYG 1PFMA 2RSOA 2B2YC 4A93B 4J8QA 2EYPA 3GQBA 3PSIA 5EKKA 3DM3A 1OXSC 3MEHA 4GN3B 3HOWG 4GNXB 3K8AA 2R92B 3ULJA 2Y0SB 1ENCA 4LWCA 1NR4A 1RODA 2PPBC 2UXBQ 3TBIB 1TS4A 3LWEA 3WWVA 1EY0A 5C4XG 1LM0A 4JCVE 1PFSA 4K2LA 1FNWA 5NUCA 2KVMA 2WKDA 2BOSA 1X65A 2QF7A 1B50A 3GD7A 4RCOA 3T1YQ 2N88A 4B3TQ 3J81L 2DJGC 4DV1L 4J6HA 3HOZB 4LF4L 1YEZA 3TEHB 2K5WA 2K03A 3HGBA 1DYQA 5GAEC 5GQOA 1CQFA 3NELA 5M5YH 1D1IA 1IYUA 3MA2B 1B3QA 3K7AH 5K5PA 2HHHQ 4JV5L 4DV4Q 1CM9A 2F0NA 1QZGA 3KLSX 1YJNA 1PMRA 1HUMA 2IJ0A 1KLUD 1G51A 1PZKD 3MXPA 3S1QH 4PMWA 4A3LH 4UDUC 2F0TA 2CWAA 1QNKA 3IKJA 5KGUA 3P20A 4I7ZC 4A3EH 2VUMB 2AQ3B 4NXNQ 1LTTD 3KLWA 2BA1A 3PIP3 2LSSA 4DR4Q 2F0FA 4QF4A 2F0GA 4QCLA 1D5MC 5M9OA 2EY2A 1JE5A 3J80L 1GUGA 2CWPA 2QW7A 2I5HA 1W3SA 2B8GA 2WB1G 4PZ8A 4LF5Q 4I65A 1K28A 4QQBX 4JBMA 3KDFA 1I4XA 5JPNC 5D3DA 3CCJA 4KV6A 2AUJD 3BDOA 1HH2P 3L0OA 1HNXL 3T1HQ 1STBA 3CAMA 5EKIA 1TR5A 2WINB 1YVCA 4Y52H 4DV7Q 1PYBA 1L0WA 1BXTA 4ZKBB 3FMCA 1VQMA 2F0MA 4K8IA 2K5DA 1G91A 1L0YB 1EFWA 1BDOA 5GAGC 3QR8A 1A0IA 3OW2A 4N9TA 2Q2HA 4AYBG 2CH4A 3J7AF 1VF5C 3H0GH 4OHJA 1VS0A 5LHY1 3CF5A 1S3OA 4EQPA 4JI4L 1JT8A 4PQXA 3I4MG 3C1FA 3BVMA 1Q12A 4OX9Q 2PNHA 1EOVA 4XQNA 2RCNA 3GP7A 1C9OA 3F2DA 3X3MA 1B3AA 2A73B 4KD4A 1PH3A 2FMMA 2KHIA 2NTSA 4P74A 2J7ZA 3CXCA 1TY0A 1RKNA 3KF6A 2K28A 1PZID 1HQRD 4X3SA 1GM5A 1MSGA 1O7IA 1WTWA 3FKIH 1TWAH 3W3AA 3LGJA 3IRBA 4A3CG 5ELOA 2F3IA 3RLFA 4KKUA 1SNOA 3TP7A 3LX0A 2F0LA 1BF4A 4A3GB 1JOKA 2L15A 2EDGA 5C4XH 5J39A 3NPPA 2QKIC 3KK7A 2R93B 4KN4C 4O2DA 3VR4A 5EBCA 5CMDA 1E2ZA 3TREA 4DAYB 1XNQQ 4OIKA 5T1IA 2SDFA 5KNBA 4KHVA 2R6GA 3MHBA 5DM63 4DR1L 3HFZB 5ELEA 4JI1L 2UXBL 2D9UA 1STHA 1AZQA 3M4YA 5JPMC 3G6JB 3U4VA 1DOKA 1KLGD 2LS01 3OSOA
chains in the Genus database with same CATH topology
3FPUB 1EWHA 3K5LA 5FO8B 3OPOA 1JOOA 1LTSD 3VA5A 2C9OA 5M5WB 2Z1CA 3T51B 4RFBA 3M3YB 3R2TA 5IGGA 1Y1VB 4HMJA 3MWYW 1JOQA 4BY7B 1LT5D 3IFTA 4EVOA 2OT2A 4IALA 1GOZA 2B2VC 2RA4A 3I8ZA 3EQLC 1I50B 3HEJA 2IW3A 1GUNA 1E2WA 4KJNA 4TQUS 2J0TD 1RDPD 1CA5A 4A3DB 5FLXE 3D4DA 5A2QL 4IURA 4WJWA 4OL7A 5BN3A 2NVYB 4C56C 4ZAIA 4FXDA 3TP8A 5CORA 1V1OA 1X32A 2N55A 1EYAA 3T13A 2EYMA 2K1BA 1V1PB 1E0BA 1LTAD 3FEWX 4Z9CB 2KUMA 2NVQB 2XN9C 4KKTA 3KLRA 3D4RA 1K83B 1S4ZA 1SEBD 1DOMA 4BA2I 1LT6D 3CU7A 1STAA 4KTAA 3HOWB 3HG9A 1KDBA 4RGNA 5EJWA 1M4VA 2XNAC 1U4MA 3VYTA 1Y8OB 2Z4IA 2OF1A 1WTRA 4EQOA 3RMHA 2K04A 3CRLC 3DWAA 3DXJC 1Q1EA 5JVH3 2EY5A 1PXUA 1U4LA 3K0YA 4CKBA 4KI0A 2DY7A 5E4WC 2IX3A 3GTOB 2R7ZB 2Q8IB 2JEAI 4JBWA 3ERQA 1R4PB 5FO9B 1XYIA 1JCKB 1EY9A 1QILA 2EOTA 5IGBA 4QIWB 2EPBA 4ZQ3A 4RGOS 4X3UA 1TT2A 2O5IC 3X3NA 2L11A 1I6HB 5AFWA 3KBGA 1H9KA 2X6LA 4KY7A 4CGYB 3S17B 1PTOD 2L9HA 3QWNA 2XIWA 1I4GA 3SHLA 1A2UA 1F2ZA 1TVXA 5I6WA 5M5YB 1PTOB 5C5MA 4DGZA 4WORA 4KN7C 2LY7A 1WVLA 3GTMB 1CHPD 5IGCA 4KD3A 2O2LD 5C5LA 4BWGB 4XT3B 4RA8A 5I2YA 3QG1A 2PZTA 1PDQA 1STEA 5J22A 1BCPF 4C1NK 3A8JE 4BA1I 4IFDI 1O7ZA 3JAML 2ZT9C 1SXTA 2EJFC 1RHPA 4XDXA 4KY5A 1FNVA 2K6AA 4H44C 5KNDA 3TN2A 3NSWA 2RDFA 1FNUA 3TZUA 4CJ1B 5HGTA 3TP5A 2NN6H 3K7AB 1D6EC 3DEOA 1F2MA 1KDAA 3H09A 3D6WA 3SK6A 3HP3A 3NWSA 5C3XA 1UAPA 4EGVA 1QNUA 4XQJA 1HFNA 5F2DA 4DAVA 1FYCA 1KNEA 3E0JA 1EQVA 3R3OA 1J9OA 5KYIA 4OO1H 3KLSA 1LTID 2HUGA 3EFXD 1HUNA 1SNPA 2KJXA 2SNSA 3PO2B 1LV9A 1SAPA 3E6ZX 3KUPA 2A6ED 2EJGC 1S5ED 2JXMB 1AFPA 3DWPA 3NK9A 1A15A 3NQTA 2B39A 1JB3A 3QOJA 3NTIA 4EQNA 4MN3A 2ID0A 2J4XA 4IQZA 3MXGA 1ESFA 2B2VA 3PMFA 2PYKA 2K01A 2QCPX 4IUNA 1ML0D 1ENAA 3Q0AA 4G57A 2F3WA 3J7YW 2IPKD 4A3JB 5M3MB 3URYA 3OMGA 3A56A 1VF7A 3AMUA 5KRUA 1X3PA 3VYUA 1SMYC 2EYJA 3S15B 2K7VA 2RVLA 3EVQA 1EY7A 4HEDA 3C3LA 1OO9B 2SNMA 3ND9A 4PMBA 3U9SA 2B8FA 3V96A 5EPJA 1UNSA 4OO1I 1SE3A 1EFID 1IW7C 1U4PA 4DU9A 4HSVA 3ZYYX 2F4IA 1I4RA 1RCVD 4KJOA 3OWEB 4LK1C 1B44D 1ENFA 5HURA 2A5HA 1LT4D 1STYA 1PRTC 4OGQC 1OXTA 1KTKA 1OXXK 2WP8J 3S1RB 4IUVA 4CKCA 3MVVA 1Z6HA 2JA8B 5C0XH 3BVZA 5LL6X 3T4AC 3OOCA 5K36G 2KHSA 2E74C 5C4HA 4CHTB 1F2YA 2KA7A 4Y7NB 2EYFA 4HR7B 4NDXA 5CR3A 5KNCA 3P1HA 2A69D 1HA5A 3ONAB 1Q1BA 1TWCB 2BE5D 2FHTA 3I72A 3S2HB 3BDLA 2CW0D 1BUVT 2XRSD 3OIPA 1X3QA 2VNUD 3HOXB 2AUKA 1SDFA 4A3KB 1A3TA 4PV1C 4DN4M 3R8BA 4E6IA 3BDCA 2F3VA 1G2SA 2B2UA 1DCZA 2PMZB 5JEAH 2A6EC 1PYWD 1VCIA 5IODA 4FF1A 5CV4A 4IFDH 3FPPA 1F77A 3DEPA 3NBHA 1S5FD 3H91A 2K32A 4FXGC 5C3EB 1SSOA 1KABA 1W6KA 4K6DA 3SK5A 4LJZC 1SJED 2K5QA 2CVRA 1SFOB 1TIID 4FP5D 3K5MA 1F2LA 3DUZA 3P7JA 2FJ2A 2B2WA 3UI2A 5DAUA 2A68C 1PFNA 5JJZA 2EVBA 3DMUA 1I4HA 3Q22A 5CBEE 4HCEA 1BCPD 1JWUD 1O7YA 1B1ZA 2I46A 3I70A 1U4RA 3C1EA 1I6VC 5I2XA 4OO1G 4RHRA 2F0WA 1GUOA 3KF8A 4Q0FA 4K5WA 2XWJB 1NR2A 3BVGA 4PNYA 5EGTA 4ZUIA 3AB9A 1HCZA 4U673 2IX0A 3I4NB 1DD2A 3NTHA 4C3IB 1HTLD 1WD1A 4NKLA 1EQTA 2CHBD 5CV8A 1SYCA 1KDCA 2B2TC 2FINB 1STNA 4K14A 5IIFA 2AWNA 1F9QA 5CV7A 3VA7A 1MD2D 1TKWB 2SEBD 4ZRZA 1BBXC 4M8AA 2VB2X 3PUWA 1V8QA 1W6JA 5IGFA 3D4WA 1ONLA 4ZKCB 2M9VA 2TSSA 1F9RA 5C0XI 1SNQA 2I07B 3OWFA 3RZOB 1TS5A 3PIO3 4QUCA 3I3CA 1CTMA 4H7BA 3TSSA 5C44B 2EZVA 4LMQD 4V0BA 5C0XJ 1FR3A 3K5OA 3JAME 5JVG3 4KY6A 4RKLA 2NVTB 3VR5A 4P2CB 5M5XB 5C4XB 2PO4A 2JE6I 1C4QA 1AN8A 3NHHA 2X69A 4ABNA 3VYSA 3QJYA 1JQYD 3VYRA 1O80A 3DM1A 4H13C 4TKOB 2MPMA 1B9MA 2NBFA 2ZXRA 3G7LA 1A6XA 1G8ZD 1HQMC 3GO5A 1GUWA 2DN8A 2HDLA 4IFDG 4PMCA 2AWOA 3I73A 5FK9C 1I4QA 2BCOA 1XWEA 1QB5D 2F0VA 1JR0D 2NTTA 1Y1WB 3CHBD 3FVQA 1II3A 5DEHA 4O42A 3FRPB 1TWFB 2ZXOA 2F03A 1CT1D 1H9SA 3MXNA 4U68A 1ZYRC 1SYEA 3TZDA 2Z8LA 4FYDA 4DNTB 2E2IB 2X6GA 3GV3A 4G7OC 4WFN3 2F0SA 2B2TA 3M7GA 2C5CA 3MXUA 2A6HD 2PZWA 1RTNA 2L0CA 3ND8A 3GTQB 3NP8A 2DNCA 3MC0B 3T16A 5ISRA 1Y8PB 5D3IB 1CHQD 5E1FA 3L3OC 2JA6B 2HCIA 3H94A 3MFGA 2PW5A 4HAEA 3A8KE 5LL6S 2EE1A 2NYZD 4KHZA 2BDOA 4RWSC 1EY5A 1IHZA 5ELDA 2B2YA 4DXFA 1QWYA 1WTVA 2F0UA 4FF2A 2K05A 1DONA 4G7ZC 2LFNA 3PUVA 1EY8A 3GV6A 4B9XA 4M1UB 3CQZB 3SVMA 3EJIA 3CKIB 5A2QE 1UUPA 4RHSA 4F8MA 1BO0A 5D14A 2A6HC 2EY6A 4Q5VA 1O7LA 1WD0A 1MBYA 1EEID 4L63B 3S9WA 1EU4A 5IOCA 2L12A 4RAUC 3BYTB 1Q8IA 1SMYD 1V43A 2WAQB 5KYLA 5IT9E 4IUUA 3K6OA 1DOLA 3Q24A 3S1NB 2D2CC 5C3WA 2H1EA 1Z47A 4IN3A 1PRTD 5K36H 2AQ1B 1IYVA 2XRQD 1S5CD 4XT1B 1TWHB 2HQEA 4QMGA 5JOBA 1EZ6A 1MSHA 2JSOA 3MZ5A 1EU3A 3NQIA 4NMZA 3GTLB 3SK8A 1IW7D 1B4OA 3SDZA 5JEAG 3OIQA 1EL0A 2E2DC 1D5ZC 3IAYA 4IUPA 3QB3A 1SNDA 1GUSA 2KEDA 2L5TA 4L6TB 1BCPB 5E3FA 2EYHA 5ELFA 4FVMA 2EYLA 1DXMA 3S14B 1JWSD 2E75C 4CJ0B 1ET6A 1FD7D 3HOYB 1CZWA 2RDHA 4AYBB 1QG7A 1F9PA 5BN4A 