1EY9A

Structure of s. nuclease stabilizing quadruple mutant t41i/p117g/h124l/s128a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey9A00
1SYCA 3QB3A 4J1MA 4QF4A 3C1EA 4EVOA 5F2DA 5I6WA 5IGGA 1EY5A 3P1HA 2F0VA 1EYDA 5C4ZA 4KHVA 5ISRA 4RKLA 2EYFA 4ZQ3A 4R8NA 2EYLA 5IOCA 2M00A 1EY6A 2PQEA 3V2TA 2EYOA 5HURA 1STNA 2SNSA 2PW5A 2F0GA 1A3TA 2PZUA 1STYA 2EY6A 1KDCA 3HEJA 5CV9A 1TQOA 1EY4A 4H7BA 2PYKA 4DGZA 4K6DA 5CC4A 2F0OA 3TMEA 5J22A 3PMFA 5E3FA 2SNMA 1A3VA 3MZ5A 5KIXA 3MXPA 4KTAA 3C1FA 4K5VA 4QMGA 4LAAA 4I65A 4RKBA 3P75A 5EKKA 5JOBA 4KY7A 3TP7A 5I9OA 1SYDA 3D8GA 5NUCA 3NHHA 2EY5A 1AEXA 1NSNS 2F0EA 2F0UA 2OF1A 3D4WA 3OSOA 4PNYA 5J1ZA 3NXWA 5KGUA 4DF7A 1RKNA 4IALA 4B9WA 3NQTA 2WACA 1JOOA 5IGFA 1A2UA 5CR3A 5CV7A 4WORA 1STHA 2F0KA 3SK4A 1EY0A 4NP5A 3SHLA 5DAUA 3S9WA 3NK9A 2KQ3A 4KV6A 4WRDA 5KRUA 4IZ8A 2EYPA 1ENAA 3MEHA 4OL7A 1STBA 2RDFA 3T13A 4S3SA 4N9TA 5EKLA 2O4XA 2PW7A 3BDCA 1A2TA 1TT2A 4HTHA 4K14A 4MIUA 2RKSA 3SR1A 5IGEA 5J39A 4NKLA 4ZUIA 3D4DA 3VA5A 1SNPA 1SNQA 3E5SA 5CGKA 1EZ6A 2KHSA 4ID6A 4G57A 4K5XA 4KJNA 2F0NA 3MHBA 4ME5A 2EYHA 4ODGA 2F0SA 2F0TA 1JORA 4ZUJA 5C6AA 3R3OA 5JAVA 1SYGA 1SNCA 1SNMA 1SYFA 2F0JA 1F2YA 5IIFA 5I6YA 5C3WA 5EGTA 5IGBA 4F7XA 1JOKA 2EYJA 1A3UA 5KYLA 1F2MA 5C3XA 1KAAA 2RBMA 5DEHA 3SXHA 2F3VA 2QDBA 1STAA 3EJIA 4KY5A 3DHQA 2F0WA 2F0QA 4YIJA 3H6MA 1EYAA 4IUNA 3SK5A 2EYMA 4EQNA 1EY7A 2PZWA 4K2LA 2F0DA 1JOQA 3RUZA 2F0LA 1SNOA 5IGDA 4KD3A 4K2KA 3U9OA 4K5WA 5IODA 1EY9A 4DU9A 5E1FA 2F0IA 4EQOA 1F2ZA 2F0HA 3NUCA 1U9RA 1EY8A 2EXZA 3D6CA 5KYIA 3HZXA 3NP8A 1EZ8A 1SNDA 1STGA 3QOJA 2F3WA 3EVQA 3EROA 2OEOA 3QOLA 2F0PA 3ERQA 3TP6A 5C5LA 4PMCA 5IGCA 5M9OA 4KD4A 1KDBA 2EY1A 1TR5A 4HMJA 3SK8A 2HQEA 4KJOA 3LX0A 3SK6A 1KABA 2PZTA 3DMUA 3OMCA 4J6HA 4N9PA 3OMGA 4KY6A 4NDXA 4E6IA 4F8MA 5C4HA 4TRDA 4HMIA 3BDLA 1SYEA 1NUCA 2ENBA 4QB4A 5CV4A 4K8JA 4NMZA 3OWFA 1KDAA 2OXPA 4PMBA 1EYCA 2EY2A 3ITPA 3MVVA 5CV6A 1EQVA 1IHZA 5CV8A 2NUCA 3TP5A 4K8IA 3TP8A 5CV5A 5KEEA 5K5PA 1SYBA 3T16A 2F0MA 4B9XA 1ENCA 1II3A 5I9PA 2SOBA 4EQPA 2LKVA 5HGTA 2F0FA 4DFAA 5C5MA
chains in the Genus database with same CATH superfamily
2K14A 4L6TB 4RGNA 4R4CA 4KLKA 2KHJA 4KHVA 4X3SA 1ASZA 4JI4L 2L4NA 3W1BA 3TS0A 4H02A 1TKWB 3QJYA 2VQFQ 5CV9A 1FGUA 3I4NH 3HOUB 4OWWB 3MZ5A 5KIXA 5ELBA 1MIUA 2FINB 4I65A 5IP9H 5GAHC 2B2TA 1G2TA 2ZTCA 1Z9FA 3U50C 4CJ2C 5C4JB 4DV6Q 3S1NH 2F3IA 3KF8B 1IBLQ 5DAUA 1JWMD 1TS2A 2IJ0A 2MJ8A 1CM9A 2KQ3A 1BR9A 2EYPA 2PMZE 1NBWA 2NWGA 2L15A 2B2UC 2I46A 5J39A 3GTMH 1LV9A 1XTDA 1KQSA 1SNQA 1J9OA 2YTYA 3CRLC 3NELA 4JI1L 3J80E 2UUCL 1XTCD 1BCPC 3E0EA 1UUPA 4IUTA 3H15A 2VUMG 1ZYRD 3A74A 1SYGA 2I5HA 2HDLA 4GLAC 3ULPA 5EBDA 2IX1A 2WAQG 1S3OA 5LMUQ 1N9WA 1STAA 3EJIA 3CCMA 1B53A 1EYAA 3E9HA 2PZWA 4O0AA 1F9PA 4K2KA 1NNXA 3W2DA 1XPOA 2Z4IA 1GUSA 3J81j 1VQ8A 2HHHL 2JJQA 2VB3X 4BBSH 4DUZL 4IUUA 1KNAA 4AH6A 1MI2A 1U4LA 3OW2A 1PHJA 3S2DB 2E5LQ 2EVBA 1DONA 5M9OA 4C3JG 1QUQA 2IX0A 5LHY1 4KJOA 3JAME 2VUMB 2CQAA 3VR6A 1PYWD 2K01A 4NDXA 1TWCB 5L37A 1Q86C 1Q3LA 2Z6KC 2CCZA 1YNJC 3STBD 4B3SQ 2R93H 3DM1A 1IYUA 1DGSA 3L0OA 1I4GA 3NQIA 5IWAQ 5C3EH 1K8AC 2UU9L 2X69A 4QUCA 5I9PA 3CQZH 3GDEA 3FDTA 4X3KA 1M1KC 1SRUA 3C1EA 3J81i 3C46A 5M5XH 1L1OB 3V05A 2K5VA 4C3JB 3CCVA 4HIOA 3V2TA 1EY6A 2LXJA 2PI2E 1ET6A 3F2CA 1ML0D 3GTQB 3WOFA 1W6KA 3K59A 3RD4A 4X62Q 4KY7A 4JYAL 5M5YH 1NSNS 2OF1A 2F0UA 5J1ZA 4C1NK 2WIIB 1DZ1A 4CDEC 1K83H 2WACA 4DV0Q 4UHVA 1QOHA 1MJCA 4OELB 4WORA 2BDOA 1XPUA 2OCEA 5IYCH 4RMFA 1WFQA 4JCVE 1VQAA 2B29A 3PGZA 2Y0SG 5KNDA 4PQXA 1YJWA 1RODA 1LTTD 2ZTDA 5C4XG 2HD3A 1LT3D 1K8MA 4LF5L 4N8FA 1LT5D 4A3KB 4GNXA 5BR8Q 2JN4A 3F1ZA 3GQBA 3GTKB 3MFYA 2F0NA 2P5ZX 3HG9A 2DY7A 4DV7Q 2N78A 2NN6I 1VQFA 3KF6A 5IT9c 5FLMG 1PH2A 1FJGL 5EGTA 3RN5A 4F7XA 1ICWA 5KYLA 1F2MA 1MGSA 2OT2A 2PPBC 1QILA 3M7NA 1G51A 4LF6L 2AQ2B 1VQJA 1VQNA 3M7GA 3CCLA 1SNOA 4RHSA 4JK1C 1D8LA 4NW2A 2BOSA 4CDFC 2A73B 4PG3A 5I2YA 1TWHB 5FKAC 4P72A 2EXZA 4RCNA 5KYIA 3NTIA 4IPDA 3EVQA 4QL5A 3HOXG 3ERQA 4PMCA 4B3ML 2HQEA 3IL8A 1MKHA 3U58A 4N9PA 2DGYA 4A3MH 1XYIA 1EOVA 1CSPA 2AMCB 2MHVA 1LTBD 3T56B 3ONAB 3S1RB 3D3RA 2ENBA 1VCIA 1YHQA 4DUYQ 4AYBB 4X65Q 5CV8A 4R1JA 3CC4A 3J80L 1O80A 1BBWA 2LY7A 1TU2B 4EQPA 3EQLC 1C7YA 1FNVA 1PTOB 2B39A 3K7AH 4J1MA 3DM3A 1RIPA 4G7ZC 5K36H 3RNUA 4YWMA 4A3GH 2B2UA 1SBBB 4GKKQ 4Y7NH 1IW7C 1YI2A 2E75C 3SGIA 4FP5D 3G71A 2F0OA 2NZOA 4G7HC 1A3VA 3H3VI 2NVTB 2ZXRA 3A8IE 3S1MH 2M2LA 2XWJB 4GN4B 1OO9B 3TBIB 4CGYB 3R8BA 4LF9Q 3I72A 3RLFA 4PZ8A 3FKIH 4JPBW 4DF7A 2EZVA 3CKIB 4IFDH 4A3IH 4C3IG 3JAML 2YYZA 2DNCA 4NP5A 2RCFA 3S9WA 3HOZG 1X55A 1JICA 2RHQB 3CW2C 5ELEA 4UP7A 1M90C 1PRTB 1O7ZA 1EUJA 3M9BA 4HTHA 1Q8KA 3T53B 3WDNA 1QNUA 5LMNW 2UXBL 2UXCQ 2JA8B 4ZAIA 1C0AA 1CUKA 1EU4A 4HR7B 1TS5A 1XWEA 2FHTA 1J5EL 3OTOL 5EPJA 2LS01 1X6OA 1I94L 2WB1G 4DR1Q 1H9JA 5I6YA 5M3FH 4O2DA 3RZDH 2R92H 5IP7G 1HNZL 4LFBL 2IHEA 2Z6KA 2AWOA 1PTOF 4C3IB 1OXTA 2FXQA 2F0WA 4JI5Q 4YIJA 4MTNA 3UI2A 4L63B 3IRBA 3G48A 2A69D 4BY1B 1W2BA 1B9NA 3HOYH 1EY9A 3A55A 4EQOA 1F2ZA 1AE3A 2F4IA 1X54A 1H9SA 3HRZC 2ASBA 4C3HH 1ASYA 3SK4A 4JVZA 2K52A 1YZ6A 2MPMA 1YHBA 4JI6Q 1KDBA 4HMJA 3LX0A 1WTHA 3PUYA 2DY8A 5C4HA 4DN4M 3D0FA 1RF2D 1B4OA 2K05A 2J7ZA 2F4VQ 1B8AA 1TIID 2OXPA 4JI3Q 1HNWL 2R7FA 2NUCA 3A54A 3J80i 1PRTF 3I2ZA 2F0MA 2ZM6Q 1CTMA 1YEZA 3DUZA 1YNXA 1MJEA 1SYCA 4DPGA 3CCUA 4JI2L 4BY7G 2UXDQ 4Z9CB 2JA6G 5C4ZA 3AEVA 2B63H 4RKLA 1EIHA 4R8NA 3S1QB 1STNA 4U68A 1V9PA 2PZUA 2F0GA 4YHHQ 1KDCA 4LF7L 4H7BA 1K3BC 1HH2P 3TMEA 2PQAB 3NTHA 1S72A 1K8OA 3I70A 1X65A 4LAAA 1DM0B 1D2BA 2A6EC 4UDUC 2RF4A 3QG1A 1AW7A 4WJ4A 1L0XB 1ZXTA 1PLFA 2N3SA 4MTKA 3NQTA 2PMZB 1PZKD 2MQHA 4CHTB 1V1PA 4OWTB 3JAMi 3PO2H 2B8GA 1QUQB 3I7FA 5FLXE 3RZOH 1S4ZA 1PV4A 4KMUC 1N36L 4IPHA 2HQLA 2IT1A 3G4SA 2JA6B 2A68C 4RFBA 4POGA 1Y1WB 3VDYA 1DOKA 1E2WA 4ILWA 1GOZA 1HA5A 2R7DA 3H0GH 4HN7A 4TSSA 1B70B 1OXXK 4IURA 2VL6A 5CGKA 1DOMA 1Q8IA 4KKTA 3UDXA 4A3JG 1Q90A 3TS2A 1ENFA 1WCMB 3CPWA 2XTIA 2I5LX 2F3VA 4DV2L 5FO9B 2D9UA 3EA6A 2DJFC 3S24A 5I2XA 1X3FA 1IBKQ 3R2TA 2XRSD 4UP9A 3AYHB 1WTXA 2KENA 4A3EH 2ES2A 3ND9A 1JWUD 4CDDC 5IGCA 4X64Q 3SDZA 3CPFA 1S5FD 3E6ZX 4CDCC 4LF4L 3A7LA 3VYSA 4KY6A 3HOUH 2DUDA 4OGQC 3A56A 2EQSA 2EXDA 4QIWE 3UDFA 2NVXH 3BDLA 3N6RA 1BBUA 5FO8B 5DLQE 4LNQA 1FYCA 4DV1L 2Q8RE 3K0YA 1S40A 5C4JH 5KEEA 4GLVB 4GNXB 4I7ZC 1ENCA 3BU2A 5IE8A 1TWAB 1PZID 1TWFH 2SOBA 2O5JC 5C44G 2NVYB 1SFOB 2VNUD 3CCEA 1JQYD 4JW0A 4OHJA 3KF6B 5FK9C 4A93B 4PZ6A 2J4XA 2UUBL 1B50A 2EYOA 2SNSA 1X3GA 1LTAD 3NTKA 1VQMA 4LF8Q 4B3RL 4RWSC 4DGZA 1Z7TA 3DLLA 1X3QA 4K6DA 5FOBB 1AN8A 2VXWA 5EQ0A 5KNBA 4XT3B 5EKKA 2FFKB 1HUMA 2E76C 2E2IH 1I6HB 3ER0A 2HIVA 2EY5A 4OO1I 3VR5A 1A63A 3RLOA 1EIFA 1L0YB 1ZEQX 3URYA 4Q5VA 1EY0A 1CA6A 4YCVA 3MEFA 4A75A 1I4XA 3NWSA 3TREA 2QKIC 3CRKC 4DV5L 4G4KA 3CU7A 2RSOA 1SEBD 3PUWA 3S2DH 4BS9A 1KRTA 1QCBD 1R9TB 2VUMH 3HOVB 1SJED 1OXSC 1A8VA 1TWCH 3K5LA 1JORA 1Q12A 5JAVA 3LNNA 4FF4A 1A3UA 3OHXC 3J7YW 2FMMA 2C35B 1PFSA 1NR4A 2KEDA 1LT4D 3N52A 2EYMA 2C5CA 2H5XA 2L12A 3JC66 4U673 1JOQA 2F0LA 1SE4A 4AIMA 4K5WA 3BYTB 5GAGC 1K8GA 3PV0A 4A3DG 1EOTA 1HZCA 1N34L 1BCPB 4KHPQ 1M8AA 1NMGA 3H91A 4RA8A 5AFWA 3HKZE 2EPBA 4C3JH 3QOLA 3STBC 2VQEL 1G8ZD 2Q2TA 2PZTA 3GD7A 4DR3L 2ZJQA 4YWKA 1BO0A 1UE6A 1BKBA 2BCOA 4B3TL 2D2CC 4BBRB 1JJGA 3OYYA 1K73C 4DR5L 3PQIA 4PMBA 1FGBD 2KOLA 1PZJD 3MVVA 4I7AA 1Y8PB 4C2MH 4DR2Q 1RTNA 1U5KA 2I0QA 2NTTA 1DJRD 2WV6D 4F88A 3RLNA 3NBHA 4DV4L 2BH2A 4OO1G 2EYFA 3AQQA 2RDGA 1EFID 1W3SA 3CCJA 1A3TA 4FXKC 1EY4A 3UE0A 1CKNA 3MXUA 1XNRL 5ELOA 1CQFA 5C0XI 3J80c 1XNQQ 3P75A 2DN8A 1F9QA 3GP7A 1UE1A 3A5UA 4A3LG 1NTGA 1W6JA 1H9SB 2JQOA 2O2LD 1BCPF 1QE6A 3F2UA 1AZPA 4RGTA 2JSOA 1XMQL 3MXNB 4QJFA 1PH1A 1GUWA 1V43A 4DR6L 4K0KL 1ENAA 4OL7A 1NY4A 1FNWA 5C4XH 1K9MC 2EJMA 1G291 5IGEA 2XGTA 1GVPA 3FPPA 4JBMA 3GTPH 5FLMH 3K5NA 5G3LD 1GM5A 3JAMc 1WTRA 3S1RH 1LABA 3MA2B 4JV5Q 2K7VA 3CCSA 3SXHA 2Z8LA 5E4WC 2VQFL 1I6VC 4KK7A 3I55A 3BG3A 1SLJA 4KD3A 1O7IA 1JE4A 3NBIA 4LUVA 1T5EA 4XQQA 4JI1Q 2UUCQ 1T5XD 1WTWA 5HGQA 1FL0A 3HZXA 5LMNQ 3HOXH 1Z47A 4IN3A 4ZKCB 2NB0A 1VDZA 2R61A 4DR7L 1SNDA 2EDGA 3EROA 4DK6C 3M4YA 3ICEA 1V1PB 3GTGB 2KUMA 3TN2A 1NE3A 2L0CA 3OWEB 4LFAL 3M3YH 1J6QA 1LYLA 2QCPX 1IKMA 1VMCA 5A35A 5DNFA 2HHHQ 2PCFB 5CV6A 1EQVA 1X3PA 4DUZQ 4X66L 4PZ7A 1SYBA 4DNIA 1X56A 4GLXA 5M5WB 4IQZA 1PVOA 2HDMA 2RCNA 1I3QB 4M8AA 4JBJA 5C0XG 1HTPA 2Z4HA 2VB2X 5IGGA 3QIAA 4APVA 1HQRD 2F0VA 4R9WA 1L2FA 4ZQ3A 5IOCA 1KNEA 2O5IC 5LMUL 5CC4A 2NYZD 3K0XA 1TS3A 