1EYGA

Crystal structure of chymotryptic fragment of e. coli ssb bound to two 35-mer single strand dnas
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
112
structure length
112
Chain Sequence
b'ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SINGLE STRANDED 28-MER OF D(C)
publication title Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
total genus 15
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eygA00
4BY1H 3PV0A 1QUQA 5IYCG 4UY8C 4HJ9A 4JYAL 5M5WH 5IYBH 3RN2A 4YWKA 2JA9A 5IWAQ 3S1NH 4RMFA 1EQQA 1NMGA 5LMNQ 1JB7A 1GVPA 4A3GG 5IT9c 4DPGA 3U4ZA 1KAWA 3F1ZA 1R9TH 2JJQA 2IHFA 3KF6A 3CP0A 4LW1A 2UU9Q 4IOCA 1K73C 3AFQA 1IXRA 4JC0A 3CCEA 1XNRL 2JEAI 1HR0Q 4JI6Q 4B3ML 4DV4L 1SFOH 4PG3A 1NTGA 1Q46A 2KCTA 3RLFA 4Y7NH 4A3LH 4A3JG 4DV0L 4RG1A 1Q8KA 2K4KA 4P73A 5GAEC 3H15A 3U58A 5M5YH 3RZOH 1NE3A 4DV6Q 5GQOA 1P8LA 1X56A 2H5XA 2BA1A 3GO5A 2ZJRA 1Y1WG 3GTMH 1I94L 3J81i 1HZ9A 3PUVA 5H1SE 4DV3L 3M4PA 3UDGA 2YU9H 1X6OA 3H0GG 4NXNL 2LSSA 3UDFA 4OWXB 3DM3A 4DR3L 3HOZH 4A3BG 1CUKA 5ELOA 5C0XG 1I6HH 2WAQG 3F2BA 3KDFB 4IJLA 4DUYL 4DV1L 1KD1C 1N9WA 4OO1I 3G48A 4IPDA 5C44H 2C35B 1HNWQ 3E0EA 3WWVA 1E24A 3CF5A 4IJHA 4JBKA 4C3HH 1L2FA 4B3TL 3K80C 1S3OA 5JJIA 5M5XH 4KHPQ 3GD7A 4IFDJ 1TWAH 2WP8J 1PH3A 3K0XA 1CKNB 1YEZA 2CFMA 2R92H 3PUZA 2PNHA 4GNXB 1K8GA 4WJ4A 5C3EG 5M3FH 2IHEA 3KJOA 1L0WA 1N8RC 1PH4A 1N33Q 3S2HH 1VCIA 4R1JA 3STBC 1JJGA 1IYJB 1YZ6A 4DAYB 4DV2Q 1YITA 2JE6I 4OONA 1VQNA 3M85A 1Z47A 3TS0A 3HKZG 1PH2A 2E5LQ 4LUVA 4R4IA 1VQIA 1W2BA 4A3IG 1QVCA 1S40A 4UP7A 1Q86C 2N78A 3IRBA 4B3TQ 4LF9L 4LFBL 1Q12A 4LF4L 3A74A 4HJAA 4BY7H 4NPSA 1XNQQ 4LWCA 3GTKH 3E9HA 3PO2H 1PVOA 3TRZA 1VQ9A 3FHWA 2AMCB 4J15A 1VQEA 4GOPB 4LF5L 3HOYG 2N3SA 3S17H 4DR4L 2LXKA 3S16H 3S1MH 2AKWB 2UUCQ 1N34Q 5LMNW 4JI0L 1XTDA 2R93G 2F4VL 