4KMUC 4IFDJ 1JWMD 2RQXA 3TDQA 3NWTA 3HS0C 2OXPA 4DNRB 1M8AA 3SEBA 2XVSA 2KCNA 4HTHA 2PW7A 3HOVB 5FOBB 4NW2A 1EEFD 3PUZA 3PV0A 1HTPA 2QDBA 2JYOA 1R9TB 3GTJB 3H0GB 5C4JB 3QO2A 1Y8NB 4ZK9B 1K8OA 2LMCB 4TRDA 1SYBA 2ENBA 5EQ0A 4ME5A 1HXYD 5CYUA 2WACA 5FO7B 5I6YA 4A3BB 1LLRD 4GZYC 1EYDA 1LT3D 2SOBA 4NP5A 2F0EA 5I9OA 1G2TA 4XIGS 2JEBI 1S5BD 2Q8TA 1LO5D 1GHJA 4G4KA 2GA4B 1AP0A 1PZJD 4UAIA 1PLFA 3I91A 1ILPA 4FF3A 4K2KA 4K5XA 5COYA 1EY6A 4ILWA 1HHVA 2R3ZA 1CK1A 1J8IA 4K6LA 2OEOA 2L1BA 3D8GA 3H3VC 3S16B 2NN6G 2QEJC 2ICEC 2NZ1D 5EPKA 3BS1A 4BS9A 2G9HD 2NN6I 4C3IG 2JP1A 5KEEA 3V05A 2G9DA 5EKLA 3I4LA 2EXZA 2F0HA 3D6CA 1NSNS 4RKBA 1ILQA 3TP6A 4FO2A 5ELBA 1HFGA 5EBDA 1RTOA 5C6AA 3AU7A 1Z7TA 4C3HG 5DNFA 1QOHA 2PCFB 5T1GA 3S1QB 4R8IA 2A69C 1D1KA 1GUTA 4HCSA 1DM0B 3OW7A 5CV9A 4FXKC 2B2WC 4L8JA 2R61A 4MHEA 2QILA 3W2DA 4K5VA 3BG3A 2JA7B 1EOTA 1XXGA 1ET9A 1WTQA 1H9MA 4R9WA 1PTOH 1FGBD 5CGKA 3SK4A 5TSSA 1OXVA 4XXEA 4FF4A 2ICIA 4F7XA 3K59A 2RSNA 4DK1A 1U9RA 5JEAJ 1PRTB 2IWHA 1Q3LA 2M00A 1JICA 2FFKB 3A7AB 4C3JB 1SNMA 3S1MB 1WTOA 1SE2A 3VR6A 3M85A 4RCNA 3FKIB 3RZDB 4K8JA 2MP1A 2A74C 3EA6A 1RF2D 2H4OA 2WB1B 4DA2A 2XWBB 1IKLA 3R2IA 2WIIB 3MAQA 3HZXA 1HPCA 4XQQA 4YIJA 5M3FB 4KKSA 4RH6A 1LABA 1CZGA 1SYGA 3C46A 2DNEA 1BOSA 1Q90A 3SXHA 1B53A 3SE0A 2HCCA 1NUCA 1H9SB 2Q8RE 3S2DB 1CFMA 2BDNA 1RJTA 2MJ8A 1CA6A 1GHKA 1SE4A 3BYYB 3U9OA 3GTPB 5C0XG 3DHQA 5IGEA 2F0DA 2CW0C 1KAAA 3M4OB 3P75A 1PTOC 3F2UA 1TWGB 4MIUA 2O4XA 4HSPA 2PZUA 1F9SA 4S3SA 2VB3X 5G3LF 4BY1B 1QJOA 4KK7A 1YNNC 1HRJA 1PTOF 1MI2A 3E5SA 1TY2A 5ELCA 3WOEA 4DXGA 3MFYA 2KQ3A 1D5XC 3RD4A 4J1MA 1V1PA 1EY4A 2E2JB 3IL8A 5I9PA 3WDNA 2JA5B 4DFAA 3T56B 1H9RA 4BBSB 3L9AX 1BR9A 1T5XD 5E4XA 1D2BA 4OIJA 1H9JA 4ID6A 4IZ8A 4FNFA 4B9WA 4A3FB 3K57A 1SNCA 4BBRB 2AQ2B 4XYQA 1WCMB 3DWQA 1DJRD 1HA6A 1S5DD 1IKMA 1EIGA 1WTXA 1IL8A 1LTRD 2M2LA 2HDMA 3V2TA 3NUCA 4A3EB 2IX1A 1VDZA 3LWUA 4ODGA 1EYCA 1STGA 4V190 2RBMA 5CC4A 2NUCA 4DAYA 4H0LC 2Z4HA 3PO3B 1K8MA 1LTBD 3HOUB 3PUXA 1ESRA 3O13A 1B2TA 2F0JA 3RUZA 1RD9D 1TS2A 2E2HB 4N9PA 5IT9L 2L55A 5FKAC 1ZEQX 3HRZC 4F87A 3D3RA 1SBBB 1GXDC 4RGMA 5CV6A 1BQQT 2FMCA 1SJHD 1ICWA 3K58A 2MHVA 3NBIA 1QCBD 2EJMA 2EY1A 4LAAA 1ZYRD 1YNJD 4C3JG 5IGDA 2V4DA 4XYOA 1Y69U 1C48A 1NAPA 2CQAA 1VMPA 5G3LD 5JAVA 3D31A 3SR1A 4CBVA 1YNND 3QIAA 2VXWA 3A7LA 3Q23A 1A3UA 4JK1C 5KIXA 4CKEA 3CRKC 2MGSA 3A55A 1I3QB 4F88A 5C4ZA 2IL8A 4IUTA 2KECA 3TMEA 4DAPA 4X3KA 3C2PA 1JE4A 2D62A 4R8NA 4ZLTF 1AEXA 4C2MB 4XTCS 3EROA 4DF7A 2TMPA 3I90A 2KEEA 1KNAA 4RGTA 3PUYA 4X3TA 3MTSA 4HN7A 1YNJC 1BCPC 3I4MB 1EIHA 2LKVA 5BN5A 3Q6SA 3R93A 1PFBA 2F0OA 1EZ8A 3N52A 1L0XB 3ITPA 4C1NI 5EPLA 4ZYSA 1E2VA 2KOLA 5A35A 5CBAE 3GTKB 5I4DA 4ULLA 2EYOA 3HKZB 3L7ZC 5CV5A 1A3VA 2WV6D 1TQOA 2K33A 5DM73 3QOLA 1EWCA 1NCVA 1AW7A 2BE5C 1AZPA 1ZXTA 2B63B 2IT1A 4CJ2C 4G7HC 3J80E 1I4PA 5J1ZA 1WTPA 4B08A 1PRTF 4A3IB 1XX8A 1LACA 3VR3A 2NWGA 1UEAB 2YU9B 4QB4A 2NB0A 2D5DA 3N6RA 2PNRC 5FLXL 3A54A 2YYZA 1MGSA 4HMIA 1O78A 2O5JC 3A8IE 3NXWA 1XTCD 3IFDA 1A2TA 4WRDA 2F0IA 3T53B 1TU2B 2DY8A 1SYDA 2PQEA 4A3MB 3VR2A 2WKCA 2NVXB 1R4QB 2F0QA 3M7NA 1GJXA 1DZ1A 4IUQA 3WOFA 4O1NA 2F1MA 4QUFA 3NE5B 1T5EA 1TWAB 1C8CA 2RKSA 3J81E 4DK0A 2KCCA 1B9NA 3H6MA 4TSSA 2B2UC 1LTGD 3KBXA 1BNZA 1QE6A 2F0KA 2A68D 2F0PA 3J7AV 4C3HB 3BZDB 1SYFA 3OHXC 1ZKOA 5D65A 2RDGA 3OMCA 1VMCA 3LNNA 3NTKA 2E76C 1JC7A 1CI3M 3GTGB 2L4NA 1G6ZA 2ZXPA 1TS3A 2MUYA 1G291 1OXUA 4ZUJA 1CQVA 2XSCA 1JORA 3FDTA 2BA0A 3K5NA 1PFMA 2RSOA 2B2YC 4A93B 4J8QA 2EYPA 3GQBA 5EKKA 1OXSC 3MEHA 2R92B 2Y0SB 1ENCA 1NR4A 1RODA 2PPBC 3TBIB 1TS4A 3LWEA 1EY0A 4K2LA 1FNWA 5NUCA 2KVMA 2WKDA 2BOSA 2QF7A 1B50A 3GD7A 4RCOA 2N88A 3J81L 4J6HA 3HOZB 2K5WA 2K03A 3HGBA 1DYQA 1CQFA 1D1IA 1IYUA 3MA2B 5K5PA 1CM9A 2F0NA 3KLSX 1PMRA 1HUMA 2IJ0A 1KLUD 1PZKD 3MXPA 4PMWA 4UDUC 2F0TA 1QNKA 3IKJA 5KGUA 3P20A 4I7ZC 2VUMB 2AQ3B 1LTTD 2BA1A 3PIP3 2F0FA 4QF4A 2F0GA 4QCLA 1D5MC 5M9OA 2EY2A 3J80L 1GUGA 2B8GA 4I65A 1I4XA 5JPNC 5D3DA 4KV6A 2AUJD 3BDOA 1STBA 5EKIA 1TR5A 2WINB 1BXTA 4ZKBB 3FMCA 2F0MA 4K8IA 2K5DA 1G91A 1L0YB 1BDOA 4N9TA 3J7AF 1VF5C 4OHJA 5LHY1 4EQPA 4PQXA 3C1FA 3BVMA 1Q12A 4XQNA 3GP7A 3X3MA 1B3AA 2A73B 4KD4A 2FMMA 2NTSA 2J7ZA 1TY0A 1RKNA 2K28A 1PZID 1HQRD 4X3SA 1MSGA 1WTWA 3W3AA 3RLFA 4KKUA 1SNOA 3TP7A 3LX0A 2F0LA 1BF4A 4A3GB 1JOKA 2EDGA 5J39A 3NPPA 2QKIC 3KK7A 2R93B 4KN4C 3VR4A 5EBCA 5CMDA 1E2ZA 5KNBA 4OIKA 2SDFA 5T1IA 4KHVA 2R6GA 3MHBA 5DM63 5ELEA 2D9UA 1STHA 1AZQA 3M4YA 5JPMC 3G6JB 1DOKA 1KLGD 2LS01 3OSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9X A;  1TQO A;  5KRU A;  4E6I A;  3BDC A;  1SNM A;  2F3V A;  4KY5 A;  2OF1 A;  4PMC A;  3EJI A;  3QOL A;  3OMC A;  4EQO A;  2EYJ A;  2EY1 A;  4I65 A;  1JOO A;  4NKL A;  5KEE A;  4LAA A;  4F8M A;  3EVQ A;  4KV6 A;  3VA5 A;  4DFA A;  4HTH A;  5EKL A;  4K8J A;  5CV8 A;  5IGD A;  2EXZ A;  1EY7 A;  1SYC A;  2PW7 A;  5IOD A;  2F0H A;  1STB A;  2RDF A;  1KDC A;  3D6C A;  2SNM A;  1NSN S;  1STN A;  4K14 A;  1TR5 A;  2EY5 A;  2F0V A;  4PMB A;  4RKB A;  2EY6 A;  5CV4 A;  3TP6 A;  5J1Z A;  5IGG A;  4HMJ A;  5HGT A;  4ID6 A;  5CV7 A;  3TP5 A;  4ZUJ A;  1JOQ A;  4IZ8 A;  1JOR A;  1F2M A;  2F0M A;  1KDA A;  4K8I A;  5JAV A;  4EVO A;  3HZX A;  3SK6 A;  4B9W A;  3SR1 A;  3S9W A;  4IAL A;  5C6A A;  5C3X A;  2QDB A;  4YIJ A;  1SNC A;  5IOC A;  1II3 A;  2EYP A;  4QB4 A;  5DEH A;  5EKK A;  1SYG A;  4N9T A;  3MEH A;  3ERQ A;  5F2D A;  4DU9 A;  5IGF A;  3D4W A;  3SXH A;  5KYL A;  1A3U A;  4EQP A;  5KIX A;  1KAB A;  1EY9 A;  3HEJ A;  4HMI A;  1EQV A;  1ENC A;  3C1F A;  4KJO A;  1SYE A;  4K6D A;  1NUC A;  3SK5 A;  4KJN A;  4TRD A;  3NXW A;  1SYB A;  1SNQ A;  1A2T A;  1EY0 A;  2ENB A;  3NUC A;  3R3O A;  4WRD A;  3V2T A;  5IGB A;  5KYI A;  2F0I A;  3OWF A;  4ZQ3 A;  5C3W A;  5HUR A;  4ME5 A;  4K2L A;  5NUC A;  2WAC A;  5CV9 A;  2F0S A;  1TT2 A;  1SNP A;  1EYC A;  4KD4 A;  1STG A;  1SYD A;  1STY A;  2PQE A;  2SNS A;  4ODG A;  5C4Z A;  5I6Y A;  3D4D A;  2F0Q A;  3U9O A;  2HQE A;  4QMG A;  4H7B A;  2PZW A;  4KY7 A;  1EZ6 A;  2RBM A;  4K5V A;  3DHQ A;  3MZ5 A;  5DAU A;  5JOB A;  3TME A;  1RKN A;  5CC4 A;  4NMZ A;  2NUC A;  4J6H A;  4OL7 A;  4R8N A;  1EYD A;  3SHL A;  3SK8 A;  1AEX A;  2F0D A;  3DMU A;  1A2U A;  3MVV A;  5IGE A;  1KAA A;  2SOB A;  4NP5 A;  1F2Z A;  3P75 A;  3NK9 A;  3NP8 A;  5I6W A;  2F0E A;  2RKS A;  3ERO A;  3TP8 A;  4DF7 A;  5I9O A;  5C5M A;  4MIU A;  4DGZ A;  3NQT A;  