2R7ZG 1TVXA 2BDNA 4KTAA 2IPKD 4RKBA 2IW3A 2B2VC 3D6WA 5ELNA 5KGUA 1I50B 1JCKB 1TWGB 4C3IH 2E5LL 1M4VA 3W1GA 2L1BA 3HOZH 1STHA 3G7LA 2JA5B 3OOCA 1VQHA 5CBEE 1VQLA 4PV1C 2N55A 4GOPA 1LTID 3FRPB 1STBA 4QQBX 1QZHA 4C1NI 1TT2A 4K14A 4L5TA 4A3KG 2A1AA 4LFCL 2R7ZB 2AKWB 2HCCA 4ID6A 3R2IA 2K5WA 4G57A 3L7ZC 1PH3A 2Z9HA 1QVGA 3U9SA 5IP7H 1GUTA 4IPCA 1WVLA 1HFGA 1IXRA 1ESFA 3V96A 5EKIA 4EX5A 2UUAL 3GTLB 1X32A 1E3PA 3KJOA 4R4TA 1UWVA 4XTCS 1EFWA 1Q1EA 1HZBA 2A8VA 3RR5A 3MFGA 2SDFA 1I4RA 3KOJA 5FO7B 3FPUB 1EY8A 2B2YC 1FJGQ 2CH4A 4QIWB 2OEOA 4BXXG 1CKMA 1IKLA 2KVMA 2ZT9C 3HOWB 1PDQA 2A6HC 3U4VA 2JA7G 1R4PB 4AYBG 4UAIA 4GS3A 2TSSA 2RQXA 3OWFA 3I4MB 3AFPA 2Q2IA 1BQQT 1SMXA 1D6EC 5BR8L 1ILPA 1RHPA 1NAPA 1P16A 3H3VH 2L5TA 1PFBA 4BY7H 2G9DA 2Q2HA 3QWNA 1HR0W 1LM0A 4UY8C 2LSSA 3I8ZA 1LUZA 2XN9C 5HURA 2PYKA 3M4OH 1LTSD 1DCZA 2KCCA 3ERSX 2JA7B 2MP1A 3TP7A 1JB3A 3VYRA 1SE2A 3I4NB 1WTVA 3VA7A 3D4WA 2KCMA 4IUVA 1IL2A 1RKNA 4KN7C 1MD2D 1NCVA 2XRQD 1GXDC 1HZAA 1EWIA 5CR3A 2YU9H 2QDLA 5KRUA 3S1NB 2AWNA 3BVMA 3S14B 1YBYA 2RDFA 5EJWA 4AQYL 5C0XJ 2O4XA 2JA8G 4V0BA 5E7NA 4X65L 3BZCA 4O42A 5BN3A 3GTMB 1CQVA 4A3JH 1KAWA 4KHZA 1EYGA 1SNMA 3T1HQ 4X6AH 2XIWA 1Y8OB 4H13C 3RMHA 1LLRD 2RBMA 3FMCA 1L1OC 2Z6BA 4GKKL 4KY5A 4BY1G 4MZ9A 2NN6G 2QA4A 1N33L 2F0DA 4LK1C 2UXBQ 1TWAH 3HKZB 3RUZA 1B3QA 2XVSA 1SFOH 2ATWA 1C4QA 3TQYA 1U9RA 3GTJH 4FO2A 1J5EQ 2CWAA 1LACA 1TY2A 1YNJD 4IJLA 4BBSB 4LFBQ 4H44C 3SK8A 2EY1A 3SK6A 2K1BA 3DMUA 4J6HA 4X3UA 1UE7A 5J3BA 3EN2A 4LW1A 2K28A 5CV4A 1FVIA 1F9SA 2B2VA 3S17H 3KK7A 3TP8A 3A8KE 4K8IA 1ET9A 4RH6A 5C44H 3T1YL 1CFMA 1HCZA 2D0OA 4ZYSA 3D31A 3LGJA 3W3AA 5FLXc 5C3EB 3S15H 4QF4A 1VQGA 3PUVA 4DR1L 4P75A 2PQEA 4OIKA 4JI5L 5M5XB 1J8IA 3GTOH 3HEJA 1TQOA 3K8AA 1GJXA 1HNWQ 3KJPA 2ZJPA 4HJ7A 4LJZC 2BE5C 1QG7A 4ME3A 3D8GA 2F0EA 4LUZA 2MGSA 4QUFA 3NXWA 1A6XA 4JI2Q 1K0SA 2OTJA 5IGFA 3KYHC 1CZWA 5M5YB 4P74A 1LTLA 3BDOA 3Q8DA 4FXGC 3F2BA 1K83B 2GVAA 1Y1WG 3TZDA 2C9OA 4LF7Q 1EL0A 2QW7A 1HPCA 1I4HA 1D5XC 2K50A 4PMWA 2JEAI 3H94A 1VQPA 3TEHB 3CAMA 2F4VL 3EBEA 2B2YA 1EZ6A 2KHSA 2E2HH 1BF4A 1YNNC 2XSCA 1Q46A 1WCMG 3R3OA 1L0WA 1TY0A 1JOKA 2EYJA 2VS1A 3B6YA 3QR8A 3S2HH 1NMFA 2CKZB 2AUKA 5IYBG 5JPNC 1U4PA 1QZGA 4GN3B 2NBFA 4A3DH 3U9OA 1IBMQ 2WAQE 1S5CD 4LUOA 4RHRA 1VF7A 5CBAE 4L8JA 3CC2A 4XYQA 4TVAB 4FNFA 3NPPA 2EJFC 1T9HA 4Y52H 1RTOA 4JI8L 4F8MA 1EQRA 4OX9L 1Q7YC 1ICFB 3AFQA 4HCSA 1XJVA 3HKSA 4A3MB 1HNXL 2NZHA 4CBVA 1PFNA 2KEEA 1E1OA 4O1NA 1OTCA 3IFDA 3BJUA 1JJCB 1N32L 1SE8A 4A93G 4LF4Q 4OO1H 4NXMQ 1OXUA 2MUYA 5JPMC 4XQJA 2NTSA 2F1MA 4DV1Q 2K5NA 4A3GB 1SR3A 4Y7NB 3M4QA 2E2DC 4NXNL 4N8X1 1BBXC 3C1FA 1PH8A 4A3LH 1F9RA 2F52A 4K6LA 3NHHA 3E9IA 4PNYA 3G6EA 5I4DA 5H1SE 1L1OA 2ZTEA 3P7JA 1A2UA 3J81E 5CV7A 2F0KA 2UUBQ 2K33A 1FD7D 4IZ8A 4A3IB 5IYDG 4B3RQ 2IHFA 2K32A 2ZJRA 1KC8C 2ZXPA 4S3SA 5EKLA 2PW7A 4MIUA 2CHBD 1UE5A 4ZUIA 5KNCA 3PF5A 1KHIA 3HOVG 1HFNA 1Q82C 1H9RA 1SDFA 1DXMA 1XMOL 2Y0SE 2EYHA 2F0TA 3K80C 4C56C 4GKJL 1B1ZA 1VQBA 1VQ6A 3FEWX 4J15A 3KLRA 4JI7Q 5IY0A 4A3BB 2R92B 3F8TA 5JVH3 4MHEA 4LWCA 3CMEA 3Q23A 3KFUA 4IUNA 1H9MA 2YV5A 4LF8L 1ZYRC 2H1EA 5EPLA 1EIGA 1FNUA 4DNRB 1I3QH 3K7UC 5IODA 1JWSD 4DR4L 1Q81C 3D6CA 3HOYB 4MN3A 4DK3C 3NP8A 1EZ8A 3PUXA 1CHPD 3IKJA 2F3WA 1YITA 4POFA 2PNHA 3ZJYC 1TR5A 2QEJC 2Z1CA 1A15A 1VQ7A 1VQ4A 4E6IA 3H3VC 4OIJA 5M3MG 3R93A 4BBRG 4ZKBB 1Q1BA 3BYYB 5AJ3L 1VQCA 1AE2A 4GOPC 1N34Q 1I50H 1JMCA 3ITPA 1PTOD 1IL8A 5ELCA 4IJHA 4HSPA 1SMYD 5C0XH 4DXGA 4H0LC 1X9NA 4JG2A 4DFAA 2KJXA 2K5DA 1C9OA 1AFPA 4CKBA 2RHSB 3P1HA 4JI0L 2IX3A 3GO5A 1GKHA 1EYDA 3CMAA 4DR3Q 5FLXL 3GTQH 4IUQA 4ALPA 4HJAA 1D1IA 3PF4A 2PW5A 2R7ZH 2B63B 5M3MB 1UEBA 2Q8IB 3PMFA 1KTKA 4K5VA 2WINB 3VR3A 2A68D 2FMCA 3PIPA 3I90A 3CP0A 3GV6A 1X3EA 1RDPD 2BA1A 1Y1VG 2ALYB 2RA4A 2VW9A 3OIPA 1BOSA 1PRTD 3C2PA 4YCWA 1U0LA 4DV3L 3NE5B 1VQ5A 3I91A 2YTXA 4WRDA 1HR0Q 3MEHA 3J7A5 3IAYA 3T13A 4A3KH 3PO2B 2R6GA 1XNRQ 3RZOB 1V1OA 1A2TA 1F2LA 2G5DA 3GTKH 3T51B 5GADC 2HUGA 4CKCA 4DXFA 1YJNA 4YY3L 3G6JB 2D0PA 3MTSA 3CCQA 3H0GB 3MHBA 4ME5A 5C6AA 1PH6A 1XMQQ 5ELDA 3Q0AA 5C3WA 5D65A 1BNZA 1MBYA 1Y1VB 4JI4Q 1KAAA 1QB5D 4JOIC 1AZQA 4EQNA 4HEDA 1TWHH 2WB1E 4GN5A 1N8RC 5E1FA 1WI5A 1XNQL 4BXXH 2CW0D 4RG1A 1STGA 3PIP3 2F0PA 3J81L 1F77A 4KD4A 4A3EB 1KABA 2SEBD 3DWPA 2JA7H 4DNTB 1KIXA 4HMIA 3PSIA 2G9HD 1G91A 4QB4A 2ICIA 4M1UB 1KDAA 2E2JB 1KRSA 4YWLA 2NVXB 2EY2A 3TP5A 4HIKA 5CV5A 1PTOH 4DR7Q 2F03A 1LTGD 1YVCA 2DJGC 1UAPA 1BVSA 1ONLA 5HY6A 3S14H 3DEPA 3MC0B 3CHBD 4DV6L 4FF1A 1TWFB 1PMRA 4LMQD 4JV5L 1KD1C 1IBLL 4R4OA 4A3CG 2M00A 4KKSA 1VQ9A 3TSSA 4LFAQ 2NVTH 3TRZA 1I4PA 4HSVA 4A3FG 1Y14B 1SROA 4X66Q 3BZKA 2QILA 1SYDA 5NUCA 3X3MA 3S16B 5JVG3 3J7ZC 3NEMA 3BS1A 5LMNL 1HHVA 3TZUA 1VMPA 3PO3G 1JE5A 4L5RC 2JA5G 2E2IB 4BA1I 1Y69U 1PA6A 5BN4A 2K5QA 5FJ8G 2MNAA 1K28A 1VQEA 3K6OA 4TKOB 5JEAG 2PQAA 2HT1A 2JA8H 4XDXA 4XQNA 4WFN3 2RKSA 3A8JE 1SNPA 2CFMA 2UU9Q 4A3FB 2OQ0A 4K5XA 4KJNA 4CJ0B 3K58A 4KN4C 1WOCA 3PUZA 2F0JA 5IIFA 5IGBA 4HJ9A 1HJPA 1CA5A 3PO3B 1D1KA 5C3XA 2K5HA 5TSSA 4YCUA 4BY1H 2A74C 2NN6H 4L5QA 5BN5A 3M4PA 3DHQA 3K57A 1LT6D 2WAQB 4G7OC 3VYTA 2ICEC 1A62A 1CK1A 5JJZA 3CCRA 2R3ZA 3KLSX 4LFCQ 4B3SL 1PFMA 4OXPA 1E7ZA 4CKEA 4JYAQ 2F0HA 3NUCA 3Q24A 1GHKA 5IWAL 3NENA 1CI3M 4DA2A 1KLGD 1KL9A 1VQOA 5C5LA 2A69C 3HOWG 2UUAQ 2LXKA 3OMGA 1E2ZA 3ZYYX 1AH9A 3EFXD 2NVQB 2DNEA 4NB3A 3PIOA 3I4MG 4P2CB 1WJJA 4RAUC 2M9VA 2TMPA 4LF5Q 1EYCA 3AMUA 4V190 4KKUA 3ULJA 1IYVA 4X62L 1GO3E 2D62A 4C2MB 3H09A 4B9WA 5CORA 3S1QH 4MNOA 1XPRA 3TDQA 1YIJA 4DV0L 4FF3A 4QY7A 5ISRA 2EYLA 1EWHA 4LF6Q 2L9HA 1XX8A 3HS0C 2EY6A 4HIDA 3E0JA 4DAPA 2X6GA 4P71A 1PH4A 2SNMA 1HUNA 1HTLD 3MXPA 3I4NG 2LMCB 5EAYA 4XIGS 3KDFA 5IP9G 2PI2A 1R4QB 1KXLA 2A19A 4IALA 4EGVA 3L9AX 4B3MQ 1JOOA 2AHOB 2JA6H 4DV7L 4JOIA 1HA6A 1Y1WH 3RN2A 3NK9A 4R8IA 3KLWA 3OIQA 4UPAA 3AB9A 2GVBA 1ILQA 4BWGB 1PYBA 3L2PA 3BDCA 2H4OA 2VY3A 2Y0SB 4FF2A 5JJKA 2K04A 4WJ3M 2B2WC 1IYJB 3PIO3 5C4XB 4DKAC 4GZYC 1B3AA 4OONA 3W5OA 1UNSA 1WCMH 4ODGA 3J7AV 1PYSB 2CQOA 3J7AF 4HJ8A 2BH8A 1GUOA 3GTPB 2E8GA 3K5MA 1PXUA 5IYBH 4AQYQ 1B9MA 1BCPD 2ID0A 3HKZG 1GD7A 4NPSA 4IOAA 5E4XA 4XT1B 4DUYL 3D4RA 4FVMA 2F0IA 1D5MC 1JR0D 2BA0A 1DD2A 2XWBB 5JEAJ 4FXDA 4BBSG 3DWQA 2RDHA 2WKCA 4HJ5A 4JBKA 2JE6I 3FVQA 3HOXB 5IT9E 4F87A 3VR2A 3NBHB 4EQ5A 1N33Q 4DAVA 4HIMA 4K8JA 1PH9A 5GROA 3I4LA 2X6LA 2LFNA 1PH7A 1SXTA 3A5ZB 1CKNB 2NVYH 4L5SA 3M3YB 2R93G 2JK8A 5K5PA 2A5HA 1E24A 4B9XA 3SVMA 5C3EG 4A93H 1BDOA 1NJIC 3OTOQ 4LF9L 3KLSA 2QF7A 3QB3A 4EVOA 4CJ1B 1I94Q 1HNZQ 4KI0A 3T1HL 3A7AB 5A2QE 5D3DA 3I56A 5DM63 1JC7A 3BZDB 1STYA 1U4RA 1G6ZA 3T4AC 1VF5C 2CWPA 4ZCKA 1HZ9A 4TQUS 1I6HH 2PNRC 2N49A 3M85A 2E74C 3T1YQ 1WD1A 2EE1A 4OEMB 5I9OA 4DAYA 3I4OA 3LWEA 2UXCL 2K03A 3E3XA 5EPKA 3OSOA 2R93B 4JBWA 1ZKOA 1QJOA 1SSOA 2JYOA 2EOTA 3LWUA 2JXMB 3C3LA 3UDIA 3CXCA 5IYDH 1E1TA 3CQZB 1S5ED 4KV6A 2RSNA 2PO4A 5T1IA 4DK0A 1RL2A 3HOZB 1VS0A 2GN5A 5IYCG 1H95A 4R4IA 2AQ1B 1EQTA 1GHJA 1R9TH 3HOVH 3DEOA 1RD9D 1B7YB 2JEBI 3FHWA 1WTQA 4IFDI 1GUGA 2F0SA 1C48A 4XXEA 3MXNA 1TXYA 5DM73 4JI6L 2WB1B 2MFIA 5DEHA 4ZRZA 3SK5A 1P8LA 1HQMC 5T1GA 4K2LA 2I5MX 4A3BH 4RGOS 2V4DA 4JI3L 1V8QA 2A6HD 1YJ9A 1BXTA 2QGQA 4RCOA 4QCLA 3HGBA 1B44D 2ZM6L 2B3GA 2MO0A 3SE0A 4FYDA 5COYA 1O7YA 2D5DA 3KF8A 3A0JA 1SN8A 2EJGC 1PTOC 2UXDL 3OMCA 5M3MH 1N36Q 4BBRH 2B8FA 1VQDA 3MWYW 1EIYB 2RVLA 1SMYC 1U4MA 2IWHA 4A3MG 1CSQA 3PCOB 4ULLA 2KBNA 3Q6SA 1NUCA 4FDBA 4Q0FA 4A76A 1CKOA 2IY5B 4YHHL 4DAMA 2KCNA 3DWAA 3BVZA 3T16A 4HAEA 3J81c 1O7LA 2LKVA 5HGTA 2F0FA 2V1CC 3Q22A 3K5OA 1K0RA 1GUNA 4JI8Q 1TS4A 1S5BD 1VQKA 1SE3A 5K36G 4BY7B 2Q2UA 1E22A 2N8NA 4OX9Q 4DV2Q 3EIVA 3WWVA 1KLUD 4A3GG 2B2WA 1HNXQ 4GOPB 1WTOA 5G3LF 4OWXB 1PRTC 1E2VA 1IBML 3NWTA 1MSGA 3M4OB 3ULLA 1DOLA 1D5ZC 4B08A 3K81C 1AEXA 1IW7D 1Y1VH 1N32Q 1EWCA 1UEAB 4IO9A 1MSHA 1EEID 2YTVA 2VZAA 5EBCA 3FKIG 4IFDG 3SHLA 5IT9L 4A3IG 3CD6A 1LO5D 1SJHD 2JP1A 3K7AB 3HP3A 1QNKA 2EIFA 4N9TA 1HRJA 2YU9B 4NXNQ 1QWYA 3MXGA 3D4DA 1IBKL 3OPOA 4R4QA 4X3TA 3GV3A 2OTLA 1JT8A 2WP8J 3VR4A 5CMDA 2WFWA 4ZUJA 3I3CA 3S1MB 1SNCA 1SYFA 2B2TC 2I07B 1BUVT 1F2YA 1CZGA 3SEBA 4NXML 4X64L 4P73A 1XXGA 4A3JB 2KCTA 5A2QL 4IOCA 2R92G 4A3BG 5M3FG 1QVCA 2E2JH 3FKIB 1SAPA 2QDBA 2F0QA 5D3IB 2HIXA 2CW0C 1STEA 3HOYG 3I73A 1XMOQ 3UE1A 1EU3A 1JB7A 1EQQA 4XYOA 3GTGH 3KDFB 3QOJA 4GKJQ 4C3HG 3GTJB 1A0IA 1Y8NB 4DV5Q 1I5FA 1SYEA 5M3FB 3RZDB 4NMZA 3S16H 3AU7A 2MO1A 5M5WH 3F2DA 1H9KA 1PH5A 4ABNA 4DR4Q 1NR2A 1IZ6A 3CF5A 3S17B 1G2SA 2L11A 1D7QA 4AYBE 4UP8A 1CT1D 2AQ3B 3X3NA 2K75A 5I6WA 5C44B 2K6AA 5F2DA 2CH4W 3BVGA 1EY5A 5ELFA 2WKDA 2BE5D 4A3CH 5GAEC 5JJIA 2GA4B 4C3HB 3S15B 4JI7L 2B63G 2IL8A 5AJ3Q 1MHWC 4A3FH 5J22A 3KBXA 2KECA 1FR3A 3KBGA 5E3FA 1EEFD 1DYQA 1V1QA 1TWGH 4JC0A 4QMGA 5JOBA 4ZLTF 3GTOB 3VYUA 4A4IA 1AP0A 1LTRD 3DXJC 5LL6S 3PO3H 2JA5H 1I4QA 1B2TA 5D14A 2NZ1D 4JI0Q 4IUPA 2OQKA 2VQEQ 2Z0SA 5FJ8H 2J0TD 3NSWA 5JEAH 4J8QA 3PO2G 2A6ED 1YNND 3HFZB 2Q8TA 2HCIA 4B3TQ 2L55A 4DK1A 1WD0A 4DR5Q 2QEXA 2KHIA 2XNAC 4HCEA 3P20A 2AUJD 4NKLA 3VA5A 1CHQD 3E5SA 3H0GG 3ND8A 4KHPL 1RCVD 2FJ2A 4WJWA 1OXVA 2NVQH 3QO2A 3GTLH 1K3RA 2E2HB 4DV3Q 4DV4Q 1RJTA 3FP9A 4IPGA 3H6MA 2N88A 4QGUA 3S2HB 2JA9A 1EY7A 1WYDA 3MAQA 3IFTA 5IGDA 4IFDJ 4YY3Q 1WTPA 4DU9A 3L3OC 4DR2L 4A3DB 4DAYB 3WOEA 3U4ZA 4GNXC 1HXYD 4ZK9B 3TP6A 3HOWH 4A3EG 3OW7A 1YHAA 2OWOA 3SR1A 2KA7A 2ZXOA 4DR6Q 5JJLA 4K0KQ 1HR0L 1E0BA 4TRDA 3I4MH 3HOUG 1QVFA 1Z6HA 1G6PA 4RGMA 1C8CA 2CVRA 4BA2I 1S5DD 3KUPA 1IHZA 3UDGA 5CYUA 3O13A 1VQIA 2K4KA 1II3A 5GQOA 1JJ2A 1O78A 5LL6X 1ESRA 3CC7A 5C5MA