3GTLH 3U50C 2K75A 3CMAA 4K0KQ 1IZ6A 4DAMA 2XTIA 3M9BA 2JA8H 3HOVH 4PZ6A 3I2ZA 1A8VA 1AE3A 2XGTA 4KI0A 1YHBA 4LUOA 3LGJA 4R4QA 1HR0W 1XMQL 1Y14B 3KJPA 4DR5Q 5EAYA 2JK8A 1VQPA 4GNXC 2JA5G 5IYDG 1KXLA 4DR1L 3BJUA 3HOXG 4NXML 1JJ2A 2B3GA 2BH2A 2UXDL 1A62A 4A93H 4L5TA 1IBLL 3OTOL 5ELNA 3S1RH 3PIOA 3T1YQ 3CCJA 2F4VQ 4JI1Q 1TWCH 2R7FA 4FDBA 3CCMA 4HIOA 3FKIH 4WJ3M 4X66L 4LF8L 2UXCL 4QQBX 3CC2A 3KFUA 3S2DH 1QUQB 1OXVA 1XPOA 3ZJYC 4JI7L 1Q7YC 4A3CH 1IBKL 4X6AH 4JI8Q 5IP7H 2ZM6Q 4JI3Q 3PCOB 4LFAQ 4YCWA 4DR1Q 3I4NG 1PYSB 2VUMG 1JT8A 4C3IH 4JBWA 1VQ7A 2NVYH 4GN5A 4DR2Q 4R4CA 4EX5A 3OTOQ 1VQDA 3KF6B 2JA7G 4BY1G 1SR3A 2Q2TA 3AFPA 2HHHL 1J6QA 1EOVA 3AYHB 4TQUS 5IYBG 3CPWA 1UE1A 1YNXA 2I5LX 1YBYA 1NJIC 4A3FH 1EIFA 1YHAA 4LF8Q 2K14A 2L15A 2OQ0A 4OWWB 1NY4A 5K36G 1UE6A 5AJ3Q 2N49A 3F2CA 2ZJQA 4POFA 4AIMA 1ASZA 4JV5Q 1TXYA 3JC66 2V1CC 2R7ZH 4JBJA 1VQLA 4DV5L 1HNXL 1PH7A 2AHOB 3GTOH 2IX0A 4APVA 3K7AH 3PGZA 3CW2C 5IY0A 4A3LG 4OO1G 4GKKL 4KLKA 3DLLA 1V9PA 4KHZA 3UE0A 4DNIA 2IX1A 4ME3A 4LF7Q 3M7NA 2GN5A 4A75A 4QY7A 3GTJH 2CKZB 5IP9H 2ALYB 4AYBE 3HFZB 3BU2A 3TEHB 1HZBA 1K8AC 3HOZG 4R4OA 4DR6L 3CPFA 1XJVA 2A8VA 4DK3C 4YCVA 3T1HQ 3STBD 4DV7L 1YI2A 4LFBQ 5C44G 4JYAQ 4GKKQ 1VQ6A 1VQAA 3GTQH 5JJKA 3G6EA 5FLMH 3D0FA 2VL6A 2QA4A 1QVGA 4IFDI 1PH5A 1U0LA 2E8GA 1SROA 4HIMA 2QEXA 3TQYA 1X65A 3PUWA 1WOCA 1N32L 2R92G 2CCZA 5M3FG 1LM0A 4Y52H 3GTPH 1XNRQ 4X64L 1X3EA 2B29A 4B3MQ 1K9MC 4DV4Q 1VQ4A 2Q2UA 1N36L 3D31A 1VQFA 3CCRA 4A3KH 3ICEA 2JQOA 3UE1A 2K50A 4YCUA 4DV0Q 4GKJL 3CXCA 2LXJA 1A0IA 1X55A 2UXBL 3RNUA 1I3QH 3F8TA 4BY7G 1NMFA 3NBHB 1HJPA 1I94Q 3GTGH 3HOUH 4DV3Q 3W1BA 4JG2A 3PO2G 2RHQB 3J7ZC 4JOIA 1I50H 3RR5A 2DUDA 3UDIA 4X62L 2VW9A 3CCVA 4DR3Q 5C4XH 1KC8C 2NZOA 3FP9A 4A3DH 4DUYQ 2K5NA 4DV1Q 1E1TA 3I56A 1P16A 1T9HA 2I5MX 4JCVE 3CC4A 