2O4X A;  4KY6 A;  3T16 A;  5ISR A;  2PZU A;  3QOJ A;  3QB3 A;  4RKL A;  4S3S A;  2KHS A;  1SND A;  4WOR A;  5C4H A;  5CGK A;  4EQN A;  1F2Y A;  5K5P A;  1SNO A;  3TP7 A;  1EYA A;  3LX0 A;  2F0L A;  2EYF A;  2OXP A;  2EYM A;  3SK4 A;  5E1F A;  3T13 A;  4NDX A;  5IGC A;  1JOK A;  4KD3 A;  5CR3 A;  2F0N A;  5J39 A;  2F0J A;  3P1H A;  2PW5 A;  2EYH A;  3NHH A;  5E3F A;  5C5L A;  3C1E A;  2LKV A;  2EYL A;  3MXP A;  3RUZ A;  3H6M A;  3PMF A;  2PYK A;  2F0T A;  4N9P A;  4F7X A;  2F0W A;  4IUN A;  1EY5 A;  1IHZ A;  3E5S A;  2PZT A;  4K2K A;  4K5X A;  4KHV A;  2F0O A;  1EZ8 A;  1ENA A;  5KGU A;  4K5W A;  5J22 A;  3BDL A;  3MHB A;  3ITP A;  4G57 A;  2F3W A;  2KQ3 A;  1EY6 A;  2F0K A;  1STA A;  4KTA A;  2F0P A;  4PNY A;  1U9R A;  2F0U A;  5EGT A;  2OEO A;  5CV6 A;  4ZUI A;  1KDB A;  1STH A;  3D8G A;  4J1M A;  2F0F A;  5IIF A;  4QF4 A;  3OMG A;  1A3T A;  2EYO A;  2F0G A;  1EY8 A;  2M00 A;  1SYF A;  1EY4 A;  5M9O A;  5I9P A;  2EY2 A;  5CV5 A;  1A3V A;  3OSO A; 
#chains in the Genus database with same CATH topology
 1HJP A;  3FPU B;  2JK8 A;  1XMO L;  1EWH A;  4JC0 A;  3K5L A;  5FO8 B;  3OPO A;  1JOO A;  1LTS D;  1VQG A;  2XGT A;  2D0P A;  3VA5 A;  1SLJ A;  2C9O A;  5M5W B;  2Z1C A;  3T51 B;  3T1Y L;  4RFB A;  4YHH Q;  3M3Y B;  3R2T A;  5IGG A;  1Y1V B;  3I2Z A;  4HMJ A;  3MWY W;  3HOX G;  1JOQ A;  4BY7 B;  1LT5 D;  3IFT A;  1PVO A;  3JAM c;  4EVO A;  3GTM H;  2OT2 A;  4IAL A;  1GOZ A;  2B2V C;  3CCU A;  2CQO A;  2RA4 A;  3I8Z A;  1VQK A;  3EQL C;  1I50 B;  3HEJ A;  4JOI C;  2ZJP A;  4A75 A;  2IW3 A;  4JVZ A;  1GUN A;  1E2W A;  4KJN A;  1NNX A;  4TQU S;  2J0T D;  3E3X A;  4UHV A;  1RDP D;  1CA5 A;  4A3D B;  5FLX E;  3D4D A;  5A2Q L;  4IUR A;  2JA8 G;  1E1T A;  4WJW A;  1WTH A;  4EQ5 A;  4A3B H;  4OL7 A;  2RCF A;  5BN3 A;  1CUK A;  2NVY B;  3OYY A;  4C56 C;  4CDE C;  4ZAI A;  4OWT B;  4FXD A;  3J7A 5;  3TP8 A;  5COR A;  2N49 A;  1ICF B;  1B8A A;  4MTN A;  4A3M G;  1V1O A;  5JJI A;  1X32 A;  3M4O H;  4GOP C;  2N55 A;  1EYA A;  3T13 A;  2EYM A;  2K1B A;  1V1P B;  3EBE A;  4JI2 L;  1E0B A;  1TWC H;  1LTA D;  2QDL A;  3FEW X;  4Z9C B;  2VQE Q;  2KUM A;  2NVQ B;  2XN9 C;  4KKT A;  4X62 L;  2UUC L;  3KLR A;  3CPW A;  3CCV A;  3D4R A;  4K0K L;  1K83 B;  1S4Z A;  1SEB D;  1YJW A;  1DOM A;  3STB D;  4BA2 I;  1LT6 D;  3CU7 A;  1STA A;  4KTA A;  3HOW B;  3HG9 A;  1VQB A;  4UP8 A;  4A3I G;  1KDB A;  4RGN A;  5EJW A;  1M4V A;  1J5E L;  4QIW E;  2XNA C;  1U4M A;  3VYT A;  3KF8 B;  1Y8O B;  1VQO A;  4APV A;  2Z4I A;  1Y1W G;  1YHB A;  2OF1 A;  1WTR A;  4EQO A;  4R4C A;  1K73 C;  3RMH A;  5IYD H;  4YCV A;  2K04 A;  3CRL C;  3J7Z C;  3DWA A;  4AQY L;  1XMQ Q;  5LMN L;  3DXJ C;  1Q1E A;  5JVH 3;  2EY5 A;  2DGY A;  1PXU A;  1U4L A;  3K0Y A;  4CKB A;  4KI0 A;  3AYH B;  2B63 H;  2DY7 A;  5E4W C;  1SMX A;  2IX3 A;  1VQA A;  1L1O B;  3GTO B;  1EQQ A;  2R7Z B;  4LUO A;  4X66 Q;  2Q8I B;  3I4O A;  2JEA I;  4JBW A;  3ERQ A;  1R4P B;  5FO9 B;  1XYI A;  1JCK B;  2HQL A;  1EY9 A;  1QIL A;  2EOT A;  5C4J H;  1X6O A;  1BBW A;  5IGB A;  3K81 C;  4QIW B;  4UY8 C;  2EPB A;  4ZQ3 A;  1XPO A;  4BY1 G;  4RGO S;  2R93 G;  4X3U A;  5FLX c;  1TT2 A;  2O5I C;  3M9B A;  2ASB A;  2Z6K C;  3X3N A;  5GAH C;  2L11 A;  1VQ8 A;  3STB C;  1I6H B;  5AFW A;  1B70 B;  1H9K A;  3KBG A;  2X6L A;  4KY7 A;  4CGY B;  3S17 B;  1PTO D;  1IBK Q;  2L9H A;  3QWN A;  2XIW A;  4CDF C;  1I4G A;  3SHL A;  1VQ4 A;  1A2U A;  1F2Z A;  1TVX A;  5I6W A;  4DR6 Q;  5M5Y B;  1PTO B;  5C5M A;  4DGZ A;  1XPU A;  3UDX A;  1Y1V H;  4LFB Q;  4WOR A;  3S24 A;  4KN7 C;  3F8T A;  2LY7 A;  1WVL A;  3GTM B;  1CHP D;  5IGC A;  4KD3 A;  2O2L D;  4QJF A;  5C5L A;  4BWG B;  5LMN Q;  1S40 A;  4XT3 B;  4RA8 A;  5I2Y A;  3QG1 A;  2PZT A;  2Z6B A;  1AE2 A;  3TS0 A;  1PDQ A;  1STE A;  1X3G A;  5J22 A;  1I3Q H;  1BCP F;  4C1N K;  1QUQ B;  1OTC A;  3A8J E;  2GVB A;  5LMN W;  3G48 A;  4BA1 I;  4IFD I;  1O7Z A;  3JAM L;  2ZT9 C;  4WJ4 A;  1SXT A;  2EJF C;  4NXN L;  1RHP A;  4XDX A;  4KY5 A;  1FNV A;  2YTV A;  2K6A A;  4H44 C;  3NEN A;  4BXX H;  5C44 H;  3MXN B;  5KND A;  3TN2 A;  3NSW A;  4DV2 Q;  2RDF A;  1FL0 A;  1FNU A;  3TZU A;  3GTG H;  2ZM6 L;  4CJ1 B;  5HGT A;  3TP5 A;  2NN6 H;  4YWK A;  3K7A B;  4DR2 Q;  1D6E C;  3DEO A;  4O0A A;  1F2M A;  1KDA A;  3H09 A;  3D6W A;  3SK6 A;  3HP3 A;  3HKZ G;  3NWS A;  2Q2T A;  5C3X A;  1UAP A;  2NVQ H;  4GN4 B;  5IP9 G;  4EGV A;  4DR6 L;  1YBY A;  4DR3 Q;  4R4T A;  1QNU A;  4XQJ A;  1HFN A;  5F2D A;  4DAV A;  1FYC A;  1KNE A;  2JQO A;  3E0J A;  1Q7Y C;  4CDD C;  1EQV A;  4YWL A;  2VUM H;  3R3O A;  1J9O A;  5KYI A;  4OO1 H;  3KLS A;  1LTI D;  2HUG A;  4JI0 Q;  3EFX D;  1HUN A;  1SNP A;  2EXD A;  2KJX A;  2SNS A;  4JI4 Q;  3PO2 B;  1LV9 A;  4X64 Q;  1SAP A;  3E6Z X;  3OTO Q;  2JA6 G;  3UDI A;  4DV1 Q;  2HT1 A;  3KUP A;  1X55 A;  5EAY A;  2A6E D;  2EJG C;  1E7Z A;  1S5E D;  2JXM B;  2ALY B;  1QVG A;  3DWP A;  1AFP A;  3NK9 A;  4B3R L;  1TWG H;  4K0K Q;  1A15 A;  3NQT A;  2B39 A;  1T9H A;  2K75 A;  4YCU A;  3HOZ G;  1JB3 A;  3QOJ A;  1HNW L;  3NTI A;  4EQN A;  4P73 A;  4MN3 A;  2ID0 A;  2J4X A;  4IQZ A;  1QUQ A;  3MXG A;  4KLK A;  1ESF A;  2B2V A;  3CME A;  1N34 L;  3PMF A;  2PYK A;  2K01 A;  2QCP X;  4IUN A;  4UP9 A;  4IOA A;  1ML0 D;  1ENA A;  3Q0A A;  4G57 A;  2F3W A;  3PGZ A;  2R92 G;  1A62 A;  2R7Z G;  3J7Y W;  2IPK D;  4A3J B;  1K8G A;  1VQ5 A;  5M3M B;  3URY A;  4QY7 A;  5IE8 A;  4R4O A;  3S2D H;  3OMG A;  1SRO A;  2KHJ A;  3A56 A;  4OEM B;  4DR1 Q;  2PI2 A;  1VF7 A;  3AMU A;  5KRU A;  3Q8D A;  1X3P A;  3VYU A;  1SMY C;  2EYJ A;  3W5O A;  2JA7 H;  3S15 B;  2K50 A;  2K7V A;  2RVL A;  3EVQ A;  2UUA L;  1EY7 A;  4HED A;  1EIY B;  3C3L A;  1QVC A;  1OO9 B;  2SNM A;  3ND9 A;  3OTO L;  4PMB A;  1I94 Q;  3U9S A;  4JI1 Q;  2B8F A;  2JJQ A;  5EPJ A;  3V96 A;  2VZA A;  1UNS A;  4OO1 I;  4LNQ A;  3S14 H;  1SE3 A;  1L1O C;  1EFI D;  4B3R Q;  2QGQ A;  1IW7 C;  1U4P A;  4DU9 A;  4X64 L;  4HSV A;  3ZYY X;  2F4I A;  1I4R A;  1RCV D;  4KJO A;  4C3H H;  2LXK A;  3AFP A;  3OWE B;  4LK1 C;  1B44 D;  1ENF A;  1WJJ A;  5HUR A;  2A5H A;  1D7Q A;  3M4P A;  1LT4 D;  1STY A;  3GTL H;  1PRT C;  3I4N H;  4OGQ C;  1E24 A;  1OXT A;  2UU9 Q;  1KTK A;  1OXX K;  1KC8 C;  1K3R A;  2WP8 J;  3S1R B;  4IUV A;  4CKC A;  4C3I H;  3MVV A;  2KCM A;  1Z6H A;  2JA8 B;  5C0X H;  3BVZ A;  5LL6 X;  4GLA