chains in the Genus database with same CATH topology
4L6TB 4RGNA 4KHVA 4X3SA 2L4NA 1TKWB 3QJYA 5CV9A 3HOUB 3MZ5A 5KIXA 5ELBA 2FINB 4I65A 2B2TA 1G2TA 5C4JB 4CJ2C 5DAUA 1JWMD 1TS2A 2IJ0A 2MJ8A 1CM9A 2KQ3A 1BR9A 2EYPA 2NWGA 2B2UC 2I46A 5J39A 1LV9A 1SNQA 1J9OA 3CRLC 3J80E 1XTCD 1BCPC 1UUPA 4IUTA 1ZYRD 1SYGA 2HDLA 5EBDA 2IX1A 1STAA 3EJIA 1B53A 1EYAA 2PZWA 1F9PA 4K2KA 3W2DA 2Z4IA 1GUSA 2VB3X 4IUUA 1KNAA 1MI2A 1U4LA 3S2DB 2EVBA 1DONA 5M9OA 4C3JG 2IX0A 5LHY1 4KJOA 3JAME 2VUMB 2CQAA 3VR6A 1PYWD 2K01A 4NDXA 1TWCB 1Q3LA 1YNJC 3DM1A 1IYUA 1I4GA 3NQIA 2X69A 4QUCA 5I9PA 3FDTA 4X3KA 3C1EA 3C46A 3V05A 4C3JB 3V2TA 1EY6A 1ET6A 1ML0D 3GTQB 3WOFA 1W6KA 3K59A 3RD4A 4KY7A 1NSNS 2OF1A 2F0UA 5J1ZA 4C1NK 2WIIB 1DZ1A 2WACA 1QOHA 4WORA 2BDOA 5KNDA 4PQXA 1RODA 1LTTD 1LT3D 1K8MA 1LT5D 4A3KB 3GQBA 3GTKB 3MFYA 2F0NA 3HG9A 2DY7A 2NN6I 5EGTA 4F7XA 1ICWA 5KYLA 1F2MA 1MGSA 2OT2A 2PPBC 1QILA 3M7NA 2AQ2B 3M7GA 1SNOA 4RHSA 4JK1C 4NW2A 2BOSA 2A73B 5I2YA 1TWHB 5FKAC 2EXZA 4RCNA 5KYIA 3NTIA 3EVQA 3ERQA 4PMCA 2HQEA 3IL8A 4N9PA 1XYIA 2MHVA 1LTBD 3T56B 3ONAB 3S1RB 3D3RA 2ENBA 1VCIA 4AYBB 5CV8A 3J80L 1O80A 2LY7A 4EQPA 1TU2B 3EQLC 1FNVA 1PTOB 2B39A 4J1MA 4G7ZC 5K36H 2B2UA 1SBBB 1IW7C 2E75C 4FP5D 2F0OA 4G7HC 1A3VA 2NVTB 2ZXRA 3A8IE 2M2LA 2XWJB 1OO9B 3TBIB 4CGYB 3R8BA 3I72A 3RLFA 4DF7A 2EZVA 3CKIB 4IFDH 4C3IG 3JAML 2YYZA 2DNCA 4NP5A 3S9WA 1JICA 5ELEA 1PRTB 1O7ZA 4HTHA 3T53B 3WDNA 1QNUA 2JA8B 4ZAIA 1EU4A 4HR7B 1TS5A 1XWEA 2FHTA 5EPJA 2LS01 1H9JA 5I6YA 2AWOA 1PTOF 4C3IB 1OXTA 2F0WA 4YIJA 3UI2A 4L63B 2A69D 4BY1B 1B9NA 1EY9A 3A55A 4EQOA 1F2ZA 2F4IA 1H9SA 3HRZC 3SK4A 2MPMA 1KDBA 4HMJA 3LX0A 3PUYA 2DY8A 5C4HA 4DN4M 1RF2D 1B4OA 2K05A 2J7ZA 1TIID 2OXPA 2NUCA 3A54A 1PRTF 2F0MA 1CTMA 3DUZA 1SYCA 4Z9CB 5C4ZA 4RKLA 1EIHA 4R8NA 3S1QB 1STNA 4U68A 2PZUA 2F0GA 1KDCA 4H7BA 3TMEA 3NTHA 1K8OA 3I70A 4LAAA 1DM0B 1D2BA 2A6EC 4UDUC 3QG1A 1AW7A 1L0XB 1ZXTA 1PLFA 4CHTB 3NQTA 2PMZB 1PZKD 1V1PA 2B8GA 5FLXE 1S4ZA 4KMUC 2IT1A 2JA6B 2A68C 4RFBA 1Y1WB 1DOKA 1E2WA 4ILWA 1GOZA 1HA5A 4HN7A 4TSSA 1OXXK 4IURA 5CGKA 1DOMA 1Q8IA 4KKTA 1Q90A 1ENFA 1WCMB 2F3VA 5FO9B 2D9UA 3EA6A 5I2XA 3R2TA 2XRSD 1WTXA 3ND9A 1JWUD 5IGCA 3SDZA 1S5FD 3E6ZX 3A7LA 3VYSA 4KY6A 4OGQC 3A56A 3BDLA 3N6RA 5FO8B 1FYCA 2Q8RE 3K0YA 5KEEA 4I7ZC 1ENCA 1TWAB 1PZID 2SOBA 2O5JC 2NVYB 1SFOB 2VNUD 1JQYD 4OHJA 5FK9C 4A93B 2J4XA 1B50A 2EYOA 2SNSA 1LTAD 3NTKA 4RWSC 4DGZA 1Z7TA 1X3QA 4K6DA 5FOBB 1AN8A 2VXWA 5EQ0A 5KNBA 4XT3B 5EKKA 2FFKB 1HUMA 2E76C 1I6HB 2EY5A 4OO1I 3VR5A 1L0YB 1ZEQX 3URYA 4Q5VA 1EY0A 1CA6A 1I4XA 3NWSA 2QKIC 3CRKC 4G4KA 3CU7A 2RSOA 1SEBD 3PUWA 4BS9A 1QCBD 1R9TB 3HOVB 1SJED 1OXSC 3K5LA 1JORA 1Q12A 5JAVA 3LNNA 4FF4A 1A3UA 3OHXC 3J7YW 2FMMA 1NR4A 2KEDA 1LT4D 3N52A 2EYMA 2C5CA 2L12A 1JOQA 4U673 2F0LA 1SE4A 4K5WA 3BYTB 3PV0A 1EOTA 1BCPB 1M8AA 3H91A 4RA8A 5AFWA 2EPBA 3QOLA 1G8ZD 2PZTA 3GD7A 1BO0A 2BCOA 2D2CC 4BBRB 4PMBA 1FGBD 2KOLA 1PZJD 3MVVA 1Y8PB 1RTNA 2NTTA 1DJRD 2WV6D 4F88A 3NBHA 4OO1G 2EYFA 2RDGA 1EFID 1A3TA 4FXKC 1EY4A 3MXUA 1CQFA 5C0XI 3P75A 2DN8A 1F9QA 3GP7A 1W6JA 1H9SB 2O2LD 1BCPF 1QE6A 3F2UA 1AZPA 4RGTA 2JSOA 1GUWA 1V43A 1ENAA 4OL7A 1FNWA 2EJMA 1G291 5IGEA 3FPPA 3K5NA 5G3LD 1WTRA 1LABA 3MA2B 2K7VA 3SXHA 2Z8LA 5E4WC 1I6VC 4KK7A 3BG3A 4KD3A 1JE4A 3NBIA 4XQQA 1T5EA 1T5XD 1WTWA 3HZXA 1Z47A 4IN3A 4ZKCB 2NB0A 1VDZA 2R61A 1SNDA 2EDGA 3EROA 3M4YA 1V1PB 3GTGB 2KUMA 3TN2A 2L0CA 3OWEB 2QCPX 1IKMA 1VMCA 5A35A 5DNFA 2PCFB 5CV6A 1EQVA 1X3PA 1SYBA 5M5WB 4IQZA 2HDMA 1I3QB 4M8AA 5C0XG 1HTPA 2Z4HA 2VB2X 5IGGA 3QIAA 1HQRD 2F0VA 4R9WA 4ZQ3A 5IOCA 1KNEA 2O5IC 5CC4A 2NYZD 1TS3A 1TVXA 2BDNA 4KTAA 2IPKD 4RKBA 2IW3A 2B2VC 3D6WA 5KGUA 1I50B 1JCKB 1TWGB 1M4VA 2L1BA 1STHA 3G7LA 2JA5B 3OOCA 5CBEE 4PV1C 2N55A 1LTID 3FRPB 1STBA 4C1NI 1TT2A 4K14A 2R7ZB 2HCCA 4ID6A 3R2IA 2K5WA 4G57A 3L7ZC 3U9SA 1GUTA 1WVLA 1HFGA 1ESFA 3V96A 5EKIA 3GTLB 1X32A 4XTCS 1Q1EA 3MFGA 2SDFA 1I4RA 5FO7B 3FPUB 1EY8A 2B2YC 4QIWB 2OEOA 1IKLA 2KVMA 2ZT9C 3HOWB 1PDQA 2A6HC 1R4PB 4UAIA 2TSSA 2RQXA 3OWFA 3I4MB 1BQQT 1D6EC 1ILPA 1RHPA 1NAPA 2L5TA 1PFBA 2G9DA 3QWNA 3I8ZA 2XN9C 5HURA 2PYKA 1LTSD 1DCZA 2KCCA 2JA7B 2MP1A 3TP7A 1JB3A 3VYRA 1SE2A 3I4NB 1WTVA 3VA7A 3D4WA 4IUVA 1RKNA 4KN7C 1MD2D 1NCVA 2XRQD 1GXDC 5CR3A 5KRUA 3S1NB 2AWNA 3BVMA 3S14B 2RDFA 5EJWA 5C0XJ 2O4XA 4V0BA 4O42A 5BN3A 3GTMB 1CQVA 4KHZA 1SNMA 2XIWA 1Y8OB 4H13C 3RMHA 1LLRD 2RBMA 3FMCA 4KY5A 2NN6G 2F0DA 4LK1C 3HKZB 3RUZA 2XVSA 1C4QA 1U9RA 4FO2A 1LACA 1TY2A 1YNJD 4BBSB 4H44C 3SK8A 2EY1A 3SK6A 2K1BA 3DMUA 4J6HA 4X3UA 2K28A 5CV4A 1F9SA 2B2VA 3KK7A 3TP8A 3A8KE 4K8IA 1ET9A 4RH6A 1CFMA 1HCZA 4ZYSA 3D31A 3W3AA 5C3EB 4QF4A 3PUVA 2PQEA 4OIKA 5M5XB 1J8IA 3HEJA 1TQOA 1GJXA 4LJZC 2BE5C 1QG7A 3D8GA 2F0EA 2MGSA 4QUFA 3NXWA 1A6XA 5IGFA 1CZWA 5M5YB 3BDOA 4FXGC 1K83B 3TZDA 2C9OA 1EL0A 1HPCA 1I4HA 1D5XC 4PMWA 2JEAI 3H94A 2B2YA 1EZ6A 2KHSA 1BF4A 1YNNC 2XSCA 3R3OA 1TY0A 1JOKA 2EYJA 2AUKA 5JPNC 1U4PA 2NBFA 3U9OA 1S5CD 4RHRA 1VF7A 5CBAE 4L8JA 4XYQA 4FNFA 3NPPA 2EJFC 1RTOA 4F8MA 4HCSA 4A3MB 4CBVA 1PFNA 2KEEA 4O1NA 3IFDA 4OO1H 1OXUA 2MUYA 5JPMC 4XQJA 2NTSA 2F1MA 4A3GB 4Y7NB 2E2DC 1BBXC 3C1FA 1F9RA 4K6LA 3NHHA 4PNYA 5I4DA 3P7JA 1A2UA 3J81E 5CV7A 2F0KA 2K33A 1FD7D 4IZ8A 4A3IB 2K32A 2ZXPA 4S3SA 5EKLA 2PW7A 4MIUA 2CHBD 4ZUIA 5KNCA 1HFNA 1H9RA 1SDFA 1DXMA 2EYHA 2F0TA 4C56C 1B1ZA 3FEWX 3KLRA 4A3BB 2R92B 5JVH3 4MHEA 3Q23A 4IUNA 1H9MA 1ZYRC 2H1EA 5EPLA 1EIGA 1FNUA 4DNRB 5IODA 1JWSD 3D6CA 3HOYB 4MN3A 3NP8A 1EZ8A 3PUXA 1CHPD 3IKJA 2F3WA 1TR5A 2QEJC 2Z1CA 1A15A 4E6IA 3H3VC 4OIJA 3R93A 4ZKBB 1Q1BA 3BYYB 3ITPA 1PTOD 1IL8A 5ELCA 4HSPA 1SMYD 5C0XH 4DXGA 4H0LC 4DFAA 2KJXA 2K5DA 1AFPA 4CKBA 3P1HA 2IX3A 3GO5A 1EYDA 5FLXL 4IUQA 1D1IA 2PW5A 2B63B 5M3MB 2Q8IB 3PMFA 1KTKA 4K5VA 2WINB 3VR3A 2A68D 2FMCA 3I90A 3GV6A 1RDPD 2BA1A 2RA4A 3OIPA 1BOSA 1PRTD 3C2PA 3NE5B 3I91A 4WRDA 3MEHA 3IAYA 3T13A 3PO2B 2R6GA 3RZOB 1V1OA 1A2TA 1F2LA 3T51B 2HUGA 4CKCA 4DXFA 3G6JB 3MTSA 3H0GB 3MHBA 4ME5A 5C6AA 5ELDA 3Q0AA 5C3WA 5D65A 1BNZA 1MBYA 1Y1VB 1KAAA 1QB5D 1AZQA 4EQNA 4HEDA 5E1FA 2CW0D 1STGA 3PIP3 2F0PA 3J81L 1F77A 4KD4A 4A3EB 1KABA 2SEBD 3DWPA 4DNTB 4HMIA 2G9HD 1G91A 4QB4A 2ICIA 4M1UB 1KDAA 2E2JB 2NVXB 2EY2A 3TP5A 5CV5A 1PTOH 2F03A 1LTGD 1UAPA 1ONLA 3DEPA 3MC0B 3CHBD 4FF1A 1TWFB 1PMRA 4LMQD 2M00A 4KKSA 3TSSA 1I4PA 4HSVA 2QILA 1SYDA 5NUCA 3X3MA 3S16B 5JVG3 3BS1A 1HHVA 3TZUA 1VMPA 2E2IB 4BA1I 1Y69U 5BN4A 2K5QA 3K6OA 4TKOB 5JEAG 4XDXA 4XQNA 4WFN3 2RKSA 3A8JE 1SNPA 4A3FB 4K5XA 4KJNA 4CJ0B 3K58A 4KN4C 3PUZA 2F0JA 5IIFA 5IGBA 1CA5A 3PO3B 1D1KA 5C3XA 5TSSA 2A74C 2NN6H 5BN5A 3DHQA 3K57A 1LT6D 2WAQB 4G7OC 3VYTA 2ICEC 1CK1A 5JJZA 2R3ZA 3KLSX 1PFMA 4CKEA 2F0HA 3NUCA 3Q24A 1GHKA 1CI3M 4DA2A 1KLGD 5C5LA 2A69C 3OMGA 1E2ZA 3ZYYX 3EFXD 2NVQB 2DNEA 4P2CB 4RAUC 2M9VA 2TMPA 1EYCA 3AMUA 4V190 4KKUA 1IYVA 2D62A 4C2MB 4B9WA 3H09A 5CORA 3TDQA 4FF3A 5ISRA 2EYLA 1EWHA 2L9HA 1XX8A 3HS0C 2EY6A 3E0JA 4DAPA 2X6GA 2SNMA 1HUNA 1HTLD 3MXPA 2LMCB 4XIGS 1R4QB 4IALA 4EGVA 3L9AX 1JOOA 1HA6A 3NK9A 4R8IA 3OIQA 3AB9A 1ILQA 4BWGB 3BDCA 2H4OA 2Y0SB 4FF2A 2K04A 2B2WC 3PIO3 5C4XB 4GZYC 1B3AA 1UNSA 4ODGA 3J7AV 3J7AF 1GUOA 3GTPB 3K5MA 1PXUA 1B9MA 1BCPD 2ID0A 5E4XA 4XT1B 3D4RA 4FVMA 2F0IA 1D5MC 1JR0D 2BA0A 1DD2A 2XWBB 5JEAJ 4FXDA 3DWQA 2RDHA 2WKCA 2JE6I 3FVQA 3HOXB 5IT9E 4F87A 3VR2A 4DAVA 4K8JA 3I4LA 2X6LA 2LFNA 1SXTA 3M3YB 5K5PA 2A5HA 4B9XA 3SVMA 1BDOA 3KLSA 2QF7A 3QB3A 4EVOA 4CJ1B 4KI0A 3A7AB 5A2QE 5D3DA 5DM63 1JC7A 3BZDB 1STYA 1U4RA 1G6ZA 