1L1OA 4GKJQ 2D62A 3A5UA 4GLVB 4JOIC 1GD7A 2JA8G 3HOVG 1OXXK 3CCUA 2YTYA 1B70B 4XIGS 1CKOA 4IPHA 3J80i 1ASYA 4MTNA 4IOAA 2K5VA 2MQHA 4DUZL 4YHHL 2OTJA 1C9OA 4UPAA 3ULLA 1SMXA 5FLXc 4DKAC 3UDXA 2OWOA 1EFWA 2E2IH 1HNZL 2JA6H 4A93G 3VDYA 3A0JA 2KHJA 2VQFL 3RN5A 1BBUA 1KRSA 4LF9Q 1LYLA 3CC7A 3J81c 3FKIG 1E3PA 3PUXA 5GADC 1YHQA 1E1OA 4LF4Q 2KBNA 2QGQA 2E2JH 2N8NA 2UUAL 5GAGC 1GO3E 4DUZQ 2KHIA 2ID0A 4DR7L 2EQSA 2NVTH 3HKSA 1AH9A 3HOWH 1MKHA 1WCMH 2R7DA 5IP7G 4JI2L 1VQGA 4X65L 2GVAA 3G4SA 4LF5Q 1UEBA 4DR4Q 5BR8L 2PQAB 1OXUA 4YWMA 3W5OA 4HJ7A 4JI0Q 1HNZQ 2MO1A 2VZAA 3B6YA 3RLNA 3RLOA 1CSPA 1VQBA 1M1KC 1W3SA 3ULPA 3CCQA 2NN6I 4QL5A 1CSQA 4A3FG 3G71A 1VQHA 1Y1VH 1RIPA 2ZJPA 1XMQQ 4DR7Q 1KRTA 1WI5A 1RL2A 1IBML 3S24A 3CCLA 1KHIA 1MJCA 2RHSB 5IE8A 5FJ8H 2VS1A 2AWOA 2HIVA 4NXMQ 5GAHC 5BR8Q 2UXDQ 1K0RA 5C0XJ 2R7ZG 3PIPA 1IBLQ 4IPCA 1HZCA 1QZGA 4A3MH 2K5HA 1TWHH 3PO3H 1VQOA 3NENA 3PF5A 1S72A 4BA2I 1X3FA 3K8AA 2PQAA 4X66Q 4B3SL 2UXCQ 3F2DA 4IFDG 2Z6KA 1GM5A 3I4MH 4BXXH 2ZTCA 3ERSX 3I4OA 4LFCL 1EQRA 3EBEA 4OXPA 4JI7Q 3ER0A 3KLWA 1YIJA 1J5EL 1IBKQ 2FXQA 2F3IA 2Y0SE 3M4QA 5IP9G 4IO9A 1VQMA 1D7QA 5M3MH 3JAMc 4BBRH 1EYGA 1EWIA 1BVSA 1G291 4MNOA 3H3VH 1Q81C 2NVQH 2Z6KC 1NBWA 1O7IA 3OW2A 4LNQA 2HIXA 1SE8A 4MZ9A 4LF6L 1C0AA 3KF8B 3SGIA 2HHHQ 3S14H 5IWAL 5FLMG 1LUZA 2ATWA 2EXDA 2UUBL 2VY3A 1BKBA 5LMNL 5JJLA 4O2DA 3TREA 2PMZE 2K52A 3I7FA 4L5QA 1PH6A 5DLQE 4LFCQ 4AQYL 1U5KA 4DK6C 1J5EQ 2B63H 4BBSH 3CCSA 2UU9L 4QGUA 1X54A 3RZDH 3BZCA 1HH2P 3H3VI 2A1AA 1TWFH 3KYHC 4IPGA 4H02A 4DV5Q 1HNXQ 1HR0L 5LMUL 1V1QA 2ASBA 2A19A 3OYYA 4LF6Q 1OXSC 4C3JH 1AE2A 1SN8A 4A3KG 1MJEA 1VQ8A 3CD6A 2CQOA 4PZ7A 5HY6A 4JBMA 3M4OH 3U4VA 1X9NA 1FJGL 1WFQA 4DV6L 2UUBQ 3TS2A 3PF4A 1E7ZA 1UE7A 2WB1E 2YTVA 1L1OB 2ZTDA 2ES2A 1HZAA 3HOUG 4AQYQ 4C2MH 2EIFA 4GN4B 4A3CG 