1EYGA

Crystal structure of chymotryptic fragment of e. coli ssb bound to two 35-mer single strand dnas
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
112
structure length
112
Chain Sequence
b'ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SINGLE STRANDED 28-MER OF D(C)
publication title Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
total genus 15
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eygA00
1PH2A 3S2HH 4LWCA 2IY5B 3CMAA 3J81j 4KHPQ 2EQSA 3CC2A 4HJ9A 1EYGA 1C7YA 1KC8C 4A75A 2ZTDA 1EWIA 2BH8A 1YBYA 5IYBH 1EFWA 4YWKA 3I56A 1TWFH 2IHFA 4IJLA 4PZ6A 5C3EG 2N49A 4A3MG 1PH7A 3F8TA 1YEZA 4YY3L 1YHBA 1D8LA 2EIFA 4JI8L 4L5QA 4YY3Q 3HOXH 4ALPA 1Q86C 3H3VI 1SRUA 5GAEC 3CD6A 5IP7G 4R4CA 4GLXA 4A3BG 1BKBA 4OWWB 1OXVA 1X3EA 4GLVB 1Q1BA 3K81C 1G51A 1NY4A 2CWPA 5IE8A 5IY0A 1GKHA 3TRZA 4DR2L 4DR6L 4A3LH 4IJHA 3CMEA 2K5NA 4PMWA 2E8GA 5M3FG 4P72A 1B8AA 4JBWA 4DR2Q 2A8VA 2VUMH 3H0GG 3ZJYC 1X54A 4JOIA 2HHHQ 2NN6G 1VQ5A 4JBKA 3PCOB 3PF5A 1JMCA 4GNXA 4XIGS 4A3GG 3HOWH 5HGQA 3HOZH 1G6PA 3G4SA 2RHSB 1WCMG 1XMQL 4BY1H 3PIPA 1U5KA 3PUYA 4MNOA 3RNUA 4LF8L 1EIYB 1VQAA 3HKZG 4IPCA 1XMQQ 2LSSA 1YHQA 2KHJA 5M3MH 5IYCH 4LF8Q 3S16H 2GVBA 4NB3A 5ELNA 3PF4A 3OTOL 4NPSA 1CKMA 5JJLA 1KL9A 2UXBL 3CP0A 1UE5A 2VQFL 1K9MC 4A76A 3MEFA 3A5ZB 3TREA 4BY7H 2QGQA 1Y1WH 3B6YA 1A0IA 1CSPA 4JI6L 2UXBQ 2WAQG 1FL0A 2VQFQ 1CSQA 1Q1EA 1I6HH 1GO3E 5C3EH 1QVGA 4JI6Q 1EQQA 4TQUS 3PUVA 4TVAB 1XNQL 3W1BA 4GKKQ 3G48A 2JA8G 4GKJL 2PI2E 1JB7A 3A74A 2Y0SE 4LUOA 3ULJA 1PH8A 5DLQE 1QVFA 1XNQQ 2BH2A 3BZCA 5C0XJ 1PVOA 1UE7A 5IP7H 4A3BH 4GKJQ 1WJJA 4C3IH 4GNXB 5LMNQ 1XMOL 3A5UA 1NTGA 4A3DG 4BBRG 2ID0A 2PQAA 1AE2A 3KJOA 3S15H 5BR8L 3F1ZA 3KFUA 1Q46A 4DPGA 1JJGA 2Q2IA 3PIOA 4GN4B 2OTLA 4IFDI 5M3FH 4JI4L 5GQOA 2HIVA 1WOCA 1XPOA 1PFSA 2MO0A 4LNQA 2I5MX 1IL2A 4AH6A 3TQYA 3DLLA 4JG2A 4JI4Q 1IBMQ 1XNRL 4IPHA 3S24A 1PH4A 1IXRA 3EBEA 2B63G 3HFZB 2B29A 4DNIA 4IFDG 1X55A 3U58A 1XNRQ 1NMFA 4DV5L 1HNWL 4IOCA 3KDFA 1I3QH 3BJUA 3EIVA 3U4VA 1HNWQ 2K75A 4DV5Q 1VQMA 3GDEA 3PUXA 1PH6A 2Q2UA 4JV5L 3NELA 1PH1A 4WJ3M 3CPFA 3KYHC 2DGYA 3STBC 2UU9L 1SLJA 1EQRA 1BBWA 1JE5A 3KF6A 2ZJPA 4JV5Q 1WFQA 4R4IA 4A3CG 1K3RA 4YHHL 2Z6KA 4OWTB 3PV0A 1I94L 1VQBA 2CKZB 1P16A 4LF9L 5IYDH 4L5RC 1LYLA 4YHHQ 2ZJRA 4GOPC 3DM3A 2UUCL 1HZCA 1I94Q 5IP9G 2RF4A 1S3OA 3Q8DA 4LF9Q 1S40A 3ULLA 4AIMA 2F3IA 3K80C 4P74A 4OX9L 1HJPA 3AFQA 5AJ3L 4DV6L 1JT8A 2BA1A 1XPUA 4O0AA 2JA8H 4XTCS 3D31A 2YTVA 4OX9Q 1VQEA 2CWAA 3CAMA 3CCRA 3GTLH 1W2BA 4R4QA 5AJ3Q 1VQFA 4DV6Q 1KQSA 3HOVG 3J81i 4IO9A 1YHAA 4HIOA 1TWCH 5JJKA 4QJFA 2JA6G 4C3HH 2ZJQA 1Y14B 1UEBA 2I5LX 1VS0A 2VY3A 4HJ7A 4IPGA 4C2MH 4HJAA 1PA6A 3JAMc 3KDFB 4UP9A 1HR0L 1VQ6A 4YWMA 3PGZA 4X66L 3GTGH 2D62A 2N8NA 4POGA 1RIPA 3RZDH 1HR0Q 4A4IA 1FJGL 3KF6B 4X66Q 3K8AA 1B70B 2MQHA 2CCZA 3I4MH 2JA7H 1AH9A 3UE1A 4EX5A 3L2PA 2QEXA 1FJGQ 2R7ZG 3J80i 4A3IH 4BA2I 2IX0A 1IBKL 2ZTCA 1VQGA 4JI8Q 1GM5A 4PZ7A 3PUZA 2CFMA 1IBKQ 3RZOH 2A19A 3M9BA 2BA0A 2NVXH 1YZ6A 5FJ8G 3HKSA 3BZKA 1EIFA 2YTXA 3OYYA 5LMUL 1DGSA 4DV0L 1QVCA 1XJVA 2JE6I 2PMZE 4A3FH 4B3ML 4L5SA 2HT1A 1VQLA 5LMUQ 3HOYG 3PO2H 1HZAA 2WB1G 5IWAL 2GVAA 4DR6Q 1EUJA 2IT1A 1A62A 4B3MQ 2RCNA 4A3JG 5C4XH 2IHEA 5IWAQ 3RN2A 3I4NH 1D7QA 3AFPA 1KIXA 3HKZE 1SE8A 1UWVA 4YCVA 5C44G 3RR5A 3CCUA 2OWOA 1Q81C 4UP8A 2OQKA 2H5XA 1X3GA 4IOAA 4B3TL 5IT9c 3FKIG 2N78A 3CW2C 1PV4A 3CPWA 1KRSA 3S17H 4DR4L 1L1OA 2HIXA 2VL6A 4B3TQ 1N33L 4POFA 3A0JA 2VZAA 2EXDA 4A3KG 3I55A 4OXPA 4DR4Q 4YCUA 4DV4L 1B7YB 4JI0L 2WAQE 1N33Q 2VNUD 2CQOA 5ELOA 1E24A 3OTOQ 4JI0Q 4DV4Q 5FLMG 1YIJA 2N3SA 1MJCA 1C0AA 1A8VA 3F2DA 1O7IA 1X6OA 4PZ8A 3AQQA 1VQ4A 2E2JH 1M1KC 3U50C 1KRTA 3TS0A 1MIUA 4JI3L 3CCVA 4PG3A 4JYAL 3CC7A 1LM0A 4DAMA 4A3MH 3S2DH 4C3JH 2PNHA 4JI3Q 2PI2A 3L7ZC 4L5TA 4UPAA 4HJ5A 1R9TH 2K52A 2K5HA 2R7ZH 3M85A 3TS2A 4JYAQ 4JI5L 3CCEA 4QY7A 3G71A 4BXXG 1N8RC 2R92G 3S14H 1LUZA 3KOJA 2NZHA 3RLOA 5C0XI 1K0RA 1PH3A 2A1AA 3KJPA 1JJCB 3F2BA 4MZ9A 4Y7NH 1U0LA 1YJNA 1PH5A 3CCLA 3J7A5 1I50H 1XMOQ 2ES2A 3LGJA 3H3VH 2LXKA 1GD7A 1L1OB 3NENA 4DUYL 5BR8Q 1TWHH 4DK6C 1K83H 1HNZL 1CKNB 3H0GH 3ULPA 4DUYQ 5JJIA 4YWLA 2KHIA 1HNZQ 5M5WH 2K5VA 1WYDA 1Z47A 4EQ5A 4A3GH 4ME3A 2ATWA 1HZBA 3FP9A 1QUQA 1WCMH 1MJEA 1YJWA 3PO3G 5K36G 1OXSC 2XTIA 4LF5L 5FLXc 4QGUA 4HIMA 2JA5G 3OW2A 3GTMH 1KD1C 2KCMA 5GAGC 1G291 4LF5Q 3I2ZA 1SR3A 3CQZH 4YCWA 1WI5A 1YVCA 3GTPH 1EOVA 2ZTEA 1K8AC 4QL5A 3UDGA 2ASBA 3CCSA 2OTJA 4OONA 4A93G 2YTYA 2UU9Q 2YU9H 4WJ4A 4AYBE 2K14A 4JOIC 4X65L 4UY8C 5LMNW 2AMCB 2UUCQ 3HOXG 4GNXC 1IZ6A 1J5EL 2JK8A 4X65Q 4BXXH 1VQIA 1T9HA 2E2HH 4DR1L 1J5EQ 4RMFA 5E7NA 3S1NH 4JBJA 3GD7A 1E1TA 4A3LG 4A3DH 4BBRH 4DR1Q 4KI0A 1QUQB 4HJ8A 4HIKA 2NVQH 4KHZA 2I0QA 1RL2A 2VQEL 1K73C 3ER0A 2VUMG 2I5HA 1JJ2A 1PHJA 4DV3L 1C9OA 1SMXA 1NE3A 5JEAG 4LF7L 1N9WA 2VQEQ 4DKAC 3ERSX 3W1GA 4X64L 3FHWA 3JC66 1XTDA 3GTJH 1E22A 4DV3Q 4DV2L 2NVTH 3HOWG 4JI1L 4LF7Q 3HOZG 1UE1A 2B3GA 4BY1G 4X64Q 1X56A 1FVIA 2NVYH 5C4JH 2QA4A 3GO5A 3EN2A 3M4PA 4UP7A 4JI1Q 3F2CA 1QZGA 4NXML 1E3PA 4J15A 1AE3A 2B63H 3PO3H 2D0OA 3HOUG 4RG1A 5IYCG 1YNXA 4DAYB 4NXMQ 2JA5H 3RLNA 5M5YH 3S1RH 2JEAI 4HIDA 4JI2L 2R6GA 2WB1E 2OQ0A 3K0XA 4R1JA 2R7DA 1TXYA 1PH9A 1NJIC 4BY7G 4JI2Q 1Y1WG 2L15A 4A3CH 2IX1A 4DV0Q 4AYBG 2UUBL 3PUWA 3WWVA 4A93H 2DUDA 4LFCL 2HQLA 4LUZA 1Q82C 1IBLL 1VCIA 3L0OA 1BBUA 2UUBQ 5IP9H 2ZM6L 2Q2TA 5J3BA 1BVSA 3M4QA 4LFCQ 2YYZA 1CKOA 4DK3C 1YI2A 1IBLQ 3W5OA 2VW9A 2ZM6Q 3G6EA 2RHQB 1KAWA 4LFAL 3CC4A 1NMGA 3H15A 1S72A 1YITA 2D0PA 4O2DA 3HOVH 1P8LA 3GTOH 2R93G 1V1QA 4LFAQ 2NN6I 4DV7L 3RLFA 1SN8A 2Q2HA 1HZ9A 2JA6H 1V9PA 3E9HA 1CKNA 4LFBL 1ASZA 2VS1A 4R4OA 3CXCA 4DV7Q 2HHHL 1X65A 1M90C 1HR0W 2MNAA 1OXUA 4GOPA 4LFBQ 4BBSG 3AEVA 3IRBA 3U4ZA 3CCJA 2MO1A 1PYSB 3CCQA 1N34L 4GS3A 3JAMi 4QIWE 1N32L 2Z6KC 4P75A 1N34Q 5H1SE 5GADC 3I4OA 2UUAL 1N32Q 3E0EA 3TEHB 1OXTA 1X3FA 2FXQA 1E7ZA 2YV5A 5GROA 1VQKA 2OCEA 2UUAQ 1QZHA 4R4TA 2WFWA 3HOUH 3S1MH 2UXCL 1W3SA 4MTNA 4P73A 4LF6L 4X62L 1HH2P 2Z0SA 1HNXL 2UXCQ 4JI5Q 4NXNL 1IYJB 4A3EG 1Y1VG 2F52A 5FJ8H 4Y52H 4LF6Q 4X62Q 1Q7YC 1N36L 4GN5A 1OXXK 1HNXQ 4KLKA 4NXNQ 4K0KL 2JQOA 3GTKH 2F4VL 5IYDG 1MKHA 4DV1L 1N36Q 3ICEA 5HY6A 1L2FA 3T1HL 3HOYH 5C0XG 4K0KQ 4GKKL 1E1OA 2F4VQ 4JCVE 4A3JH 1PYBA 4DV1Q 3T1HQ 3E9IA 4GOPB 1VQPA 5C44H 2AHOB 2K50A 4APVA 5LMNL 1A63A 1TWGH 3J81c 1VQOA 4QQBX 3FKIH 1VQ9A 3AYHB 3KLWA 3CCMA 1SROA 3STBD 1V43A 4BA1I 2LXJA 2R93H 1H95A 1VQ7A 2Y0SG 2K4KA 3BU2A 4A3KH 3S1QH 2AKWB 3GTQH 4LF4L 2KCTA 2NZOA 4IFDJ 3UE0A 3NBHB 4DR7L 2E5LL 3KF8B 3M3YH 4BBSH 4LW1A 1IBML 4JI7L 4LF4Q 5M5XH 5IYBG 5FLMH 1CUKA 3M4OH 4DR7Q 2E5LQ 1VQ8A 4JI7Q 3CF5A 2JA7G 4DR3L 3I4MG 3J7ZC 3RN5A 3D0FA 3J80c 4AQYL 1UE6A 2R7FA 3NEMA 2V1CC 1Q12A 4DR5L 3I7FA 5GAHC 4DR3Q 2MFIA 4A3IG 1K8GA 1FGUA 3UDIA 2JA9A 4H02A 4AQYQ 2C35B 3VDYA 3K7AH 1SFOH 4GN3B 4DR5Q 1J6QA 1OTCA 2R92H 4B3RL 4FDBA 4DUZL 1L1OC 1LTLA 3UDFA 1Y1VH 4A3EH 1VQDA 1VQNA 1KXLA 4OO1I 4A3FG 2AWNA 2WP8J 4B3RQ 4DUZQ 2KBNA 2E2IH 3PO2G 1GVPA 4B3SL 4JBMA 5EAYA 3MXNB 4IPDA 5C4XG 2PQAB 4X6AH 1L0WA 1VQJA 3T1YL 1KHIA 4OWXB 4B3SQ 4GLAC 3I4NG 3M7NA 1X9NA 3SGIA 4OO1G 1VQCA 2ALYB 1VQHA 3T1YQ 3UDXA 2XGTA 4JC0A 2UXDL 1YJ9A 4DV2Q 1I5FA 2JJQA 1NBWA 2JEBI 1ASYA 2KENA 5JEAJ 2UXDQ 1Z9FA 3PSIA 5M3MG 1TWAH 4P71A 2GN5A 4LUVA 1XPRA 3K7UC 4KHPL 2AWOA 1Q8KA
chains in the Genus database with same CATH superfamily
1PH2A 3S2HH 2AQ3B 2XVSA 2B2UA 2EQSA 1KC8C 1SXTA 4YWKA 2IHFA 4PZ6A 1PZKD 4C56C 1Z7TA 3D4RA 3F8TA 1PH7A 1D8LA 2PZTA 4YY3Q 4ALPA 1Q86C 4R8NA 5I4DA 3S1MB 4A3BG 2KOLA 2DNCA 2BDOA 2EPBA 4RA8A 4DR2L 1D5ZC 3CMEA 2K5NA 4F87A 4P72A 1ET9A 4L63B 1I4PA 3VA5A 3HOYB 1VQ5A 3G4SA 5C44B 1UNSA 5CBEE 1EIYB 1VQAA 2H4OA 5EPJA 3MXPA 2KHJA 5IYCH 4RGTA 1ILPA 1SNCA 3OHXC 5E1FA 5ELNA 3D6WA 1EYDA 1CKMA 3VR4A 5JJLA 1RODA 2CH4A 4ZKCB 1K9MC 3MEFA 1VMPA 4F8MA 1GUOA 1Y1WH 1EY5A 1CSPA 1HFNA 1A6XA 4EQNA 1TY0A 1FL0A 2VQFQ 3A8IE 1CSQA 1BCPB 2JN4A 1B2TA 4TQUS 4TVAB 2A74C 2KEEA 3R3OA 4GKJL 1Y69U 1PH8A 2BH2A 1UE7A 4K8JA 5LMNQ 1D5MC 3KJOA 2PQAA 1AE2A 3EFXD 1SYDA 3OMCA 1LABA 1SYFA 4H13C 3VYUA 4IFDI 2B2VA 3R2TA 1WOCA 5BN3A 2I5MX 2Q8IB 5NUCA 1IL2A 4JG2A 1IBMQ 3EBEA 2HQEA 3HFZB 2B29A 4DNIA 4IFDG 1YNNC 2NVYB 1X55A 1HNWL 3ZYYX 4DV5L 2WIIB 1PRTF 5IOCA 4QMGA 3GDEA 3PUXA 4JV5L 1XWEA 1CTMA 3CPFA 3PQIA 1SLJA 2M2LA 1JE5A 2K1BA 3CRKC 2FMMA 4YHHL 2Z6KA 4HMJA 2CKZB 4LF9L 4A93B 1HZCA 1I94Q 1S3OA 2KUMA 3ULLA 5C6AA 1W6JA 1DOKA 1JT8A 3S9WA 4OX9Q 1EIHA 4R4QA 4U673 4IO9A 1AN8A 2Q8TA 2X6LA 3AB9A 1TS4A 4XT3B 2ZJQA 3ERQA 1NCVA 3GTOB 2A6HC 2JA6B 1UUPA 4HJ7A 1EWCA 4M1UB 4HJAA 2BDNA 3JAMc 4IUVA 5C4HA 4UP9A 1C8CA 4POGA 2EZVA 1HR0Q 2K05A 3QG1A 4X66Q 2MQHA 4KK7A 2NWGA 3UE1A 5EPKA 2QEXA 2XRSD 2IX0A 1IBKL 1XTCD 2ZTCA 2I07B 1VQGA 4DF7A 1YNJD 2CFMA 3RZOH 2A19A 3S16B 5D3IB 2XSCA 2EYMA 2G9HD 1DGSA 3K5NA 2LFNA 1QOHA 2JXMB 3PIP3 2LMCB 5EKIA 4RCOA 5IWAL 1EUJA 4B3MQ 4A3JG 2FINB 2HUGA 3LWUA 1TS5A 3AFPA 3RUZA 4X3TA 1CQFA 1GXDC 2H5XA 5BN5A 4IOAA 4B3TL 5IT9c 3FKIG 4DK0A 3H94A 4DR4L 1L1OA 2VL6A 3A0JA 2B2WC 1DD2A 4DXGA 4OXPA 1AFPA 4JI0L 3S15B 4MHEA 3S1QB 2CHBD 1YIJA 2N3SA 5C3XA 5T1GA 1O7IA 1X6OA 3M3YB 1KRTA 1CK1A 3SVMA 2EYFA 4JI3L 1PTOB 4JW0A 5DNFA 3CC7A 1LM0A 3X3MA 3S2DH 1MI2A 4L5TA 4JYAQ 3TS2A 3QOJA 4ABNA 1SFOB 3FVQA 1I3QB 3VYRA 3A7AB 3KOJA 1L0XB 3RLOA 3NSWA 2H1EA 3QIAA 1PH3A 3H3VC 3F2BA 3I91A 1KDCA 4ZKBB 3LGJA 1L1OB 3NENA 