3T4AC 1VF5C 4TQUS 2PNRC 3M85A 2E74C 1WD1A 2EE1A 5I9OA 4DAYA 3LWEA 2K03A 5EPKA 3OSOA 2R93B 4JBWA 1ZKOA 1QJOA 1SSOA 2JYOA 2EOTA 3LWUA 2JXMB 3C3LA 3CQZB 1S5ED 4KV6A 2RSNA 2PO4A 5T1IA 4DK0A 3HOZB 2AQ1B 1EQTA 1GHJA 3DEOA 1RD9D 2JEBI 1WTQA 4IFDI 1GUGA 2F0SA 1C48A 4XXEA 3MXNA 5DM73 2WB1B 5DEHA 4ZRZA 3SK5A 1HQMC 5T1GA 4K2LA 4RGOS 2V4DA 1V8QA 2A6HD 1BXTA 4RCOA 4QCLA 3HGBA 1B44D 3SE0A 4FYDA 5COYA 1O7YA 2D5DA 3KF8A 2EJGC 1PTOC 3OMCA 2B8FA 3MWYW 2RVLA 1SMYC 1U4MA 2IWHA 4ULLA 3Q6SA 1NUCA 4Q0FA 2KCNA 3DWAA 3BVZA 3T16A 4HAEA 1O7LA 2LKVA 5HGTA 2F0FA 3Q22A 3K5OA 1GUNA 1TS4A 1S5BD 1SE3A 5K36G 4BY7B 1KLUD 2B2WA 1WTOA 5G3LF 1PRTC 1E2VA 3NWTA 1MSGA 3M4OB 1DOLA 1D5ZC 4B08A 1AEXA 1IW7D 1EWCA 1UEAB 1EEID 1MSHA 5EBCA 4IFDG 3SHLA 5IT9L 1LO5D 1SJHD 2JP1A 3K7AB 3HP3A 1QNKA 4N9TA 1HRJA 2YU9B 1QWYA 3MXGA 3D4DA 3OPOA 4X3TA 3GV3A 2WP8J 3VR4A 5CMDA 4ZUJA 3I3CA 3S1MB 1SNCA 1SYFA 2B2TC 2I07B 1BUVT 1F2YA 1CZGA 3SEBA 4A3JB 1XXGA 5A2QL 3FKIB 1SAPA 2QDBA 2F0QA 5D3IB 2CW0C 1STEA 3I73A 1EU3A 4XYOA 3QOJA 4C3HG 3GTJB 1Y8NB 1SYEA 5M3FB 3RZDB 4NMZA 3AU7A 1H9KA 4ABNA 1NR2A 3S17B 1G2SA 2L11A 1CT1D 2AQ3B 3X3NA 5I6WA 5C44B 2K6AA 5F2DA 3BVGA 1EY5A 5ELFA 2WKDA 2BE5D 2GA4B 4C3HB 3S15B 2IL8A 5J22A 3KBXA 2KECA 1FR3A 3KBGA 5E3FA 1EEFD 1DYQA 4ZLTF 4QMGA 3GTOB 5JOBA 3VYUA 1AP0A 1LTRD 3DXJC 5LL6S 1I4QA 1B2TA 5D14A 2NZ1D 4IUPA 2J0TD 3NSWA 5JEAH 4J8QA 2A6ED 1YNND 2Q8TA 2HCIA 2L55A 4DK1A 1WD0A 2XNAC 4HCEA 3P20A 2AUJD 4NKLA 3VA5A 1CHQD 3E5SA 3ND8A 1RCVD 2FJ2A 4WJWA 1OXVA 3QO2A 2E2HB 1RJTA 3H6MA 2N88A 3S2HB 1EY7A 3MAQA 3IFTA 5IGDA 4IFDJ 1WTPA 4DU9A 3L3OC 4A3DB 3WOEA 1HXYD 4ZK9B 3TP6A 3OW7A 3SR1A 2KA7A 2ZXOA 1E0BA 4TRDA 1Z6HA 4RGMA 1C8CA 2CVRA 4BA2I 1S5DD 3KUPA 1IHZA 5CYUA 3O13A 1II3A 1O78A 5LL6X 1ESRA 5C5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYC A;  3QB3 A;  4J1M A;  4QF4 A;  3C1E A;  4EVO A;  5F2D A;  5I6W A;  5IGG A;  1EY5 A;  3P1H A;  2F0V A;  1EYD A;  5C4Z A;  4KHV A;  5ISR A;  4RKL A;  2EYF A;  4ZQ3 A;  4R8N A;  2EYL A;  5IOC A;  2M00 A;  1EY6 A;  2PQE A;  3V2T A;  2EYO A;  5HUR A;  1STN A;  2SNS A;  2PW5 A;  2F0G A;  1A3T A;  2PZU A;  1STY A;  2EY6 A;  1KDC A;  3HEJ A;  5CV9 A;  1TQO A;  1EY4 A;  4H7B A;  2PYK A;  4DGZ A;  4K6D A;  5CC4 A;  2F0O A;  3TME A;  5J22 A;  3PMF A;  5E3F A;  2SNM A;  1A3V A;  3MZ5 A;  5KIX A;  3MXP A;  4KTA A;  3C1F A;  4K5V A;  4QMG A;  4LAA A;  4I65 A;  4RKB A;  3P75 A;  5EKK A;  5JOB A;  4KY7 A;  3TP7 A;  5I9O A;  1SYD A;  3D8G A;  5NUC A;  3NHH A;  2EY5 A;  1AEX A;  1NSN S;  2F0E A;  2F0U A;  2OF1 A;  3D4W A;  3OSO A;  4PNY A;  5J1Z A;  3NXW A;  5KGU A;  4DF7 A;  1RKN A;  4IAL A;  4B9W A;  3NQT A;  2WAC A;  1JOO A;  5IGF A;  1A2U A;  5CR3 A;  5CV7 A;  4WOR A;  1STH A;  2F0K A;  3SK4 A;  1EY0 A;  4NP5 A;  3SHL A;  5DAU A;  3S9W A;  3NK9 A;  2KQ3 A;  4KV6 A;  4WRD A;  5KRU A;  4IZ8 A;  2EYP A;  1ENA A;  3MEH A;  4OL7 A;  1STB A;  2RDF A;  3T13 A;  4S3S A;  4N9T A;  5EKL A;  2O4X A;  2PW7 A;  3BDC A;  1A2T A;  1TT2 A;  4HTH A;  4K14 A;  4MIU A;  2RKS A;  3SR1 A;  5IGE A;  5J39 A;  4NKL A;  4ZUI A;  3D4D A;  3VA5 A;  1SNP A;  1SNQ A;  3E5S A;  5CGK A;  1EZ6 A;  2KHS A;  4ID6 A;  4G57 A;  4K5X A;  4KJN A;  2F0N A;  3MHB A;  4ME5 A;  2EYH A;  4ODG A;  2F0S A;  2F0T A;  1JOR A;  4ZUJ A;  5C6A A;  3R3O A;  5JAV A;  1SYG A;  1SNC A;  1SNM A;  1SYF A;  2F0J A;  1F2Y A;  5IIF A;  5I6Y A;  5C3W A;  5EGT A;  5IGB A;  4F7X A;  1JOK A;  2EYJ A;  1A3U A;  5KYL A;  1F2M A;  5C3X A;  1KAA A;  2RBM A;  5DEH A;  3SXH A;  2F3V A;  2QDB A;  1STA A;  3EJI A;  4KY5 A;  3DHQ A;  2F0W A;  2F0Q A;  4YIJ A;  3H6M A;  1EYA A;  4IUN A;  3SK5 A;  2EYM A;  4EQN A;  1EY7 A;  2PZW A;  4K2L A;  2F0D A;  1JOQ A;  3RUZ A;  2F0L A;  1SNO A;  5IGD A;  4KD3 A;  4K2K A;  3U9O A;  4K5W A;  5IOD A;  1EY9 A;  4DU9 A;  5E1F A;  2F0I A;  4EQO A;  1F2Z A;  2F0H A;  3NUC A;  1U9R A;  1EY8 A;  2EXZ A;  3D6C A;  5KYI A;  3HZX A;  3NP8 A;  1EZ8 A;  1SND A;  1STG A;  3QOJ A;  2F3W A;  3EVQ A;  3ERO A;  2OEO A;  3QOL A;  2F0P A;  3ERQ A;  3TP6 A;  5C5L A;  4PMC A;  5IGC A;  5M9O A;  4KD4 A;  1KDB A;  2EY1 A;  1TR5 A;  4HMJ A;  3SK8 A;  2HQE A;  4KJO A;  3LX0 A;  3SK6 A;  1KAB A;  2PZT A;  3DMU A;  3OMC A;  4J6H A;  4N9P A;  3OMG A;  4KY6 A;  4NDX A;  4E6I A;  4F8M A;  5C4H A;  4TRD A;  4HMI A;  3BDL A;  1SYE A;  1NUC A;  2ENB A;  4QB4 A;  5CV4 A;  4K8J A;  4NMZ A;  3OWF A;  1KDA A;  2OXP A;  4PMB A;  1EYC A;  2EY2 A;  3ITP A;  3MVV A;  5CV6 A;  1EQV A;  1IHZ A;  5CV8 A;  2NUC A;  3TP5 A;  4K8I A;  3TP8 A;  5CV5 A;  5KEE A;  5K5P A;  1SYB A;  3T16 A;  2F0M A;  4B9X A;  1ENC A;  1II3 A;  5I9P A;  2SOB A;  4EQP A;  2LKV A;  5HGT A;  2F0F A;  4DFA A;  5C5M A; 
#chains in the Genus database with same CATH topology
 2K14 A;  4L6T B;  4RGN A;  4R4C A;  4KLK A;  2KHJ A;  4KHV A;  4X3S A;  1ASZ A;  4JI4 L;  2L4N A;  3W1B A;  3TS0 A;  4H02 A;  1TKW B;  3QJY A;  2VQF Q;  5CV9 A;  1FGU A;  3I4N H;  3HOU B;  4OWW B;  3MZ5 A;  5KIX A;  5ELB A;  1MIU A;  2FIN B;  4I65 A;  5IP9 H;  5GAH C;  2B2T A;  1G2T A;  2ZTC A;  1Z9F A;  3U50 C;  4CJ2 C;  5C4J B;  4DV6 Q;  3S1N H;  2F3I A;  3KF8 B;  1IBL Q;  5DAU A;  1JWM D;  1TS2 A;  2IJ0 A;  2MJ8 A;  1CM9 A;  2KQ3 A;  1BR9 A;  2EYP A;  2PMZ E;  1NBW A;  2NWG A;  2L15 A;  2B2U C;  2I46 A;  5J39 A;  3GTM H;  1LV9 A;  1XTD A;  1KQS A;  1SNQ A;  1J9O A;  2YTY A;  3CRL C;  3NEL A;  4JI1 L;  3J80 E;  2UUC L;  1XTC D;  1BCP C;  3E0E A;  1UUP A;  4IUT A;  3H15 A;  2VUM G;  1ZYR D;  3A74 A;  1SYG A;  2I5H A;  2HDL A;  4GLA C;  3ULP A;  5EBD A;  2IX1 A;  2WAQ G;  1S3O A;  5LMU Q;  1N9W A;  1STA A;  3EJI A;  3CCM A;  1B53 A;  1EYA A;  3E9H A;  2PZW A;  4O0A A;  1F9P A;  4K2K A;  1NNX A;  3W2D A;  1XPO A;  2Z4I A;  1GUS A;  3J81 j;  1VQ8 A;  2HHH L;  2JJQ A;  2VB3 X;  4BBS H;  4DUZ L;  4IUU A;  1KNA A;  4AH6 A;  1MI2 A;  1U4L A;  3OW2 A;  1PHJ A;  3S2D B;  2E5L Q;  2EVB A;  1DON A;  5M9O A;  4C3J G;  1QUQ A;  2IX0 A;  5LHY 1;  4KJO A;  3JAM E;  2VUM B;  2CQA A;  3VR6 A;  1PYW D;  2K01 A;  4NDX A;  1TWC B;  5L37 A;  1Q86 C;  1Q3L A;  2Z6K C;  2CCZ A;  1YNJ C;  3STB D;  4B3S Q;  2R93 H;  3DM1 A;  1IYU A;  1DGS A;  3L0O A;  1I4G A;  3NQI A;  5IWA Q;  5C3E H;  1K8A C;  2UU9 L;  2X69 A;  4QUC A;  5I9P A;  3CQZ H;  3GDE A;  3FDT A;  4X3K A;  1M1K C;  1SRU A;  3C1E A;  3J81 i;  3C46 A;  5M5X H;  1L1O B;  3V05 A;  2K5V A;  4C3J B;  3CCV A;  4HIO A;  3V2T A;  1EY6 A;  2LXJ A;  2PI2 E;  1ET6 A;  3F2C A;  1ML0 D;  3GTQ B;  3WOF A;  1W6K A;  3K59 A;  3RD4 A;  4X62 Q;  4KY7 A;  4JYA L;  5M5Y H;  1NSN S;  2OF1 A;  2F0U A;  5J1Z A;  4C1N K;  2WII B;  1DZ1 A;  4CDE C;  1K83 H;  2WAC A;  4DV0 Q;  4UHV A;  1QOH A;  1MJC A;  4OEL B;  4WOR A;  2BDO A;  1XPU A;  2OCE A;  5IYC H;  4RMF A;  1WFQ A;  4JCV E;  1VQA A;  2B29 A;  3PGZ A;  2Y0S G;  5KND A;  4PQX A;  1YJW A;  1ROD A;  1LTT D;  2ZTD A;  5C4X G;  2HD3 A;  1LT3 D;  1K8M A;  4LF5 L;  4N8F A;  1LT5 D;  4A3K B;  4GNX A;  5BR8 Q;  2JN4 A;  3F1Z A;  3GQB A;  3GTK B;  3MFY A;  2F0N A;  2P5Z X;  3HG9 A;  2DY7 A;  4DV7 Q;  2N78 A;  2NN6 I;  1VQF A;  3KF6 A;  5IT9 c;  5FLM G;  1PH2 A;  1FJG L;  5EGT A;  3RN5 A;  4F7X A;  1ICW A;  5KYL A;  1F2M A;  1MGS A;  2OT2 A;  2PPB C;  1QIL A;  3M7N A;  1G51 A;  4LF6 L;  2AQ2 B;  1VQJ A;  1VQN A;  3M7G A;  3CCL A;  1SNO A;  4RHS A;  4JK1 C;  1D8L A;  4NW2 A;  2BOS A;  4CDF C;  2A73 B;  4PG3 A;  5I2Y A;  1TWH B;  5FKA C;  4P72 A;  2EXZ A;  4RCN A;  5KYI A;  3NTI A;  4IPD A;  3EVQ A;  4QL5 A;  3HOX G;  3ERQ A;  4PMC A;  4B3M L;  2HQE A;  3IL8 A;  1MKH A;  3U58 A;  4N9P A;  2DGY A;  4A3M H;  1XYI A;  1EOV A;  1CSP A;  2AMC B;  2MHV A;  1LTB D;  3T56 B;  3ONA B;  3S1R B;  3D3R A;  2ENB A;  1VCI A;  1YHQ A;  4DUY Q;  4AYB B;  4X65 Q;  5CV8 A;  4R1J A;  3CC4 A;  3J80 L;  1O80 A;  1BBW A;  2LY7 A;  1TU2 B;  4EQP A;  3EQL C;  1C7Y A;  1FNV A;  1PTO B;  2B39 A;  3K7A H;  4J1M A;  3DM3 A;  1RIP A;  4G7Z C;  5K36 H;  3RNU A;  4YWM A;  4A3G H;  2B2U A;  1SBB B;  4GKK Q;  4Y7N H;  1IW7 C;  1YI2 A;  2E75 C;  3SGI A;  4FP5 D;  3G71 A;  2F0O A;  2NZO A;  4G7H C;  1A3V A;  3H3V I;  2NVT B;  2ZXR A;  3A8I E;  3S1M H;  2M2L A;  2XWJ B;  4GN4 B;  1OO9 B;  3TBI B;  4CGY B;  3R8B A;  4LF9 Q;  3I72 A;  3RLF A;  4PZ8 A;  3FKI H;  4JPB W;  4DF7 A;  2EZV A;  3CKI B;  4IFD H;  4A3I H;  4C3I G;  3JAM L;  2YYZ A;  2DNC A;  4NP5 A;  2RCF A;  3S9W A;  3HOZ G;  1X55 A;  1JIC A;  2RHQ B;  3CW2 C;  