1V43A 2PI2E 1WJJA 4A3EH 1CKMA 1OXTA 1PH1A 4L5SA 3S1QH 4DR6Q 5C4XG 2BH8A 3K7UC 5J3BA 4A3DG 4DV7Q 3KOJA 5LMUQ 2HT1A 1PYBA 2Z0SA 5IYCH 4TVAB 1HNWL 2F52A 2Q2IA 2CWPA 2OTLA 1KIXA 1FJGQ 3AEVA 1MIUA 2RF4A 4KHPL 1PHJA 4A3GH 1VS0A 4A4IA 4A76A 1N32Q 2WFWA 1QVFA 2PI2A 1N33L 1Q82C 1JJCB 1TWGH 4P71A 4YWLA 2YTXA 4BA1I 4X64Q 2Q2HA 4DV2L 1PH9A 1BBWA 2YYZA 2JA6G 1B8AA 4PMWA 3EN2A 1N36Q 2MO0A 1XPRA 2E5LL 4A3JH 1C7YA 4R4TA 1PH8A 2MFIA 2KENA 4P75A 2UXBQ 2OQKA 5JEAG 1Y1WH 2NN6G 3L7ZC 1Q1EA 2D0PA 2VQEL 1XNQL 1L1OC 5GROA 1B7YB 3CQZH 4B3RL 3HOWG 3H0GH 1WCMG 4X62Q 2I0QA 5C4JH 2GVBA 4A3BH 4NB3A 2BA0A 3GDEA 3NELA 1PA6A 2UUCL 1N34L 2OCEA 2IY5B 4K0KL 1VQCA 3EIVA 5HGQA 4HIDA 1K3RA 4UP8A 4HIKA 4YY3L 4P74A 2Y0SG 3L0OA 3BZKA 3L2PA 2NVXH 1Y1VG 1FL0A 3A5ZB 1G51A 3KDFA 4YHHQ 2VQEQ 4DR5L 4B3RQ 3M3YH 5C3EH 3PUYA 4ALPA 1EUJA 5FJ8G 3Q8DA 5C0XI 4POGA 3J7A5 1OTCA 2E2HH 1Q1BA 3NEMA 1H95A 3K81C 3CMEA 2VNUD 1D8LA 4GLXA 4A3MG 4O0AA 2VQFQ 3T1YL 1CKNA 1PFSA 1GKHA 3JAMi 3PO3G 2WAQE 4JI1L 4EQ5A 4GNXA 4A3IH 1YVCA 1A63A 4L5RC 4PZ8A 4QIWE 3S15H 4AYBG 4YY3Q 1YJWA 1UE5A 2DGYA 4JI4L 3ULJA 2UUAQ 3I4MG 4BXXG 1FGUA 1JMCA 3HOYH 1M90C 4GLAC 4JI8L 3CAMA 4JI2Q 1UWVA 4JI3L 2AWNA 1E22A 4X65Q 2ZM6L 5M3MG 4LFAL 4BBRG 2KCMA 4P72A 2CWAA 4JI5L 3W1GA 2R93H 1FVIA 3J81j 4DR2L 3E9IA 1YJNA 3J80c 1WYDA 1QZHA 1JE5A 1XMOL 3I55A 2WB1G 1PV4A 3MXNB 1DGSA 2MNAA 2R6GA 2IT1A 3HKZE 4GS3A 4GOPA 4OX9L 2I5HA 1X3GA 4LUZA 4QJFA 4JI4Q 4NXNQ 1VQJA 1G6PA 5E7NA 3AQQA 1IBMQ 2JA5H 5IYDH 1SLJA 5AJ3L 1EIYB 2B63G 4HJ8A 4BBSG 3HOXH 4JV5L 4GOPC 1Z9FA 4XTCS 2D0OA 4AH6A 2ZTEA 4OWTB 1VQKA 4JI5Q 2NZHA 4UP9A 1XMOQ 1KQSA 1KL9A 1IL2A 2JEBI 3MEFA 4OX9Q 1LTLA 1K83H 4B3SQ 3PSIA 5JEAJ 1VQ5A 4LF7L 4GN3B 1SRUA 2YV5A 1XPUA 3I4NH 1I5FA 2VUMH 4A3EG 1YJ9A 4JI6L 3T1HL 2RCNA 4HJ5A 2HQLA 2JA7H