C;  1XJV A;  3T4A C;  3HOU H;  3OOC A;  5K36 G;  1LTL A;  2E74 C;  2KHS A;  5C4H A;  4CHT B;  1F2Y A;  2PI2 E;  2KA7 A;  1XNR L;  4OXP A;  2OQK A;  4Y7N B;  2EYF A;  4JG2 A;  4HR7 B;  1BBU A;  4NDX A;  5CR3 A;  5KNC A;  4DV2 L;  3P1H A;  5C3E H;  2VQE L;  5JJL A;  2A69 D;  1DGS A;  1HA5 A;  3ONA B;  2MQH A;  2BH8 A;  3A0J A;  1Q1B A;  1TWC B;  2BE5 D;  2ES2 A;  2FHT A;  3CMA A;  3I72 A;  3S2H B;  3BDL A;  2D0O A;  2CW0 D;  1BUV T;  1RIP A;  2XRS D;  3KYH C;  3OIP A;  1X3Q A;  2VNU D;  1UE7 A;  3HOX B;  4LF9 Q;  1SRU A;  1J5E Q;  2AUK A;  1SDF A;  4A3K B;  1A3T A;  3PO2 H;  1QZH A;  4PV1 C;  3HOV G;  4DN4 M;  3R8B A;  4E6I A;  3BDC A;  2F3V A;  1G2S A;  2B2U A;  1DCZ A;  1K0R A;  4JI5 L;  1PH4 A;  2PMZ B;  5JEA H;  2A6E C;  1PYW D;  1K8A C;  1VCI A;  4P71 A;  5IOD A;  3CCS A;  2HHH L;  4FF1 A;  5CV4 A;  3U58 A;  1HNW Q;  4IFD H;  3FPP A;  1F77 A;  3DEP A;  3UDG A;  2XTI A;  3NBH A;  1S5F D;  3H91 A;  1ASZ A;  2K32 A;  4FXG C;  3J81 c;  5C3E B;  1N32 L;  2RF4 A;  3UE0 A;  4A3J G;  1SSO A;  4A76 A;  3RLO A;  1VQD A;  1KAB A;  1W6K A;  4K6D A;  3SK5 A;  4LJZ C;  1SJE D;  4AQY Q;  4A3D H;  4R1J A;  2VY3 A;  2K5Q A;  2WFW A;  4DR7 L;  2CVR A;  1SFO B;  4JI8 L;  1TII D;  2N78 A;  4FP5 D;  3K5M A;  5IYC G;  1F2L A;  2NVY H;  4LF7 L;  4ME3 A;  3DUZ A;  4YWM A;  3P7J A;  2FJ2 A;  1K0S A;  1E1O A;  2B2W A;  3UI2 A;  5DAU A;  2A68 C;  1PFN A;  5JJZ A;  2VS1 A;  2EVB A;  1I6H H;  3DMU A;  3RZD H;  5IT9 c;  1I4H A;  3SGI A;  1IBL L;  1D8L A;  2K14 A;  3Q22 A;  5CBE E;  4HCE A;  1BCP D;  1JWU D;  2FXQ A;  2RHQ B;  1I94 L;  4BY7 H;  3A74 A;  4DAM A;  1O7Y A;  3HOV H;  1B1Z A;  4R4I A;  4WJ3 M;  2UUA Q;  1C0A A;  3PO2 G;  1UWV A;  5IYB H;  1SR3 A;  1U0L A;  2I46 A;  2ZTE A;  3I70 A;  1U4R A;  3C1E A;  1I6V C;  5I2X A;  3I56 A;  5LMU Q;  4RHR A;  4OO1 G;  3E0E A;  2F0W A;  1GUO A;  1HZ9 A;  1VQH A;  4L5S A;  3CW2 C;  3KF8 A;  4Q0F A;  4K5W A;  4JI3 Q;  2XWJ B;  1NR2 A;  4LFA L;  3BVG A;  4PNY A;  5EGT A;  1RL2 A;  4ZUI A;  3AB9 A;  1HCZ A;  3CCL A;  5C3E G;  4U67 3;  4HIO A;  1YHQ A;  3RN2 A;  1VQ9 A;  2IX0 A;  4IPD A;  3I4N B;  2UXD L;  3NTH A;  1DD2 A;  4C3I B;  4AH6 A;  1HTL D;  1WD1 A;  3ERS X;  4NKL A;  4RMF A;  4HJ5 A;  1EQT A;  2CHB D;  3CQZ H;  5CV8 A;  4BXX G;  1PH8 A;  1SYC A;  1KDC A;  1YIJ A;  2B2T C;  2FIN B;  1STN A;  4K14 A;  5IIF A;  4A3G H;  2AWN A;  1F9Q A;  1S72 A;  5CV7 A;  2VQF L;  3VA7 A;  2UXC L;  1MD2 D;  1TKW B;  2SEB D;  4ZRZ A;  2P5Z X;  4DV6 Q;  1BBX C;  1K3B C;  4M8A A;  2K52 A;  2VB2 X;  3PUW A;  1V8Q A;  1W6J A;  5IGF A;  3D4W A;  4HJ8 A;  1ONL A;  4ZKC B;  1XMQ L;  1P8L A;  2M9V A;  2TSS A;  1F9R A;  5C0X I;  1SNQ A;  2I07 B;  2NZO A;  4DV3 Q;  3OWF A;  2DUD A;  3RZO B;  2JA5 H;  1TS5 A;  4DR2 L;  3PIO 3;  2ATW A;  4QUC A;  4DKA C;  3I3C A;  4DR5 Q;  1CTM A;  4H7B A;  3TSS A;  5C44 B;  2EZV A;  4LMQ D;  4V0B A;  5C0X J;  5FJ8 G;  1GKH A;  4X65 L;  1CKM A;  1FR3 A;  3K5O A;  3JAM E;  5JVG 3;  3PO3 H;  4KY6 A;  2JA7 G;  4HIM A;  4RKL A;  1XMO Q;  4GOP B;  3VR5 A;  2NVT B;  4P2C B;  5M5X B;  4LF4 Q;  4GS3 A;  5C4X B;  4MTK A;  2PO4 A;  2JE6 I;  2Y0S G;  1C4Q A;  1AN8 A;  3NHH A;  3H3V H;  2G5D A;  2X69 A;  4ABN A;  1VQE A;  2PQA B;  3VYS A;  3GTO H;  2F52 A;  3QJY A;  4A93 H;  1JQY D;  2PQA A;  1O80 A;  3VYR A;  3DM1 A;  4H13 C;  4A93 G;  2UXD Q;  4TKO B;  4R4Q A;  2MPM A;  1B9M A;  1EIF A;  2NBF A;  2ZXR A;  4BBR G;  3G7L A;  1A6X A;  1G8Z D;  5J3B A;  1HQM C;  3GO5 A;  1GUW A;  2OCE A;  3PQI A;  2DN8 A;  1IYJ B;  2HDL A;  2NVX H;  1UE5 A;  4IFD G;  4PMC A;  4JYA L;  3A5U A;  2AWO A;  3CCQ A;  4ZCK A;  1PHJ A;  1BVS A;  4DUY Q;  3I73 A;  5FK9 C;  1HR0 L;  1I4Q A;  2VL6 A;  2BCO A;  1XWE A;  4GNX C;  1QB5 D;  4H02 A;  3EN2 A;  2F0V A;  1JR0 D;  3ICE A;  1E3P A;  2NTT A;  1Y1W B;  1X3F A;  4CDC C;  2BH2 A;  4LUV A;  2E5L Q;  3CHB D;  4A4I A;  3FVQ A;  1IXR A;  4JW0 A;  5E7N A;  1II3 A;  5DEH A;  4O42 A;  5LMU L;  5BR8 L;  2QA4 A;  3FRP B;  1TWF B;  2ZXO A;  2R7F A;  5IY0 A;  5M3M G;  5M3M H;  2F03 A;  1CT1 D;  4GLV B;  2N3S A;  2IY5 B;  1H9S A;  3MXN A;  4U68 A;  1SN8 A;  1ZYR C;  3G6E A;  2A1A A;  4POF A;  3GTJ H;  1SYE A;  4LFA Q;  3TZD A;  2Z8L A;  4FYD A;  4DNT B;  2E2I B;  2X6G A;  3GV3 A;  4G7O C;  4GKK L;  4WFN 3;  2F0S A;  1Q8K A;  2B2T A;  3M7G A;  2C5C A;  3MXU A;  2A6H D;  4PG3 A;  3S1R H;  2PZW A;  1L2F A;  1RTN A;  2L0C A;  3ND8 A;  4OEL B;  3GTQ B;  5C44 G;  1I5F A;  1M1K C;  3NP8 A;  2DNC A;  3MC0 B;  3T16 A;  5ISR A;  1Y8P B;  5D3I B;  3G4S A;  1CHQ D;  5E1F A;  3J81 i;  2MFI A;  1PH5 A;  3L3O C;  2JA6 B;  2HCI A;  3H94 A;  3MFG A;  4A3D G;  3KDF B;  2PW5 A;  4ALP A;  1MHW C;  4HAE A;  3A8K E;  5LL6 S;  2R7Z H;  2EE1 A;  2NYZ D;  4KHZ A;  4JPB W;  1CSQ A;  2BDO A;  4RWS C;  1EY5 A;  1IHZ A;  4A3J H;  4MNO A;  5ELD A;  2B2Y A;  4DXF A;  1HZC A;  2Q2U A;  2HIX A;  2QEX A;  1QWY A;  3S1N H;  2AHO B;  1WTV A;  2F0U A;  1VQN A;  4FF2 A;  2K05 A;  4GOP A;  1DON A;  4IJH A;  4G7Z C;  2LFN A;  2UUB Q;  3PUV A;  1EY8 A;  3GV6 A;  1GVP A;  4B9X A;  3PCO B;  4M1U B;  4BY7 G;  3CQZ B;  1X56 A;  3SVM A;  2ZTD A;  3EJI A;  1Y1V G;  3CKI B;  5A2Q E;  1EWI A;  1UUP A;  2K5N A;  4RHS A;  4F8M A;  4DV7 L;  1BO0 A;  5D14 A;  3S17 H;  3U50 C;  3U4Z A;  2Z0S A;  2I5M X;  2A6H C;  3MEF A;  2NVT H;  1KAW A;  2EY6 A;  4Q5V A;  2WAQ E;  1O7L A;  1WD0 A;  1MBY A;  4X65 Q;  1EEI D;  4L63 B;  3S9W A;  1EU4 A;  5IOC A;  2VUM G;  2V1C C;  3I7F A;  2CFM A;  4IPC A;  2L12 A;  4RAU C;  1IBK L;  2K5H A;  1YNX A;  3BYT B;  1XTD A;  1Q8I A;  1SMY D;  1V43 A;  1Q82 C;  2OQ0 A;  3ZJY C;  2WAQ B;  5KYL A;  4LF6 Q;  1VQL A;  4DK6 C;  5IT9 E;  3H3V I;  1TWF H;  4IUU A;  3K6O A;  1DOL A;  3Q24 A;  1FJG L;  4DK3 C;  3S1N B;  2D2C C;  1KXL A;  5C3W A;  2H1E A;  1Z47 A;  4IN3 A;  1PRT D;  5K36 H;  1LYL A;  2AQ1 B;  1IYV A;  4A3G G;  2XRQ D;  1S5C D;  4XT1 B;  4AIM A;  1TWH B;  2HQE A;  3GTK H;  4QMG A;  4A3C H;  1EZ6 A;  1FGU A;  1MSH A;  4NPS A;  3MZ5 A;  1EU3 A;  2JSO A;  5JOB A;  5AJ3 Q;  3NQI A;  4OWW B;  4NMZ A;  1PH7 A;  3GTL B;  1M90 C;  4DV4 L;  3SK8 A;  1IW7 D;  1B4O A;  3SDZ A;  5JEA G;  2Z6K A;  3OIQ A;  5M5X H;  2MNA A;  1EL0 A;  2E2D C;  1D5Z C;  1JJC B;  3IAY A;  4IUP A;  3QB3 A;  1JMC A;  1SND A;  1GUS A;  3E9I A;  1N33 L;  3K80 C;  4JI6 L;  2KED A;  2L5T A;  4L6T B;  1BCP B;  5E3F A;  2EYH A;  