5ELE A;  4UP7 A;  1M90 C;  1PRT B;  1O7Z A;  1EUJ A;  3M9B A;  4HTH A;  1Q8K A;  3T53 B;  3WDN A;  1QNU A;  5LMN W;  2UXB L;  2UXC Q;  2JA8 B;  4ZAI A;  1C0A A;  1CUK A;  1EU4 A;  4HR7 B;  1TS5 A;  1XWE A;  2FHT A;  1J5E L;  3OTO L;  5EPJ A;  2LS0 1;  1X6O A;  1I94 L;  2WB1 G;  4DR1 Q;  1H9J A;  5I6Y A;  5M3F H;  4O2D A;  3RZD H;  2R92 H;  5IP7 G;  1HNZ L;  4LFB L;  2IHE A;  2Z6K A;  2AWO A;  1PTO F;  4C3I B;  1OXT A;  2FXQ A;  2F0W A;  4JI5 Q;  4YIJ A;  4MTN A;  3UI2 A;  4L63 B;  3IRB A;  3G48 A;  2A69 D;  4BY1 B;  1W2B A;  1B9N A;  3HOY H;  1EY9 A;  3A55 A;  4EQO A;  1F2Z A;  1AE3 A;  2F4I A;  1X54 A;  1H9S A;  3HRZ C;  2ASB A;  4C3H H;  1ASY A;  3SK4 A;  4JVZ A;  2K52 A;  1YZ6 A;  2MPM A;  1YHB A;  4JI6 Q;  1KDB A;  4HMJ A;  3LX0 A;  1WTH A;  3PUY A;  2DY8 A;  5C4H A;  4DN4 M;  3D0F A;  1RF2 D;  1B4O A;  2K05 A;  2J7Z A;  2F4V Q;  1B8A A;  1TII D;  2OXP A;  4JI3 Q;  1HNW L;  2R7F A;  2NUC A;  3A54 A;  3J80 i;  1PRT F;  3I2Z A;  2F0M A;  2ZM6 Q;  1CTM A;  1YEZ A;  3DUZ A;  1YNX A;  1MJE A;  1SYC A;  4DPG A;  3CCU A;  4JI2 L;  4BY7 G;  2UXD Q;  4Z9C B;  2JA6 G;  5C4Z A;  3AEV A;  2B63 H;  4RKL A;  1EIH A;  4R8N A;  3S1Q B;  1STN A;  4U68 A;  1V9P A;  2PZU A;  2F0G A;  4YHH Q;  1KDC A;  4LF7 L;  4H7B A;  1K3B C;  1HH2 P;  3TME A;  2PQA B;  3NTH A;  1S72 A;  1K8O A;  3I70 A;  1X65 A;  4LAA A;  1DM0 B;  1D2B A;  2A6E C;  4UDU C;  2RF4 A;  3QG1 A;  1AW7 A;  4WJ4 A;  1L0X B;  1ZXT A;  1PLF A;  2N3S A;  4MTK A;  3NQT A;  2PMZ B;  1PZK D;  2MQH A;  4CHT B;  1V1P A;  4OWT B;  3JAM i;  3PO2 H;  2B8G A;  1QUQ B;  3I7F A;  5FLX E;  3RZO H;  1S4Z A;  1PV4 A;  4KMU C;  1N36 L;  4IPH A;  2HQL A;  2IT1 A;  3G4S A;  2JA6 B;  2A68 C;  4RFB A;  4POG A;  1Y1W B;  3VDY A;  1DOK A;  1E2W A;  4ILW A;  1GOZ A;  1HA5 A;  2R7D A;  3H0G H;  4HN7 A;  4TSS A;  1B70 B;  1OXX K;  4IUR A;  2VL6 A;  5CGK A;  1DOM A;  1Q8I A;  4KKT A;  3UDX A;  4A3J G;  1Q90 A;  3TS2 A;  1ENF A;  1WCM B;  3CPW A;  2XTI A;  2I5L X;  2F3V A;  4DV2 L;  5FO9 B;  2D9U A;  3EA6 A;  2DJF C;  3S24 A;  5I2X A;  1X3F A;  1IBK Q;  3R2T A;  2XRS D;  4UP9 A;  3AYH B;  1WTX A;  2KEN A;  4A3E H;  2ES2 A;  3ND9 A;  1JWU D;  4CDD C;  5IGC A;  4X64 Q;  3SDZ A;  3CPF A;  1S5F D;  3E6Z X;  4CDC C;  4LF4 L;  3A7L A;  3VYS A;  4KY6 A;  3HOU H;  2DUD A;  4OGQ C;  3A56 A;  2EQS A;  2EXD A;  4QIW E;  3UDF A;  2NVX H;  3BDL A;  3N6R A;  1BBU A;  5FO8 B;  5DLQ E;  4LNQ A;  1FYC A;  4DV1 L;  2Q8R E;  3K0Y A;  1S40 A;  5C4J H;  5KEE A;  4GLV B;  4GNX B;  4I7Z C;  1ENC A;  3BU2 A;  5IE8 A;  1TWA B;  1PZI D;  1TWF H;  2SOB A;  2O5J C;  5C44 G;  2NVY B;  1SFO B;  2VNU D;  3CCE A;  1JQY D;  4JW0 A;  4OHJ A;  3KF6 B;  5FK9 C;  4A93 B;  4PZ6 A;  2J4X A;  2UUB L;  1B50 A;  2EYO A;  2SNS A;  1X3G A;  1LTA D;  3NTK A;  1VQM A;  4LF8 Q;  4B3R L;  4RWS C;  4DGZ A;  1Z7T A;  3DLL A;  1X3Q A;  4K6D A;  5FOB B;  1AN8 A;  2VXW A;  5EQ0 A;  5KNB A;  4XT3 B;  5EKK A;  2FFK B;  1HUM A;  2E76 C;  2E2I H;  1I6H B;  3ER0 A;  2HIV A;  2EY5 A;  4OO1 I;  3VR5 A;  1A63 A;  3RLO A;  1EIF A;  1L0Y B;  1ZEQ X;  3URY A;  4Q5V A;  1EY0 A;  1CA6 A;  4YCV A;  3MEF A;  4A75 A;  1I4X A;  3NWS A;  3TRE A;  2QKI C;  3CRK C;  4DV5 L;  4G4K A;  3CU7 A;  2RSO A;  1SEB D;  3PUW A;  3S2D H;  4BS9 A;  1KRT A;  1QCB D;  1R9T B;  2VUM H;  3HOV B;  1SJE D;  1OXS C;  1A8V A;  1TWC H;  3K5L A;  1JOR A;  1Q12 A;  5JAV A;  3LNN A;  4FF4 A;  1A3U A;  3OHX C;  3J7Y W;  2FMM A;  2C35 B;  1PFS A;  1NR4 A;  2KED A;  1LT4 D;  3N52 A;  2EYM A;  2C5C A;  2H5X A;  2L12 A;  3JC6 6;  4U67 3;  1JOQ A;  2F0L A;  1SE4 A;  4AIM A;  4K5W A;  3BYT B;  5GAG C;  1K8G A;  3PV0 A;  4A3D G;  1EOT A;  1HZC A;  1N34 L;  1BCP B;  4KHP Q;  1M8A A;  1NMG A;  3H91 A;  4RA8 A;  5AFW A;  3HKZ E;  2EPB A;  4C3J H;  3QOL A;  3STB C;  2VQE L;  1G8Z D;  2Q2T A;  2PZT A;  3GD7 A;  4DR3 L;  2ZJQ A;  4YWK A;  1BO0 A;  1UE6 A;  1BKB A;  2BCO A;  4B3T L;  2D2C C;  4BBR B;  1JJG A;  3OYY A;  1K73 C;  4DR5 L;  3PQI A;  4PMB A;  1FGB D;  2KOL A;  1PZJ D;  3MVV A;  4I7A A;  1Y8P B;  4C2M H;  4DR2 Q;  1RTN A;  1U5K A;  2I0Q A;  2NTT A;  1DJR D;  2WV6 D;  4F88 A;  3RLN A;  3NBH A;  4DV4 L;  2BH2 A;  4OO1 G;  2EYF A;  3AQQ A;  2RDG A;  1EFI D;  1W3S A;  3CCJ A;  1A3T A;  4FXK C;  1EY4 A;  3UE0 A;  1CKN A;  3MXU A;  1XNR L;  5ELO A;  1CQF A;  5C0X I;  3J80 c;  1XNQ Q;  3P75 A;  2DN8 A;  1F9Q A;  3GP7 A;  1UE1 A;  3A5U A;  4A3L G;  1NTG A;  1W6J A;  1H9S B;  2JQO A;  2O2L D;  1BCP F;  1QE6 A;  3F2U A;  1AZP A;  4RGT A;  2JSO A;  1XMQ L;  3MXN B;  4QJF A;  1PH1 A;  1GUW A;  1V43 A;  4DR6 L;  4K0K L;  1ENA A;  4OL7 A;  1NY4 A;  1FNW A;  5C4X H;  1K9M C;  2EJM A;  1G29 1;  5IGE A;  2XGT A;  1GVP A;  3FPP A;  4JBM A;  3GTP H;  5FLM H;  3K5N A;  5G3L D;  1GM5 A;  3JAM c;  1WTR A;  3S1R H;  1LAB A;  3MA2 B;  4JV5 Q;  2K7V A;  3CCS A;  3SXH A;  2Z8L A;  5E4W C;  2VQF L;  1I6V C;  4KK7 A;  3I55 A;  3BG3 A;  1SLJ A;  4KD3 A;  1O7I A;  1JE4 A;  3NBI A;  4LUV A;  1T5E A;  4XQQ A;  4JI1 Q;  2UUC Q;  1T5X D;  1WTW A;  5HGQ A;  1FL0 A;  3HZX A;  5LMN Q;  3HOX H;  1Z47 A;  4IN3 A;  4ZKC B;  2NB0 A;  1VDZ A;  2R61 A;  4DR7 L;  1SND A;  2EDG A;  3ERO A;  4DK6 C;  3M4Y A;  3ICE A;  1V1P B;  3GTG B;  2KUM A;  3TN2 A;  1NE3 A;  2L0C A;  3OWE B;  4LFA L;  3M3Y H;  1J6Q A;  1LYL A;  2QCP X;  1IKM A;  1VMC A;  5A35 A;  5DNF A;  2HHH Q;  2PCF B;  5CV6 A;  1EQV A;  1X3P A;  4DUZ Q;  4X66 L;  4PZ7 A;  1SYB A;  4DNI A;  1X56 A;  4GLX A;  5M5W B;  4IQZ A;  1PVO A;  2HDM A;  2RCN A;  1I3Q B;  4M8A A;  4JBJ A;  5C0X G;  1HTP A;  2Z4H A;  2VB2 X;  5IGG A;  3QIA A;  4APV A;  1HQR D;  2F0V A;  4R9W A;  1L2F A;  4ZQ3 A;  5IOC A;  1KNE A;  2O5I C;  5LMU L;  5CC4 A;  2NYZ D;  3K0X A;  1TS3 A;  2R7Z G;  1TVX A;  2BDN A;  4KTA A;  2IPK D;  4RKB A;  2IW3 A;  2B2V C;  3D6W A;  5ELN A;  5KGU A;  1I50 B;  1JCK B;  1TWG B;  4C3I H;  2E5L L;  1M4V A;  3W1G A;  2L1B A;  3HOZ H;  1STH A;  3G7L A;  2JA5 B;  3OOC A;  1VQH A;  5CBE E;  1VQL A;  4PV1 C;  2N55 A;  4GOP A;  1LTI D;  3FRP B;  1STB A;  4QQB X;  1QZH A;  4C1N I;  1TT2 A;  4K14 A;  4L5T A;  4A3K G;  2A1A A;  4LFC L;  2R7Z B;  2AKW B;  2HCC A;  4ID6 A;  3R2I A;  2K5W A;  4G57 A;  3L7Z C;  1PH3 A;  2Z9H A;  1QVG A;  3U9S A;  5IP7 H;  1GUT A;  4IPC A;  1WVL A;  1HFG A;  1IXR A;  1ESF A;  3V96 A;  5EKI A;  4EX5 A;  2UUA L;  3GTL B;  1X32 A;  1E3P A;  3KJO A;  4R4T A;  1UWV A;  4XTC S;  1EFW A;  1Q1E A;  1HZB A;  2A8V A;  3RR5 A;  3MFG A;  2SDF A;  1I4R A;  3KOJ A;  5FO7 B;  3FPU B;  1EY8 A;  2B2Y C;  1FJG Q;  2CH4 A;  4QIW B;  2OEO A;  4BXX G;  1CKM A;  1IKL A;  2KVM A;  2ZT9 C;  3HOW B;  1PDQ A;  2A6H C;  3U4V A;  2JA7 G;  1R4P B;  4AYB G;  4UAI A;  4GS3 A;  2TSS A;  2RQX A;  3OWF A;  3I4M B;  3AFP A;  2Q2I A;  1BQQ T;  1SMX A;  1D6E C;  5BR8 L;  1ILP A;  1RHP A;  1NAP A;  1P16 A;  3H3V H;  2L5T A;  1PFB A;  4BY7 H;  2G9D A;  2Q2H A;  3QWN A;  1HR0 W;  1LM0 A;  4UY8 C;  2LSS A;  3I8Z A;  1LUZ A;  2XN9 C;  5HUR A;  2PYK A;  3M4O H;  1LTS D;  1DCZ A;  2KCC A;  3ERS X;  2JA7 B;  2MP1 A;  3TP7 A;  1JB3 A;  3VYR A;  1SE2 A;  3I4N B;  1WTV A;  3VA7 A;  3D4W A;  2KCM A;  4IUV A;  1IL2 A;  1RKN A;  4KN7 C;  1MD2 D;  1NCV A;  2XRQ D;  1GXD C;  1HZA A;  1EWI A;  5CR3 A;  2YU9 H;  2QDL A;  5KRU A;  3S1N B;  2AWN A;  3BVM A;  3S14 B;  1YBY A;  2RDF A;  5EJW A;  4AQY L;  5C0X J;  2O4X A;  2JA8 G;  4V0B A;  5E7N A;  4X65 L;  3BZC A;  4O42 A;  5BN3 A;  3GTM B;  1CQV A;  4A3J H;  1KAW A;  4KHZ A;  1EYG A;  1SNM A;  3T1H Q;  4X6A H;  2XIW A;  1Y8O B;  4H13 C;  3RMH A;  1LLR D;  2RBM A;  3FMC A;  1L1O C;  2Z6B A;  4GKK L;  4KY5 A;  4BY1 G;  4MZ9 A;  2NN6 G;  2QA4 A;  1N33 L;  2F0D A;  4LK1 C;  2UXB Q;  1TWA H;  3HKZ B;  3RUZ A;  1B3Q A;  2XVS A;  1SFO H;  2ATW A;  1C4Q A;  3TQY A;  1U9R A;  3GTJ H;  4FO2 A;  1J5E Q;  2CWA A;  1LAC A;  1TY2 A;  1YNJ D;  4IJL A;  4BBS B;  4LFB Q;  4H44 C;  3SK8 A;  2EY1 A;  3SK6 A;  2K1B A;  3DMU A;  4J6H A;  4X3U A;  1UE7 A;  5J3B A;  3EN2 A;  4LW1 A;  2K28 A;  5CV4 A;  1FVI A;  1F9S A;  2B2V A;  3S17 H;  3KK7 A;  3TP8 A;  3A8K E;  4K8I A;  1ET9 A;  4RH6 A;  5C44 H;  3T1Y L;  1CFM A;  1HCZ A;  2D0O A;  4ZYS A;  3D31 A;  3LGJ A;  3W3A A;  5FLX c;  5C3E B;  3S15 H;  4QF4 A;  1VQG A;  3PUV A;  4DR1 L;  4P75 A;  2PQE A;  4OIK A;  4JI5 L;  5M5X B;  1J8I A;  3GTO H;  3HEJ A;  1TQO A;  3K8A A;  1GJX A;  1HNW Q;  3KJP A;  2ZJP A;  4HJ7 