4HCSA 1TWHH 3I3CA 1JOKA 3K0YA 4G7ZC 3J81L 4RAUC 5CYUA 4FNFA 4HR7B 1WCMH 1YJWA 1OXSC 2AQ2B 2L1BA 4K2KA 5C5LA 2WKCA 2JA5G 4HN7A 3OW2A 1TWCB 5GAGC 3GP7A 4LF5Q 3DWPA 1WI5A 1YVCA 3E0JA 3VA7A 4C2MB 4QL5A 3J80L 4DAYA 4J6HA 4X65L 4N9TA 3SXHA 2AMCB 1HTPA 1L0YB 3DM1A 4WORA 4A3IB 1JB3A 4BXXH 5D14A 1J5EQ 4S3SA 4I7AA 2EYLA 3GD7A 4FF3A 2M00A 4A3FB 3ER0A 2I5HA 4DV3L 3PO2B 1N9WA 4DKAC 1JQYD 3W1GA 3JC66 1XTDA 2F0IA 2A73B 1JOQA 3Q22A 2HD3A 2NVYH 5C4JH 3NE5B 4DN4M 1IW7C 4J15A 3TSSA 2D0OA 3E5SA 3HOUG 5IYCG 4DAYB 3VR3A 1PDQA 1S5ED 5M3MB 3Q23A 2BE5C 3S1RH 3MEHA 4JI2L 2R6GA 2KHSA 1TXYA 2EYJA 1PH9A 1Y1WG 1R4PB 4A3CH 1EY6A 3D3RA 3PUWA 3WWVA 5KYLA 4A93H 2DUDA 1K0SA 3L0OA 2UUBQ 1I6HB 4E6IA 5D3DA 5C3EB 2Q2TA 5J3BA 2EXZA 4P2CB 2YYZA 5I9OA 1IBLQ 1AZQA 4FXGC 1R9TB 4UAIA 4EGVA 1U9RA 3CC4A 1FNWA 3GV3A 3H15A 2F0GA 1P8LA 3GTOH 2F0EA 2L11A 2X6GA 1SN8A 4FVMA 2JA6H 1V9PA 3E9HA 4O42A 3E3XA 1WTVA 4H0LC 2HHHL 1X65A 1ICFB 5IGCA 4LFBQ 3IRBA 3JAMi 4QIWE 5M3FB 2V4DA 3H0GB 4P75A 1N34Q 5H1SE 3I4OA 1N32Q 3TEHB 2M9VA 4LMQD 1K8MA 4KJNA 1LTTD 1VQKA 4R4TA 3KF8A 1LTBD 3GTMB 4X62L 2I46A 3FPUB 3TP6A 3K6OA 4Y52H 4LF6Q 3CQZB 1Q7YC 4OL7A 1HNXQ 3OIPA 3GTPB 2JQOA 4DV1L 5HY6A 4GKKL 2F0FA 3TBIB 3I70A 2KCCA 3CHBD 2TMPA 3KLWA 3STBD 1RD9D 1BCPD 1PMRA 2LXJA 1SE2A 4H7BA 4A3KH 4BBRB 3S1QH 4DFAA 3SHLA 3KF8B 3M3YH 3TDQA 5FO9B 4LW1A 4JI7L 5IYBG 1KABA 3WOFA 4DAVA 2E5LQ 2LS01 1HHVA 1BQQT 1UE6A 3NEMA 2V1CC 5GAHC 4DR3Q 2B63B 4H02A 4AQYQ 1C48A 2B2WA 1SFOH 1LV9A 4GN3B 4JVZA 1J8IA 2F0QA 3M7GA 5M5YB 1PTOF 3UDFA 2DJFC 1Y8OB 2AWNA 3RMHA 1GVPA 1L0WA 5ISRA 4N8X1 5C0XH 3M7NA 2ALYB 1MD2D 3T1YQ 5A35A 2UXDL 1ENCA 2JJQA 2JEBI 1STNA 3QB3A 1KLUD 4RGOS 3PSIA 2PO4A 2A69D 2RDHA 3HOVB 2GN5A 2R61A 2QEJC 4ZYSA 2Q8RE 2PPBC 3NHHA 3TMEA 1X32A 1NSNS 4LWCA 2IY5B 2G9DA 4K5VA 5K5PA 1DONA 3CC2A 4HJ9A 3TP7A 5IGEA 5DEHA 3I56A 1B9NA 3VYSA 4IJLA 2ZXOA 2N49A 5C5MA 2IWHA 4YY3L 1YEZA 4IN3A 4DAPA 4CJ1B 2R7ZB 1SRUA 1EYAA 1A3UA 1LTID 1PFNA 1OXVA 1X3EA 1EU4A 2JSOA 1O7YA 1G51A 4DR6L 5IE8A 3P7JA 1GKHA 5A2QL 4PMWA 1B8AA 3D8GA 2VUMH 1IKLA 4KJOA 4YIJA 5FOBB 3T4AC 2HHHQ 5JEAH 1SJED 4XIGS 3RD4A 3HOWH 3SK4A 3J81E 1G6PA 1WCMG 4BY1H 1MBYA 3PUYA 4MNOA 4Q5VA 1TWGB 1JCKB 3HKZG 1SBBB 1XMQQ 1YHQA 1XYIA 5M3MH 1MHWC 1CHQD 4LF8Q 1A3VA 2GVBA 1ENAA 1DOMA 3HG9A 4N9PA 1EEFD 1F2ZA 2VQFL 3LWEA 3BG3A 4BY7H 1BXTA 2QGQA 1A0IA 2UXBQ 1I4GA 3M4OB 1JICA 1EOTA 1Q1EA 1I6HH 5C3EH 4JI6Q 1JOOA 3FMCA 1VDZA 2F3VA 3MWYW 4GKKQ 3G48A 2JA8G 2PI2E 4XQQA 5CC4A 2Y0SE 3BZCA 5IP7H 4C3IH 1J9OA 3NBIA 2E2HB 2R92B 2Z4IA 1O7LA 4N8FA 1UAPA 4DPGA 1JJGA 3C1EA 3NXWA 2OTLA 5M3FH 2Z9HA 4NDXA 1XPOA 1PFSA 1PTOC 2MO0A 4IUTA 2NN6H 3TQYA 2NB0A 1IXRA 3NK9A 1CI3M 3NUCA 3OWEB 4FP5D 1ILQA 2E2DC 3EIVA 2IPKD 3NQTA 3T51B 4KY6A 3QO2A 2DGYA 4HMIA 1EQRA 3KF6A 4A3CG 4TRDA 4OWTB 1CQVA 1ZYRD 3PV0A 1I94L 5ELFA 1VQBA 1P16A 3WOEA 3NPPA 2RF4A 1S40A 2F3IA 3K80C 3V2TA 1GJXA 4OX9L 1HJPA 1SYEA 1I4XA 5CV7A 2BA1A 2EJGC 3D31A 5I2YA 1D1KA 2GA4B 2YTVA 1VQEA 2CWAA 1F2LA 3CAMA 5DAUA 2JA6G 4C3HH 1Y14B 1SNOA 2PCFB 2SDFA 4CDFC 1WTOA 2I5LX 2VY3A 1SNQA 4IPGA 4DXFA 3J7AV 4FF1A 1QCBD 2F3WA 4CJ0B 1HR0L 4ODGA 4X66L 4XYQA 2N8NA 4KN4C 1RIPA 5J22A 1B3AA 2XWBB 5CV4A 4HTHA 1CA5A 3KF6B 1DYQA 3K8AA 1B70B 2CCZA 3HOZB 1FJGQ 1E2ZA 2JP1A 3HP3A 5ELDA 1CA6A 1GM5A 1C4QA 3I73A 1VF5C 3NWTA 2B8GA 1YZ6A 3OYYA 4K5XA 1XJVA 1JE4A 2HCCA 4B3ML 1H9MA 2WB1G 4DR6Q 4JK1C 2IT1A 2RCNA 5C4XH 2PQEA 1STEA 3RN2A 4TKOB 4YCVA 1Q81C 4UP8A 1LACA 3GV6A 1HUNA 2N78A 3E6ZX 2KA7A 1PV4A 3BVGA 5EKKA 2F0NA 2QKIC 3S17H 1Q90A 2J0TD 4O1NA 4A3KG 1XX8A 4YCUA 1B7YB 1N33Q 4IUQA 2VNUD 4FXDA 1E24A 3K58A 1BNZA 4DV4Q 3VYTA 1O78A 1MJCA 1VQ4A 2E2JH 1M1KC 1RJTA 3CCVA 4JYAL 2CW0D 4DAMA 4A3MH 4C3JH 4XYOA 2PNHA 4ZCKA 2PI2A 3L7ZC 2R7ZH 2K52A 2K5HA 3M85A 4QY7A 1N8RC 3S14H 2FHTA 1LUZA 1PZID 4H44C 1BO0A 5C0XI 3OPOA 1K0RA 3KJPA 1U0LA 1YJNA 3CCLA 3MAQA 1I50H 3J7A5 3H3VH 1GD7A 4DK1A 1CKNB 1GUNA 2O2LD 4DUYQ 2KCNA 5JPNC 5JJIA 1HNZQ 2B2TC 5CORA 1SYBA 1Z47A 4A3GH 2C5CA 3PO3G 1SJHD 5K36G 2XTIA 1SNPA 4LF5L 4KD4A 5G3LF 5FLXc 4IUNA 5FKAC 4HIMA 1G291 2RDGA 3NTKA 1HA6A 2OTJA 3FRPB 4WJ4A 4PNYA 3I4MB 3BS1A 1TY2A 1IZ6A 1EYCA 1J5EL 1G2SA 4WJWA 3R2IA 4F7XA 1STHA 3HOXB 4IURA 1VQIA 2A6HD 2E2HH 4JBJA 4A3DH 2HDMA 4HJ8A 3W2DA 4KHZA 5A2QE 2I0QA 2VUMG 1PHJA 1C9OA 5JEAG 1A2UA 3BVMA 4DV2L 1E22A 3HOWG 3I4NB 1BOSA 4BY1G 2F0JA 4X64Q 1D1IA 1MSGA 3OSOA 4UP7A 1A3TA 4JI1Q 2K5WA 1AE3A 1KNAA 2FJ2A 3IL8A 3BDCA 1YNXA 4NXMQ 3RLNA 1B44D 1EY0A 3EROA 1K8OA 2R7DA 3NWSA 1STBA 2NUCA 5L37A 4BY7G 1RTNA 4FF4A 5EBCA 2IX1A 4AYBG 2PW5A 3A8KE 3K5LA 2UUBL 1LTSD 1NR4A 2LKVA 3M4YA 1IBLL 1RKNA 1VCIA 5IP9H 1QG7A 1BVSA 4LFCQ 4KD3A 1AEXA 1UEAB 4DK3C 1YI2A 3BVZA 2ZM6Q 5F2DA 4C3IG 1EFID 2G5DA 4A3BB 2R93G 3DUZA 1JWUD 2NN6I 1TS2A 4LFBL 1R4QB 1YNJC 2VS1A 3L3OC 4DV7Q 5KNCA 2EYPA 4BBSG 3AEVA 2MO1A 1N34L 4CDCC 1N32L 1I4HA 3E0EA 1OXTA 3DEPA 2YV5A 3FPPA 1H9SB 3S1MH 1W3SA 2NTTA 4MTNA 4P73A 4LF6L 1HH2P 1PRTD 3P20A 1HNXL 3N6RA 2UXCQ 4A3EG 1Y1VG 4KY5A 5FJ8H 3IFDA 4GN5A 4NXNQ 1CZWA 4UDUC 3N52A 1N36Q 3NQIA 3HOYH 4XXEA 2YU9B 4K0KQ 1E1OA 1PYBA 3T1HQ 3E9IA 1VF7A 1VMCA 1VQPA 5C44H 2AHOB 4APVA 1LT5D 2MJ8A 3AYHB 1K3BC 1SROA 3GTLB 3T53B 4C3HG 2FFKB 4BA1I 2OF1A 3BZDB 3TZUA 4QUFA 2NZOA 2IL8A 3UE0A 4IFDJ 2NVQB 3NBHB 2AUJD 2E5LL 1H9JA 5TSSA 3URYA 2TSSA 3GTGB 1VQ8A 2ZXPA 5C4ZA 5IGBA 4DR3L 1SYCA 3ITPA 4AQYL 1Q12A 3I7FA 1T5XD 2MFIA 2K28A 1K8GA 3VDYA 2C35B 4DR5Q 2F4IA 4FDBA 2NVXB 1I4QA 4FO2A 1WTHA 2XWJB 3L9AX 3MXNB 1DXMA 5C4XG 3T1YL 4B3SQ 1IHZA 4GLAC 2XIWA 4WFN3 1X9NA 3UDXA 2XGTA 3LNNA 4JC0A 1YJ9A 4DV2Q 1I5FA 1NBWA 4C1NK 5JEAJ 2XRQD 3O13A 2AWOA 1Q8KA 3JAML 1MSHA 3J81j 1EYGA 1S5FD 4A75A 2ZTDA 1EWIA 2B2TA 4A3MG 4C3JG 1V8QA 2EIFA 2RA4A 1Y8NB 1WTQA 3HOXH 3H3VI 3EA6A 1B1ZA 2A6EC 1HXYD 3GQBA 3K81C 5IY0A 3D6CA 3TRZA 3QOLA 4Y7NB 2F0TA 3NP8A 3C2PA 2E8GA 1X3QA 2KJXA 2PZWA 2A68D 3ZJYC 1HA5A 4JBKA 5IODA 1K83B 4A3GG 4X3UA 5IT9L 2NTSA 4V190 1RTOA 1XMQL 1U5KA 2RKSA 3V05A 3RNUA 1ONLA 4LF8L 1RCVD 3FKIB 3W3AA 1U4PA 3OIQA 2LSSA 3S16H 2MPMA 4NB3A 2EY5A 1H9KA 3MA2B 4CHTB 5IGDA 2UXBL 1UE5A 4A76A 3TREA 3SR1A 3B6YA 1WVLA 2PYKA 4JI6L 4FF2A 2WAQG 1M8AA 1GO3E 1QVGA 1WTWA 3G6JB 3BYYB 1BBXC 1QVFA 3A74A 4LUOA 3ULJA 1IYVA 5DLQE 3K7AB 1XNQQ 1PVOA 4HCEA 4A3BH 2K7VA 1HQRD 1NTGA 4A3DG 5T1IA 2ID0A 3S15H 5BR8L 1F9QA 2ZXRA 3F1ZA 3Q24A 1SNMA 4V0BA 1U4LA 3PIOA 4K5WA 4GN4B 2LY7A 5JJZA 4BS9A 4X3SA 2D5DA 1LT4D 1B4OA 1IYUA 4NW2A 5CV6A 4AH6A 3DLLA 4JI4Q 1PTOH 2NVTB 1X3PA 1EL0A 1B53A 1B3QA 1CFMA 2NBFA 4EVOA 1XNRQ 2K33A 1XXGA 3KDFA 1I3QH 1I4RA 3BJUA 4CGYB 2K75A 1TWAB 2JA5B 4WJ3M 2WV6D 3KYHC 3Q6SA 3STBC 4K8IA 4XT1B 4C1NI 1V1PA 2UU9L 3S2HB 4QCLA 1WFQA 1K3RA 3V96A 4L5RC 1LYLA 2ZJRA 1LTGD 3DM3A 2UUCL 5FO8B 1G6ZA 5IP9G 3MHBA 4RH6A 4P74A 3AFQA 2EOTA 1G91A 1XPUA 4O0AA 3C46A 1EY4A 3ND9A 5BN4A 3CCRA 2VB2X 3GTLH 1KQSA 3OWFA 5AJ3Q 1VQFA 4DV6Q 1WD0A 4HIOA 1TWCH 4QJFA 3IAYA 4L6TB 5I6WA 4LJZC 3J7YW 2F1MA 1PA6A 4C2MH 3KDFB 4KKSA 3NTHA 2WINB 3F2UA 3GTGH 2EE1A 3A54A 4NKLA 5D65A 4A4IA 1SEBD 3HZXA 1FJGL 1V1PB 1AH9A 4EX5A 3L2PA 4A3IH 4RGNA 3HOUB 4HAEA 4PZ7A 3M9BA 2NVXH 1KAAA 5FJ8G 3HKSA 1EIFA 4DV0L 2A69C 1QVCA 1A15A 2JE6I 4A3FH 2HT1A 5LMUQ 3HOYG 3PO2H 5LL6X 1Y1WB 1F9PA 2GVAA 2IHEA 1NUCA 1D7QA 5HGTA 1KIXA 4OO1H 3HKZE 5C44G 1UWVA 3CCUA 2OWOA 2OQKA 4CDEC 2O5IC 4CJ2C 2HIXA 1N33L 5J39A 2EXDA 3I55A 4DV4L 4DNTB 5IIFA 3GTQB 2CQOA 3KLSX 5ELOA 4ZQ3A 1C0AA 3F2DA 3AQQA 1LO5D 5FK9C 5FO7B 3U50C 3J80E 1MIUA 2OT2A 4PG3A 1E2VA 5CV8A 2B2YC 2D2CC 3KBGA 2EVBA 3VR6A 4ME5A 4UPAA 1D6EC 1R9TH 1TQOA 1RF2D 4QIWB 4LK1C 4JI5L 3CCEA 4BXXG 2NZHA 2A1AA 1JJCB 4Y7NH 2L12A 3SDZA 1PTOD 4DUYL 3PMFA 5BR8Q 2Z1CA 1K83H 3SE0A 1HNZL 3H0GH 3ULPA 1D2BA 1EQTA 4JPBW 5DM63 1EWHA 2KHIA 1SAPA 1WYDA 4EQ5A 4IUPA 3FP9A 1LTRD 1F2YA 5KRUA 1MJEA 1FNUA 2ICIA 1TR5A 2JYOA 4QGUA 4ZAIA 3GTMH 4RHRA 1KD1C 1BR9A 2KCMA 4FYDA 5CR3A 3JAME 1EQVA 3I2ZA 1SR3A 4LAAA 3CQZH 4YCWA 1QILA 4Q0FA 1V1OA 3GTPH 3X3NA 1EOVA 2ZTEA 5KEEA 2Z4HA 1K8AC 2ASBA 3CCSA 4OONA 4A93G 2YTYA 2UU9Q 1TWFB 2K14A 2NYZD 4KKTA 4JOIC 2CVRA 5LMNW 2UUCQ 3HOXG 2A5HA 4GNXC 2JK8A 3MVVA 4RGMA 1T9HA 5E7NA 4EQOA 1PFBA 4BBRH 4DR1Q 4HIKA 1RL2A 1K73C 1CZGA 2QW7A 1JJ2A 4TSSA 1NE3A 3A7LA 3DEOA 2VQEQ 1PLFA 3ERSX 4X64L 3FHWA 1ZYRC 4RWSC 2NVTH 4JI1L 5ELBA 4LF7Q 2B3GA 1X56A 1FVIA 3DXJC 1SSOA 2RDFA 3GO5A 3M4PA 3F2CA 1QZGA 2B63H 4NXML 2R3ZA 1CHPD 3SK8A 4HSVA 2JA5H 1W6KA 1F9SA 1S5DD 5M5YH 3K0XA 2WB1E 4OIJA 4R1JA 2DNEA 1SMYC 3U9OA 3H09A 1NJIC 1EY8A 2MGSA 1F77A 1Q3LA 5EJWA 4DV0Q 4UHVA 4LFCL 2HQLA 4HEDA 4LUZA 1Q82C 2K5QA 2ZM6L 1FGBD 3M4QA 2BCOA 1CKOA 3S2DB 1D5XC 3OMGA 5EPLA 3W5OA 2VW9A 5EKLA 3G6EA 2RHQB 2CQAA 1KAWA 1TT2A 2L9HA 3HOVH 4LFAQ 4DV7L 3EQLC 2Q2HA 1CKNA 1ASZA 4R4OA 5DM73 3C1FA 3CXCA 2MHVA 1M90C 3HGBA 1HR0W 1OXUA 4ZLTF 3U4ZA 4MTKA 4CKEA 4GS3A 1KDAA 1TWHB 2ICEC 3IKJA 1STYA 2EY2A 1STGA 1WTPA 2FXQA 1ML0D 1E7ZA 3CKIB 1WCMB 2UUAQ 2X69A 3HOUH 1ZKOA 2UXCL 3BYTB 4KTAA 3HKZB 3P75A 4JI5Q 4NXNL 4B08A 1EZ6A 2F52A 2RCFA 2QF7A 1IKMA 4WRDA 1N36L 2QCPX 1OXXK 1TIID 2DJGC 1LT3D 4K0KL 2WACA 1MKHA 3ICEA 3T1HL 3HEJA 5C0XG 2F4VQ 2K01A 1QWYA 1YNND 2D9UA 4PQXA 4RFBA 2J7ZA 2K50A 3T13A 2CW0C 1TWGH 5KIXA 3J81c 1VQOA 2JA8B 2DY7A 3CCMA 4XQJA 1SE3A 3KLSA 2K4KA 3BU2A 4EQPA 1OO9B 2AKWB 3GTQH 2KCTA 5EQ0A 4B9XA 2Y0SB 2P5ZX 1SDFA 4IQZA 2IX3A 4LF4Q 5FLMH 3M4OH 4DR7Q 5CBAE 3RZDB 2AUKA 3D0FA 3J80c 5C4JB 2JA7B 4A3IG 4DR5L 3QJYA 4G4KA 3DMUA 