5ELF A;  4FVM A;  3CC2 A;  2EYL A;  1DXM A;  2ZJR A;  2C35 B;  3S14 B;  1JWS D;  2E75 C;  4CJ0 B;  1ET6 A;  1V1Q A;  4DPG A;  1U5K A;  5IWA L;  3S16 H;  4PZ7 A;  4L5T A;  1FD7 D;  5IYB G;  1J6Q A;  3HOY B;  1CZW A;  2RDH A;  4AYB B;  1QG7 A;  2F4V L;  1UE6 A;  5IP9 H;  1F9P A;  4N8X 1;  4KMU C;  5BN4 A;  4GKJ Q;  3ER0 A;  4IFD J;  1JWM D;  2RQX A;  4JI3 L;  3TDQ A;  3F1Z A;  3NWT A;  4UPA A;  3HS0 C;  2OXP A;  4DNR B;  1QVF A;  3S15 H;  3HKZ E;  2Z9H A;  1M8A A;  3SEB A;  2XVS A;  2KCN A;  1FJG Q;  5HY6 A;  4JI0 L;  4HTH A;  4B3T L;  2PW7 A;  3HOV B;  5FOB B;  4EX5 A;  1NMF A;  4NW2 A;  5IYC H;  1EEF D;  3RN5 A;  3PUZ A;  3BJU A;  1PH9 A;  3PV0 A;  4BY1 H;  4BBR H;  5GRO A;  1HTP A;  2QDB A;  2JYO A;  4DUZ L;  4OX9 L;  3A5Z B;  1R9T B;  1N8R C;  1X54 A;  3GTJ B;  3H0G B;  5C4J B;  2KBN A;  3QO2 A;  1Y8N B;  3F2B A;  3HKS A;  3J81 j;  4ZK9 B;  1K8O A;  2LMC B;  4TRD A;  1SYB A;  2ENB A;  1PH6 A;  4DV3 L;  5EQ0 A;  4ME5 A;  1N36 L;  1HXY D;  5CYU A;  3CCE A;  1A8V A;  2WAC A;  5FO7 B;  5I6Y A;  1IL2 A;  1JB7 A;  3HOZ H;  3PO3 G;  1FVI A;  1SE8 A;  4A3B B;  1LLR D;  3TRZ A;  4GZY C;  5FJ8 H;  2IHE A;  1EYD A;  1LT3 D;  2SOB A;  4NP5 A;  3PIP A;  4POG A;  2F0E A;  5I9O A;  1G2T A;  4XIG S;  3TS2 A;  2JEB I;  1MJE A;  1S5B D;  2Q8T A;  1LO5 D;  2Q2I A;  1GHJ A;  4G4K A;  2GA4 B;  1TXY A;  4NB3 A;  1IBM L;  3J80 c;  1X3E A;  1AP0 A;  1PZJ D;  1PH1 A;  4A3I H;  2R93 H;  4B3S L;  4UAI A;  1PLF A;  1NJI C;  3I91 A;  1ILP A;  4FF3 A;  4K2K A;  2WB1 E;  4K5X A;  1AH9 A;  5COY A;  3CC7 A;  2E2I H;  2AMC B;  1K83 H;  3S2H H;  1EY6 A;  4ILW A;  1HHV A;  4GLX A;  4LFC L;  2R3Z A;  4X62 Q;  1CK1 A;  1J8I A;  4K6L A;  2OEO A;  2L1B A;  3D8G A;  3H3V C;  3W1G A;  4JV5 Q;  4JOI A;  3CC4 A;  3S16 B;  2NN6 G;  1YIT A;  2QEJ C;  3HOY H;  3KOJ A;  2ICE C;  2NZ1 D;  5EPK A;  3BS1 A;  2B63 G;  2EQS A;  4BS9 A;  2G9H D;  1GD7 A;  2NN6 I;  4C3I G;  2JP1 A;  1CKO A;  5KEE A;  3TQY A;  3V05 A;  2G9D A;  5EKL A;  3AQQ A;  3I4L A;  2EXZ A;  2F0H A;  3I4N G;  3D6C A;  3PF5 A;  5H1S E;  1NSN S;  4RKB A;  1ILQ A;  3TP6 A;  4FO2 A;  5ELB A;  1HFG A;  5EBD A;  2YU9 H;  1MKH A;  4YY3 Q;  1RTO A;  2E5L L;  5C6A A;  3AU7 A;  1Z7T A;  4C3H G;  3NEM A;  5DNF A;  3M4Q A;  1QOH A;  2PCF B;  3UDF A;  5T1G A;  3I4M H;  3S1Q B;  4HID A;  4R8I A;  3T1H L;  1HR0 Q;  1SFO H;  1L1O A;  3KFU A;  4LW1 A;  2A69 C;  1D1K A;  1GUT A;  2E8G A;  1PH2 A;  4HCS A;  1DM0 B;  3K0X A;  3OW7 A;  2DJF C;  5CV9 A;  4FXK C;  3RNU A;  2B2W C;  1X9N A;  4L8J A;  2R61 A;  4MHE A;  2QIL A;  3W2D A;  4K5V A;  3ULP A;  4A3M H;  3E9H A;  4GKJ L;  3BG3 A;  4JI2 Q;  4IPG A;  2JA7 B;  5BR8 Q;  1EOT A;  1XXG A;  1ET9 A;  4X6A H;  1WTQ A;  1H9M A;  4R9W A;  1PTO H;  1FGB D;  5CGK A;  3SK4 A;  4HJ7 A;  1KRT A;  4KHP L;  2OTJ A;  5TSS A;  1OXV A;  2R92 H;  4XXE A;  3KJP A;  4FF4 A;  2ICI A;  3AFQ A;  4F7X A;  4HJA A;  3K59 A;  4YY3 L;  2RSN A;  4DR7 Q;  4DK1 A;  2WAQ G;  1U9R A;  1N34 Q;  2A8V A;  5JEA J;  2UU9 L;  2UUB L;  1TWH H;  4L5R C;  1PRT B;  2IWH A;  1Q3L A;  2M00 A;  1JIC A;  2FFK B;  3S1M H;  3A7A B;  4C3J B;  5HGQ A;  1SNM A;  3S1M B;  2A19 A;  1WTO A;  1SE2 A;  1WYD A;  2EIF A;  3VR6 A;  3M85 A;  4RCN A;  1N36 Q;  3FKI B;  1XNQ L;  1P16 A;  4B3M Q;  3RZD B;  4K8J A;  2PMZ E;  2MP1 A;  2A74 C;  3EA6 A;  1RF2 D;  2H4O A;  4NXM Q;  2JA6 H;  2GN5 A;  2WB1 B;  2XWB B;  4DA2 A;  1G6P A;  1IKL A;  4DR3 L;  1NTG A;  3R2I A;  2WII B;  1VQP A;  1KQS A;  5M3F H;  3MAQ A;  3HZX A;  4LF8 Q;  1HPC A;  4XQQ A;  4YIJ A;  5M3F B;  4KKS A;  4LUZ A;  3F2C A;  4RH6 A;  1LAB A;  1CZG A;  1SYG A;  2YTY A;  4P75 A;  1I50 H;  4N8F A;  3C46 A;  1CKN B;  2DNE A;  2B29 A;  1BOS A;  1Q90 A;  3SXH A;  1B53 A;  3SE0 A;  3HOW H;  4HIK A;  4UP7 A;  2HCC A;  1NUC A;  4LFC Q;  1H9S B;  4MZ9 A;  2Q8R E;  3S2D B;  1CFM A;  2BDN A;  1RJT A;  1C7Y A;  2MJ8 A;  1CA6 A;  1GHK A;  1SE4 A;  3BYY B;  1EYG A;  3HOU G;  3U9O A;  4YHH L;  3CCR A;  3GTP B;  5C0X G;  4B3S Q;  3DHQ A;  1UEB A;  5L37 A;  5IGE A;  2F0D A;  2CW0 C;  1KAA A;  3KF6 B;  3M4O B;  3P75 A;  2KCT A;  1PTO C;  3F2U A;  1TWG B;  4MIU A;  2O4X A;  5IYD G;  4HSP A;  4RG1 A;  3I55 A;  1CSP A;  2PZU A;  2B3G A;  1F9S A;  4S3S A;  2VB3 X;  4JBJ A;  4DV5 L;  1Y1W H;  5G3L F;  4BY1 B;  1QJO A;  1WOC A;  3CPF A;  4KK7 A;  1YNN C;  1PV4 A;  1HRJ A;  1PTO F;  1VQ6 A;  1MI2 A;  3E5S A;  1XNR Q;  1TY2 A;  1VQJ A;  4L5Q A;  5ELC A;  3CD6 A;  3WOE A;  3G71 A;  1H95 A;  4DXG A;  1XPR A;  3MFY A;  2KQ3 A;  2N8N A;  1D5X C;  3RD4 A;  1AE3 A;  2Y0S E;  4J1M A;  1V1P A;  2E2J H;  4I7A A;  3HOX H;  4DR5 L;  4DR4 L;  1EY4 A;  2E2J B;  3IL8 A;  5I9P A;  4JI7 L;  3RR5 A;  1YHA A;  1BKB A;  2I0Q A;  3WDN A;  2JA5 B;  4IPH A;  1Q81 C;  4DFA A;  3T56 B;  1ASY A;  1H9R A;  4BBS B;  3L9A X;  1BR9 A;  1T5X D;  5E4X A;  1D2B A;  4OIJ A;  1HNX Q;  3J80 i;  1H9J A;  4ID6 A;  5IWA Q;  1KIX A;  4IZ8 A;  1Q46 A;  4A3F H;  2YV5 A;  2CCZ A;  4FNF A;  5JJK A;  4B9W A;  4A3F B;  3K57 A;  1SNC A;  4A3K G;  2E2H H;  4BBR B;  4LF6 L;  2AQ2 B;  4XYQ A;  2HD3 A;  1WCM B;  4KHP Q;  3DWQ A;  1DJR D;  1HA6 A;  1S5D D;  1IKM A;  1EIG A;  1IL8 A;  1LTR D;  1WTX A;  2M2L A;  2HDM A;  1E22 A;  2R7D A;  3RLN A;  2MO0 A;  3V2T A;  3NUC A;  2KEN A;  4A3E B;  2IX1 A;  1VDZ A;  3LWU A;  4IJL A;  2YTX A;  4ODG A;  1EYC A;  1STG A;  4V19 0;  1MJC A;  4C2M H;  2RBM A;  5M5W H;  4DV0 L;  5CC4 A;  2NUC A;  4DAY A;  4H0L C;  3DLL A;  4JI8 Q;  1EUJ A;  1V9P A;  2Z4H A;  3PO3 B;  1K8M A;  1LTB D;  3HOU B;  1UE1 A;  3PUX A;  4JI7 Q;  1W2B A;  1ESR A;  4JYA Q;  1KHI A;  2IHF A;  3O13 A;  4HJ9 A;  1HR0 W;  4YCW A;  3B6Y A;  1B2T A;  2F0J A;  3RUZ A;  3H15 A;  1RD9 D;  1TS2 A;  2E2H B;  4N9P A;  5IT9 L;  1IBM Q;  1B7Y B;  3H0G G;  2L55 A;  5FKA C;  1ZEQ X;  3HRZ C;  4F87 A;  3D3R A;  3UE1 A;  1HZB A;  1WCM G;  1SBB B;  1GXD C;  4RGM A;  4OWX B;  5CV6 A;  1BQQ T;  4A3K H;  2FMC A;  1SJH D;  1WFQ A;  4OON A;  1ICW A;  5GAD C;  3K58 A;  4A3F G;  3BZC A;  5ELN A;  2MHV A;  3NBI A;  3PIO A;  1GO3 E;  1QCB D;  2EJM A;  4P72 A;  2CH4 W;  2EY1 A;  3FKI G;  3NBH B;  1LUZ A;  4LAA A;  1ZYR D;  3M3Y H;  3W1B A;  1YNJ D;  4C3J G;  5IGD A;  2V4D A;  1K9M C;  3GDE A;  2K5V A;  4XYO A;  1Y69 U;  1C48 A;  4DV5 Q;  1NAP A;  2CQA A;  1N32 Q;  1HNZ L;  4GKK Q;  4DUZ Q;  1VMP A;  5G3L D;  5JAV A;  1R9T H;  3D31 A;  4TVA B;  