A;  4LJZ C;  2BE5 C;  1QG7 A;  4ME3 A;  3D8G A;  2F0E A;  4LUZ A;  2MGS A;  4QUF A;  3NXW A;  1A6X A;  4JI2 Q;  1K0S A;  2OTJ A;  5IGF A;  3KYH C;  1CZW A;  5M5Y B;  4P74 A;  1LTL A;  3BDO A;  3Q8D A;  4FXG C;  3F2B A;  1K83 B;  2GVA A;  1Y1W G;  3TZD A;  2C9O A;  4LF7 Q;  1EL0 A;  2QW7 A;  1HPC A;  1I4H A;  1D5X C;  2K50 A;  4PMW A;  2JEA I;  3H94 A;  1VQP A;  3TEH B;  3CAM A;  2F4V L;  3EBE A;  2B2Y A;  1EZ6 A;  2KHS A;  2E2H H;  1BF4 A;  1YNN C;  2XSC A;  1Q46 A;  1WCM G;  3R3O A;  1L0W A;  1TY0 A;  1JOK A;  2EYJ A;  2VS1 A;  3B6Y A;  3QR8 A;  3S2H H;  1NMF A;  2CKZ B;  2AUK A;  5IYB G;  5JPN C;  1U4P A;  1QZG A;  4GN3 B;  2NBF A;  4A3D H;  3U9O A;  1IBM Q;  2WAQ E;  1S5C D;  4LUO A;  4RHR A;  1VF7 A;  5CBA E;  4L8J A;  3CC2 A;  4XYQ A;  4TVA B;  4FNF A;  3NPP A;  2EJF C;  1T9H A;  4Y52 H;  1RTO A;  4JI8 L;  4F8M A;  1EQR A;  4OX9 L;  1Q7Y C;  1ICF B;  3AFQ A;  4HCS A;  1XJV A;  3HKS A;  4A3M B;  1HNX L;  2NZH A;  4CBV A;  1PFN A;  2KEE A;  1E1O A;  4O1N A;  1OTC A;  3IFD A;  3BJU A;  1JJC B;  1N32 L;  1SE8 A;  4A93 G;  4LF4 Q;  4OO1 H;  4NXM Q;  1OXU A;  2MUY A;  5JPM C;  4XQJ A;  2NTS A;  2F1M A;  4DV1 Q;  2K5N A;  4A3G B;  1SR3 A;  4Y7N B;  3M4Q A;  2E2D C;  4NXN L;  4N8X 1;  1BBX C;  3C1F A;  1PH8 A;  4A3L H;  1F9R A;  2F52 A;  4K6L A;  3NHH A;  3E9I A;  4PNY A;  3G6E A;  5I4D A;  5H1S E;  1L1O A;  2ZTE A;  3P7J A;  1A2U A;  3J81 E;  5CV7 A;  2F0K A;  2UUB Q;  2K33 A;  1FD7 D;  4IZ8 A;  4A3I B;  5IYD G;  4B3R Q;  2IHF A;  2K32 A;  2ZJR A;  1KC8 C;  2ZXP A;  4S3S A;  5EKL A;  2PW7 A;  4MIU A;  2CHB D;  1UE5 A;  4ZUI A;  5KNC A;  3PF5 A;  1KHI A;  3HOV G;  1HFN A;  1Q82 C;  1H9R A;  1SDF A;  1DXM A;  1XMO L;  2Y0S E;  2EYH A;  2F0T A;  3K80 C;  4C56 C;  4GKJ L;  1B1Z A;  1VQB A;  1VQ6 A;  3FEW X;  4J15 A;  3KLR A;  4JI7 Q;  5IY0 A;  4A3B B;  2R92 B;  3F8T A;  5JVH 3;  4MHE A;  4LWC A;  3CME A;  3Q23 A;  3KFU A;  4IUN A;  1H9M A;  2YV5 A;  4LF8 L;  1ZYR C;  2H1E A;  5EPL A;  1EIG A;  1FNU A;  4DNR B;  1I3Q H;  3K7U C;  5IOD A;  1JWS D;  4DR4 L;  1Q81 C;  3D6C A;  3HOY B;  4MN3 A;  4DK3 C;  3NP8 A;  1EZ8 A;  3PUX A;  1CHP D;  3IKJ A;  2F3W A;  1YIT A;  4POF A;  2PNH A;  3ZJY C;  1TR5 A;  2QEJ C;  2Z1C A;  1A15 A;  1VQ7 A;  1VQ4 A;  4E6I A;  3H3V C;  4OIJ A;  5M3M G;  3R93 A;  4BBR G;  4ZKB B;  1Q1B A;  3BYY B;  5AJ3 L;  1VQC A;  1AE2 A;  4GOP C;  1N34 Q;  1I50 H;  1JMC A;  3ITP A;  1PTO D;  1IL8 A;  5ELC A;  4IJH A;  4HSP A;  1SMY D;  5C0X H;  4DXG A;  4H0L C;  1X9N A;  4JG2 A;  4DFA A;  2KJX A;  2K5D A;  1C9O A;  1AFP A;  4CKB A;  2RHS B;  3P1H A;  4JI0 L;  2IX3 A;  3GO5 A;  1GKH A;  1EYD A;  3CMA A;  4DR3 Q;  5FLX L;  3GTQ H;  4IUQ A;  4ALP A;  4HJA A;  1D1I A;  3PF4 A;  2PW5 A;  2R7Z H;  2B63 B;  5M3M B;  1UEB A;  2Q8I B;  3PMF A;  1KTK A;  4K5V A;  2WIN B;  3VR3 A;  2A68 D;  2FMC A;  3PIP A;  3I90 A;  3CP0 A;  3GV6 A;  1X3E A;  1RDP D;  2BA1 A;  1Y1V G;  2ALY B;  2RA4 A;  2VW9 A;  3OIP A;  1BOS A;  1PRT D;  3C2P A;  4YCW A;  1U0L A;  4DV3 L;  3NE5 B;  1VQ5 A;  3I91 A;  2YTX A;  4WRD A;  1HR0 Q;  3MEH A;  3J7A 5;  3IAY A;  3T13 A;  4A3K H;  3PO2 B;  2R6G A;  1XNR Q;  3RZO B;  1V1O A;  1A2T A;  1F2L A;  2G5D A;  3GTK H;  3T51 B;  5GAD C;  2HUG A;  4CKC A;  4DXF A;  1YJN A;  4YY3 L;  3G6J B;  2D0P A;  3MTS A;  3CCQ A;  3H0G B;  3MHB A;  4ME5 A;  5C6A A;  1PH6 A;  1XMQ Q;  5ELD A;  3Q0A A;  5C3W A;  5D65 A;  1BNZ A;  1MBY A;  1Y1V B;  4JI4 Q;  1KAA A;  1QB5 D;  4JOI C;  1AZQ A;  4EQN A;  4HED A;  1TWH H;  2WB1 E;  4GN5 A;  1N8R C;  5E1F A;  1WI5 A;  1XNQ L;  4BXX H;  2CW0 D;  4RG1 A;  1STG A;  3PIP 3;  2F0P A;  3J81 L;  1F77 A;  4KD4 A;  4A3E B;  1KAB A;  2SEB D;  3DWP A;  2JA7 H;  4DNT B;  1KIX A;  4HMI A;  3PSI A;  2G9H D;  1G91 A;  4QB4 A;  2ICI A;  4M1U B;  1KDA A;  2E2J B;  1KRS A;  4YWL A;  2NVX B;  2EY2 A;  3TP5 A;  4HIK A;  5CV5 A;  1PTO H;  4DR7 Q;  2F03 A;  1LTG D;  1YVC A;  2DJG C;  1UAP A;  1BVS A;  1ONL A;  5HY6 A;  3S14 H;  3DEP A;  3MC0 B;  3CHB D;  4DV6 L;  4FF1 A;  1TWF B;  1PMR A;  4LMQ D;  4JV5 L;  1KD1 C;  1IBL L;  4R4O A;  4A3C G;  2M00 A;  4KKS A;  1VQ9 A;  3TSS A;  4LFA Q;  2NVT H;  3TRZ A;  1I4P A;  4HSV A;  4A3F G;  1Y14 B;  1SRO A;  4X66 Q;  3BZK A;  2QIL A;  1SYD A;  5NUC A;  3X3M A;  3S16 B;  5JVG 3;  3J7Z C;  3NEM A;  3BS1 A;  5LMN L;  1HHV A;  3TZU A;  1VMP A;  3PO3 G;  1JE5 A;  4L5R C;  2JA5 G;  2E2I B;  4BA1 I;  1Y69 U;  1PA6 A;  5BN4 A;  2K5Q A;  5FJ8 G;  2MNA A;  1K28 A;  1VQE A;  3K6O A;  4TKO B;  5JEA G;  2PQA A;  2HT1 A;  2JA8 H;  4XDX A;  4XQN A;  4WFN 3;  2RKS A;  3A8J E;  1SNP A;  2CFM A;  2UU9 Q;  4A3F B;  2OQ0 A;  4K5X A;  4KJN A;  4CJ0 B;  3K58 A;  4KN4 C;  1WOC A;  3PUZ A;  2F0J A;  5IIF A;  5IGB A;  4HJ9 A;  1HJP A;  1CA5 A;  3PO3 B;  1D1K A;  5C3X A;  2K5H A;  5TSS A;  4YCU A;  4BY1 H;  2A74 C;  2NN6 H;  4L5Q A;  5BN5 A;  3M4P A;  3DHQ A;  3K57 A;  1LT6 D;  2WAQ B;  4G7O C;  3VYT A;  2ICE C;  1A62 A;  1CK1 A;  5JJZ A;  3CCR A;  2R3Z A;  3KLS X;  4LFC Q;  4B3S L;  1PFM A;  4OXP A;  1E7Z A;  4CKE A;  4JYA Q;  2F0H A;  3NUC A;  3Q24 A;  1GHK A;  5IWA L;  3NEN A;  1CI3 M;  4DA2 A;  1KLG D;  1KL9 A;  1VQO A;  5C5L A;  2A69 C;  3HOW G;  2UUA Q;  2LXK A;  3OMG A;  1E2Z A;  3ZYY X;  1AH9 A;  3EFX D;  2NVQ B;  2DNE A;  4NB3 A;  3PIO A;  3I4M G;  4P2C B;  1WJJ A;  4RAU C;  2M9V A;  2TMP A;  4LF5 Q;  1EYC A;  3AMU A;  4V19 0;  4KKU A;  3ULJ A;  1IYV A;  4X62 L;  1GO3 E;  2D62 A;  4C2M B;  3H09 A;  4B9W A;  5COR A;  3S1Q H;  4MNO A;  1XPR A;  3TDQ A;  1YIJ A;  4DV0 L;  4FF3 A;  4QY7 A;  5ISR A;  2EYL A;  1EWH A;  4LF6 Q;  2L9H A;  1XX8 A;  3HS0 C;  2EY6 A;  4HID A;  3E0J A;  4DAP A;  2X6G A;  4P71 A;  1PH4 A;  2SNM A;  1HUN A;  1HTL D;  3MXP A;  3I4N G;  2LMC B;  5EAY A;  4XIG S;  3KDF A;  5IP9 G;  2PI2 A;  1R4Q B;  1KXL A;  2A19 A;  4IAL A;  4EGV A;  3L9A X;  4B3M Q;  1JOO A;  2AHO B;  2JA6 H;  4DV7 L;  4JOI A;  1HA6 A;  1Y1W H;  3RN2 A;  3NK9 A;  4R8I A;  3KLW A;  3OIQ A;  4UPA A;  3AB9 A;  2GVB A;  1ILQ A;  4BWG B;  1PYB A;  3L2P A;  3BDC A;  2H4O A;  2VY3 A;  2Y0S B;  4FF2 A;  5JJK A;  2K04 A;  4WJ3 M;  2B2W C;  1IYJ B;  3PIO 3;  5C4X B;  4DKA C;  4GZY C;  1B3A A;  4OON A;  3W5O A;  1UNS A;  1WCM H;  4ODG A;  3J7A V;  1PYS B;  2CQO A;  3J7A F;  4HJ8 A;  2BH8 A;  1GUO A;  3GTP B;  2E8G A;  3K5M A;  1PXU A;  5IYB H;  4AQY Q;  1B9M A;  1BCP D;  2ID0 A;  3HKZ G;  1GD7 A;  4NPS A;  4IOA A;  5E4X A;  4XT1 B;  4DUY L;  3D4R A;  4FVM A;  2F0I A;  1D5M C;  1JR0 D;  2BA0 A;  1DD2 A;  2XWB B;  5JEA J;  4FXD A;  4BBS G;  3DWQ A;  2RDH A;  2WKC A;  4HJ5 A;  4JBK A;  2JE6 I;  3FVQ A;  3HOX B;  5IT9 E;  4F87 A;  3VR2 A;  3NBH B;  4EQ5 A;  1N33 Q;  4DAV A;  4HIM A;  4K8J A;  1PH9 A;  5GRO A;  3I4L A;  2X6L A;  2LFN A;  1PH7 A;  1SXT A;  3A5Z B;  1CKN B;  2NVY H;  4L5S A;  3M3Y B;  2R93 G;  2JK8 A;  5K5P A;  2A5H A;  1E24 A;  4B9X A;  3SVM A;  5C3E G;  4A93 H;  1BDO A;  1NJI C;  3OTO Q;  4LF9 L;  3KLS A;  2QF7 A;  3QB3 A;  4EVO A;  4CJ1 B;  1I94 Q;  1HNZ Q;  4KI0 A;  3T1H L;  3A7A B;  5A2Q E;  5D3D A;  3I56 A;  5DM6 3;  1JC7 A;  3BZD B;  1STY A;  1U4R A;  1G6Z A;  3T4A C;  1VF5 C;  2CWP A;  4ZCK A;  1HZ9 A;  4TQU S;  1I6H H;  2PNR C;  2N49 A;  3M85 A;  2E74 C;  3T1Y Q;  1WD1 A;  2EE1 A;  4OEM B;  5I9O A;  4DAY A;  3I4O A;  3LWE A;  2UXC L;  2K03 A;  3E3X A;  5EPK A;  3OSO A;  2R93 B;  4JBW A;  1ZKO A;  1QJO A;  1SSO A;  2JYO A;  2EOT A;  3LWU A;  2JXM B;  3C3L A;  3UDI A;  3CXC A;  5IYD H;  1E1T A;  3CQZ B;  1S5E D;  4KV6 A;  2RSN A;  2PO4 A;  5T1I A;  4DK0 A;  1RL2 A;  3HOZ B;  1VS0 A;  2GN5 A;  5IYC G;  1H95 A;  4R4I A;  2AQ1 B;  1EQT A;  1GHJ A;  1R9T H;  3HOV H;  3DEO A;  1RD9 D;  1B7Y B;  2JEB I;  3FHW A;  1WTQ A;  4IFD I;  1GUG A;  2F0S A;  1C48 A;  4XXE A;  3MXN A;  1TXY A;  5DM7 3;  4JI6 L;  2WB1 B;  2MFI A;  5DEH A;  4ZRZ A;  3SK5 A;  1P8L A;  1HQM C;  5T1G A;  4K2L A;  2I5M X;  4A3B H;  4RGO S;  2V4D A;  4JI3 L;  1V8Q A;  2A6H D;  1YJ9 A;  1BXT A;  2QGQ A;  4RCO A;  4QCL A;  3HGB A;  1B44 D;  2ZM6 L;  2B3G A;  2MO0 A;  3SE0 A;  4FYD A;  5COY A;  1O7Y A;  2D5D A;  3KF8 A;  3A0J A;  1SN8 A;  2EJG C;  1PTO C;  2UXD L;  3OMC A;  5M3M H;  1N36 Q;  4BBR H;  2B8F A;  1VQD A;  3MWY W;  1EIY B;  2RVL A;  1SMY C;  1U4M A;  2IWH A;  4A3M G;  1CSQ A;  3PCO B;  4ULL A;  2KBN A;  3Q6S A;  1NUC A;  4FDB A;  4Q0F A;  4A76 A;  1CKO A;  2IY5 B;  4YHH L;  4DAM A;  2KCN A;  3DWA A;  3BVZ A;  3T16 A;  4HAE A;  3J81 c;  1O7L A;  2LKV A;  5HGT A;  2F0F A;  2V1C C;  3Q22 A;  3K5O A;  1K0R A;  1GUN A;  4JI8 Q;  1TS4 A;  1S5B D;  1VQK A;  1SE3 A;  5K36 G;  4BY7 B;  2Q2U A;  1E22 A;  2N8N A;  4OX9 Q;  4DV2 Q;  3EIV A;  3WWV A;  1KLU D;  4A3G G;  2B2W A;  1HNX Q;  4GOP B;  1WTO A;  5G3L F;  4OWX B;  1PRT C;  1E2V A;  1IBM L;  3NWT A;  1MSG A;  3M4O B;  3ULL A;  1DOL A;  1D5Z C;  4B08 A;  3K81 C;  1AEX A;  1IW7 D;  1Y1V H;  1N32 Q;  1EWC A;  1UEA B;  4IO9 A;  1MSH A;  1EEI D;  2YTV A;  2VZA A;  5EBC A;  3FKI G;  4IFD G;  3SHL A;  5IT9 L;  4A3I G;  3CD6 A;  1LO5 D;  1SJH D;  2JP1 A;  3K7A B;  3HP3 A;  1QNK A;  2EIF A;  4N9T A;  1HRJ A;  2YU9 B;  4NXN Q;  1QWY A;  3MXG A;  3D4D A;  1IBK L;  3OPO A;  4R4Q A;  4X3T A;  3GV3 A;  2OTL A;  1JT8 A;  2WP8 J;  3VR4 A;  5CMD A;  2WFW A;  4ZUJ A;  3I3C A;  3S1M B;  1SNC A;  1SYF A;  2B2T C;  2I07 B;  1BUV T;  1F2Y A;  1CZG A;  3SEB A;  4NXM L;  4X64 L;  4P73 A;  1XXG A;  4A3J B;  2KCT A;  5A2Q L;  4IOC A;  2R92 G;  4A3B G;  5M3F G;  1QVC A;  2E2J H;  3FKI B;  1SAP A;  2QDB A;  2F0Q A;  5D3I B;  2HIX A;  2CW0 C;  1STE A;  3HOY G;  3I73 A;  1XMO Q;  3UE1 A;  1EU3 A;  1JB7 A;  1EQQ A;  4XYO A;  3GTG H;  3KDF B;  3QOJ A;  4GKJ Q;  4C3H G;  3GTJ B;  1A0I A;  1Y8N B;  4DV5 Q;  1I5F A;  1SYE A;  5M3F B;  3RZD B;  4NMZ A;  3S16 H;  3AU7 A;  2MO1 A;  5M5W H;  3F2D A;  1H9K A;  1PH5 A;  4ABN A;  4DR4 Q;  1NR2 A;  1IZ6 A;  3CF5 A;  3S17 B;  1G2S A;  2L11 A;  1D7Q A;  4AYB E;  4UP8 A;  1CT1 D;  2AQ3 B;  3X3N A;  2K75 A;  5I6W A;  5C44 B;  2K6A A;  5F2D A;  2CH4 W;  3BVG A;  1EY5 A;  5ELF A;  2WKD A;  2BE5 D;  4A3C H;  5GAE C;  5JJI A;  2GA4 B;  4C3H B;  3S15 B;  4JI7 L;  2B63 G;  2IL8 A;  5AJ3 Q;  1MHW C;  4A3F H;  5J22 A;  3KBX A;  2KEC A;  1FR3 A;  3KBG A;  5E3F A;  1EEF D;  1DYQ A;  1V1Q A;  1TWG H;  4JC0 A;  4QMG A;  5JOB A;  4ZLT F;  3GTO B;  3VYU A;  4A4I A;  1AP0 A;  1LTR D;  3DXJ C;  5LL6 S;  3PO3 H;  2JA5 H;  1I4Q A;  1B2T A;  5D14 A;  2NZ1 D;  4JI0 Q;  4IUP A;  2OQK A;  2VQE Q;  2Z0S A;  5FJ8 H;  2J0T D;  3NSW A;  5JEA H;  4J8Q A;  3PO2 G;  2A6E D;  1YNN D;  3HFZ B;  2Q8T A;  2HCI A;  4B3T Q;  2L55 A;  4DK1 A;  1WD0 A;  4DR5 Q;  2QEX A;  2KHI A;  2XNA C;  4HCE A;  3P20 A;  2AUJ D;  4NKL A;  3VA5 A;  1CHQ D;  3E5S A;  3H0G G;  3ND8 A;  4KHP L;  1RCV D;  2FJ2 A;  4WJW A;  1OXV A;  2NVQ H;  3QO2 A;  3GTL H;  1K3R A;  2E2H B;  4DV3 Q;  4DV4 Q;  1RJT A;  3FP9 A;  4IPG A;  3H6M A;  2N88 A;  4QGU A;  3S2H B;  2JA9 A;  1EY7 A;  1WYD A;  3MAQ A;  3IFT A;  5IGD A;  4IFD J;  4YY3 Q;  1WTP A;  4DU9 A;  3L3O C;  4DR2 L;  4A3D B;  4DAY B;  3WOE A;  3U4Z A;  4GNX C;  1HXY D;  4ZK9 B;  3TP6 A;  3HOW H;  4A3E G;  3OW7 A;  1YHA A;  2OWO A;  3SR1 A;  2KA7 A;  2ZXO A;  4DR6 Q;  5JJL A;  4K0K Q;  1HR0 L;  1E0B A;  4TRD A;  3I4M H;  3HOU G;  1QVF A;  1Z6H A;  1G6P A;  4RGM A;  1C8C A;  2CVR A;  4BA2 I;  1S5D D;  3KUP A;  1IHZ A;  3UDG A;  5CYU A;  3O13 A;  1VQI A;  2K4K A;  1II3 A;  5GQO A;  1JJ2 A;  1O78 A;  5LL6 X;  1ESR A;  3CC7 A;  5C5M A; 
#chains in the Genus database with same CATH homology
 4L6T B;  4RGN A;  4KHV A;  4X3S A;  2L4N A;  1TKW B;  3QJY A;  5CV9 A;  3HOU B;  3MZ5 A;  5KIX A;  5ELB A;  2FIN B;  4I65 A;  2B2T A;  1G2T A;  5C4J B;  4CJ2 C;  5DAU A;  1JWM D;  1TS2 A;  2IJ0 A;  2MJ8 A;  1CM9 A;  2KQ3 A;  1BR9 A;  2EYP A;  2NWG A;  2B2U C;  2I46 A;  5J39 A;  1LV9 A;  1SNQ A;  1J9O A;  3CRL C;  3J80 E;  1XTC D;  1BCP C;  1UUP A;  4IUT A;  1ZYR D;  1SYG A;  2HDL A;  5EBD A;  2IX1 A;  1STA A;  3EJI A;  1B53 A;  1EYA A;  2PZW A;  1F9P A;  4K2K A;  3W2D A;  2Z4I A;  1GUS A;  2VB3 X;  4IUU A;  1KNA A;  1MI2 A;  1U4L A;  3S2D B;  2EVB A;  1DON A;  5M9O A;  4C3J G;  2IX0 A;  5LHY 1;  4KJO A;  3JAM E;  2VUM B;  2CQA A;  3VR6 A;  1PYW D;  2K01 A;  4NDX A;  1TWC B;  1Q3L A;  1YNJ C;  3DM1 A;  1IYU A;  1I4G A;  3NQI A;  2X69 A;  4QUC A;  5I9P A;  3FDT A;  4X3K A;  3C1E A;  3C46 A;  3V05 A;  4C3J B;  3V2T A;  1EY6 A;  1ET6 A;  1ML0 D;  3GTQ B;  3WOF A;  1W6K A;  3K59 A;  3RD4 A;  4KY7 A;  1NSN S;  2OF1 A;  2F0U A;  5J1Z A;  4C1N K;  2WII B;  1DZ1 A;  2WAC A;  1QOH A;  4WOR A;  2BDO A;  5KND A;  4PQX A;  1ROD A;  1LTT D;  1LT3 D;  1K8M A;  1LT5 D;  4A3K B;  3GQB A;  3GTK B;  3MFY A;  2F0N A;  3HG9 A;  2DY7 A;  2NN6 I;  5EGT A;  4F7X A;  1ICW A;  5KYL A;  1F2M A;  1MGS A;  2OT2 A;  2PPB C;  1QIL A;  3M7N A;  2AQ2 B;  3M7G A;  1SNO A;  4RHS A;  4JK1 C;  4NW2 A;  2BOS A;  2A73 B;  5I2Y A;  1TWH B;  5FKA C;  2EXZ A;  4RCN A;  5KYI A;  3NTI A;  3EVQ A;  3ERQ A;  4PMC A;  2HQE A;  3IL8 A;  4N9P A;  1XYI A;  2MHV A;  1LTB D;  3T56 B;  3ONA B;  3S1R B;  3D3R A;  2ENB A;  1VCI A;  4AYB B;  5CV8 A;  3J80 L;  1O80 A;  2LY7 A;  4EQP A;  1TU2 B;  3EQL C;  1FNV A;  1PTO B;  2B39 A;  4J1M A;  4G7Z C;  5K36 H;  2B2U A;  1SBB B;  1IW7 C;  2E75 C;  4FP5 D;  2F0O A;  4G7H C;  1A3V A;  2NVT B;  2ZXR A;  3A8I E;  2M2L A;  2XWJ B;  1OO9 B;  3TBI B;  4CGY B;  3R8B A;  3I72 A;  3RLF A;  4DF7 A;  2EZV A;  3CKI B;  4IFD H;  4C3I G;  3JAM L;  2YYZ A;  2DNC A;  4NP5 A;  3S9W A;  1JIC A;  5ELE A;  1PRT B;  1O7Z A;  4HTH A;  3T53 B;  3WDN A;  1QNU A;  2JA8 B;  4ZAI A;  1EU4 A;  4HR7 B;  1TS5 A;  1XWE A;  2FHT A;  5EPJ A;  2LS0 1;  1H9J A;  5I6Y A;  2AWO A;  1PTO F;  4C3I B;  1OXT A;  2F0W A;  4YIJ A;  3UI2 A;  4L63 B;  2A69 D;  4BY1 B;  1B9N A;  1EY9 A;  3A55 A;  4EQO A;  1F2Z A;  2F4I A;  1H9S A;  3HRZ C;  3SK4 A;  2MPM A;  1KDB A;  4HMJ A;  3LX0 A;  3PUY A;  2DY8 A;  5C4H A;  4DN4 M;  1RF2 D;  1B4O A;  2K05 A;  2J7Z A;  1TII D;  2OXP A;  2NUC A;  3A54 A;  1PRT F;  2F0M A;  1CTM A;  3DUZ A;  1SYC A;  4Z9C B;  5C4Z A;  4RKL A;  1EIH A;  4R8N A;  3S1Q B;  1STN A;  4U68 A;  2PZU A;  2F0G A;  1KDC A;  4H7B A;  3TME A;  3NTH A;  1K8O A;  3I70 A;  4LAA A;  1DM0 B;  1D2B A;  2A6E C;  4UDU C;  3QG1 A;  1AW7 A;  1L0X B;  1ZXT A;  1PLF A;  4CHT B;  3NQT A;  2PMZ B;  1PZK D;  1V1P A;  2B8G A;  5FLX E;  1S4Z A;  4KMU C;  2IT1 A;  2JA6 B;  2A68 C;  4RFB A;  1Y1W B;  1DOK A;  1E2W A;  4ILW A;  1GOZ A;  1HA5 A;  4HN7 A;  4TSS A;  1OXX K;  4IUR A;  5CGK A;  1DOM A;  1Q8I A;  4KKT A;  1Q90 A;  1ENF A;  1WCM B;  2F3V A;  5FO9 B;  2D9U A;  3EA6 A;  5I2X A;  3R2T A;  2XRS D;  1WTX A;  3ND9 A;  1JWU D;  5IGC A;  3SDZ A;  1S5F D;  3E6Z X;  3A7L A;  3VYS A;  4KY6 A;  4OGQ C;  3A56 A;  3BDL A;  3N6R A;  5FO8 B;  1FYC A;  2Q8R E;  3K0Y A;  5KEE A;  4I7Z C;  1ENC A;  1TWA B;  1PZI D;  2SOB A;  2O5J C;  2NVY B;  1SFO B;  2VNU D;  1JQY D;  4OHJ A;  5FK9 C;  4A93 B;  2J4X A;  1B50 A;  2EYO A;  2SNS A;  1LTA D;  3NTK A;  4RWS C;  4DGZ A;  1Z7T A;  1X3Q A;  4K6D A;  5FOB B;  1AN8 A;  2VXW A;  5EQ0 A;  5KNB A;  4XT3 B;  5EKK A;  2FFK B;  1HUM A;  2E76 C;  1I6H B;  2EY5 A;  4OO1 I;  3VR5 A;  1L0Y B;  1ZEQ X;  3URY A;  4Q5V A;  1EY0 A;  1CA6 A;  1I4X A;  3NWS A;  2QKI C;  3CRK C;  4G4K A;  3CU7 A;  2RSO A;  1SEB D;  3PUW A;  4BS9 A;  1QCB D;  1R9T B;  3HOV B;  1SJE D;  1OXS C;  3K5L A;  1JOR A;  1Q12 A;  5JAV A;  3LNN A;  4FF4 A;  1A3U A;  3OHX C;  3J7Y W;  2FMM A;  1NR4 A;  2KED A;  1LT4 D;  3N52 A;  2EYM A;  2C5C A;  2L12 A;  1JOQ A;  4U67 3;  2F0L A;  1SE4 A;  4K5W A;  3BYT B;  3PV0 A;  1EOT A;  1BCP B;  1M8A A;  3H91 A;  4RA8 A;  5AFW A;  2EPB A;  3QOL A;  1G8Z D;  2PZT A;  3GD7 A;  1BO0 A;  2BCO A;  2D2C C;  4BBR B;  4PMB A;  1FGB D;  2KOL A;  1PZJ D;  3MVV A;  1Y8P B;  1RTN A;  2NTT A;  1DJR D;  2WV6 D;  4F88 A;  3NBH A;  4OO1 G;  2EYF A;  2RDG A;  1EFI D;  1A3T A;  4FXK C;  1EY4 A;  3MXU A;  1CQF A;  5C0X I;  3P75 A;  2DN8 A;  1F9Q A;  3GP7 A;  1W6J A;  1H9S B;  2O2L D;  1BCP F;  1QE6 A;  3F2U A;  1AZP A;  4RGT A;  2JSO A;  1GUW A;  1V43 A;  1ENA A;  4OL7 A;  1FNW A;  2EJM A;  1G29 1;  5IGE A;  3FPP A;  3K5N A;  5G3L D;  1WTR A;  1LAB A;  3MA2 B;  2K7V A;  3SXH A;  2Z8L A;  5E4W C;  1I6V C;  4KK7 A;  3BG3 A;  4KD3 A;  1JE4 A;  3NBI A;  4XQQ A;  1T5E A;  1T5X D;  1WTW A;  3HZX A;  1Z47 A;  4IN3 A;  4ZKC B;  2NB0 A;  1VDZ A;  2R61 A;  1SND A;  2EDG A;  3ERO A;  3M4Y A;  1V1P B;  3GTG B;  2KUM A;  3TN2 A;  2L0C A;  3OWE B;  2QCP X;  1IKM A;  1VMC A;  5A35 A;  5DNF A;  2PCF B;  5CV6 A;  1EQV A;  1X3P A;  1SYB A;  5M5W B;  4IQZ A;  2HDM A;  1I3Q B;  4M8A A;  5C0X G;  1HTP A;  2Z4H A;  2VB2 X;  5IGG A;  3QIA A;  1HQR D;  2F0V A;  4R9W A;  4ZQ3 A;  5IOC A;  1KNE A;  2O5I C;  5CC4 A;  2NYZ D;  