4I65A 1OTCA 2R92H 3S1RB 4F88A 1LTLA 1ET6A 1VQNA 4OO1I 4A3FG 4B3RQ 2QILA 4DUZQ 2KBNA 3PO2G 3MTSA 4B3SL 2NZ1D 4IPDA 5KNBA 2PQAB 4X6AH 2B2YA 1KHIA 4OWXB 2L4NA 4OO1G 3SGIA 1VQCA 1VQHA 4ULLA 5AFWA 3I8ZA 1ASYA 2BOSA 2KENA 1RDPD 5M3MG 1MGSA 1XPRA 4AYBE 3CMAA 4KHPQ 4FXKC 1GUWA 3HS0C 1C7YA 3R93A 5IYBH 2BH8A 2HCIA 1YBYA 3CU7A 4K6DA 1EFWA 1TWFH 2ENBA 5ELEA 1H9SA 2DY8A 5ELCA 5C3EG 1FD7D 3QR8A 1YHBA 4JI8L 3T16A 1II3A 5IGFA 4L5QA 3I72A 3FDTA 5GAEC 3CD6A 5IP7G 4R4CA 4XDXA 4GLXA 1BKBA 4OWWB 1WTXA 4GLVB 3I4LA 1Q1BA 1NY4A 2CWPA 4HSPA 4A3LH 4IJHA 2N88A 2VXWA 5M3FG 4J1MA 4DR2Q 4JBWA 2A8VA 3H0GG 1S5CD 1X54A 2WB1B 4JOIA 5KGUA 2NN6G 4MN3A 3PCOB 3PF5A 1JMCA 2IW3A 4RHSA 4GNXA 3KUPA 5HGQA 3HOZH 2RHSB 3AMUA 3OW7A 2F0DA 3PIPA 5M5WB 2EYOA 2F0VA 4IPCA 4CKCA 4K2LA 3NBHA 1KTKA 5JVG3 5G3LD 4OHJA 1G2TA 3PF4A 4R8IA 3OTOL 4NPSA 4GZYC 4A3KB 3EJIA 1KL9A 3CP0A 3A5ZB 4RKBA 1DZ1A 1EQQA 3PUVA 1XNQL 3W1BA 3TP5A 3DWQA 3G7LA 1JB7A 5C0XJ 4IALA 4GKJQ 1WJJA 3BDOA 4GNXB 1XMOL 3K57A 3A5UA 4K6LA 3MXNA 4BBRG 3OOCA 3S1NB 1FR3A 3VR2A 3T56B 1PRTC 3KFUA 1Q46A 2Q2IA 1LT6D 4JI4L 1H9RA 3H91A 5GQOA 3SK6A 2HIVA 5I6YA 5C3WA 4LNQA 3GTJB 4KKUA 2PZUA 1XNRL 4IPHA 3S24A 1PH4A 1F2MA 2B63G 1PFMA 5FLXL 3U58A 1NMFA 2WKDA 1HUMA 1ESFA 4IOCA 3MC0B 2E76C 3PO3B 2IJ0A 3U4VA 4KY7A 2Q2UA 4DV5Q 1VQMA 1PH6A 5E3FA 1HNWQ 4OELB 3NELA 1PH1A 1HFGA 5LL6S 1TVXA 4X3KA 1BBWA 2ZJPA 4JV5Q 1QB5D 4R4IA 1Z6HA 5IYDH 2J4XA 4YHHQ 1TU2B 2E75C 4GOPC 2RSNA 3Q8DA 4LF9Q 4AIMA 1IW7D 2EYHA 2C9OA 5EGTA 1QJOA 5AJ3L 1FYCA 4DV6L 2JA8H 4XTCS 2F0PA 2F0MA 2BE5D 4QUCA 1W2BA 1BCPF 3HOVG 3HRZC 3J81i 1YHAA 1O80A 2EY1A 5JJKA 2F0KA 1T5EA 3BDLA 1A2TA 1UEBA 4XQNA 1VS0A 3MXGA 1JC7A 3FEWX 4DU9A 1VQ6A 4YWMA 3PGZA 2VUMB 1HPCA 2D62A 2SNSA 3RZDH 3SEBA 3A56A 2F0WA 1U4RA 3I4MH 3NTIA 1M4VA 2JA7H 3HOWB 3TN2A 4L8JA 4BY1B 2R7ZG 3J80i 4BA2I 2A6ED 3A8JE 3QWNA 5KNDA 1TS3A 4JI8Q 1F9RA 1HTLD 3PUZA 1IBKQ 4ILWA 1EY9A 2BA0A 4BWGB 3BZKA 1DOLA 2YTXA 5LMUL 2CH4W 1ESRA 2PMZE 4L5SA 1JORA 1VQLA 3KK7A 2L0CA 1JWMD 2K04A 5E4WC 4ZUJA 4BY7B 1HZAA 3GTKB 2KVMA 1EZ8A 1A62A 3ND8A 1B50A 2SNMA 4AYBB 4KHVA 2VB3X 5IWAQ 2OEOA 3I4NH 4A3JB 1CM9A 1SE8A 3RR5A 1STAA 1X3GA 4ZRZA 3CW2C 1PYWD 2O4XA 3CPWA 1EEID 1KRSA 2F0HA 4B3TQ 3D4DA 4C3IB 4POFA 3Q0AA 2VZAA 2R93B 4DR4Q 2WAQE 4J8QA 1E2WA 3OTOQ 4JI0Q 5FLMG 1A8VA 2B39A 4PZ8A 4BBSB 5M5XB 2RQXA 2QDBA 3TS0A 2XNAC 1DM0B 2A68C 3IFTA 4JI3Q 1BF4A 4HJ5A 1NR2A 3PIO3 1EY7A 3G71A 4G7OC 1O7ZA 2ZT9C 2R92G 4MIUA 4NMZA 2O5JC 2QDLA 4MZ9A 2KECA 1PH5A 2ES2A 4A3EB 1Y1VB 1XMOQ 5M9OA 5JPMC 2LXKA 1ZXTA 2E2IB 2B2UC 4DK6C 2F0OA 5I9PA 1ENFA 1RHPA 5COYA 3C3LA 4ZUIA 4YWLA 5CV9A 5M5WH 5EBDA 2K5VA 4ME3A 2ATWA 1HZBA 1QUQA 1E0BA 4G57A 5JAVA 1HRJA 2F0SA 1BDOA 2F03A 2MUYA 5J1ZA 1KNEA 4C3HB 1Y8PB 4KN7C 3DHQA 1BCPC 3UDGA 1GHKA 2RVLA 2YU9H 4QB4A 2DN8A 3EVQA 2K32A 3WDNA 4K14A 1JR0D 1ZEQX 4UY8C 1S5BD 4QF4A 1ICWA 3CRLC 2PW7A 1AW7A 4X65Q 4DA2A 2K5DA 4IZ8A 2E74C 4DR1L 4RMFA 3AU7A 1SYGA 3S1NH 1E1TA 4A3LG 3I90A 3P1HA 1QUQB 4KI0A 4KMUC 2NVQH 3SK5A 2VQEL 2RBMA 1SMXA 2AQ1B 4LF7L 2B8FA 5CV5A 3K5MA 1KDBA 3GTJH 5C4XB 4DV3Q 1JWSD 3U9SA 3HOZG 1UE1A 4OIKA 3H6MA 3TZDA 2QA4A 2SOBA 3EN2A 4IFDH 1BUVT 1E3PA 3PO3H 4CDDC 5K36H 4RG1A 3S17B 2JEAI 4HIDA 2FMCA 1GHJA 2KQ3A 3R8BA 2OQ0A 4ZK9B 1WD1A 1HQMC 4JI2Q 2L15A 2HDLA 3ONAB 2Z8LA 2E2JB 3LX0A 2B2VC 2KEDA 1BBUA 4RCNA 5KYIA 4A3MB 1NNXA 4C3JB 4OEMB 4G7HC 5CMDA 5JVH3 4LFAL 3VR5A 1NMGA 3S14B 1AP0A 1S72A 1G8ZD 1YITA 2D0PA 4O2DA 3MFYA 1V1QA 3RLFA 4M8AA 1HZ9A 2EJMA 5JOBA 3J7AF 1NAPA 1I50B 2EY6A 4PV1C 1PZJD 1SNDA 5LHY1 2MNAA 4GOPA 3CCJA 2SEBD 1PYSB 2RSOA 3CCQA 1PRTB 4PMBA 2PNRC 2Z6KC 1CT1D 4CKBA 4Z9CB 2PMZB 5GADC 2EJFC 2UUAL 1GUGA 1X3FA 4A3GB 5FLXE 4B9WA 5GROA 2OCEA 1QZHA 2WFWA 5E4XA 3MZ5A 2Z0SA 1IYJB 3TP8A 1LTAD 2EDGA 2MP1A 4X62Q 4CBVA 1WTRA 2F0LA 2L55A 4KLKA 3GTKH 2F4VL 5IYDG 3K59A 1L2FA 1S4ZA 3MFGA 1DCZA 2WAQB 1Q8IA 4JCVE 4A3JH 4DV1Q 1AZPA 1K28A 1TKWB 2L5TA 4GOPB 2K03A 4U68A 4RKLA 5LMNL 1A63A 1U4MA 1GUSA 3K5OA 1KLGD 4QQBX 3FKIH 1FNVA 1VQ9A 3KLRA 1V43A 2R93H 1GUTA 1H95A 1VQ7A 2Y0SG 4DGZA 4A3DB 4LF4L 1LLRD 4OGQC 1I6VC 4DR7L 4BBSH 1IBML 5M5XH 1B9MA 1CUKA 5IGGA 3KBXA 4JI7Q 3CF5A 2JA7G 3I4MG 1QE6A 2Z6BA 1SE4A 3J7ZC 3RN5A 2N55A 2R7FA 1IL8A 4I7ZC 1FGUA 3UDIA 2JA9A 2XN9C 3K7AH 4KV6A 1J6QA 4B3RL 1QNKA 5HURA 4DUZL 3RZOB 1L1OC 3A55A 1Y1VH 4NP5A 1VQDA 4A3EH 1KXLA 4IUUA 5I2XA 2WP8J 2E2IH 4PMCA 1EIGA 2OXPA 4JBMA 3DWAA 5EAYA 4ID6A 1DJRD 3D4WA 1VQJA 3MXUA 1PXUA 2K6AA 3I4NG 1HCZA 2F0UA 1GOZA 5IT9E 3UI2A 1QNUA 4R9WA 2UXDQ 1Z9FA 1SMYD 5CGKA 1TWAH 4P71A 4DNRB 4LUVA 1EU3A 3K7UC 4KHPL
chains in the Genus database with same CATH topology
1PH2A 3S2HH 4LWCA 2IY5B 3CMAA 3J81j 4KHPQ 2EQSA 3CC2A 4HJ9A 1EYGA 1C7YA 1KC8C 4A75A 2ZTDA 1EWIA 2BH8A 1YBYA 5IYBH 1EFWA 4YWKA 3I56A 1TWFH 2IHFA 4IJLA 4PZ6A 5C3EG 2N49A 4A3MG 1PH7A 3F8TA 1YEZA 4YY3L 1YHBA 1D8LA 2EIFA 4JI8L 4L5QA 4YY3Q 3HOXH 4ALPA 1Q86C 3H3VI 1SRUA 5GAEC 3CD6A 5IP7G 4R4CA 4GLXA 4A3BG 1BKBA 4OWWB 1OXVA 1X3EA 4GLVB 1Q1BA 3K81C 1G51A 1NY4A 2CWPA 5IE8A 5IY0A 1GKHA 3TRZA 4DR2L 4DR6L 4A3LH 4IJHA 3CMEA 2K5NA 4PMWA 2E8GA 5M3FG 4P72A 1B8AA 4JBWA 4DR2Q 2A8VA 2VUMH 3H0GG 3ZJYC 1X54A 4JOIA 2HHHQ 2NN6G 1VQ5A 4JBKA 3PCOB 3PF5A 1JMCA 4GNXA 4XIGS 4A3GG 3HOWH 5HGQA 3HOZH 1G6PA 3G4SA 2RHSB 1WCMG 1XMQL 4BY1H 3PIPA 1U5KA 3PUYA 4MNOA 3RNUA 4LF8L 1EIYB 1VQAA 3HKZG 4IPCA 1XMQQ 2LSSA 1YHQA 2KHJA 5M3MH 5IYCH 4LF8Q 3S16H 2GVBA 4NB3A 5ELNA 3PF4A 3OTOL 4NPSA 1CKMA 5JJLA 1KL9A 2UXBL 3CP0A 1UE5A 2VQFL 1K9MC 4A76A 3MEFA 3A5ZB 3TREA 4BY7H 2QGQA 1Y1WH 3B6YA 1A0IA 1CSPA 4JI6L 2UXBQ 2WAQG 1FL0A 2VQFQ 1CSQA 1Q1EA 1I6HH 1GO3E 5C3EH 1QVGA 4JI6Q 1EQQA 4TQUS 3PUVA 4TVAB 1XNQL 3W1BA 4GKKQ 3G48A 2JA8G 4GKJL 2PI2E 1JB7A 3A74A 2Y0SE 4LUOA 3ULJA 1PH8A 5DLQE 1QVFA 1XNQQ 2BH2A 3BZCA 5C0XJ 1PVOA 1UE7A 5IP7H 4A3BH 4GKJQ 1WJJA 4C3IH 4GNXB 5LMNQ 1XMOL 3A5UA 1NTGA 4A3DG 4BBRG 2ID0A 2PQAA 1AE2A 3KJOA 3S15H 5BR8L 3F1ZA 3KFUA 1Q46A 4DPGA 1JJGA 2Q2IA 3PIOA 4GN4B 2OTLA 4IFDI 5M3FH 4JI4L 5GQOA 2HIVA 1WOCA 1XPOA 1PFSA 2MO0A 4LNQA 2I5MX 1IL2A 4AH6A 3TQYA 3DLLA 4JG2A 4JI4Q 1IBMQ 1XNRL 4IPHA 3S24A 1PH4A 1IXRA 3EBEA 2B63G 3HFZB 2B29A 4DNIA 4IFDG 1X55A 3U58A 1XNRQ 1NMFA 4DV5L 1HNWL 4IOCA 3KDFA 1I3QH 3BJUA 3EIVA 3U4VA 1HNWQ 2K75A 4DV5Q 1VQMA 3GDEA 3PUXA 1PH6A 2Q2UA 4JV5L 3NELA 1PH1A 4WJ3M 3CPFA 3KYHC 2DGYA 3STBC 2UU9L 1SLJA 1EQRA 1BBWA 1JE5A 3KF6A 2ZJPA 4JV5Q 1WFQA 4R4IA 4A3CG 1K3RA 4YHHL 2Z6KA 4OWTB 3PV0A 1I94L 1VQBA 2CKZB 1P16A 4LF9L 5IYDH 4L5RC 1LYLA 4YHHQ 2ZJRA 4GOPC 3DM3A 2UUCL 1HZCA 1I94Q 5IP9G 2RF4A 1S3OA 3Q8DA 4LF9Q 1S40A 3ULLA 4AIMA 2F3IA 3K80C 4P74A 4OX9L 1HJPA 3AFQA 5AJ3L 4DV6L 1JT8A 2BA1A 1XPUA 4O0AA 2JA8H 4XTCS 3D31A 2YTVA 4OX9Q 1VQEA 2CWAA 3CAMA 3CCRA 3GTLH 1W2BA 4R4QA 5AJ3Q 1VQFA 4DV6Q 1KQSA 3HOVG 3J81i 4IO9A 1YHAA 4HIOA 1TWCH 5JJKA 4QJFA 2JA6G 4C3HH 2ZJQA 1Y14B 1UEBA 2I5LX 1VS0A 2VY3A 4HJ7A 4IPGA 4C2MH 4HJAA 1PA6A 3JAMc 3KDFB 4UP9A 1HR0L 1VQ6A 4YWMA 3PGZA 4X66L 3GTGH 2D62A 2N8NA 4POGA 1RIPA 3RZDH 1HR0Q 4A4IA 1FJGL 3KF6B 4X66Q 3K8AA 1B70B 2MQHA 2CCZA 3I4MH 2JA7H 1AH9A 3UE1A 4EX5A 3L2PA 2QEXA 1FJGQ 2R7ZG 3J80i 4A3IH 4BA2I 2IX0A 1IBKL 2ZTCA 1VQGA 4JI8Q 1GM5A 4PZ7A 3PUZA 2CFMA 1IBKQ 3RZOH 2A19A 3M9BA 2BA0A 2NVXH 1YZ6A 5FJ8G 3HKSA 3BZKA 1EIFA 2YTXA 3OYYA 5LMUL 1DGSA 4DV0L 1QVCA 1XJVA 2JE6I 2PMZE 4A3FH 4B3ML 4L5SA 2HT1A 1VQLA 5LMUQ 3HOYG 3PO2H 1HZAA 2WB1G 5IWAL 2GVAA 4DR6Q 1EUJA 2IT1A 1A62A 4B3MQ 2RCNA 4A3JG 5C4XH 2IHEA 5IWAQ 3RN2A 3I4NH 1D7QA 3AFPA 1KIXA 3HKZE 1SE8A 1UWVA 4YCVA 5C44G 3RR5A 3CCUA 2OWOA 1Q81C 4UP8A 2OQKA 2H5XA 1X3GA 4IOAA 4B3TL 5IT9c 3FKIG 2N78A 3CW2C 1PV4A 3CPWA 1KRSA 3S17H 4DR4L 1L1OA 2HIXA 2VL6A 4B3TQ 1N33L 4POFA 3A0JA 2VZAA 2EXDA 4A3KG 3I55A 4OXPA 4DR4Q 4YCUA 4DV4L 1B7YB 4JI0L 2WAQE 1N33Q 2VNUD 2CQOA 5ELOA 1E24A 3OTOQ 4JI0Q 4DV4Q 5FLMG 1YIJA 2N3SA 1MJCA 1C0AA 1A8VA 3F2DA 1O7IA 1X6OA 4PZ8A 3AQQA 1VQ4A 2E2JH 1M1KC 3U50C 1KRTA 3TS0A 1MIUA 4JI3L 3CCVA 4PG3A 4JYAL 3CC7A 1LM0A 4DAMA 4A3MH 3S2DH 4C3JH 2PNHA 4JI3Q 2PI2A 3L7ZC 4L5TA 4UPAA 4HJ5A 1R9TH 2K52A 2K5HA 2R7ZH 3M85A 3TS2A 4JYAQ 4JI5L 3CCEA 4QY7A 3G71A 4BXXG 1N8RC 2R92G 3S14H 1LUZA 3KOJA 2NZHA 3RLOA 5C0XI 1K0RA 1PH3A 2A1AA 3KJPA 1JJCB 3F2BA 4MZ9A 4Y7NH 1U0LA 1YJNA 1PH5A 3CCLA 3J7A5 1I50H 1XMOQ 2ES2A 3LGJA 3H3VH 2LXKA 1GD7A 1L1OB 3NENA 4DUYL 5BR8Q 1TWHH 4DK6C 1K83H 1HNZL 1CKNB 3H0GH 3ULPA 4DUYQ 5JJIA 4YWLA 2KHIA 1HNZQ 5M5WH 2K5VA 1WYDA 1Z47A 4EQ5A 4A3GH 4ME3A 2ATWA 1HZBA 3FP9A 1QUQA 1WCMH 1MJEA 1YJWA 3PO3G 5K36G 1OXSC 2XTIA 4LF5L 5FLXc 4QGUA 4HIMA 2JA5G 3OW2A 3GTMH 1KD1C 2KCMA 5GAGC 1G291 4LF5Q 3I2ZA 1SR3A 3CQZH 4YCWA 1WI5A 1YVCA 3GTPH 1EOVA 2ZTEA 1K8AC 4QL5A 3UDGA 2ASBA 3CCSA 2OTJA 4OONA 4A93G 2YTYA 2UU9Q 2YU9H 4WJ4A 4AYBE 2K14A 4JOIC 4X65L 4UY8C 5LMNW 2AMCB 2UUCQ 3HOXG 4GNXC 1IZ6A 1J5EL 2JK8A 4X65Q 4BXXH 1VQIA 1T9HA 2E2HH 4DR1L 1J5EQ 4RMFA 5E7NA 3S1NH 4JBJA 3GD7A 1E1TA 4A3LG 4A3DH 4BBRH 4DR1Q 4KI0A 1QUQB 4HJ8A 4HIKA 2NVQH 4KHZA 2I0QA 1RL2A 2VQEL 1K73C 3ER0A 2VUMG 2I5HA 1JJ2A 1PHJA 4DV3L 1C9OA 1SMXA 1NE3A 5JEAG 4LF7L 1N9WA 2VQEQ 4DKAC 3ERSX 3W1GA 4X64L 3FHWA 3JC66 1XTDA 3GTJH 1E22A 4DV3Q 4DV2L 2NVTH 3HOWG 4JI1L 4LF7Q 3HOZG 1UE1A 2B3GA 4BY1G 4X64Q 1X56A 1FVIA 2NVYH 5C4JH 2QA4A 3GO5A 3EN2A 3M4PA 4UP7A 4JI1Q 3F2CA 1QZGA 4NXML 1E3PA 4J15A 1AE3A 2B63H 3PO3H 2D0OA 3HOUG 4RG1A 5IYCG 1YNXA 4DAYB 4NXMQ 2JA5H 3RLNA 5M5YH 3S1RH 2JEAI 4HIDA 4JI2L 2R6GA 2WB1E 2OQ0A 