2LXJ A;  4DNI A;  1EQR A;  3SR1 A;  4CBV A;  1YNN D;  2OTL A;  3QIA A;  3CCM A;  2VXW A;  3A7L A;  3Q23 A;  1NMG A;  1IZ6 A;  1A3U A;  4A3L G;  4JK1 C;  5KIX A;  4CKE A;  3CRK C;  4GNX A;  3FP9 A;  2MGS A;  3A55 A;  4IO9 A;  3KJO A;  1I3Q B;  4J15 A;  1Y14 B;  1CKN A;  4AYB E;  4F88 A;  5C4Z A;  2OWO A;  2IL8 A;  4IUT A;  2KEC A;  3TME A;  4DAP A;  4X3K A;  1PA6 A;  3C2P A;  1JE4 A;  2D62 A;  2HIV A;  3D0F A;  4R8N A;  4ZLT F;  1JJG A;  1AEX A;  4C2M B;  2JA9 A;  4XTC S;  3ERO A;  4DF7 A;  2TMP A;  3I90 A;  2KEE A;  1VQC A;  1KNA A;  4RGT A;  3PUY A;  4X3T A;  2ZTC A;  3AEV A;  2ZM6 Q;  2ZJQ A;  3MTS A;  3JC6 6;  4GN5 A;  4HN7 A;  1VQF A;  4QL5 A;  1YNJ C;  1BCP C;  3I4M B;  1EIH A;  2LKV A;  5BN5 A;  3Q6S A;  3R93 A;  1NY4 A;  1PFB A;  2F0O A;  1EZ8 A;  2NZH A;  3N52 A;  2UUC Q;  1L0X B;  2CKZ B;  3ITP A;  4C1N I;  5EPL A;  3ULL A;  4ZYS A;  1KL9 A;  1E2V A;  2KOL A;  2VW9 A;  5A35 A;  5CBA E;  3GTK B;  5I4D A;  3FHW A;  4ULL A;  2EYO A;  5M3F G;  3HKZ B;  3L7Z C;  5CV5 A;  1A3V A;  3GTP H;  2WV6 D;  1TQO A;  3RZO H;  4X66 L;  2K33 A;  5DM7 3;  5FLM H;  3QOL A;  1EWC A;  1NCV A;  1AW7 A;  2BE5 C;  1AZP A;  1ZXT A;  2AKW B;  2B63 B;  2IT1 A;  4CJ2 C;  1Q86 C;  4NXM L;  4PZ6 A;  3BU2 A;  1N33 Q;  4DV0 Q;  4G7H C;  1JJ2 A;  1VQ7 A;  4JI6 Q;  3J80 E;  1I4P A;  5J1Z A;  1WTP A;  4B08 A;  1N9W A;  2JN4 A;  1PRT F;  4A3I B;  4DUY L;  1Z9F A;  2GVA A;  1XX8 A;  1LAC A;  3VR3 A;  2NWG A;  4LF8 L;  1UEA B;  2YU9 B;  1WI5 A;  1YZ6 A;  2H5X A;  4QB4 A;  2NB0 A;  2VQF Q;  2D5D A;  4IOC A;  3N6R A;  2PNR C;  5AJ3 L;  1YI2 A;  5FLX L;  3A54 A;  2YYZ A;  1HZA A;  3CP0 A;  1MGS A;  1KRS A;  4HMI A;  1O78 A;  4DV6 L;  4LF7 Q;  2O5J C;  4B3M L;  3A8I E;  4FDB A;  3NXW A;  1XTC D;  3IFD A;  1A2T A;  2K4K A;  4QGU A;  3VDY A;  4LFB L;  4WRD A;  2F0I A;  4LF5 L;  4JBK A;  3T53 B;  1IBL Q;  1TU2 B;  2I5L X;  2DY8 A;  1SYD A;  2PQE A;  4A3M B;  3VR2 A;  2WKC A;  2NVX B;  1R4Q B;  2F0Q A;  3GTQ H;  4LF9 L;  1PYS B;  3M7N A;  1GJX A;  1DZ1 A;  4IUQ A;  3WOF A;  4O1N A;  2F4V Q;  2F1M A;  4QUF A;  4BBS H;  1MIU A;  3NE5 B;  3L2P A;  4A3B G;  1T5E A;  1TWA B;  1C8C A;  2RKS A;  3J81 E;  4Y7N H;  2JA8 H;  4JI5 Q;  4DK0 A;  1NBW A;  1HNZ Q;  1WCM H;  2KCC A;  1B9N A;  5IP7 G;  3H6M A;  4TSS A;  2B2U C;  4A3E G;  1LTG D;  3EIV A;  1VQI A;  3KBX A;  1BNZ A;  1QE6 A;  2F0K A;  2A68 D;  2F0P A;  3PF4 A;  2RHS B;  5IP7 H;  3J7A V;  4C3H B;  3BZD B;  3K7U C;  1SYF A;  3OHX C;  1A63 A;  1ZKO A;  5D65 A;  2RDG A;  3OMC A;  1VMC A;  1YJ9 A;  3LNN A;  3NTK A;  2UXC Q;  2E76 C;  5DLQ E;  1JC7 A;  4C3J H;  1CI3 M;  3GTG B;  4BBS G;  5FLM G;  2L4N A;  2MO1 A;  3BZK A;  1G6Z A;  2JA5 G;  2ZXP A;  1NE3 A;  1TS3 A;  3JAM i;  2MUY A;  1G29 1;  1OXU A;  4ZUJ A;  1KD1 C;  1CQV A;  2XSC A;  1JOR A;  3FDT A;  2BA0 A;  3K5N A;  3HOY G;  1PFM A;  2RSO A;  2B2Y C;  4A93 B;  4J8Q A;  2EYP A;  3GQB A;  3PSI A;  5EKK A;  3DM3 A;  1OXS C;  3MEH A;  4GN3 B;  3HOW G;  4GNX B;  3K8A A;  2R92 B;  3ULJ A;  2Y0S B;  1ENC A;  4LWC A;  1NR4 A;  1ROD A;  2PPB C;  2UXB Q;  3TBI B;  1TS4 A;  3LWE A;  3WWV A;  1EY0 A;  5C4X G;  1LM0 A;  4JCV E;  1PFS A;  4K2L A;  1FNW A;  5NUC A;  2KVM A;  2WKD A;  2BOS A;  1X65 A;  2QF7 A;  1B50 A;  3GD7 A;  4RCO A;  3T1Y Q;  2N88 A;  4B3T Q;  3J81 L;  2DJG C;  4DV1 L;  4J6H A;  3HOZ B;  4LF4 L;  1YEZ A;  3TEH B;  2K5W A;  2K03 A;  3HGB A;  1DYQ A;  5GAE C;  5GQO A;  1CQF A;  3NEL A;  5M5Y H;  1D1I A;  1IYU A;  3MA2 B;  1B3Q A;  3K7A H;  5K5P A;  2HHH Q;  4JV5 L;  4DV4 Q;  1CM9 A;  2F0N A;  1QZG A;  3KLS X;  1YJN A;  1PMR A;  1HUM A;  2IJ0 A;  1KLU D;  1G51 A;  1PZK D;  3MXP A;  3S1Q H;  4PMW A;  4A3L H;  4UDU C;  2F0T A;  2CWA A;  1QNK A;  3IKJ A;  5KGU A;  3P20 A;  4I7Z C;  4A3E H;  2VUM B;  2AQ3 B;  4NXN Q;  1LTT D;  3KLW A;  2BA1 A;  3PIP 3;  2LSS A;  4DR4 Q;  2F0F A;  4QF4 A;  2F0G A;  4QCL A;  1D5M C;  5M9O A;  2EY2 A;  1JE5 A;  3J80 L;  1GUG A;  2CWP A;  2QW7 A;  2I5H A;  1W3S A;  2B8G A;  2WB1 G;  4PZ8 A;  4LF5 Q;  4I65 A;  1K28 A;  4QQB X;  4JBM A;  3KDF A;  1I4X A;  5JPN C;  5D3D A;  3CCJ A;  4KV6 A;  2AUJ D;  3BDO A;  1HH2 P;  3L0O A;  1HNX L;  3T1H Q;  1STB A;  3CAM A;  5EKI A;  1TR5 A;  2WIN B;  1YVC A;  4Y52 H;  4DV7 Q;  1PYB A;  1L0W A;  1BXT A;  4ZKB B;  3FMC A;  1VQM A;  2F0M A;  4K8I A;  2K5D A;  1G91 A;  1L0Y B;  1EFW A;  1BDO A;  5GAG C;  3QR8 A;  1A0I A;  3OW2 A;  4N9T A;  2Q2H A;  4AYB G;  2CH4 A;  3J7A F;  1VF5 C;  3H0G H;  4OHJ A;  1VS0 A;  5LHY 1;  3CF5 A;  1S3O A;  4EQP A;  4JI4 L;  1JT8 A;  4PQX A;  3I4M G;  3C1F A;  3BVM A;  1Q12 A;  4OX9 Q;  2PNH A;  1EOV A;  4XQN A;  2RCN A;  3GP7 A;  1C9O A;  3F2D A;  3X3M A;  1B3A A;  2A73 B;  4KD4 A;  1PH3 A;  2FMM A;  2KHI A;  2NTS A;  4P74 A;  2J7Z A;  3CXC A;  1TY0 A;  1RKN A;  3KF6 A;  2K28 A;  1PZI D;  1HQR D;  4X3S A;  1GM5 A;  1MSG A;  1O7I A;  1WTW A;  3FKI H;  1TWA H;  3W3A A;  3LGJ A;  3IRB A;  4A3C G;  5ELO A;  2F3I A;  3RLF A;  4KKU A;  1SNO A;  3TP7 A;  3LX0 A;  2F0L A;  1BF4 A;  4A3G B;  1JOK A;  2L15 A;  2EDG A;  5C4X H;  5J39 A;  3NPP A;  2QKI C;  3KK7 A;  2R93 B;  4KN4 C;  4O2D A;  3VR4 A;  5EBC A;  5CMD A;  1E2Z A;  3TRE A;  4DAY B;  1XNQ Q;  4OIK A;  5T1I A;  2SDF A;  5KNB A;  4KHV A;  2R6G A;  3MHB A;  5DM6 3;  4DR1 L;  3HFZ B;  5ELE A;  4JI1 L;  2UXB L;  2D9U A;  1STH A;  1AZQ A;  3M4Y A;  5JPM C;  3G6J B;  3U4V A;  1DOK A;  1KLG D;  2LS0 1;  3OSO A; 
#chains in the Genus database with same CATH homology