1TS3 A;  1TVX A;  2BDN A;  4KTA A;  2IPK D;  4RKB A;  2IW3 A;  2B2V C;  3D6W A;  5KGU A;  1I50 B;  1JCK B;  1TWG B;  1M4V A;  2L1B A;  1STH A;  3G7L A;  2JA5 B;  3OOC A;  5CBE E;  4PV1 C;  2N55 A;  1LTI D;  3FRP B;  1STB A;  4C1N I;  1TT2 A;  4K14 A;  2R7Z B;  2HCC A;  4ID6 A;  3R2I A;  2K5W A;  4G57 A;  3L7Z C;  3U9S A;  1GUT A;  1WVL A;  1HFG A;  1ESF A;  3V96 A;  5EKI A;  3GTL B;  1X32 A;  4XTC S;  1Q1E A;  3MFG A;  2SDF A;  1I4R A;  5FO7 B;  3FPU B;  1EY8 A;  2B2Y C;  4QIW B;  2OEO A;  1IKL A;  2KVM A;  2ZT9 C;  3HOW B;  1PDQ A;  2A6H C;  1R4P B;  4UAI A;  2TSS A;  2RQX A;  3OWF A;  3I4M B;  1BQQ T;  1D6E C;  1ILP A;  1RHP A;  1NAP A;  2L5T A;  1PFB A;  2G9D A;  3QWN A;  3I8Z A;  2XN9 C;  5HUR A;  2PYK A;  1LTS D;  1DCZ A;  2KCC A;  2JA7 B;  2MP1 A;  3TP7 A;  1JB3 A;  3VYR A;  1SE2 A;  3I4N B;  1WTV A;  3VA7 A;  3D4W A;  4IUV A;  1RKN A;  4KN7 C;  1MD2 D;  1NCV A;  2XRQ D;  1GXD C;  5CR3 A;  5KRU A;  3S1N B;  2AWN A;  3BVM A;  3S14 B;  2RDF A;  5EJW A;  5C0X J;  2O4X A;  4V0B A;  4O42 A;  5BN3 A;  3GTM B;  1CQV A;  4KHZ A;  1SNM A;  2XIW A;  1Y8O B;  4H13 C;  3RMH A;  1LLR D;  2RBM A;  3FMC A;  4KY5 A;  2NN6 G;  2F0D A;  4LK1 C;  3HKZ B;  3RUZ A;  2XVS A;  1C4Q A;  1U9R A;  4FO2 A;  1LAC A;  1TY2 A;  1YNJ D;  4BBS B;  4H44 C;  3SK8 A;  2EY1 A;  3SK6 A;  2K1B A;  3DMU A;  4J6H A;  4X3U A;  2K28 A;  5CV4 A;  1F9S A;  2B2V A;  3KK7 A;  3TP8 A;  3A8K E;  4K8I A;  1ET9 A;  4RH6 A;  1CFM A;  1HCZ A;  4ZYS A;  3D31 A;  3W3A A;  5C3E B;  4QF4 A;  3PUV A;  2PQE A;  4OIK A;  5M5X B;  1J8I A;  3HEJ A;  1TQO A;  1GJX A;  4LJZ C;  2BE5 C;  1QG7 A;  3D8G A;  2F0E A;  2MGS A;  4QUF A;  3NXW A;  1A6X A;  5IGF A;  1CZW A;  5M5Y B;  3BDO A;  4FXG C;  1K83 B;  3TZD A;  2C9O A;  1EL0 A;  1HPC A;  1I4H A;  1D5X C;  4PMW A;  2JEA I;  3H94 A;  2B2Y A;  1EZ6 A;  2KHS A;  1BF4 A;  1YNN C;  2XSC A;  3R3O A;  1TY0 A;  1JOK A;  2EYJ A;  2AUK A;  5JPN C;  1U4P A;  2NBF A;  3U9O A;  1S5C D;  4RHR A;  1VF7 A;  5CBA E;  4L8J A;  4XYQ A;  4FNF A;  3NPP A;  2EJF C;  1RTO A;  4F8M A;  4HCS A;  4A3M B;  4CBV A;  1PFN A;  2KEE A;  4O1N A;  3IFD A;  4OO1 H;  1OXU A;  2MUY A;  5JPM C;  4XQJ A;  2NTS A;  2F1M A;  4A3G B;  4Y7N B;  2E2D C;  1BBX C;  3C1F A;  1F9R A;  4K6L A;  3NHH A;  4PNY A;  5I4D A;  3P7J A;  1A2U A;  3J81 E;  5CV7 A;  2F0K A;  2K33 A;  1FD7 D;  4IZ8 A;  4A3I B;  2K32 A;  2ZXP A;  4S3S A;  5EKL A;  2PW7 A;  4MIU A;  2CHB D;  4ZUI A;  5KNC A;  1HFN A;  1H9R A;  1SDF A;  1DXM A;  2EYH A;  2F0T A;  4C56 C;  1B1Z A;  3FEW X;  3KLR A;  4A3B B;  2R92 B;  5JVH 3;  4MHE A;  3Q23 A;  4IUN A;  1H9M A;  1ZYR C;  2H1E A;  5EPL A;  1EIG A;  1FNU A;  4DNR B;  5IOD A;  1JWS D;  3D6C A;  3HOY B;  4MN3 A;  3NP8 A;  1EZ8 A;  3PUX A;  1CHP D;  3IKJ A;  2F3W A;  1TR5 A;  2QEJ C;  2Z1C A;  1A15 A;  4E6I A;  3H3V C;  4OIJ A;  3R93 A;  4ZKB B;  1Q1B A;  3BYY B;  3ITP A;  1PTO D;  1IL8 A;  5ELC A;  4HSP A;  1SMY D;  5C0X H;  4DXG A;  4H0L C;  4DFA A;  2KJX A;  2K5D A;  1AFP A;  4CKB A;  3P1H A;  2IX3 A;  3GO5 A;  1EYD A;  5FLX L;  4IUQ A;  1D1I A;  2PW5 A;  2B63 B;  5M3M B;  2Q8I B;  3PMF A;  1KTK A;  4K5V A;  2WIN B;  3VR3 A;  2A68 D;  2FMC A;  3I90 A;  3GV6 A;  1RDP D;  2BA1 A;  2RA4 A;  3OIP A;  1BOS A;  1PRT D;  3C2P A;  3NE5 B;  3I91 A;  4WRD A;  3MEH A;  3IAY A;  3T13 A;  3PO2 B;  2R6G A;  3RZO B;  1V1O A;  1A2T A;  1F2L A;  3T51 B;  2HUG A;  4CKC A;  4DXF A;  3G6J B;  3MTS A;  3H0G B;  3MHB A;  4ME5 A;  5C6A A;  5ELD A;  3Q0A A;  5C3W A;  5D65 A;  1BNZ A;  1MBY A;  1Y1V B;  1KAA A;  1QB5 D;  1AZQ A;  4EQN A;  4HED A;  5E1F A;  2CW0 D;  1STG A;  3PIP 3;  2F0P A;  3J81 L;  1F77 A;  4KD4 A;  4A3E B;  1KAB A;  2SEB D;  3DWP A;  4DNT B;  4HMI A;  2G9H D;  1G91 A;  4QB4 A;  2ICI A;  4M1U B;  1KDA A;  2E2J B;  2NVX B;  2EY2 A;  3TP5 A;  5CV5 A;  1PTO H;  2F03 A;  1LTG D;  1UAP A;  1ONL A;  3DEP A;  3MC0 B;  3CHB D;  4FF1 A;  1TWF B;  1PMR A;  4LMQ D;  2M00 A;  4KKS A;  3TSS A;  1I4P A;  4HSV A;  2QIL A;  1SYD A;  5NUC A;  3X3M A;  3S16 B;  5JVG 3;  3BS1 A;  1HHV A;  3TZU A;  1VMP A;  2E2I B;  4BA1 I;  1Y69 U;  5BN4 A;  2K5Q A;  3K6O A;  4TKO B;  5JEA G;  4XDX A;  4XQN A;  4WFN 3;  2RKS A;  3A8J E;  1SNP A;  4A3F B;  4K5X A;  4KJN A;  4CJ0 B;  3K58 A;  4KN4 C;  3PUZ A;  2F0J A;  5IIF A;  5IGB A;  1CA5 A;  3PO3 B;  1D1K A;  5C3X A;  5TSS A;  2A74 C;  2NN6 H;  5BN5 A;  3DHQ A;  3K57 A;  1LT6 D;  2WAQ B;  4G7O C;  3VYT A;  2ICE C;  1CK1 A;  5JJZ A;  2R3Z A;  3KLS X;  1PFM A;  4CKE A;  2F0H A;  3NUC A;  3Q24 A;  1GHK A;  1CI3 M;  4DA2 A;  1KLG D;  5C5L A;  2A69 C;  3OMG A;  1E2Z A;  3ZYY X;  3EFX D;  2NVQ B;  2DNE A;  4P2C B;  4RAU C;  2M9V A;  2TMP A;  1EYC A;  3AMU A;  4V19 0;  4KKU A;  1IYV A;  2D62 A;  4C2M B;  4B9W A;  3H09 A;  5COR A;  3TDQ A;  4FF3 A;  5ISR A;  2EYL A;  1EWH A;  2L9H A;  1XX8 A;  3HS0 C;  2EY6 A;  3E0J A;  4DAP A;  2X6G A;  2SNM A;  1HUN A;  1HTL D;  3MXP A;  2LMC B;  4XIG S;  1R4Q B;  4IAL A;  4EGV A;  3L9A X;  1JOO A;  1HA6 A;  3NK9 A;  4R8I A;  3OIQ A;  3AB9 A;  1ILQ A;  4BWG B;  3BDC A;  2H4O A;  2Y0S B;  4FF2 A;  2K04 A;  2B2W C;  3PIO 3;  5C4X B;  4GZY C;  1B3A A;  1UNS A;  4ODG A;  3J7A V;  3J7A F;  1GUO A;  3GTP B;  3K5M A;  1PXU A;  1B9M A;  1BCP D;  2ID0 A;  5E4X A;  4XT1 B;  3D4R A;  4FVM A;  2F0I A;  1D5M C;  1JR0 D;  2BA0 A;  1DD2 A;  2XWB B;  5JEA J;  4FXD A;  3DWQ A;  2RDH A;  2WKC A;  2JE6 I;  3FVQ A;  3HOX B;  5IT9 E;  4F87 A;  3VR2 A;  4DAV A;  4K8J A;  3I4L A;  2X6L A;  2LFN A;  1SXT A;  3M3Y B;  5K5P A;  2A5H A;  4B9X A;  3SVM A;  1BDO A;  3KLS A;  2QF7 A;  3QB3 A;  4EVO A;  4CJ1 B;  4KI0 A;  3A7A B;  5A2Q E;  5D3D A;  5DM6 3;  1JC7 A;  3BZD B;  1STY A;  1U4R A;  1G6Z A;  3T4A C;  1VF5 C;  4TQU S;  2PNR C;  3M85 A;  2E74 C;  1WD1 A;  2EE1 A;  5I9O A;  4DAY A;  3LWE A;  2K03 A;  5EPK A;  3OSO A;  2R93 B;  4JBW A;  1ZKO A;  1QJO A;  1SSO A;  2JYO A;  2EOT A;  3LWU A;  2JXM B;  3C3L A;  3CQZ B;  1S5E D;  4KV6 A;  2RSN A;  2PO4 A;  5T1I A;  4DK0 A;  3HOZ B;  2AQ1 B;  1EQT A;  1GHJ A;  3DEO A;  1RD9 D;  2JEB I;  1WTQ A;  4IFD I;  1GUG A;  2F0S A;  1C48 A;  4XXE A;  3MXN A;  5DM7 3;  2WB1 B;  5DEH A;  4ZRZ A;  3SK5 A;  1HQM C;  5T1G A;  4K2L A;  4RGO S;  2V4D A;  1V8Q A;  2A6H D;  1BXT A;  4RCO A;  4QCL A;  3HGB A;  1B44 D;  3SE0 A;  4FYD A;  5COY A;  1O7Y A;  2D5D A;  3KF8 A;  2EJG C;  1PTO C;  3OMC A;  2B8F A;  3MWY W;  2RVL A;  1SMY C;  1U4M A;  2IWH A;  4ULL A;  3Q6S A;  1NUC A;  4Q0F A;  2KCN A;  3DWA A;  3BVZ A;  3T16 A;  4HAE A;  1O7L A;  2LKV A;  5HGT A;  2F0F A;  3Q22 A;  3K5O A;  1GUN A;  1TS4 A;  1S5B D;  1SE3 A;  5K36 G;  4BY7 B;  1KLU D;  2B2W A;  1WTO A;  5G3L F;  1PRT C;  1E2V A;  3NWT A;  1MSG A;  3M4O B;  1DOL A;  1D5Z C;  4B08 A;  1AEX A;  1IW7 D;  1EWC A;  1UEA B;  1EEI D;  1MSH A;  5EBC A;  4IFD G;  3SHL A;  5IT9 L;  1LO5 D;  1SJH D;  2JP1 A;  3K7A B;  3HP3 A;  1QNK A;  4N9T A;  1HRJ A;  2YU9 B;  1QWY A;  3MXG A;  3D4D A;  3OPO A;  4X3T A;  3GV3 A;  2WP8 J;  3VR4 A;  5CMD A;  4ZUJ A;  3I3C A;  3S1M B;  1SNC A;  1SYF A;  2B2T C;  2I07 B;  1BUV T;  1F2Y A;  1CZG A;  3SEB A;  4A3J B;  1XXG A;  5A2Q L;  3FKI B;  1SAP A;  2QDB A;  2F0Q A;  5D3I B;  2CW0 C;  1STE A;  3I73 A;  1EU3 A;  4XYO A;  3QOJ A;  4C3H G;  3GTJ B;  1Y8N B;  1SYE A;  5M3F B;  3RZD B;  4NMZ A;  3AU7 A;  1H9K A;  4ABN A;  1NR2 A;  3S17 B;  1G2S A;  2L11 A;  1CT1 D;  2AQ3 B;  3X3N A;  5I6W A;  5C44 B;  2K6A A;  5F2D A;  3BVG A;  1EY5 A;  5ELF A;  2WKD A;  2BE5 D;  2GA4 B;  4C3H B;  3S15 B;  2IL8 A;  5J22 A;  3KBX A;  2KEC A;  1FR3 A;  3KBG A;  5E3F A;  1EEF D;  1DYQ A;  4ZLT F;  4QMG A;  3GTO B;  5JOB A;  3VYU A;  1AP0 A;  1LTR D;  3DXJ C;  5LL6 S;  1I4Q A;  1B2T A;  5D14 A;  2NZ1 D;  4IUP A;  2J0T D;  3NSW A;  5JEA H;  4J8Q A;  2A6E D;  1YNN D;  2Q8T A;  2HCI A;  2L55 A;  4DK1 A;  1WD0 A;  2XNA C;  4HCE A;  3P20 A;  2AUJ D;  4NKL A;  3VA5 A;  1CHQ D;  3E5S A;  3ND8 A;  1RCV D;  2FJ2 A;  4WJW A;  1OXV A;  3QO2 A;  2E2H B;  1RJT A;  3H6M A;  2N88 A;  3S2H B;  1EY7 A;  3MAQ A;  3IFT A;  5IGD A;  4IFD J;  1WTP A;  4DU9 A;  3L3O C;  4A3D B;  3WOE A;  1HXY D;  4ZK9 B;  3TP6 A;  3OW7 A;  3SR1 A;  2KA7 A;  2ZXO A;  1E0B A;  4TRD A;  1Z6H A;  4RGM A;  1C8C A;  2CVR A;  4BA2 I;  1S5D D;  3KUP A;  1IHZ A;  5CYU A;  3O13 A;  1II3 A;  1O78 A;  5LL6 X;  1ESR A;  5C5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...