3K0XA 4R1JA 2R7DA 1TXYA 1PH9A 1NJIC 4BY7G 4JI2Q 1Y1WG 2L15A 4A3CH 2IX1A 4DV0Q 4AYBG 2UUBL 3PUWA 3WWVA 4A93H 2DUDA 4LFCL 2HQLA 4LUZA 1Q82C 1IBLL 1VCIA 3L0OA 1BBUA 2UUBQ 5IP9H 2ZM6L 2Q2TA 5J3BA 1BVSA 3M4QA 4LFCQ 2YYZA 1CKOA 4DK3C 1YI2A 1IBLQ 3W5OA 2VW9A 2ZM6Q 3G6EA 2RHQB 1KAWA 4LFAL 3CC4A 1NMGA 3H15A 1S72A 1YITA 2D0PA 4O2DA 3HOVH 1P8LA 3GTOH 2R93G 1V1QA 4LFAQ 2NN6I 4DV7L 3RLFA 1SN8A 2Q2HA 1HZ9A 2JA6H 1V9PA 3E9HA 1CKNA 4LFBL 1ASZA 2VS1A 4R4OA 3CXCA 4DV7Q 2HHHL 1X65A 1M90C 1HR0W 2MNAA 1OXUA 4GOPA 4LFBQ 4BBSG 3AEVA 3IRBA 3U4ZA 3CCJA 2MO1A 1PYSB 3CCQA 1N34L 4GS3A 3JAMi 4QIWE 1N32L 2Z6KC 4P75A 1N34Q 5H1SE 5GADC 3I4OA 2UUAL 1N32Q 3E0EA 3TEHB 1OXTA 1X3FA 2FXQA 1E7ZA 2YV5A 5GROA 1VQKA 2OCEA 2UUAQ 1QZHA 4R4TA 2WFWA 3HOUH 3S1MH 2UXCL 1W3SA 4MTNA 4P73A 4LF6L 4X62L 1HH2P 2Z0SA 1HNXL 2UXCQ 4JI5Q 4NXNL 1IYJB 4A3EG 1Y1VG 2F52A 5FJ8H 4Y52H 4LF6Q 4X62Q 1Q7YC 1N36L 4GN5A 1OXXK 1HNXQ 4KLKA 4NXNQ 4K0KL 2JQOA 3GTKH 2F4VL 5IYDG 1MKHA 4DV1L 1N36Q 3ICEA 5HY6A 1L2FA 3T1HL 3HOYH 5C0XG 4K0KQ 4GKKL 1E1OA 2F4VQ 4JCVE 4A3JH 1PYBA 4DV1Q 3T1HQ 3E9IA 4GOPB 1VQPA 5C44H 2AHOB 2K50A 4APVA 5LMNL 1A63A 1TWGH 3J81c 1VQOA 4QQBX 3FKIH 1VQ9A 3AYHB 3KLWA 3CCMA 1SROA 3STBD 1V43A 4BA1I 2LXJA 2R93H 1H95A 1VQ7A 2Y0SG 2K4KA 3BU2A 4A3KH 3S1QH 2AKWB 3GTQH 4LF4L 2KCTA 2NZOA 4IFDJ 3UE0A 3NBHB 4DR7L 2E5LL 3KF8B 3M3YH 4BBSH 4LW1A 1IBML 4JI7L 4LF4Q 5M5XH 5IYBG 5FLMH 1CUKA 3M4OH 4DR7Q 2E5LQ 1VQ8A 4JI7Q 3CF5A 2JA7G 4DR3L 3I4MG 3J7ZC 3RN5A 3D0FA 3J80c 4AQYL 1UE6A 2R7FA 3NEMA 2V1CC 1Q12A 4DR5L 3I7FA 5GAHC 4DR3Q 2MFIA 4A3IG 1K8GA 1FGUA 3UDIA 2JA9A 4H02A 4AQYQ 2C35B 3VDYA 3K7AH 1SFOH 4GN3B 4DR5Q 1J6QA 1OTCA 2R92H 4B3RL 4FDBA 4DUZL 1L1OC 1LTLA 3UDFA 1Y1VH 4A3EH 1VQDA 1VQNA 1KXLA 4OO1I 4A3FG 2AWNA 2WP8J 4B3RQ 4DUZQ 2KBNA 2E2IH 3PO2G 1GVPA 4B3SL 4JBMA 5EAYA 3MXNB 4IPDA 5C4XG 2PQAB 4X6AH 1L0WA 1VQJA 3T1YL 1KHIA 4OWXB 4B3SQ 4GLAC 3I4NG 3M7NA 1X9NA 3SGIA 4OO1G 1VQCA 2ALYB 1VQHA 3T1YQ 3UDXA 2XGTA 4JC0A 2UXDL 1YJ9A 4DV2Q 1I5FA 2JJQA 1NBWA 2JEBI 1ASYA 2KENA 5JEAJ 2UXDQ 1Z9FA 3PSIA 5M3MG 1TWAH 4P71A 2GN5A 4LUVA 1XPRA 3K7UC 4KHPL 2AWOA 1Q8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH2 A;  3S2H H;  4LWC A;  2IY5 B;  3CMA A;  3J81 j;  4KHP Q;  2EQS A;  3CC2 A;  4HJ9 A;  1EYG A;  1C7Y A;  1KC8 C;  4A75 A;  2ZTD A;  1EWI A;  2BH8 A;  1YBY A;  5IYB H;  1EFW A;  4YWK A;  3I56 A;  1TWF H;  2IHF A;  4IJL A;  4PZ6 A;  5C3E G;  2N49 A;  4A3M G;  1PH7 A;  3F8T A;  1YEZ A;  4YY3 L;  1YHB A;  1D8L A;  2EIF A;  4JI8 L;  4L5Q A;  4YY3 Q;  3HOX H;  4ALP A;  1Q86 C;  3H3V I;  1SRU A;  5GAE C;  3CD6 A;  5IP7 G;  4R4C A;  4GLX A;  4A3B G;  1BKB A;  4OWW B;  1OXV A;  1X3E A;  4GLV B;  1Q1B A;  3K81 C;  1G51 A;  1NY4 A;  2CWP A;  5IE8 A;  5IY0 A;  1GKH A;  3TRZ A;  4DR2 L;  4DR6 L;  4A3L H;  4IJH A;  3CME A;  2K5N A;  4PMW A;  2E8G A;  5M3F G;  4P72 A;  1B8A A;  4JBW A;  4DR2 Q;  2A8V A;  2VUM H;  3H0G G;  3ZJY C;  1X54 A;  4JOI A;  2HHH Q;  2NN6 G;  1VQ5 A;  4JBK A;  3PCO B;  3PF5 A;  1JMC A;  4GNX A;  4XIG S;  4A3G G;  3HOW H;  5HGQ A;  3HOZ H;  1G6P A;  3G4S A;  2RHS B;  1WCM G;  1XMQ L;  4BY1 H;  3PIP A;  1U5K A;  3PUY A;  4MNO A;  3RNU A;  4LF8 L;  1EIY B;  1VQA A;  3HKZ G;  4IPC A;  1XMQ Q;  2LSS A;  1YHQ A;  2KHJ A;  5M3M H;  5IYC H;  4LF8 Q;  3S16 H;  2GVB A;  4NB3 A;  5ELN A;  3PF4 A;  3OTO L;  4NPS A;  1CKM A;  5JJL A;  1KL9 A;  2UXB L;  3CP0 A;  1UE5 A;  2VQF L;  1K9M C;  4A76 A;  3MEF A;  3A5Z B;  3TRE A;  4BY7 H;  2QGQ A;  1Y1W H;  3B6Y A;  1A0I A;  1CSP A;  4JI6 L;  2UXB Q;  2WAQ G;  1FL0 A;  2VQF Q;  1CSQ A;  1Q1E A;  1I6H H;  1GO3 E;  5C3E H;  1QVG A;  4JI6 Q;  1EQQ A;  4TQU S;  3PUV A;  4TVA B;  1XNQ L;  3W1B A;  4GKK Q;  3G48 A;  2JA8 G;  4GKJ L;  2PI2 E;  1JB7 A;  3A74 A;  2Y0S E;  4LUO A;  3ULJ A;  1PH8 A;  5DLQ E;  1QVF A;  1XNQ Q;  2BH2 A;  3BZC A;  5C0X J;  1PVO A;  1UE7 A;  5IP7 H;  4A3B H;  4GKJ Q;  1WJJ A;  4C3I H;  4GNX B;  5LMN Q;  1XMO L;  3A5U A;  1NTG A;  4A3D G;  4BBR G;  2ID0 A;  2PQA A;  1AE2 A;  3KJO A;  3S15 H;  5BR8 L;  3F1Z A;  3KFU A;  1Q46 A;  4DPG A;  1JJG A;  2Q2I A;  3PIO A;  4GN4 B;  2OTL A;  4IFD I;  5M3F H;  4JI4 L;  5GQO A;  2HIV A;  1WOC A;  1XPO A;  1PFS A;  2MO0 A;  4LNQ A;  2I5M X;  1IL2 A;  4AH6 A;  3TQY A;  3DLL A;  4JG2 A;  4JI4 Q;  1IBM Q;  1XNR L;  4IPH A;  3S24 A;  1PH4 A;  1IXR A;  3EBE A;  2B63 G;  3HFZ B;  2B29 A;  4DNI A;  4IFD G;  1X55 A;  3U58 A;  1XNR Q;  1NMF A;  4DV5 L;  1HNW L;  4IOC A;  3KDF A;  1I3Q H;  3BJU A;  3EIV A;  3U4V A;  1HNW Q;  2K75 A;  4DV5 Q;  1VQM A;  3GDE A;  3PUX A;  1PH6 A;  2Q2U A;  4JV5 L;  3NEL A;  1PH1 A;  4WJ3 M;  3CPF A;  3KYH C;  2DGY A;  3STB C;  2UU9 L;  1SLJ A;  1EQR A;  1BBW A;  1JE5 A;  3KF6 A;  2ZJP A;  4JV5 Q;  1WFQ A;  4R4I A;  4A3C G;  1K3R A;  4YHH L;  2Z6K A;  4OWT B;  3PV0 A;  1I94 L;  1VQB A;  2CKZ B;  1P16 A;  4LF9 L;  5IYD H;  4L5R C;  1LYL A;  4YHH Q;  2ZJR A;  4GOP C;  3DM3 A;  2UUC L;  1HZC A;  1I94 Q;  5IP9 G;  2RF4 A;  1S3O A;  3Q8D A;  4LF9 Q;  1S40 A;  3ULL A;  4AIM A;  2F3I A;  3K80 C;  4P74 A;  4OX9 L;  1HJP A;  3AFQ A;  5AJ3 L;  4DV6 L;  1JT8 A;  2BA1 A;  1XPU A;  4O0A A;  2JA8 H;  4XTC S;  3D31 A;  2YTV A;  4OX9 Q;  1VQE A;  2CWA A;  3CAM A;  3CCR A;  3GTL H;  1W2B A;  4R4Q A;  5AJ3 Q;  1VQF A;  4DV6 Q;  1KQS A;  3HOV G;  3J81 i;  4IO9 A;  1YHA A;  4HIO A;  1TWC H;  5JJK A;  4QJF A;  2JA6 G;  4C3H H;  2ZJQ A;  1Y14 B;  1UEB A;  2I5L X;  1VS0 A;  2VY3 A;  4HJ7 A;  4IPG A;  4C2M H;  4HJA A;  1PA6 A;  3JAM c;  3KDF B;  4UP9 A;  1HR0 L;  1VQ6 A;  4YWM A;  3PGZ A;  4X66 L;  3GTG H;  2D62 A;  2N8N A;  4POG A;  1RIP A;  3RZD H;  1HR0 Q;  4A4I A;  1FJG L;  3KF6 B;  4X66 Q;  3K8A A;  1B70 B;  2MQH A;  2CCZ A;  3I4M H;  2JA7 H;  1AH9 A;  3UE1 A;  4EX5 A;  3L2P A;  2QEX A;  1FJG Q;  2R7Z G;  3J80 i;  4A3I H;  4BA2 I;  2IX0 A;  1IBK L;  2ZTC A;  1VQG A;  4JI8 Q;  1GM5 A;  4PZ7 A;  3PUZ A;  2CFM A;  1IBK Q;  3RZO H;  2A19 A;  3M9B A;  2BA0 A;  2NVX H;  1YZ6 A;  5FJ8 G;  3HKS A;  3BZK A;  1EIF A;  2YTX A;  3OYY A;  5LMU L;  1DGS A;  4DV0 L;  1QVC A;  1XJV A;  2JE6 I;  2PMZ E;  4A3F H;  4B3M L;  4L5S A;  2HT1 A;  1VQL A;  5LMU Q;  3HOY G;  3PO2 H;  1HZA A;  2WB1 G;  5IWA L;  2GVA A;  4DR6 Q;  1EUJ A;  2IT1 A;  1A62 A;  4B3M Q;  2RCN A;  4A3J G;  5C4X H;  2IHE A;  5IWA Q;  3RN2 A;  3I4N H;  1D7Q A;  3AFP A;  1KIX A;  3HKZ E;  1SE8 A;  1UWV A;  4YCV A;  5C44 G;  3RR5 A;  3CCU A;  2OWO A;  1Q81 C;  4UP8 A;  2OQK A;  2H5X A;  1X3G A;  4IOA A;  4B3T L;  5IT9 c;  3FKI G;  2N78 A;  3CW2 C;  1PV4 A;  3CPW A;  1KRS A;  3S17 H;  4DR4 L;  1L1O A;  2HIX A;  2VL6 A;  4B3T Q;  1N33 L;  4POF A;  3A0J A;  2VZA A;  2EXD A;  4A3K G;  3I55 A;  4OXP A;  4DR4 Q;  4YCU A;  4DV4 L;  1B7Y B;  4JI0 L;  2WAQ E;  1N33 Q;  2VNU D;  2CQO A;  5ELO A;  1E24 A;  3OTO Q;  4JI0 Q;  4DV4 Q;  5FLM G;  1YIJ A;  2N3S A;  1MJC A;  1C0A A;  1A8V A;  3F2D A;  1O7I A;  1X6O A;  4PZ8 A;  3AQQ A;  1VQ4 A;  2E2J H;  1M1K C;  3U50 C;  1KRT A;  3TS0 A;  1MIU A;  4JI3 L;  3CCV A;  4PG3 A;  4JYA L;  3CC7 A;  1LM0 A;  4DAM A;  4A3M H;  3S2D H;  4C3J H;  2PNH A;  4JI3 Q;  2PI2 A;  3L7Z C;  4L5T A;  4UPA A;  4HJ5 A;  1R9T H;  2K52 A;  2K5H A;  2R7Z H;  3M85 A;  3TS2 A;  4JYA Q;  4JI5 L;  3CCE A;  4QY7 A;  3G71 A;  4BXX G;  1N8R C;  2R92 G;  3S14 H;  1LUZ A;  3KOJ A;  2NZH A;  3RLO A;  5C0X I;  1K0R A;  1PH3 A;  2A1A A;  3KJP A;  1JJC B;  3F2B A;  4MZ9 A;  4Y7N H;  1U0L A;  1YJN A;  1PH5 A;  3CCL A;  3J7A 5;  1I50 H;  1XMO Q;  2ES2 A;  3LGJ A;  3H3V H;  2LXK A;  1GD7 A;  1L1O B;  3NEN A;  4DUY L;  5BR8 Q;  1TWH H;  4DK6 C;  1K83 H;  1HNZ L;  1CKN B;  3H0G H;  3ULP A;  4DUY Q;  5JJI A;  4YWL A;  2KHI A;  1HNZ Q;  5M5W H;  2K5V A;  1WYD A;  1Z47 A;  4EQ5 A;  4A3G H;  4ME3 A;  2ATW A;  1HZB A;  3FP9 A;  1QUQ A;  1WCM H;  1MJE A;  1YJW A;  3PO3 G;  5K36 G;  1OXS C;  2XTI A;  4LF5 L;  5FLX c;  4QGU A;  4HIM A;  2JA5 G;  3OW2 A;  3GTM H;  1KD1 C;  2KCM A;  5GAG C;  1G29 1;  4LF5 Q;  3I2Z A;  1SR3 A;  3CQZ H;  4YCW A;  1WI5 A;  1YVC A;  3GTP H;  1EOV A;  2ZTE A;  1K8A C;  4QL5 A;  3UDG A;  2ASB A;  3CCS A;  2OTJ A;  4OON A;  4A93 G;  2YTY A;  2UU9 Q;  2YU9 H;  4WJ4 A;  4AYB E;  2K14 A;  4JOI C;  4X65 L;  4UY8 C;  5LMN W;  2AMC B;  2UUC Q;  3HOX G;  4GNX C;  1IZ6 A;  1J5E L;  2JK8 A;  4X65 Q;  4BXX H;  1VQI A;  1T9H A;  2E2H H;  4DR1 L;  1J5E Q;  4RMF A;  5E7N A;  3S1N H;  4JBJ A;  3GD7 A;  1E1T A;  4A3L G;  4A3D H;  4BBR H;  4DR1 Q;  4KI0 A;  1QUQ B;  4HJ8 A;  4HIK A;  2NVQ H;  4KHZ A;  2I0Q A;  1RL2 A;  2VQE L;  1K73 C;  3ER0 A;  2VUM G;  2I5H A;  1JJ2 A;  1PHJ A;  4DV3 L;  1C9O A;  1SMX A;  1NE3 A;  5JEA G;  4LF7 L;  1N9W A;  2VQE Q;  4DKA C;  3ERS X;  3W1G A;  4X64 L;  3FHW A;  3JC6 6;  1XTD A;  3GTJ H;  1E22 A;  4DV3 Q;  4DV2 L;  2NVT H;  3HOW G;  4JI1 L;  4LF7 Q;  3HOZ G;  1UE1 A;  2B3G A;  4BY1 G;  4X64 Q;  1X56 A;  1FVI A;  2NVY H;  5C4J H;  2QA4 A;  3GO5 A;  3EN2 A;  3M4P A;  4UP7 A;  4JI1 Q;  3F2C A;  1QZG A;  4NXM L;  1E3P A;  4J15 A;  1AE3 A;  2B63 H;  3PO3 H;  2D0O A;  3HOU G;  4RG1 A;  5IYC G;  1YNX A;  4DAY B;  4NXM Q;  2JA5 H;  3RLN A;  5M5Y H;  3S1R H;  2JEA I;  4HID A;  4JI2 L;  2R6G A;  2WB1 E;  2OQ0 A;  3K0X A;  4R1J A;  2R7D A;  1TXY A;  1PH9 A;  1NJI C;  4BY7 G;  4JI2 Q;  1Y1W