 3FPU B;  1EWH A;  3K5L A;  5FO8 B;  3OPO A;  1JOO A;  1LTS D;  3VA5 A;  2C9O A;  5M5W B;  2Z1C A;  3T51 B;  4RFB A;  3M3Y B;  3R2T A;  5IGG A;  1Y1V B;  4HMJ A;  3MWY W;  1JOQ A;  4BY7 B;  1LT5 D;  3IFT A;  4EVO A;  2OT2 A;  4IAL A;  1GOZ A;  2B2V C;  2RA4 A;  3I8Z A;  3EQL C;  1I50 B;  3HEJ A;  2IW3 A;  1GUN A;  1E2W A;  4KJN A;  4TQU S;  2J0T D;  1RDP D;  1CA5 A;  4A3D B;  5FLX E;  3D4D A;  5A2Q L;  4IUR A;  4WJW A;  4OL7 A;  5BN3 A;  2NVY B;  4C56 C;  4ZAI A;  4FXD A;  3TP8 A;  5COR A;  1V1O A;  1X32 A;  2N55 A;  1EYA A;  3T13 A;  2EYM A;  2K1B A;  1V1P B;  1E0B A;  1LTA D;  3FEW X;  4Z9C B;  2KUM A;  2NVQ B;  2XN9 C;  4KKT A;  3KLR A;  3D4R A;  1K83 B;  1S4Z A;  1SEB D;  1DOM A;  4BA2 I;  1LT6 D;  3CU7 A;  1STA A;  4KTA A;  3HOW B;  3HG9 A;  1KDB A;  4RGN A;  5EJW A;  1M4V A;  2XNA C;  1U4M A;  3VYT A;  1Y8O B;  2Z4I A;  2OF1 A;  1WTR A;  4EQO A;  3RMH A;  2K04 A;  3CRL C;  3DWA A;  3DXJ C;  1Q1E A;  5JVH 3;  2EY5 A;  1PXU A;  1U4L A;  3K0Y A;  4CKB A;  4KI0 A;  2DY7 A;  5E4W C;  2IX3 A;  3GTO B;  2R7Z B;  2Q8I B;  2JEA I;  4JBW A;  3ERQ A;  1R4P B;  5FO9 B;  1XYI A;  1JCK B;  1EY9 A;  1QIL A;  2EOT A;  5IGB A;  4QIW B;  2EPB A;  4ZQ3 A;  4RGO S;  4X3U A;  1TT2 A;  2O5I C;  3X3N A;  2L11 A;  1I6H B;  5AFW A;  3KBG A;  1H9K A;  2X6L A;  4KY7 A;  4CGY B;  3S17 B;  1PTO D;  2L9H A;  3QWN A;  2XIW A;  1I4G A;  3SHL A;  1A2U A;  1F2Z A;  1TVX A;  5I6W A;  5M5Y B;  1PTO B;  5C5M A;  4DGZ A;  4WOR A;  4KN7 C;  2LY7 A;  1WVL A;  3GTM B;  1CHP D;  5IGC A;  4KD3 A;  2O2L D;  5C5L A;  4BWG B;  4XT3 B;  4RA8 A;  5I2Y A;  3QG1 A;  2PZT A;  1PDQ A;  1STE A;  5J22 A;  1BCP F;  4C1N K;  3A8J E;  4BA1 I;  4IFD I;  1O7Z A;  3JAM L;  2ZT9 C;  1SXT A;  2EJF C;  1RHP A;  4XDX A;  4KY5 A;  1FNV A;  2K6A A;  4H44 C;  5KND A;  3TN2 A;  3NSW A;  2RDF A;  1FNU A;  3TZU A;  4CJ1 B;  5HGT A;  3TP5 A;  2NN6 H;  3K7A B;  1D6E C;  3DEO A;  1F2M A;  1KDA A;  3H09 A;  3D6W A;  3SK6 A;  3HP3 A;  3NWS A;  5C3X A;  1UAP A;  4EGV A;  1QNU A;  4XQJ A;  1HFN A;  5F2D A;  4DAV A;  1FYC A;  1KNE A;  3E0J A;  1EQV A;  3R3O A;  1J9O A;  5KYI A;  4OO1 H;  3KLS A;  1LTI D;  2HUG A;  3EFX D;  1HUN A;  1SNP A;  2KJX A;  2SNS A;  3PO2 B;  1LV9 A;  1SAP A;  3E6Z X;  3KUP A;  2A6E D;  2EJG C;  1S5E D;  2JXM B;  1AFP A;  3DWP A;  3NK9 A;  1A15 A;  3NQT A;  2B39 A;  1JB3 A;  3QOJ A;  3NTI A;  4EQN A;  4MN3 A;  2ID0 A;  2J4X A;  4IQZ A;  3MXG A;  1ESF A;  2B2V A;  3PMF A;  2PYK A;  2K01 A;  2QCP X;  4IUN A;  1ML0 D;  1ENA A;  3Q0A A;  4G57 A;  2F3W A;  3J7Y W;  2IPK D;  4A3J B;  5M3M B;  3URY A;  3OMG A;  3A56 A;  1VF7 A;  3AMU A;  5KRU A;  1X3P A;  3VYU A;  1SMY C;  2EYJ A;  3S15 B;  2K7V A;  2RVL A;  3EVQ A;  1EY7 A;  4HED A;  3C3L A;  1OO9 B;  2SNM A;  3ND9 A;  4PMB A;  3U9S A;  2B8F A;  3V96 A;  5EPJ A;  1UNS A;  4OO1 I;  1SE3 A;  1EFI D;  1IW7 C;  1U4P A;  4DU9 A;  4HSV A;  3ZYY X;  2F4I A;  1I4R A;  1RCV D;  4KJO A;  3OWE B;  4LK1 C;  1B44 D;  1ENF A;  5HUR A;  2A5H A;  1LT4 D;  1STY A;  1PRT C;  4OGQ C;  1OXT A;  1KTK A;  1OXX K;  2WP8 J;  3S1R B;  4IUV A;  4CKC A;  3MVV A;  1Z6H A;  2JA8 B;  5C0X H;  3BVZ A;  5LL6 X;  3T4A C;  3OOC A;  5K36 G;  2KHS A;  2E74 C;  5C4H A;  4CHT B;  1F2Y A;  2KA7 A;  4Y7N B;  2EYF A;  4HR7 B;  4NDX A;  5CR3 A;  5KNC A;  3P1H A;  2A69 D;  1HA5 A;  3ONA B;  1Q1B A;  1TWC B;  2BE5 D;  2FHT A;  3I72 A;  3S2H B;  3BDL A;  2CW0 D;  1BUV T;  2XRS D;  3OIP A;  1X3Q A;  2VNU D;  3HOX B;  2AUK A;  1SDF A;  4A3K B;  1A3T A;  4PV1 C;  4DN4 M;  3R8B A;  4E6I A;  3BDC A;  2F3V A;  1G2S A;  2B2U A;  1DCZ A;  2PMZ B;  5JEA H;  2A6E C;  1PYW D;  1VCI A;  5IOD A;  4FF1 A;  5CV4 A;  4IFD H;  3FPP A;  1F77 A;  3DEP A;  3NBH A;  1S5F D;  3H91 A;  2K32 A;  4FXG C;  5C3E B;  1SSO A;  1KAB A;  1W6K A;  4K6D A;  3SK5 A;  4LJZ C;  1SJE D;  2K5Q A;  2CVR A;  1SFO B;  1TII D;  4FP5 D;  3K5M A;  1F2L A;  3DUZ A;  3P7J A;  2FJ2 A;  2B2W A;  3UI2 A;  5DAU A;  2A68 C;  1PFN A;  5JJZ A;  2EVB A;  3DMU A;  1I4H A;  3Q22 A;  5CBE E;  4HCE A;  1BCP D;  1JWU D;  1O7Y A;  1B1Z A;  2I46 A;  3I70 A;  1U4R A;  3C1E A;  1I6V C;  5I2X A;  4OO1 G;  4RHR A;  2F0W A;  1GUO A;  3KF8 A;  4Q0F A;  4K5W A;  2XWJ B;  1NR2 A;  3BVG A;  4PNY A;  5EGT A;  4ZUI A;  3AB9 A;  1HCZ A;  4U67 3;  2IX0 A;  3I4N B;  1DD2 A;  3NTH A;  4C3I B;  1HTL D;  1WD1 A;  4NKL A;  1EQT A;  2CHB D;  5CV8 A;  1SYC A;  1KDC A;  2B2T C;  2FIN B;  1STN A;  4K14 A;  5IIF A;  2AWN A;  1F9Q A;  5CV7 A;  3VA7 A;  1MD2 D;  1TKW B;  2SEB D;  4ZRZ A;  1BBX C;  4M8A A;  2VB2 X;  3PUW A;  1V8Q A;  1W6J A;  5IGF A;  3D4W A;  1ONL A;  4ZKC B;  2M9V A;  2TSS A;  1F9R A;  5C0X I;  1SNQ A;  2I07 B;  3OWF A;  3RZO B;  1TS5 A;  3PIO 3;  4QUC A;  3I3C A;  1CTM A;  4H7B A;  3TSS A;  5C44 B;  2EZV A;  4LMQ D;  4V0B A;  5C0X J;  1FR3 A;  3K5O A;  3JAM E;  5JVG 3;  4KY6 A;  4RKL A;  2NVT B;  3VR5 A;  4P2C B;  5M5X B;  5C4X B;  2PO4 A;  2JE6 I;  1C4Q A;  1AN8 A;  3NHH A;  2X69 A;  4ABN A;  3VYS A;  3QJY A;  1JQY D;  3VYR A;  1O80 A;  3DM1 A;  4H13 C;  4TKO B;  2MPM A;  1B9M A;  2NBF A;  2ZXR A;  3G7L A;  1A6X A;  1G8Z D;  1HQM C;  3GO5 A;  1GUW A;  2DN8 A;  2HDL A;  4IFD G;  4PMC A;  2AWO A;  3I73 A;  5FK9 C;  1I4Q A;  2BCO A;  1XWE A;  1QB5 D;  2F0V A;  1JR0 D;  2NTT A;  1Y1W B;  3CHB D;  3FVQ A;  1II3 A;  5DEH A;  4O42 A;  3FRP B;  1TWF B;  2ZXO A;  2F03 A;  1CT1 D;  1H9S A;  3MXN A;  4U68 A;  1ZYR C;  1SYE A;  3TZD A;  2Z8L A;  4FYD A;  4DNT B;  2E2I B;  2X6G A;  3GV3 A;  4G7O C;  4WFN 3;  2F0S A;  2B2T A;  3M7G A;  2C5C A;  3MXU A;  2A6H D;  2PZW A;  1RTN A;  2L0C A;  3ND8 A;  3GTQ B;  3NP8 A;  2DNC A;  3MC0 B;  3T16 A;  5ISR A;  1Y8P B;  5D3I B;  1CHQ D;  5E1F A;  3L3O C;  2JA6 B;  2HCI A;  3H94 A;  3MFG A;  2PW5 A;  4HAE A;  3A8K E;  5LL6 S;  2EE1 A;  2NYZ D;  4KHZ A;  2BDO A;  4RWS C;  1EY5 A;  1IHZ A;  5ELD A;  2B2Y A;  4DXF A;  1QWY A;  1WTV A;  2F0U A;  4FF2 A;  2K05 A;  1DON A;  4G7Z C;  2LFN A;  3PUV A;  1EY8 A;  3GV6 A;  4B9X A;  4M1U B;  3CQZ B;  3SVM A;  3EJI A;  3CKI B;  5A2Q E;  1UUP A;  4RHS A;  4F8M A;  1BO0 A;  5D14 A;  2A6H C;  2EY6 A;  4Q5V A;  1O7L A;  1WD0 A;  1MBY A;  1EEI D;  4L63 B;  3S9W A;  1EU4 A;  5IOC A;  2L12 A;  4RAU C;  3BYT B;  1Q8I A;  1SMY D;  1V43 A;  2WAQ B;  5KYL A;  5IT9 E;  4IUU A;  3K6O A;  1DOL A;  3Q24 A;  3S1N B;  2D2C C;  5C3W A;  2H1E A;  1Z47 A;  4IN3 A;  1PRT D;  5K36 H;  2AQ1 B;  1IYV A;  2XRQ D;  1S5C D;  4XT1 B;  1TWH B;  2HQE A;  4QMG A;  5JOB A;  1EZ6 A;  1MSH A;  2JSO A;  3MZ5 A;  1EU3 A;  3NQI A;  4NMZ A;  3GTL B;  3SK8 A;  1IW7 D;  1B4O A;  3SDZ A;  5JEA G;  3OIQ A;  1EL0 A;  2E2D C;  1D5Z C;  3IAY A;  4IUP A;  3QB3 A;  1SND A;  1GUS A;  2KED A;  2L5T A;  4L6T B;  1BCP B;  5E3F A;  2EYH A;  5ELF A;  4FVM A;  2EYL A;  1DXM A;  3S14 B;  1JWS D;  2E75 C;  4CJ0 B;  1ET6 A;  1FD7 D;  3HOY B;  1CZW A;  2RDH A;  4AYB B;  1QG7 A;  1F9P A;  5BN4 A;  4KMU C;  4IFD J;  1JWM D;  2RQX A;  3TDQ A;  3NWT A;  3HS0 C;  2OXP A;  4DNR B;  1M8A A;  3SEB A;  2XVS A;  2KCN A;  4HTH A;  2PW7 A;  3HOV B;  5FOB B;  4NW2 A;  1EEF D;  3PUZ A;  3PV0 A;  1HTP A;  2QDB A;  2JYO A;  1R9T B;  3GTJ B;  3H0G B;  5C4J B;  3QO2 A;  1Y8N B;  4ZK9 B;  1K8O A;  2LMC B;  4TRD A;  1SYB A;  2ENB A;  5EQ0 A;  4ME5 A;  