G;  2L15 A;  4A3C H;  2IX1 A;  4DV0 Q;  4AYB G;  2UUB L;  3PUW A;  3WWV A;  4A93 H;  2DUD A;  4LFC L;  2HQL A;  4LUZ A;  1Q82 C;  1IBL L;  1VCI A;  3L0O A;  1BBU A;  2UUB Q;  5IP9 H;  2ZM6 L;  2Q2T A;  5J3B A;  1BVS A;  3M4Q A;  4LFC Q;  2YYZ A;  1CKO A;  4DK3 C;  1YI2 A;  1IBL Q;  3W5O A;  2VW9 A;  2ZM6 Q;  3G6E A;  2RHQ B;  1KAW A;  4LFA L;  3CC4 A;  1NMG A;  3H15 A;  1S72 A;  1YIT A;  2D0P A;  4O2D A;  3HOV H;  1P8L A;  3GTO H;  2R93 G;  1V1Q A;  4LFA Q;  2NN6 I;  4DV7 L;  3RLF A;  1SN8 A;  2Q2H A;  1HZ9 A;  2JA6 H;  1V9P A;  3E9H A;  1CKN A;  4LFB L;  1ASZ A;  2VS1 A;  4R4O A;  3CXC A;  4DV7 Q;  2HHH L;  1X65 A;  1M90 C;  1HR0 W;  2MNA A;  1OXU A;  4GOP A;  4LFB Q;  4BBS G;  3AEV A;  3IRB A;  3U4Z A;  3CCJ A;  2MO1 A;  1PYS B;  3CCQ A;  1N34 L;  4GS3 A;  3JAM i;  4QIW E;  1N32 L;  2Z6K C;  4P75 A;  1N34 Q;  5H1S E;  5GAD C;  3I4O A;  2UUA L;  1N32 Q;  3E0E A;  3TEH B;  1OXT A;  1X3F A;  2FXQ A;  1E7Z A;  2YV5 A;  5GRO A;  1VQK A;  2OCE A;  2UUA Q;  1QZH A;  4R4T A;  2WFW A;  3HOU H;  3S1M H;  2UXC L;  1W3S A;  4MTN A;  4P73 A;  4LF6 L;  4X62 L;  1HH2 P;  2Z0S A;  1HNX L;  2UXC Q;  4JI5 Q;  4NXN L;  1IYJ B;  4A3E G;  1Y1V G;  2F52 A;  5FJ8 H;  4Y52 H;  4LF6 Q;  4X62 Q;  1Q7Y C;  1N36 L;  4GN5 A;  1OXX K;  1HNX Q;  4KLK A;  4NXN Q;  4K0K L;  2JQO A;  3GTK H;  2F4V L;  5IYD G;  1MKH A;  4DV1 L;  1N36 Q;  3ICE A;  5HY6 A;  1L2F A;  3T1H L;  3HOY H;  5C0X G;  4K0K Q;  4GKK L;  1E1O A;  2F4V Q;  4JCV E;  4A3J H;  1PYB A;  4DV1 Q;  3T1H Q;  3E9I A;  4GOP B;  1VQP A;  5C44 H;  2AHO B;  2K50 A;  4APV A;  5LMN L;  1A63 A;  1TWG H;  3J81 c;  1VQO A;  4QQB X;  3FKI H;  1VQ9 A;  3AYH B;  3KLW A;  3CCM A;  1SRO A;  3STB D;  1V43 A;  4BA1 I;  2LXJ A;  2R93 H;  1H95 A;  1VQ7 A;  2Y0S G;  2K4K A;  3BU2 A;  4A3K H;  3S1Q H;  2AKW B;  3GTQ H;  4LF4 L;  2KCT A;  2NZO A;  4IFD J;  3UE0 A;  3NBH B;  4DR7 L;  2E5L L;  3KF8 B;  3M3Y H;  4BBS H;  4LW1 A;  1IBM L;  4JI7 L;  4LF4 Q;  5M5X H;  5IYB G;  5FLM H;  1CUK A;  3M4O H;  4DR7 Q;  2E5L Q;  1VQ8 A;  4JI7 Q;  3CF5 A;  2JA7 G;  4DR3 L;  3I4M G;  3J7Z C;  3RN5 A;  3D0F A;  3J80 c;  4AQY L;  1UE6 A;  2R7F A;  3NEM A;  2V1C C;  1Q12 A;  4DR5 L;  3I7F A;  5GAH C;  4DR3 Q;  2MFI A;  4A3I G;  1K8G A;  1FGU A;  3UDI A;  2JA9 A;  4H02 A;  4AQY Q;  2C35 B;  3VDY A;  3K7A H;  1SFO H;  4GN3 B;  4DR5 Q;  1J6Q A;  1OTC A;  2R92 H;  4B3R L;  4FDB A;  4DUZ L;  1L1O C;  1LTL A;  3UDF A;  1Y1V H;  4A3E H;  1VQD A;  1VQN A;  1KXL A;  4OO1 I;  4A3F G;  2AWN A;  2WP8 J;  4B3R Q;  4DUZ Q;  2KBN A;  2E2I H;  3PO2 G;  1GVP A;  4B3S L;  4JBM A;  5EAY A;  3MXN B;  4IPD A;  5C4X G;  2PQA B;  4X6A H;  1L0W A;  1VQJ A;  3T1Y L;  1KHI A;  4OWX B;  4B3S Q;  4GLA C;  3I4N G;  3M7N A;  1X9N A;  3SGI A;  4OO1 G;  1VQC A;  2ALY B;  1VQH A;  3T1Y Q;  3UDX A;  2XGT A;  4JC0 A;  2UXD L;  1YJ9 A;  4DV2 Q;  1I5F A;  2JJQ A;  1NBW A;  2JEB I;  1ASY A;  2KEN A;  5JEA J;  2UXD Q;  1Z9F A;  3PSI A;  5M3M G;  1TWA H;  4P71 A;  2GN5 A;  4LUV A;  1XPR A;  3K7U C;  4KHP L;  2AWO A;  1Q8K A; 
#chains in the Genus database with same CATH topology
 1PH2 A;  3S2H H;  2AQ3 B;  2XVS A;  2B2U A;  2EQS A;  1KC8 C;  1SXT A;  4YWK A;  2IHF A;  4PZ6 A;  1PZK D;  4C56 C;  1Z7T A;  3D4R A;  3F8T A;  1PH7 A;  1D8L A;  2PZT A;  4YY3 Q;  4ALP A;  1Q86 C;  4R8N A;  5I4D A;  3S1M B;  4A3B G;  2KOL A;  2DNC A;  2BDO A;  2EPB A;  4RA8 A;  4DR2 L;  1D5Z C;  3CME A;  2K5N A;  4F87 A;  4P72 A;  1ET9 A;  4L63 B;  1I4P A;  3VA5 A;  3HOY B;  1VQ5 A;  3G4S A;  5C44 B;  1UNS A;  5CBE E;  1EIY B;  1VQA A;  2H4O A;  5EPJ A;  3MXP A;  2KHJ A;  5IYC H;  4RGT A;  1ILP A;  1SNC A;  3OHX C;  5E1F A;  5ELN A;  3D6W A;  1EYD A;  1CKM A;  3VR4 A;  5JJL A;  1ROD A;  2CH4 A;  4ZKC B;  1K9M C;  3MEF A;  1VMP A;  4F8M A;  1GUO A;  1Y1W H;  1EY5 A;  1CSP A;  1HFN A;  1A6X A;  4EQN A;  1TY0 A;  1FL0 A;  2VQF Q;  3A8I E;  1CSQ A;  1BCP B;  2JN4 A;  1B2T A;  4TQU S;  4TVA B;  2A74 C;  2KEE A;  3R3O A;  4GKJ L;  1Y69 U;  1PH8 A;  2BH2 A;  1UE7 A;  4K8J A;  5LMN Q;  1D5M C;  3KJO A;  2PQA A;  1AE2 A;  3EFX D;  1SYD A;  3OMC A;  1LAB A;  1SYF A;  4H13 C;  3VYU A;  4IFD I;  2B2V A;  3R2T A;  1WOC A;  5BN3 A;  2I5M X;  2Q8I B;  5NUC A;  1IL2 A;  4JG2 A;  1IBM Q;  3EBE A;  2HQE A;  3HFZ B;  2B29 A;  4DNI A;  4IFD G;  1YNN C;  2NVY B;  1X55 A;  1HNW L;  3ZYY X;  4DV5 L;  2WII B;  1PRT F;  5IOC A;  4QMG A;  3GDE A;  3PUX A;  4JV5 L;  1XWE A;  1CTM A;  3CPF A;  3PQI A;  1SLJ A;  2M2L A;  1JE5 A;  2K1B A;  3CRK C;  2FMM A;  4YHH L;  2Z6K A;  4HMJ A;  2CKZ B;  4LF9 L;  4A93 B;  1HZC A;  1I94 Q;  1S3O A;  2KUM A;  3ULL A;  5C6A A;  1W6J A;  1DOK A;  1JT8 A;  3S9W A;  4OX9 Q;  1EIH A;  4R4Q A;  4U67 3;  4IO9 A;  1AN8 A;  2Q8T A;  2X6L A;  3AB9 A;  1TS4 A;  4XT3 B;  2ZJQ A;  3ERQ A;  1NCV A;  3GTO B;  2A6H C;  2JA6 B;  1UUP A;  4HJ7 A;  1EWC A;  4M1U B;  4HJA A;  2BDN A;  3JAM c;  4IUV A;  5C4H A;  4UP9 A;  1C8C A;  4POG A;  2EZV A;  1HR0 Q;  2K05 A;  3QG1 A;  4X66 Q;  2MQH A;  4KK7 A;  2NWG A;  3UE1 A;  5EPK A;  2QEX A;  2XRS D;  2IX0 A;  1IBK L;  1XTC D;  2ZTC A;  2I07 B;  1VQG A;  4DF7 A;  1YNJ D;  2CFM A;  3RZO H;  2A19 A;  3S16 B;  5D3I B;  2XSC A;  2EYM A;  2G9H D;  1DGS A;  3K5N A;  2LFN A;  1QOH A;  2JXM B;  3PIP 3;  2LMC B;  5EKI A;  4RCO A;  5IWA L;  1EUJ A;  4B3M Q;  4A3J G;  2FIN B;  2HUG A;  3LWU A;  1TS5 A;  3AFP A;  3RUZ A;  4X3T A;  1CQF A;  1GXD C;  2H5X A;  5BN5 A;  4IOA A;  4B3T L;  5IT9 c;  3FKI G;  4DK0 A;  3H94 A;  4DR4 L;  1L1O A;  2VL6 A;  3A0J A;  2B2W C;  1DD2 A;  4DXG A;  4OXP A;  1AFP A;  4JI0 L;  3S15 B;  4MHE A;  3S1Q B;  2CHB D;  1YIJ A;  2N3S A;  5C3X A;  5T1G A;  1O7I A;  1X6O A;  3M3Y B;  1KRT A;  1CK1 A;  3SVM A;  2EYF A;  4JI3 L;  1PTO B;  4JW0 A;  5DNF A;  3CC7 A;  1LM0 A;  3X3M A;  3S2D H;  1MI2 A;  4L5T A;  4JYA Q;  3TS2 A;  3QOJ A;  4ABN A;  1SFO B;  3FVQ A;  1I3Q B;  3VYR A;  3A7A B;  3KOJ A;  1L0X B;  3RLO A;  3NSW A;  2H1E A;  3QIA A;  1PH3 A;  3H3V C;  3F2B A;  3I91 A;  1KDC A;  4ZKB B;  3LGJ A;  1L1O B;  3NEN A;  4HCS A;  1TWH H;  3I3C A;  1JOK A;  3K0Y A;  4G7Z C;  3J81 L;  4RAU C;  5CYU A;  4FNF A;  4HR7 B;  1WCM H;  1YJW A;  1OXS C;  2AQ2 B;  2L1B A;  4K2K A;  5C5L A;  2WKC A;  2JA5 G;  4HN7 A;  3OW2 A;  1TWC B;  5GAG C;  3GP7 A;  4LF5 Q;  3DWP A;  1WI5 A;  1YVC A;  3E0J A;  3VA7 A;  4C2M B;  4QL5 A;  3J80 L;  4DAY A;  4J6H A;  4X65 L;  4N9T A;  3SXH A;  2AMC B;  1HTP A;  1L0Y B;  3DM1 A;  4WOR A;  4A3I B;  1JB3 A;  4BXX H;  5D14 A;  1J5E Q;  4S3S A;  4I7A A;  2EYL A;  3GD7 A;  4FF3 A;  2M00 A;  4A3F B;  3ER0 A;  2I5H A;  4DV3 L;  3PO2 B;  1N9W A;  4DKA C;  1JQY D;  3W1G A;  3JC6 6;  1XTD A;  2F0I A;  2A73 B;  1JOQ A;  3Q22 A;  2HD3 A;  2NVY H;  5C4J H;  3NE5 B;  4DN4 M;  1IW7 C;  4J15 A;  3TSS A;  2D0O A;  3E5S A;  3HOU G;  5IYC G;  4DAY B;  3VR3 A;  1PDQ A;  1S5E D;  5M3M B;  3Q23 A;  2BE5 C;  3S1R H;  3MEH A;  4JI2 L;  2R6G A;  2KHS A;  1TXY A;  2EYJ A;  1PH9 A;  1Y1W G;  1R4P B;  4A3C H;  1EY6 A;  3D3R A;  3PUW A;  3WWV A;  5KYL A;  4A93 H;  2DUD A;  1K0S A;  3L0O A;  2UUB Q;  1I6H B;  4E6I A;  5D3D A;  5C3E B;  2Q2T A;  5J3B A;  2EXZ A;  4P2C B;  2YYZ A;  5I9O A;  1IBL Q;  1AZQ A;  4FXG C;  1R9T B;  4UAI A;  4EGV A;  1U9R A;  3CC4 A;  1FNW A;  3GV3 A;  3H15 A;  2F0G A;  1P8L A;  3GTO H;  2F0E A;  2L11 A;  2X6G A;  1SN8 A;  4FVM A;  2JA6 H;  1V9P A;  3E9H A;  4O42 A;  3E3X A;  1WTV A;  4H0L C;  2HHH L;  1X65 A;  1ICF B;  5IGC A;  4LFB Q;  3IRB A;  3JAM i;  4QIW E;  5M3F B;  2V4D A;  3H0G B;  4P75 A;  1N34 Q;  5H1S E;  3I4O A;  1N32 Q;  3TEH B;  2M9V A;  4LMQ D;  1K8M A;  4KJN A;  1LTT D;  1VQK A;  4R4T A;  3KF8 A;  1LTB D;  3GTM B;  4X62 L;  2I46 A;  3FPU B;  3TP6 A;  3K6O A;  4Y52 H;  4LF6 Q;  3CQZ B;  1Q7Y C;  4OL7 A;  1HNX Q;  3OIP A;  3GTP B;  2JQO A;  4DV1 L;  5HY6 A;  4GKK L;  2F0F A;  3TBI B;  3I70 A;  2KCC A;  3CHB D;  2TMP A;  3KLW A;  3STB D;  1RD9 D;  1BCP D;  1PMR A;  2LXJ A;  1SE2 A;  4H7B A;  4A3K H;  4BBR B;  3S1Q H;  4DFA A;  3SHL A;  3KF8 B;  3M3Y H;  3TDQ A;  5FO9 B;  4LW1 A;  4JI7 L;  5IYB G;  1KAB A;  3WOF A;  4DAV A;  2E5L Q;  2LS0 1;  1HHV A;  1BQQ T;  1UE6 A;  3NEM A;  2V1C C;  5GAH C;  4DR3 Q;  2B63 B;  4H02 A;  4AQY Q;  1C48 A;  2B2W A;  1SFO H;  1LV9 A;  4GN3 B;  4JVZ A;  1J8I A;  2F0Q A;  3M7G A;  5M5Y B;  1PTO F;  3UDF A;  2DJF C;  1Y8O B;  2AWN A;  3RMH A;  1GVP A;  1L0W A;  5ISR A;  4N8X 1;  5C0X H;  3M7N A;  2ALY B;  1MD2 D;  3T1Y Q;  5A35 A;  2UXD L;  1ENC A;  2JJQ A;  2JEB I;  1STN A;  3QB3 A;  1KLU D;  4RGO S;  3PSI A;  2PO4 A;  2A69 D;  2RDH A;  3HOV B;  2GN5 A;  2R61 A;  2QEJ C;  4ZYS A;  2Q8R E;  2PPB C;  3NHH A;  3TME A;  1X32 A;  1NSN S;  4LWC A;  2IY5 B;  2G9D A;  4K5V A;  5K5P A;  1DON A;  3CC2 A;  4HJ9 A;  3TP7 A;  5IGE A;  5DEH A;  3I56 A;  1B9N A;  3VYS A;  4IJL A;  2ZXO A;  2N49 A;  5C5M A;  2IWH A;  4YY3 L;  1YEZ A;  4IN3 A;  4DAP A;  4CJ1 B;  2R7Z B;  1SRU A;  1EYA A;  1A3U A;  1LTI D;  1PFN A;  1OXV A;  1X3E A;  1EU4 A;  2JSO A;  1O7Y A;  1G51 A;  4DR6 L;  5IE8 A;  3P7J A;  1GKH A;  5A2Q L;  4PMW A;  1B8A A;  3D8G A;  2VUM H;  1IKL A;  4KJO A;  4YIJ A;  5FOB B;  3T4A C;  2HHH Q;  5JEA H;  1SJE D;  4XIG S;  3RD4 A;  3HOW H;  3SK4 A;  3J81 E;  1G6P A;  1WCM G;  4BY1 H;  1MBY A;  3PUY A;  4MNO A;  4Q5V A;  1TWG B;  1JCK B;  3HKZ G;  1SBB B;  1XMQ Q;  1YHQ A;  1XYI A;  5M3M H;  1MHW C;  1CHQ D;  4LF8 Q;  1A3V A;  2GVB A;  1ENA A;  1DOM A;  3HG9 A;  4N9P A;  1EEF D;  1F2Z A;  2VQF L;  3LWE A;  3BG3 A;  4BY7 H;  1BXT A;  2QGQ A;  1A0I A;  2UXB Q;  1I4G A;  3M4O B;  1JIC A;  1EOT A;  1Q1E A;  1I6H H;  5C3E H;  4JI6 Q;  1JOO A;  3FMC A;  1VDZ A;  2F3V A;  3MWY W;  4GKK Q;  3G48 A;  2JA8 G;  2PI2 E;  4XQQ A;  5CC4 A;  2Y0S E;  3BZC A;  5IP7 H;  4C3I H;  1J9O A;  3NBI A;  2E2H B;  2R92 B;  2Z4I A;  1O7L A;  4N8F A;  1UAP A;  4DPG A;  1JJG A;  3C1E A;  3NXW A;  2OTL A;  5M3F H;  2Z9H A;  4NDX A;  1XPO A;  1PFS A;  1PTO C;  2MO0 A;  4IUT A;  2NN6 H;  3TQY A;  2NB0 A;  1IXR A;  3NK9 A;  1CI3 M;  3NUC A;  3OWE B;  4FP5 D;  1ILQ A;  2E2D C;  3EIV A;  2IPK D;  3NQT A;  3T51 B;  4KY6 A;  3QO2 A;  2DGY A;  4HMI A;  1EQR A;  3KF6 A;  4A3C G;  4TRD A;  4OWT B;  1CQV A;  1ZYR D;  3PV0 A;  1I94 L;  5ELF A;  1VQB A;  1P16 A;  3WOE A;  3NPP A;  2RF4 A;  1S40 A;  2F3I A;  3K80 C;  3V2T A;  1GJX A;  4OX9 L;  1HJP A;  1SYE A;  1I4X A;  5CV7 A;  2BA1 A;  2EJG C;  3D31 A;  5I2Y A;  1D1K A;  2GA4 B;  2YTV A;  1VQE A;  2CWA A;  1F2L A;  3CAM A;  5DAU A;  2JA6 G;  4C3H H;  1Y14 B;  1SNO A;  2PCF B;  2SDF A;  4CDF C;  1WTO A;  2I5L X;  2VY3 A;  1SNQ A;  4IPG A;  4DXF A;  3J7A V;  4FF1 A;  1QCB D;  2F3W A;  4CJ0 B;  1HR0 L;  4ODG A;  4X66 L;  4XYQ A;  2N8N A;  4KN4 C;  1RIP A;  5J22 A;  1B3A A;  2XWB B;  5CV4 A;  4HTH A;  1CA5 A;  3KF6 B;  1DYQ A;  3K8A A;  1B70 B;  2CCZ A;  3HOZ B;  1FJG Q;  1E2Z A;  2JP1 A;  3HP3 A;  5ELD A;  1CA6 A;  1GM5 A;  1C4Q A;  3I73 A;  1VF5 C;  3NWT A;  2B8G A;  1YZ6 A;  3OYY A;  4K5X A;  1XJV A;  1JE4 A;  2HCC A;  4B3M L;  1H9M A;  2WB1 G;  4DR6 Q;  4JK1 C;  2IT1 A;  2RCN A;  5C4X H;  2PQE A;  1STE A;  3RN2 A;  4TKO B;  4YCV A;  1Q81 C;  4UP8 A;  1LAC A;  3GV6 A;  1HUN A;  2N78 A;  3E6Z X;  2KA7 A;  1PV4 A;  3BVG A;  5EKK A;  2F0N A;  2QKI C;  3S17 H;  1Q90 A;  2J0T D;  4O1N A;  4A3K G;  1XX8 A;  4YCU A;  1B7Y B;  1N33 Q;  4IUQ A;  2VNU D;  4FXD A;  1E24 A;  3K58 A;  1BNZ A;  4DV4 Q;  3VYT A;  1O78 A;  1MJC A;  1VQ4 A;  2E2J H;  1M1K C;  1RJT A;  3CCV A;  4JYA L;  2CW0 D;  4DAM A;  4A3M H;  4C3J H;  4XYO A;  2PNH A;  4ZCK A;  2PI2 A;  3L7Z C;  2R7Z H;  2K52 A;  2K5H A;  3M85 A;  4QY7 A;  1N8R C;  3S14 H;  2FHT A;  1LUZ A;  1PZI D;  4H44 C;  1BO0 A;  5C0X I;  3OPO A;  1K0R A;  3KJP A;  1U0L A;  1YJN A;  3CCL A;  3MAQ A;  1I50 H;  3J7A 5;  3H3V H;  1GD7 A;  4DK1 A;  1CKN B;  1GUN A;  2O2L D;  4DUY Q;  2KCN A;  5JPN C;  5JJI A;  1HNZ Q;  2B2T C;  5COR A;  1SYB A;  1Z47 A;  4A3G H;  2C5C A;  3PO3 G;  1SJH D;  5K36 G;  2XTI A;  1SNP A;  4LF5 L;  4KD4 A;  5G3L F;  5FLX c;  4IUN A;  5FKA C;  4HIM A;  1G29 1;  2RDG A;  3NTK A;  1HA6 A;  2OTJ A;  3FRP B;  4WJ4 A;  4PNY A;  3I4M B;  3BS1 A;  1TY2 A;  1IZ6 A;  1EYC A;  1J5E L;  1G2S A;  4WJW A;  3R2I A;  4F7X A;  1STH A;  3HOX B;  4IUR A;  1VQI A;  2A6H D;  2E2H H;  4JBJ A;  4A3D H;  2HDM A;  4HJ8 A;  3W2D A;  4KHZ A;  5A2Q E;  2I0Q A;  2VUM G;  1PHJ A;  1C9O A;  5JEA G;  1A2U A;  3BVM A;  4DV2 L;  1E22 A;  3HOW G;  3I4N B;  1BOS A;  4BY1 G;  2F0J A;  4X64 Q;  1D1I A;  1MSG A;  3OSO A;  4UP7 A;  1A3T A;  4JI1 Q;  2K5W A;  1AE3 A;  1KNA A;  2FJ2 A;  3IL8 A;  3BDC A;  1YNX A;  4NXM Q;  3RLN A;  1B44 D;  1EY0 A;  3ERO A;  1K8O A;  2R7D A;  3NWS A;  1STB A;  2NUC A;  5L37 A;  4BY7 G;  1RTN A;  4FF4 A;  5EBC A;  2IX1 A;  4AYB G;  2PW5 A;  3A8K E;  3K5L A;  2UUB L;  1LTS D;  1NR4 A;  2LKV A;  3M4Y A;  1IBL L;  1RKN A;  1VCI A;  5IP9 H;  1QG7 A;  1BVS A;  4LFC Q;  4KD3 A;  1AEX A;  1UEA B;  4DK3 C;  1YI2 A;  3BVZ A;  2ZM6 Q;  5F2D A;  4C3I G;  1EFI D;  2G5D A;  4A3B B;  2R93 G;  3DUZ A;  1JWU D;  2NN6 I;  1TS2 A;  4LFB L;  1R4Q B;  1YNJ C;  2VS1 A;  3L3O C;  4DV7 Q;  5KNC A;  2EYP A;  4BBS G;  3AEV A;  2MO1 A;  1N34 L;  4CDC C;  1N32 L;  1I4H A;  3E0E A;  1OXT A;  3DEP A;  2YV5 A;  3FPP A;  1H9S B;  3S1M H;  1W3S A;  2NTT A;  4MTN A;  4P73 A;  4LF6 L;  1HH2 P;  1PRT D;  3P20 A;  1HNX L;  3N6R A;  2UXC Q;  4A3E G;  1Y1V G;  4KY5 A;  5FJ8 H;  3IFD A;  4GN5 A;  4NXN Q;  1CZW A;  4UDU C;  3N52 A;  1N36 Q;  3NQI A;  3HOY H;  4XXE A;  2YU9 B;  4K0K Q;  1E1O A;  1PYB A;  3T1H Q;  3E9I A;  1VF7 A;  1VMC A;  1VQP A;  5C44 H;  2AHO B;  4APV A;  1LT5 D;  2MJ8 A;  3AYH B;  1K3B C;  1SRO A;  3GTL B;  3T53 B;  4C3H G;  2FFK B;  4BA1 I;  2OF1 A;  3BZD B;  3TZU A;  4QUF A;  2NZO A;  2IL8 A;  3UE0 A;  4IFD J;  2NVQ B;  3NBH B;  2AUJ D;  2E5L L;  1H9J A;  5TSS A;  3URY A;  2TSS A;  3GTG B;  1VQ8 A;  2ZXP A;  5C4Z A;  5IGB A;  4DR3 L;  1SYC A;  3ITP A;  4AQY L;  1Q12 A;  3I7F A;  1T5X D;  2MFI A;  2K28 A;  1K8G A;  3VDY A;  2C35 B;  4DR5 Q;  2F4I A;  4FDB A;  2NVX B;  1I4Q A;  4FO2 A;  1WTH A;  2XWJ B;  3L9A X;  3MXN B;  1DXM A;  5C4X G;  3T1Y L;  4B3S Q;  1IHZ A;  4GLA C;  2XIW A;  4WFN 3;  1X9N A;  3UDX A;  2XGT A;  3LNN A;  4JC0 A;  1YJ9 A;  4DV2 Q;  1I5F A;  1NBW A;  4C1N K;  5JEA J;  2XRQ D;  3O13 A;  2AWO A;  1Q8K A;  3JAM L;  1MSH A;  3J81 j;  1EYG A;  1S5F D;  4A75 A;  2ZTD A;  1EWI A;  2B2T A;  4A3M G;  4C3J G;  1V8Q A;  2EIF A;  2RA4 A;  1Y8N B;  1WTQ A;  3HOX H;  3H3V I;  3EA6 A;  1B1Z A;  2A6E C;  1HXY D;  3GQB A;  3K81 C;  5IY0 A;  3D6C A;  3TRZ A;  3QOL A;  4Y7N B;  2F0T A;  3NP8 A;  3C2P A;  2E8G A;  1X3Q A;  2KJX A;  2PZW A;  2A68 D;  3ZJY C;  1HA5 A;  4JBK A;  5IOD A;  1K83 B;  4A3G G;  4X3U A;  5IT9 L;  2NTS A;  4V19 0;  1RTO A;  1XMQ L;  1U5K A;  2RKS A;  3V05 A;  3RNU A;  1ONL A;  4LF8 L;  1RCV D;  3FKI B;  3W3A A;  1U4P A;  3OIQ A;  2LSS A;  3S16 H;  2MPM A;  4NB3 A;  2EY5 A;  1H9K A;  3MA2 B;  4CHT B;  5IGD A;  2UXB L;  1UE5 A;  4A76 A;  3TRE A;  3SR1 A;  3B6Y A;  1WVL A;  2PYK A;  4JI6 L;  4FF2 A;  2WAQ G;  1M8A A;  1GO3 E;  1QVG A;  1WTW A;  3G6J B;  3BYY B;  1BBX C;  1QVF A;  3A74 A;  4LUO A;  3ULJ A;  1IYV A;  5DLQ E;  3K7A B;  1XNQ Q;  1PVO A;  4HCE A;  4A3B H;  2K7V A;  1HQR D;  1NTG A;  4A3D G;  5T1I A;  2ID0 A;  3S15 H;  5BR8 L;  1F9Q A;  2ZXR A;  3F1Z A;  3Q24 A;  1SNM A;  4V0B A;  1U4L A;  3PIO A;  4K5W A;  4GN4 B;  2LY7 A;  5JJZ A;  4BS9 A;  4X3S A;  2D5D A;  1LT4 D;  1B4O A;  1IYU A;  4NW2 A;  5CV6 A;  4AH6 A;  3DLL A;  4JI4 Q;  1PTO H;  2NVT B;  1X3P A;  1EL0 A;  1B53 A;  1B3Q A;  1CFM A;  2NBF A;  4EVO A;  1XNR Q;  2K33 A;  1XXG A;  3KDF A;  1I3Q H;  1I4R A;  3BJU A;  4CGY B;  2K75 A;  1TWA B;  2JA5 B;  4WJ3 M;  2WV6 D;  3KYH C;  3Q6S A;  3STB C;  4K8I A;  4XT1 B;  4C1N I;  1V1P A;  2UU9 L;  3S2H B;  4QCL A;  1WFQ A;  1K3R A;  3V96 A;  4L5R C;  1LYL A;  2ZJR A;  1LTG D;  3DM3 A;  2UUC L;  5FO8 B;  1G6Z A;  5IP9 G;  3MHB A;  4RH6 A;  4P74 A;  3AFQ A;  2EOT A;  1G91 A;  1XPU A;  4O0A A;  3C46 A;  1EY4 A;  3ND9 A;  5BN4 A;  3CCR A;  2VB2 X;  3GTL H;  1KQS A;  3OWF A;  5AJ3 Q;  1VQF A;  4DV6 Q;  1WD0 A;  4HIO A;  1TWC H;  4QJF A;  3IAY A;  4L6T B;  5I6W A;  4LJZ C;  3J7Y W;  2F1M A;  1PA6 A;  4C2M H;  3KDF B;  4KKS A;  3NTH A;  2WIN B;  3F2U A;  3GTG H;  2EE1 A;  3A54 A;  4NKL A;  5D65 A;  4A4I A;  1SEB D;  3HZX A;  1FJG L;  1V1P B;  1AH9 A;  4EX5 A;  3L2P A;  4A3I H;  4RGN A;  3HOU B;  4HAE A;  4PZ7 A;  3M9B A;  2NVX H;  1KAA A;  5FJ8 G;  3HKS A;  1EIF A;  4DV0 L;  2A69 C;  1QVC A;  1A15 A;  2JE6 I;  4A3F H;  2HT1 A;  5LMU Q;  3HOY G;  3PO2 H;  5LL6 X;  1Y1W B;  1F9P A;  2GVA A;  2IHE A;  1NUC A;  1D7Q A;  5HGT A;  1KIX A;  4OO1 H;  3HKZ E;  5C44 G;  1UWV A;  3CCU A;  2OWO A;  2OQK A;  4CDE C;  2O5I C;  4CJ2 C;  2HIX A;  1N33 L;  5J39 A;  2EXD A;  3I55 A;  4DV4 L;  4DNT B;  5IIF A;  3GTQ B;  2CQO A;  3KLS X;  5ELO A;  4ZQ3 A;  1C0A A;  3F2D A;  3AQQ A;  1LO5 D;  5FK9 C;  5FO7 B;  3U50 C;  3J80 E;  1MIU A;  2OT2 A;  4PG3 A;  1E2V A;  5CV8 A;  2B2Y C;  2D2C C;  3KBG A;  2EVB A;  3VR6 A;  4ME5 A;  4UPA A;  1D6E C;  1R9T H;  1TQO A;  1RF2 D;  4QIW B;  4LK1 C;  4JI5 L;  3CCE A;  4BXX G;  2NZH A;  2A1A A;  1JJC B;  4Y7N H;  2L12 A;  3SDZ A;  1PTO D;  4DUY L;  3PMF A;  5BR8 Q;  2Z1C A;  1K83 H;  3SE0 A;  1HNZ L;  3H0G H;  3ULP A;  1D2B A;  1EQT A;  4JPB W;  5DM6 3;  1EWH A;  2KHI A;  1SAP A;  1WYD A;  4EQ5 A;  4IUP A;  3FP9 A;  1LTR D;  1F2Y A;  5KRU A;  1MJE A;  1FNU A;  2ICI A;  1TR5 A;  2JYO A;  4QGU A;  4ZAI A;  3GTM H;  4RHR A;  1KD1 C;  1BR9 A;  2KCM A;  4FYD A;  5CR3 A;  3JAM E;  1EQV A;  3I2Z A;  1SR3 A;  4LAA A;  3CQZ H;  4YCW A;  1QIL A;  4Q0F A;  1V1O A;  3GTP H;  3X3N A;  1EOV A;  2ZTE A;  5KEE A;  2Z4H A;  1K8A C;  2ASB A;  3CCS A;  4OON A;  4A93 G;  2YTY A;  2UU9 Q;  1TWF B;  2K14 A;  2NYZ D;  4KKT A;  4JOI C;  2CVR A;  5LMN W;  2UUC Q;  3HOX G;  2A5H A;  4GNX C;  2JK8 A;  3MVV A;  4RGM A;  1T9H A;  5E7N A;  4EQO A;  1PFB A;  4BBR H;  4DR1 Q;  4HIK A;  1RL2 A;  1K73 C;  1CZG A;  2QW7 A;  1JJ2 A;  4TSS A;  1NE3 A;  3A7L A;  3DEO A;  2VQE Q;  1PLF A;  3ERS X;  4X64 L;  3FHW A;  1ZYR C;  4RWS C;  2NVT H;  4JI1 L;  5ELB A;  4LF7 Q;  2B3G A;  1X56 A;  1FVI A;  3DXJ C;  1SSO A;  2RDF A;  3GO5 A;  3M4P A;  3F2C A;  1QZG A;  2B63 H;  4NXM L;  2R3Z A;  1CHP D;  3SK8 A;  4HSV A;  2JA5 H;  1W6K A;  1F9S A;  1S5D D;  5M5Y H;  3K0X A;  2WB1 E;  4OIJ A;  4R1J A;  2DNE A;  1SMY C;  3U9O A;  3H09 A;  1NJI C;  1EY8 A;  2MGS A;  1F77 A;  1Q3L A;  5EJW A;  4DV0 Q;  4UHV A;  4LFC L;  2HQL A;  4HED A;  4LUZ A;  1Q82 C;  2K5Q A;  2ZM6 L;  1FGB D;  3M4Q A;  2BCO A;  1CKO A;  3S2D B;  1D5X C;  3OMG A;  5EPL A;  3W5O A;  2VW9 A;  5EKL A;  3G6E A;  2RHQ B;  2CQA A;  1KAW A;  1TT2 A;  2L9H A;  3HOV H;  4LFA Q;  4DV7 L;  3EQL C;  2Q2H A;  1CKN A;  1ASZ A;  4R4O A;  5DM7 3;  3C1F A;  3CXC A;  2MHV A;  1M90 C;  3HGB A;  1HR0 W;  1OXU A;  4ZLT F;  3U4Z A;  4MTK A;  4CKE A;  4GS3 A;  1KDA A;  1TWH B;  2ICE C;  3IKJ A;  1STY A;  2EY2 A;  1STG A;  1WTP A;  2FXQ A;  1ML0 D;  1E7Z A;  3CKI B;  1WCM B;  2UUA Q;  2X69 A;  3HOU H;  1ZKO A;  2UXC L;  3BYT B;  4KTA A;  3HKZ B;  3P75 A;  4JI5 Q;  4NXN L;  4B08 A;  1EZ6 A;  2F52 A;  2RCF A;  2QF7 A;  1IKM A;  4WRD A;  1N36 L;  2QCP X;  1OXX K;  1TII D;  2DJG C;  1LT3 D;  4K0K L;  2WAC A;  1MKH A;  3ICE A;  3T1H L;  3HEJ A;  5C0X G;  2F4V Q;  2K01 A;  1QWY A;  1YNN D;  2D9U A;  4PQX A;  4RFB A;  2J7Z A;  2K50 A;  3T13 A;  2CW0 C;  1TWG H;  5KIX A;  3J81 c;  1VQO A;  2JA8 B;  2DY7 A;  3CCM A;  4XQJ A;  1SE3 A;  3KLS A;  2K4K A;  3BU2 A;  4EQP A;  1OO9 B;  2AKW B;  3GTQ H;  2KCT A;  5EQ0 A;  4B9X A;  2Y0S B;  2P5Z X;  1SDF A;  4IQZ A;  2IX3 A;  4LF4 Q;  5FLM H;  3M4O H;  4DR7 Q;  5CBA E;  3RZD B;  2AUK A;  3D0F A;  3J80 c;  5C4J B;  2JA7 B;  4A3I G;  4DR5 L;  3QJY A;  4G4K A;  3DMU A;  4I65 A;  1OTC A;  2R92 H;  3S1R B;  4F88 A;  1LTL A;  1ET6 A;  1VQN A;  4OO1 I;  4A3F G;  4B3R Q;  2QIL A;  4DUZ Q;  2KBN A;  3PO2 G;  3MTS A;  4B3S L;  2NZ1 D;  4IPD A;  5KNB A;  2PQA B;  4X6A H;  2B2Y A;  1KHI A;  4OWX B;  2L4N A;  4OO1 G;  3SGI A;  1VQC A;  1VQH A;  4ULL A;  5AFW A;  3I8Z A;  1ASY A;  2BOS A;  2KEN A;  1RDP D;  5M3M G;  1MGS A;  1XPR A;  4AYB E;  3CMA A;  4KHP Q;  4FXK C;  1GUW A;  3HS0 C;  1C7Y A;  3R93 A;  5IYB H;  2BH8 A;  2HCI A;  1YBY A;  3CU7 A;  4K6D A;  1EFW A;  1TWF H;  2ENB A;  5ELE A;  1H9S A;  2DY8 A;  5ELC A;  5C3E G;  1FD7 D;  3QR8 A;  1YHB A;  4JI8 L;  3T16 A;  1II3 A;  5IGF A;  4L5Q A;  3I72 A;  3FDT A;  5GAE C;  3CD6 A;  5IP7 G;  4R4C A;  4XDX A;  4GLX A;  1BKB A;  4OWW B;  1WTX A;  4GLV B;  3I4L A;  1Q1B A;  1NY4 A;  2CWP A;  4HSP A;  4A3L H;  4IJH A;  2N88 A;  2VXW A;  5M3F G;  4J1M A;  4DR2 Q;  4JBW A;  2A8V A;  3H0G G;  1S5C D;  1X54 A;  2WB1 B;  4JOI A;  5KGU A;  2NN6 G;  4MN3 A;  3PCO B;  3PF5 A;  1JMC A;  2IW3 A;  4RHS A;  4GNX A;  3KUP A;  5HGQ A;  3HOZ H;  2RHS B;  3AMU A;  3OW7 A;  2F0D A;  3PIP A;  5M5W B;  2EYO A;  2F0V A;  4IPC A;  4CKC A;  4K2L A;  3NBH A;  1KTK A;  5JVG 3;  5G3L D;  4OHJ A;  1G2T A;  3PF4 A;  4R8I A;  3OTO L;  4NPS A;  4GZY C;  4A3K B;  3EJI A;  1KL9 A;  3CP0 A;  3A5Z B;  4RKB A;  1DZ1 A;  1EQQ A;  3PUV A;  1XNQ L;  3W1B A;  3TP5 A;  3DWQ A;  3G7L A;  1JB7 A;  5C0X J;  4IAL A;  4GKJ Q;  1WJJ A;  3BDO A;  4GNX B;  1XMO L;  3K57 A;  3A5U A;  4K6L A;  3MXN A;  4BBR G;  3OOC A;  3S1N B;  1FR3 A;  3VR2 A;  3T56 B;  1PRT C;  3KFU A;  1Q46 A;  2Q2I A;  1LT6 D;  4JI4 L;  1H9R A;  3H91 A;  5GQO A;  3SK6 A;  2HIV A;  5I6Y A;  5C3W A;  4LNQ A;  3GTJ B;  4KKU A;  2PZU A;  1XNR L;  4IPH A;  3S24 A;  1PH4 A;  1F2M A;  2B63 G;  1PFM A;  5FLX L;  3U58 A;  1NMF A;  2WKD A;  1HUM A;  1ESF A;  4IOC A;  3MC0 B;  2E76 C;  3PO3 B;  2IJ0 A;  3U4V A;  4KY7 A;  2Q2U A;  4DV5 Q;  1VQM A;  1PH6 A;  5E3F A;  1HNW Q;  4OEL B;  3NEL A;  1PH1 A;  1HFG A;  5LL6 S;  1TVX A;  4X3K A;  1BBW A;  2ZJP A;  4JV5 Q;  1QB5 D;  4R4I A;  1Z6H A;  5IYD H;  2J4X A;  4YHH Q;  1TU2 B;  2E75 C;  4GOP C;  2RSN A;  3Q8D A;  4LF9 Q;  4AIM A;  1IW7 D;  2EYH A;  2C9O A;  5EGT A;  1QJO A;  5AJ3 L;  1FYC A;  4DV6 L;  2JA8 H;  4XTC S;  2F0P A;  2F0M A;  2BE5 D;  4QUC A;  1W2B A;  1BCP F;  3HOV G;  3HRZ C;  3J81 i;  1YHA A;  1O80 A;  2EY1 A;  5JJK A;  2F0K A;  1T5E A;  3BDL A;  1A2T A;  1UEB A;  4XQN A;  1VS0 A;  3MXG A;  1JC7 A;  3FEW X;  4DU9 A;  1VQ6 A;  4YWM A;  3PGZ A;  2VUM B;  1HPC A;  2D62 A;  2SNS A;  3RZD H;  3SEB A;  3A56 A;  2F0W A;  1U4R A;  3I4M H;  3NTI A;  1M4V A;  2JA7 H;  3HOW B;  3TN2 A;  4L8J A;  4BY1 B;  2R7Z G;  3J80 i;  4BA2 I;  2A6E D;  3A8J E;  3QWN A;  5KND A;  1TS3 A;  4JI8 Q;  1F9R A;  1HTL D;  3PUZ A;  1IBK Q;  4ILW A;  1EY9 A;  2BA0 A;  4BWG B;  3BZK A;  1DOL A;  2YTX A;  5LMU L;  2CH4 W;  1ESR A;  2PMZ E;  4L5S A;  1JOR A;  1VQL A;  3KK7 A;  2L0C A;  1JWM D;  2K04 A;  5E4W C;  4ZUJ A;  4BY7 B;  1HZA A;  3GTK B;  2KVM A;  1EZ8 A;  1A62 A;  3ND8 A;  1B50 A;  2SNM A;  4AYB B;  4KHV A;  2VB3 X;  5IWA Q;  2OEO A;  3I4N H;  4A3J B;  1CM9 A;  1SE8 A;  3RR5 A;  1STA A;  1X3G A;  4ZRZ A;  3CW2 C;  1PYW D;  2O4X A;  3CPW A;  1EEI D;  1KRS A;  2F0H A;  4B3T Q;  3D4D A;  4C3I B;  4POF A;  3Q0A A;  2VZA A;  2R93 B;  4DR4 Q;  2WAQ E;  4J8Q A;  1E2W A;  3OTO Q;  4JI0 Q;  5FLM G;  1A8V A;  2B39 A;  4PZ8 A;  4BBS B;  5M5X B;  2RQX A;  2QDB A;  3TS0 A;  2XNA C;  1DM0 B;  2A68 C;  3IFT A;  4JI3 Q;  1BF4 A;  4HJ5 A;  1NR2 A;  3PIO 3;  1EY7 A;  3G71 A;  4G7O C;  1O7Z A;  2ZT9 C;  2R92 G;  4MIU A;  4NMZ A;  2O5J C;  2QDL A;  4MZ9 A;  2KEC A;  1PH5 A;  2ES2 A;  4A3E B;  1Y1V B;  1XMO Q;  5M9O A;  5JPM C;  2LXK A;  1ZXT A;  2E2I B;  2B2U C;  4DK6 C;  2F0O A;  5I9P A;  1ENF A;  1RHP A;  5COY A;  3C3L A;  4ZUI A;  4YWL A;  5CV9 A;  5M5W H;  5EBD A;  2K5V A;  4ME3 A;  2ATW A;  1HZB A;  1QUQ A;  1E0B A;  4G57 A;  5JAV A;  1HRJ A;  2F0S A;  1BDO A;  2F03 A;  2MUY A;  5J1Z A;  1KNE A;  4C3H B;  1Y8P B;  4KN7 C;  3DHQ A;  1BCP C;  3UDG A;  1GHK A;  2RVL A;  2YU9 H;  4QB4 A;  2DN8 A;  3EVQ A;  2K32 A;  3WDN A;  4K14 A;  1JR0 D;  1ZEQ X;  4UY8 C;  1S5B D;  4QF4 A;  1ICW A;  3CRL C;  2PW7 A;  1AW7 A;  4X65 Q;  4DA2 A;  2K5D A;  4IZ8 A;  2E74 C;  4DR1 L;  4RMF A;  3AU7 A;  1SYG A;  3S1N H;  1E1T A;  4A3L G;  3I90 A;  3P1H A;  1QUQ B;  4KI0 A;  4KMU C;  2NVQ H;  3SK5 A;  2VQE L;  2RBM A;  1SMX A;  2AQ1 B;  4LF7 L;  2B8F A;  5CV5 A;  3K5M A;  1KDB A;  3GTJ H;  5C4X B;  4DV3 Q;  1JWS D;  3U9S A;  3HOZ G;  1UE1 A;  4OIK A;  3H6M A;  3TZD A;  2QA4 A;  2SOB A;  3EN2 A;  4IFD H;  1BUV T;  1E3P A;  3PO3 H;  4CDD C;  5K36 H;  4RG1 A;  3S17 B;  2JEA I;  4HID A;  2FMC A;  1GHJ A;  2KQ3 A;  3R8B A;  2OQ0 A;  4ZK9 B;  1WD1 A;  1HQM C;  4JI2 Q;  2L15 A;  2HDL A;  3ONA B;  2Z8L A;  2E2J B;  3LX0 A;  2B2V C;  2KED A;  1BBU A;  4RCN A;  5KYI A;  4A3M B;  1NNX A;  4C3J B;  4OEM B;  4G7H C;  5CMD A;  5JVH 3;  4LFA L;  3VR5 A;  1NMG A;  3S14 B;  1AP0 A;  1S72 A;  1G8Z D;  1YIT A;  2D0P A;  4O2D A;  3MFY A;  1V1Q A;  3RLF A;  4M8A A;  1HZ9 A;  2EJM A;  5JOB A;  3J7A F;  1NAP A;  1I50 B;  2EY6 A;  4PV1 C;  1PZJ D;  1SND A;  5LHY 1;  2MNA A;  4GOP A;  3CCJ A;  2SEB D;  1PYS B;  2RSO A;  3CCQ A;  1PRT B;  4PMB A;  2PNR C;  2Z6K C;  1CT1 D;  4CKB A;  4Z9C B;  2PMZ B;  5GAD C;  2EJF C;  2UUA L;  1GUG A;  1X3F A;  4A3G B;  5FLX E;  4B9W A;  5GRO A;  2OCE A;  1QZH A;  2WFW A;  5E4X A;  3MZ5 A;  2Z0S A;  1IYJ B;  3TP8 A;  1LTA D;  2EDG A;  2MP1 A;  4X62 Q;  4CBV A;  1WTR A;  2F0L A;  2L55 A;  4KLK A;  3GTK H;  2F4V L;  5IYD G;  3K59 A;  1L2F A;  1S4Z A;  3MFG A;  1DCZ A;  2WAQ B;  1Q8I A;  4JCV E;  4A3J H;  4DV1 Q;  1AZP A;  1K28 A;  1TKW B;  2L5T A;  4GOP B;  2K03 A;  4U68 A;  4RKL A;  5LMN L;  1A63 A;  1U4M A;  1GUS A;  3K5O A;  1KLG D;  4QQB X;  3FKI H;  1FNV A;  1VQ9 A;  3KLR A;  1V43 A;  2R93 H;  1GUT A;  1H95 A;  1VQ7 A;  2Y0S G;  4DGZ A;  4A3D B;  4LF4 L;  1LLR D;  4OGQ C;  1I6V C;  4DR7 L;  4BBS H;  1IBM L;  5M5X H;  1B9M A;  1CUK A;  5IGG A;  3KBX A;  4JI7 Q;  3CF5 A;  2JA7 G;  3I4M G;  1QE6 A;  2Z6B A;  1SE4 A;  3J7Z C;  3RN5 A;  2N55 A;  2R7F A;  1IL8 A;  4I7Z C;  1FGU A;  3UDI A;  2JA9 A;  2XN9 C;  3K7A H;  4KV6 A;  1J6Q A;  4B3R L;  1QNK A;  5HUR A;  4DUZ L;  3RZO B;  1L1O C;  3A55 A;  1Y1V H;  4NP5 A;  1VQD A;  4A3E H;  1KXL A;  4IUU A;  5I2X A;  2WP8 J;  2E2I H;  4PMC A;  1EIG A;  2OXP A;  4JBM A;  3DWA A;  5EAY A;  4ID6 A;  1DJR D;  3D4W A;  1VQJ A;  3MXU A;  1PXU A;  2K6A A;  3I4N G;  1HCZ A;  2F0U A;  1GOZ A;  5IT9 E;  3UI2 A;  1QNU A;  4R9W A;  2UXD Q;  1Z9F A;  1SMY D;  5CGK A;  1TWA H;  4P71 A;  4DNR B;  4LUV A;  1EU3 A;  3K7U C;  4KHP L; 
#chains in the Genus database with same CATH homology