1HXY D;  5CYU A;  2WAC A;  5FO7 B;  5I6Y A;  4A3B B;  1LLR D;  4GZY C;  1EYD A;  1LT3 D;  2SOB A;  4NP5 A;  2F0E A;  5I9O A;  1G2T A;  4XIG S;  2JEB I;  1S5B D;  2Q8T A;  1LO5 D;  1GHJ A;  4G4K A;  2GA4 B;  1AP0 A;  1PZJ D;  4UAI A;  1PLF A;  3I91 A;  1ILP A;  4FF3 A;  4K2K A;  4K5X A;  5COY A;  1EY6 A;  4ILW A;  1HHV A;  2R3Z A;  1CK1 A;  1J8I A;  4K6L A;  2OEO A;  2L1B A;  3D8G A;  3H3V C;  3S16 B;  2NN6 G;  2QEJ C;  2ICE C;  2NZ1 D;  5EPK A;  3BS1 A;  4BS9 A;  2G9H D;  2NN6 I;  4C3I G;  2JP1 A;  5KEE A;  3V05 A;  2G9D A;  5EKL A;  3I4L A;  2EXZ A;  2F0H A;  3D6C A;  1NSN S;  4RKB A;  1ILQ A;  3TP6 A;  4FO2 A;  5ELB A;  1HFG A;  5EBD A;  1RTO A;  5C6A A;  3AU7 A;  1Z7T A;  4C3H G;  5DNF A;  1QOH A;  2PCF B;  5T1G A;  3S1Q B;  4R8I A;  2A69 C;  1D1K A;  1GUT A;  4HCS A;  1DM0 B;  3OW7 A;  5CV9 A;  4FXK C;  2B2W C;  4L8J A;  2R61 A;  4MHE A;  2QIL A;  3W2D A;  4K5V A;  3BG3 A;  2JA7 B;  1EOT A;  1XXG A;  1ET9 A;  1WTQ A;  1H9M A;  4R9W A;  1PTO H;  1FGB D;  5CGK A;  3SK4 A;  5TSS A;  1OXV A;  4XXE A;  4FF4 A;  2ICI A;  4F7X A;  3K59 A;  2RSN A;  4DK1 A;  1U9R A;  5JEA J;  1PRT B;  2IWH A;  1Q3L A;  2M00 A;  1JIC A;  2FFK B;  3A7A B;  4C3J B;  1SNM A;  3S1M B;  1WTO A;  1SE2 A;  3VR6 A;  3M85 A;  4RCN A;  3FKI B;  3RZD B;  4K8J A;  2MP1 A;  2A74 C;  3EA6 A;  1RF2 D;  2H4O A;  2WB1 B;  4DA2 A;  2XWB B;  1IKL A;  3R2I A;  2WII B;  3MAQ A;  3HZX A;  1HPC A;  4XQQ A;  4YIJ A;  5M3F B;  4KKS A;  4RH6 A;  1LAB A;  1CZG A;  1SYG A;  3C46 A;  2DNE A;  1BOS A;  1Q90 A;  3SXH A;  1B53 A;  3SE0 A;  2HCC A;  1NUC A;  1H9S B;  2Q8R E;  3S2D B;  1CFM A;  2BDN A;  1RJT A;  2MJ8 A;  1CA6 A;  1GHK A;  1SE4 A;  3BYY B;  3U9O A;  3GTP B;  5C0X G;  3DHQ A;  5IGE A;  2F0D A;  2CW0 C;  1KAA A;  3M4O B;  3P75 A;  1PTO C;  3F2U A;  1TWG B;  4MIU A;  2O4X A;  4HSP A;  2PZU A;  1F9S A;  4S3S A;  2VB3 X;  5G3L F;  4BY1 B;  1QJO A;  4KK7 A;  1YNN C;  1HRJ A;  1PTO F;  1MI2 A;  3E5S A;  1TY2 A;  5ELC A;  3WOE A;  4DXG A;  3MFY A;  2KQ3 A;  1D5X C;  3RD4 A;  4J1M A;  1V1P A;  1EY4 A;  2E2J B;  3IL8 A;  5I9P A;  3WDN A;  2JA5 B;  4DFA A;  3T56 B;  1H9R A;  4BBS B;  3L9A X;  1BR9 A;  1T5X D;  5E4X A;  1D2B A;  4OIJ A;  1H9J A;  4ID6 A;  4IZ8 A;  4FNF A;  4B9W A;  4A3F B;  3K57 A;  1SNC A;  4BBR B;  2AQ2 B;  4XYQ A;  1WCM B;  3DWQ A;  1DJR D;  1HA6 A;  1S5D D;  1IKM A;  1EIG A;  1WTX A;  1IL8 A;  1LTR D;  2M2L A;  2HDM A;  3V2T A;  3NUC A;  4A3E B;  2IX1 A;  1VDZ A;  3LWU A;  4ODG A;  1EYC A;  1STG A;  4V19 0;  2RBM A;  5CC4 A;  2NUC A;  4DAY A;  4H0L C;  2Z4H A;  3PO3 B;  1K8M A;  1LTB D;  3HOU B;  3PUX A;  1ESR A;  3O13 A;  1B2T A;  2F0J A;  3RUZ A;  1RD9 D;  1TS2 A;  2E2H B;  4N9P A;  5IT9 L;  2L55 A;  5FKA C;  1ZEQ X;  3HRZ C;  4F87 A;  3D3R A;  1SBB B;  1GXD C;  4RGM A;  5CV6 A;  1BQQ T;  2FMC A;  1SJH D;  1ICW A;  3K58 A;  2MHV A;  3NBI A;  1QCB D;  2EJM A;  2EY1 A;  4LAA A;  1ZYR D;  1YNJ D;  4C3J G;  5IGD A;  2V4D A;  4XYO A;  1Y69 U;  1C48 A;  1NAP A;  2CQA A;  1VMP A;  5G3L D;  5JAV A;  3D31 A;  3SR1 A;  4CBV A;  1YNN D;  3QIA A;  2VXW A;  3A7L A;  3Q23 A;  1A3U A;  4JK1 C;  5KIX A;  4CKE A;  3CRK C;  2MGS A;  3A55 A;  1I3Q B;  4F88 A;  5C4Z A;  2IL8 A;  4IUT A;  2KEC A;  3TME A;  4DAP A;  4X3K A;  3C2P A;  1JE4 A;  2D62 A;  4R8N A;  4ZLT F;  1AEX A;  4C2M B;  4XTC S;  3ERO A;  4DF7 A;  2TMP A;  3I90 A;  2KEE A;  1KNA A;  4RGT A;  3PUY A;  4X3T A;  3MTS A;  4HN7 A;  1YNJ C;  1BCP C;  3I4M B;  1EIH A;  2LKV A;  5BN5 A;  3Q6S A;  3R93 A;  1PFB A;  2F0O A;  1EZ8 A;  3N52 A;  1L0X B;  3ITP A;  4C1N I;  5EPL A;  4ZYS A;  1E2V A;  2KOL A;  5A35 A;  5CBA E;  3GTK B;  5I4D A;  4ULL A;  2EYO A;  3HKZ B;  3L7Z C;  5CV5 A;  1A3V A;  2WV6 D;  1TQO A;  2K33 A;  5DM7 3;  3QOL A;  1EWC A;  1NCV A;  1AW7 A;  2BE5 C;  1AZP A;  1ZXT A;  2B63 B;  2IT1 A;  4CJ2 C;  4G7H C;  3J80 E;  1I4P A;  5J1Z A;  1WTP A;  4B08 A;  1PRT F;  4A3I B;  1XX8 A;  1LAC A;  3VR3 A;  2NWG A;  1UEA B;  2YU9 B;  4QB4 A;  2NB0 A;  2D5D A;  3N6R A;  2PNR C;  5FLX L;  3A54 A;  2YYZ A;  1MGS A;  4HMI A;  1O78 A;  2O5J C;  3A8I E;  3NXW A;  1XTC D;  3IFD A;  1A2T A;  4WRD A;  2F0I A;  3T53 B;  1TU2 B;  2DY8 A;  1SYD A;  2PQE A;  4A3M B;  3VR2 A;  2WKC A;  2NVX B;  1R4Q B;  2F0Q A;  3M7N A;  1GJX A;  1DZ1 A;  4IUQ A;  3WOF A;  4O1N A;  2F1M A;  4QUF A;  3NE5 B;  1T5E A;  1TWA B;  1C8C A;  2RKS A;  3J81 E;  4DK0 A;  2KCC A;  1B9N A;  3H6M A;  4TSS A;  2B2U C;  1LTG D;  3KBX A;  1BNZ A;  1QE6 A;  2F0K A;  2A68 D;  2F0P A;  3J7A V;  4C3H B;  3BZD B;  1SYF A;  3OHX C;  1ZKO A;  5D65 A;  2RDG A;  3OMC A;  1VMC A;  3LNN A;  3NTK A;  2E76 C;  1JC7 A;  1CI3 M;  3GTG B;  2L4N A;  1G6Z A;  2ZXP A;  1TS3 A;  2MUY A;  1G29 1;  1OXU A;  4ZUJ A;  1CQV A;  2XSC A;  1JOR A;  3FDT A;  2BA0 A;  3K5N A;  1PFM A;  2RSO A;  2B2Y C;  4A93 B;  4J8Q A;  2EYP A;  3GQB A;  5EKK A;  1OXS C;  3MEH A;  2R92 B;  2Y0S B;  1ENC A;  1NR4 A;  1ROD A;  2PPB C;  3TBI B;  1TS4 A;  3LWE A;  1EY0 A;  4K2L A;  1FNW A;  5NUC A;  2KVM A;  2WKD A;  2BOS A;  2QF7 A;  1B50 A;  3GD7 A;  4RCO A;  2N88 A;  3J81 L;  4J6H A;  3HOZ B;  2K5W A;  2K03 A;  3HGB A;  1DYQ A;  1CQF A;  1D1I A;  1IYU A;  3MA2 B;  5K5P A;  1CM9 A;  2F0N A;  3KLS X;  1PMR A;  1HUM A;  2IJ0 A;  1KLU D;  1PZK D;  3MXP A;  4PMW A;  4UDU C;  2F0T A;  1QNK A;  3IKJ A;  5KGU A;  3P20 A;  4I7Z C;  2VUM B;  2AQ3 B;  1LTT D;  2BA1 A;  3PIP 3;  2F0F A;  4QF4 A;  2F0G A;  4QCL A;  1D5M C;  5M9O A;  2EY2 A;  3J80 L;  1GUG A;  2B8G A;  4I65 A;  1I4X A;  5JPN C;  5D3D A;  4KV6 A;  2AUJ D;  3BDO A;  1STB A;  5EKI A;  1TR5 A;  2WIN B;  1BXT A;  4ZKB B;  3FMC A;  2F0M A;  4K8I A;  2K5D A;  1G91 A;  1L0Y B;  1BDO A;  4N9T A;  3J7A F;  1VF5 C;  4OHJ A;  5LHY 1;  4EQP A;  4PQX A;  3C1F A;  3BVM A;  1Q12 A;  4XQN A;  3GP7 A;  3X3M A;  1B3A A;  2A73 B;  4KD4 A;  2FMM A;  2NTS A;  2J7Z A;  1TY0 A;  1RKN A;  2K28 A;  1PZI D;  1HQR D;  4X3S A;  1MSG A;  1WTW A;  3W3A A;  3RLF A;  4KKU A;  1SNO A;  3TP7 A;  3LX0 A;  2F0L A;  1BF4 A;  4A3G B;  1JOK A;  2EDG A;  5J39 A;  3NPP A;  2QKI C;  3KK7 A;  2R93 B;  4KN4 C;  3VR4 A;  5EBC A;  5CMD A;  1E2Z A;  5KNB A;  4OIK A;  2SDF A;  5T1I A;  4KHV A;  2R6G A;  3MHB A;  5DM6 3;  5ELE A;  2D9U A;  1STH A;  1AZQ A;  3M4Y A;  5JPM C;  3G6J B;  1DOK A;  1KLG D;  2LS0 1;  3OSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...