 1PH2 A;  3S2H H;  4LWC A;  2IY5 B;  3CMA A;  3J81 j;  4KHP Q;  2EQS A;  3CC2 A;  4HJ9 A;  1EYG A;  1C7Y A;  1KC8 C;  4A75 A;  2ZTD A;  1EWI A;  2BH8 A;  1YBY A;  5IYB H;  1EFW A;  4YWK A;  3I56 A;  1TWF H;  2IHF A;  4IJL A;  4PZ6 A;  5C3E G;  2N49 A;  4A3M G;  1PH7 A;  3F8T A;  1YEZ A;  4YY3 L;  1YHB A;  1D8L A;  2EIF A;  4JI8 L;  4L5Q A;  4YY3 Q;  3HOX H;  4ALP A;  1Q86 C;  3H3V I;  1SRU A;  5GAE C;  3CD6 A;  5IP7 G;  4R4C A;  4GLX A;  4A3B G;  1BKB A;  4OWW B;  1OXV A;  1X3E A;  4GLV B;  1Q1B A;  3K81 C;  1G51 A;  1NY4 A;  2CWP A;  5IE8 A;  5IY0 A;  1GKH A;  3TRZ A;  4DR2 L;  4DR6 L;  4A3L H;  4IJH A;  3CME A;  2K5N A;  4PMW A;  2E8G A;  5M3F G;  4P72 A;  1B8A A;  4JBW A;  4DR2 Q;  2A8V A;  2VUM H;  3H0G G;  3ZJY C;  1X54 A;  4JOI A;  2HHH Q;  2NN6 G;  1VQ5 A;  4JBK A;  3PCO B;  3PF5 A;  1JMC A;  4GNX A;  4XIG S;  4A3G G;  3HOW H;  5HGQ A;  3HOZ H;  1G6P A;  3G4S A;  2RHS B;  1WCM G;  1XMQ L;  4BY1 H;  3PIP A;  1U5K A;  3PUY A;  4MNO A;  3RNU A;  4LF8 L;  1EIY B;  1VQA A;  3HKZ G;  4IPC A;  1XMQ Q;  2LSS A;  1YHQ A;  2KHJ A;  5M3M H;  5IYC H;  4LF8 Q;  3S16 H;  2GVB A;  4NB3 A;  5ELN A;  3PF4 A;  3OTO L;  4NPS A;  1CKM A;  5JJL A;  1KL9 A;  2UXB L;  3CP0 A;  1UE5 A;  2VQF L;  1K9M C;  4A76 A;  3MEF A;  3A5Z B;  3TRE A;  4BY7 H;  2QGQ A;  1Y1W H;  3B6Y A;  1A0I A;  1CSP A;  4JI6 L;  2UXB Q;  2WAQ G;  1FL0 A;  2VQF Q;  1CSQ A;  1Q1E A;  1I6H H;  1GO3 E;  5C3E H;  1QVG A;  4JI6 Q;  1EQQ A;  4TQU S;  3PUV A;  4TVA B;  1XNQ L;  3W1B A;  4GKK Q;  3G48 A;  2JA8 G;  4GKJ L;  2PI2 E;  1JB7 A;  3A74 A;  2Y0S E;  4LUO A;  3ULJ A;  1PH8 A;  5DLQ E;  1QVF A;  1XNQ Q;  2BH2 A;  3BZC A;  5C0X J;  1PVO A;  1UE7 A;  5IP7 H;  4A3B H;  4GKJ Q;  1WJJ A;  4C3I H;  4GNX B;  5LMN Q;  1XMO L;  3A5U A;  1NTG A;  4A3D G;  4BBR G;  2ID0 A;  2PQA A;  1AE2 A;  3KJO A;  3S15 H;  5BR8 L;  3F1Z A;  3KFU A;  1Q46 A;  4DPG A;  1JJG A;  2Q2I A;  3PIO A;  4GN4 B;  2OTL A;  4IFD I;  5M3F H;  4JI4 L;  5GQO A;  2HIV A;  1WOC A;  1XPO A;  1PFS A;  2MO0 A;  4LNQ A;  2I5M X;  1IL2 A;  4AH6 A;  3TQY A;  3DLL A;  4JG2 A;  4JI4 Q;  1IBM Q;  1XNR L;  4IPH A;  3S24 A;  1PH4 A;  1IXR A;  3EBE A;  2B63 G;  3HFZ B;  2B29 A;  4DNI A;  4IFD G;  1X55 A;  3U58 A;  1XNR Q;  1NMF A;  4DV5 L;  1HNW L;  4IOC A;  3KDF A;  1I3Q H;  3BJU A;  3EIV A;  3U4V A;  1HNW Q;  2K75 A;  4DV5 Q;  1VQM A;  3GDE A;  3PUX A;  1PH6 A;  2Q2U A;  4JV5 L;  3NEL A;  1PH1 A;  4WJ3 M;  3CPF A;  3KYH C;  2DGY A;  3STB C;  2UU9 L;  1SLJ A;  1EQR A;  1BBW A;  1JE5 A;  3KF6 A;  2ZJP A;  4JV5 Q;  1WFQ A;  4R4I A;  4A3C G;  1K3R A;  4YHH L;  2Z6K A;  4OWT B;  3PV0 A;  1I94 L;  1VQB A;  2CKZ B;  1P16 A;  4LF9 L;  5IYD H;  4L5R C;  1LYL A;  4YHH Q;  2ZJR A;  4GOP C;  3DM3 A;  2UUC L;  1HZC A;  1I94 Q;  5IP9 G;  2RF4 A;  1S3O A;  3Q8D A;  4LF9 Q;  1S40 A;  3ULL A;  4AIM A;  2F3I A;  3K80 C;  4P74 A;  4OX9 L;  1HJP A;  3AFQ A;  5AJ3 L;  4DV6 L;  1JT8 A;  2BA1 A;  1XPU A;  4O0A A;  2JA8 H;  4XTC S;  3D31 A;  2YTV A;  4OX9 Q;  1VQE A;  2CWA A;  3CAM A;  3CCR A;  3GTL H;  1W2B A;  4R4Q A;  5AJ3 Q;  1VQF A;  4DV6 Q;  1KQS A;  3HOV G;  3J81 i;  4IO9 A;  1YHA A;  4HIO A;  1TWC H;  5JJK A;  4QJF A;  2JA6 G;  4C3H H;  2ZJQ A;  1Y14 B;  1UEB A;  2I5L X;  1VS0 A;  2VY3 A;  4HJ7 A;  4IPG A;  4C2M H;  4HJA A;  1PA6 A;  3JAM c;  3KDF B;  4UP9 A;  1HR0 L;  1VQ6 A;  4YWM A;  3PGZ A;  4X66 L;  3GTG H;  2D62 A;  2N8N A;  4POG A;  1RIP A;  3RZD H;  1HR0 Q;  4A4I A;  1FJG L;  3KF6 B;  4X66 Q;  3K8A A;  1B70 B;  2MQH A;  2CCZ A;  3I4M H;  2JA7 H;  1AH9 A;  3UE1 A;  4EX5 A;  3L2P A;  2QEX A;  1FJG Q;  2R7Z G;  3J80 i;  4A3I H;  4BA2 I;  2IX0 A;  1IBK L;  2ZTC A;  1VQG A;  4JI8 Q;  1GM5 A;  4PZ7 A;  3PUZ A;  2CFM A;  1IBK Q;  3RZO H;  2A19 A;  3M9B A;  2BA0 A;  2NVX H;  1YZ6 A;  5FJ8 G;  3HKS A;  3BZK A;  1EIF A;  2YTX A;  3OYY A;  5LMU L;  1DGS A;  4DV0 L;  1QVC A;  1XJV A;  2JE6 I;  2PMZ E;  4A3F H;  4B3M L;  4L5S A;  2HT1 A;  1VQL A;  5LMU Q;  3HOY G;  3PO2 H;  1HZA A;  2WB1 G;  5IWA L;  2GVA A;  4DR6 Q;  1EUJ A;  2IT1 A;  1A62 A;  4B3M Q;  2RCN A;  4A3J G;  5C4X H;  2IHE A;  5IWA Q;  3RN2 A;  3I4N H;  1D7Q A;  3AFP A;  1KIX A;  3HKZ E;  1SE8 A;  1UWV A;  4YCV A;  5C44 G;  3RR5 A;  3CCU A;  2OWO A;  1Q81 C;  4UP8 A;  2OQK A;  2H5X A;  1X3G A;  4IOA A;  4B3T L;  5IT9 c;  3FKI G;  2N78 A;  3CW2 C;  1PV4 A;  3CPW A;  1KRS A;  3S17 H;  4DR4 L;  1L1O A;  2HIX A;  2VL6 A;  4B3T Q;  1N33 L;  4POF A;  3A0J A;  2VZA A;  2EXD A;  4A3K G;  3I55 A;  4OXP A;  4DR4 Q;  4YCU A;  4DV4 L;  1B7Y B;  4JI0 L;  2WAQ E;  1N33 Q;  2VNU D;  2CQO A;  5ELO A;  1E24 A;  3OTO Q;  4JI0 Q;  4DV4 Q;  5FLM G;  1YIJ A;  2N3S A;  1MJC A;  1C0A A;  1A8V A;  3F2D A;  1O7I A;  1X6O A;  4PZ8 A;  3AQQ A;  1VQ4 A;  2E2J H;  1M1K C;  3U50 C;  1KRT A;  3TS0 A;  1MIU A;  4JI3 L;  3CCV A;  4PG3 A;  4JYA L;  3CC7 A;  1LM0 A;  4DAM A;  4A3M H;  3S2D H;  4C3J H;  2PNH A;  4JI3 Q;  2PI2 A;  3L7Z C;  4L5T A;  4UPA A;  4HJ5 A;  1R9T H;  2K52 A;  2K5H A;  2R7Z H;  3M85 A;  3TS2 A;  4JYA Q;  4JI5 L;  3CCE A;  4QY7 A;  3G71 A;  4BXX G;  1N8R C;  2R92 G;  3S14 H;  1LUZ A;  3KOJ A;  2NZH A;  3RLO A;  5C0X I;  1K0R A;  1PH3 A;  2A1A A;  3KJP A;  1JJC B;  3F2B A;  4MZ9 A;  4Y7N H;  1U0L A;  1YJN A;  1PH5 A;  3CCL A;  3J7A 5;  1I50 H;  1XMO Q;  2ES2 A;  3LGJ A;  3H3V H;  2LXK A;  1GD7 A;  1L1O B;  3NEN A;  4DUY L;  5BR8 Q;  1TWH H;  4DK6 C;  1K83 H;  1HNZ L;  1CKN B;  3H0G H;  3ULP A;  4DUY Q;  5JJI A;  4YWL A;  2KHI A;  1HNZ Q;  5M5W H;  2K5V A;  1WYD A;  1Z47 A;  4EQ5 A;  4A3G H;  4ME3 A;  2ATW A;  1HZB A;  3FP9 A;  1QUQ A;  1WCM H;  1MJE A;  1YJW A;  3PO3 G;  5K36 G;  1OXS C;  2XTI A;  4LF5 L;  5FLX c;  4QGU A;  4HIM A;  2JA5 G;  3OW2 A;  3GTM H;  1KD1 C;  2KCM A;  5GAG C;  1G29 1;  4LF5 Q;  3I2Z A;  1SR3 A;  3CQZ H;  4YCW A;  1WI5 A;  1YVC A;  3GTP H;  1EOV A;  2ZTE A;  1K8A C;  4QL5 A;  3UDG A;  2ASB A;  3CCS A;  2OTJ A;  4OON A;  4A93 G;  2YTY A;  2UU9 Q;  2YU9 H;  4WJ4 A;  4AYB E;  2K14 A;  4JOI C;  4X65 L;  4UY8 C;  5LMN W;  2AMC B;  2UUC Q;  3HOX G;  4GNX C;  1IZ6 A;  1J5E L;  2JK8 A;  4X65 Q;  4BXX H;  1VQI A;  1T9H A;  2E2H H;  4DR1 L;  1J5E Q;  4RMF A;  5E7N A;  3S1N H;  4JBJ A;  3GD7 A;  1E1T A;  4A3L G;  4A3D H;  4BBR H;  4DR1 Q;  4KI0 A;  1QUQ B;  4HJ8 A;  4HIK A;  2NVQ H;  4KHZ A;  2I0Q A;  1RL2 A;  2VQE L;  1K73 C;  3ER0 A;  2VUM G;  2I5H A;  1JJ2 A;  1PHJ A;  4DV3 L;  1C9O A;  1SMX A;  1NE3 A;  5JEA G;  4LF7 L;  1N9W A;  2VQE Q;  4DKA C;  3ERS X;  3W1G A;  4X64 L;  3FHW A;  3JC6 6;  1XTD A;  3GTJ H;  1E22 A;  4DV3 Q;  4DV2 L;  2NVT H;  3HOW G;  4JI1 L;  4LF7 Q;  3HOZ G;  1UE1 A;  2B3G A;  4BY1 G;  4X64 Q;  1X56 A;  1FVI A;  2NVY H;  5C4J H;  2QA4 A;  3GO5 A;  3EN2 A;  3M4P A;  4UP7 A;  4JI1 Q;  3F2C A;  1QZG A;  4NXM L;  1E3P A;  4J15 A;  1AE3 A;  2B63 H;  3PO3 H;  2D0O A;  3HOU G;  4RG1 A;  5IYC G;  1YNX A;  4DAY B;  4NXM Q;  2JA5 H;  3RLN A;  5M5Y H;  3S1R H;  2JEA I;  4HID A;  4JI2 L;  2R6G A;  2WB1 E;  2OQ0 A;  3K0X A;  4R1J A;  2R7D A;  1TXY A;  1PH9 A;  1NJI C;  4BY7 G;  4JI2 Q;  1Y1W G;  2L15 A;  4A3C H;  2IX1 A;  4DV0 Q;  4AYB G;  2UUB L;  3PUW A;  3WWV A;  4A93 H;  2DUD A;  4LFC L;  2HQL A;  4LUZ A;  1Q82 C;  1IBL L;  1VCI A;  3L0O A;  1BBU A;  2UUB Q;  5IP9 H;  2ZM6 L;  2Q2T A;  5J3B A;  1BVS A;  3M4Q A;  4LFC Q;  2YYZ A;  1CKO A;  4DK3 C;  1YI2 A;  1IBL Q;  3W5O A;  2VW9 A;  2ZM6 Q;  3G6E A;  2RHQ B;  1KAW A;  4LFA L;  3CC4 A;  1NMG A;  3H15 A;  1S72 A;  1YIT A;  2D0P A;  4O2D A;  3HOV H;  1P8L A;  3GTO H;  2R93 G;  1V1Q A;  4LFA Q;  2NN6 I;  4DV7 L;  3RLF A;  1SN8 A;  2Q2H A;  1HZ9 A;  2JA6 H;  1V9P A;  3E9H A;  1CKN A;  4LFB L;  1ASZ A;  2VS1 A;  4R4O A;  3CXC A;  4DV7 Q;  2HHH L;  1X65 A;  1M90 C;  1HR0 W;  2MNA A;  1OXU A;  4GOP A;  4LFB Q;  4BBS G;  3AEV A;  3IRB A;  3U4Z A;  3CCJ A;  2MO1 A;  1PYS B;  3CCQ A;  1N34 L;  4GS3 A;  3JAM i;  4QIW E;  1N32 L;  2Z6K C;  4P75 A;  1N34 Q;  5H1S E;  5GAD C;  3I4O A;  2UUA L;  1N32 Q;  3E0E A;  3TEH B;  1OXT A;  1X3F A;  2FXQ A;  1E7Z A;  2YV5 A;  5GRO A;  1VQK A;  2OCE A;  2UUA Q;  1QZH A;  4R4T A;  2WFW A;  3HOU H;  3S1M H;  2UXC L;  1W3S A;  4MTN A;  4P73 A;  4LF6 L;  4X62 L;  1HH2 P;  2Z0S A;  1HNX L;  2UXC Q;  4JI5 Q;  4NXN L;  1IYJ B;  4A3E G;  1Y1V G;  2F52 A;  5FJ8 H;  4Y52 H;  4LF6 Q;  4X62 Q;  1Q7Y C;  1N36 L;  4GN5 A;  1OXX K;  1HNX Q;  4KLK A;  4NXN Q;  4K0K L;  2JQO A;  3GTK H;  2F4V L;  5IYD G;  1MKH A;  4DV1 L;  1N36 Q;  3ICE A;  5HY6 A;  1L2F A;  3T1H L;  3HOY H;  5C0X G;  4K0K Q;  4GKK L;  1E1O A;  2F4V Q;  4JCV E;  4A3J H;  1PYB A;  4DV1 Q;  3T1H Q;  3E9I A;  4GOP B;  1VQP A;  5C44 H;  2AHO B;  2K50 A;  4APV A;  5LMN L;  1A63 A;  1TWG H;  3J81 c;  1VQO A;  4QQB X;  3FKI H;  1VQ9 A;  3AYH B;  3KLW A;  3CCM A;  1SRO A;  3STB D;  1V43 A;  4BA1 I;  2LXJ A;  2R93 H;  1H95 A;  1VQ7 A;  2Y0S G;  2K4K A;  3BU2 A;  4A3K H;  3S1Q H;  2AKW B;  3GTQ H;  4LF4 L;  2KCT A;  2NZO A;  4IFD J;  3UE0 A;  3NBH B;  4DR7 L;  2E5L L;  3KF8 B;  3M3Y H;  4BBS H;  4LW1 A;  1IBM L;  4JI7 L;  4LF4 Q;  5M5X H;  5IYB G;  5FLM H;  1CUK A;  3M4O H;  4DR7 Q;  2E5L Q;  1VQ8 A;  4JI7 Q;  3CF5 A;  2JA7 G;  4DR3 L;  3I4M G;  3J7Z C;  3RN5 A;  3D0F A;  3J80 c;  4AQY L;  1UE6 A;  2R7F A;  3NEM A;  2V1C C;  1Q12 A;  4DR5 L;  3I7F A;  5GAH C;  4DR3 Q;  2MFI A;  4A3I G;  1K8G A;  1FGU A;  3UDI A;  2JA9 A;  4H02 A;  4AQY Q;  2C35 B;  3VDY A;  3K7A H;  1SFO H;  4GN3 B;  4DR5 Q;  1J6Q A;  1OTC A;  2R92 H;  4B3R L;  4FDB A;  4DUZ L;  1L1O C;  1LTL A;  3UDF A;  1Y1V H;  4A3E H;  1VQD A;  1VQN A;  1KXL A;  4OO1 I;  4A3F G;  2AWN A;  2WP8 J;  4B3R Q;  4DUZ Q;  2KBN A;  2E2I H;  3PO2 G;  1GVP A;  4B3S L;  4JBM A;  5EAY A;  3MXN B;  4IPD A;  5C4X G;  2PQA B;  4X6A H;  1L0W A;  1VQJ A;  3T1Y L;  1KHI A;  4OWX B;  4B3S Q;  4GLA C;  3I4N G;  3M7N A;  1X9N A;  3SGI A;  4OO1 G;  1VQC A;  2ALY B;  1VQH A;  3T1Y Q;  3UDX A;  2XGT A;  4JC0 A;  2UXD L;  1YJ9 A;  4DV2 Q;  1I5F A;  2JJQ A;  1NBW A;  2JEB I;  1ASY A;  2KEN A;  5JEA J;  2UXD Q;  1Z9F A;  3PSI A;  5M3M G;  1TWA H;  4P71 A;  2GN5 A;  4LUV A;  1XPR A;  3K7U C;  4KHP L;  2AWO A;  1Q8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...