chains in the Genus database with same CATH superfamily
1AZPA 4BY1H 2B39A 5M5WH 3SE0A 3S1NH 4RMFA 5LMNQ 1ENAA 1JB7A 4HMJA 4A3GG 4DPGA 1KAWA 2AUJD 4LW1A 5KGUA 1K73C 1ZYRD 1S5DD 3FPPA 3J7AF 4C3JB 1SNQA 3M4OB 4XYOA 4PG3A 1NTGA 3IFDA 4OO1H 4A3LH 1TIID 1AP0A 1Q8KA 5JPMC 4C2MB 1X56A 3GTMH 3E0JA 1RHPA 4A3EB 1X3PA 4QF4A 1WD0A 2PZTA 4EQPA 2EY5A 2YU9H 4CGYB 1TR5A 4NXNL 5AFWA 3DM3A 4FF3A 2XRSD 3VR4A 1KDCA 5T1IA 1E24A 1L2FA 3LWEA 2O5IC 2KCCA 1H9KA 4KHPQ 1B53A 1DOMA 1TWAH 1FD7D 1EYCA 3M7GA 1SNDA 2NB0A 5IGEA 5M3FH 1YNJD 4YIJA 3ONAB 4A3JB 1RTOA 1YZ6A 3HKZG 4RKBA 2MHVA 3KBGA 4K8IA 4LUVA 5EGTA 2F0IA 1BCPF 4ME5A 1QVCA 4LF9L 4UP7A 4B3TQ 5K5PA 2NUCA 1KAAA 1IKMA 3H0GB 4NPSA 4BY7H 4A3BB 3MXPA 4LWCA 5CBEE 5EKLA 2AMCB 3HOYG 4GOPB 1PRTC 2UUCQ 4Z9CB 1Y8PB 3L3OC 2F4VL 3QWNA 4K0KQ 1IZ6A 2E75C 4DK1A 1CA5A 2CQAA 3M3YB 5C3EB 1A8VA 1AE3A 4IALA 4QQBX 1YHBA 4LUOA 3LGJA 1HR0W 4E6IA 2JK8A 1VQPA 1TU2B 4X3TA 1Y69U 4DR1L 2KUMA 3BJUA 3HOXG 4NXML 1JJ2A 2BH2A 1EL0A 1F2MA 1A62A 4L5TA 5ELNA 3S1RH 3T1YQ 4JI1Q 1TWCH 2FFKB 1FNWA 4CBVA 1DZ1A 4X66L 2R3ZA 1K8OA 3CC2A 4DU9A 1OXVA 2EY1A 5I2XA 1Q7YC 4JI8Q 5IP7H 4JI3Q 2R93B 1RKNA 4JBWA 1VQ7A 1S5FD 4MHEA 1VQDA 5IT9E 2K28A 3C46A 5CBAE 1HCZA 2HHHL 1J6QA 1EOVA 1UE1A 2XNAC 1NJIC 4A3FH 4LF8Q 2K14A 5K36G 5AJ3Q 3P20A 4POFA 1SNOA 1I4HA 1SNMA 3GQBA 2V4DA 1VQLA 1PMRA 1PH7A 2AHOB 2IX0A 2ZXPA 4CDFC 2Z9HA 1V9PA 1LABA 2IX1A 4IFDH 4ME3A 2A6ED 5E1FA 4A75A 1B9MA 3GTJH 2ALYB 1K8AC 3EA6A 3HOZG 4R4OA 1EY4A 2K05A 1D1KA 4HN7A 4DK3C 2A8VA 3STBD 4DV7L 1XX8A 2BCOA 4GKKQ 1PZKD 1VQ6A 5FLXL 2J0TD 3D8GA 4C3HG 5FLMH 2QILA 2QA4A 1QVGA 1PH5A 2E8GA 4HIMA 3DWPA 1X65A 3MXGA 2R92G 4ABNA 4RGOS 3VYSA 5KYLA 4DFAA 1X3QA 5M5YB 1VQ4A 4A3KH 4GKJL 2K50A 4XQJA 3CXCA 2HUGA 2LXJA 1IL8A 1QE6A 1A0IA 3LX0A 5J39A 1NMFA 3K5LA 1I94Q 1E2VA 4DV3Q 1CT1D 4DXGA 4JG2A 2RHQB 3BVMA 5C44B 5C4XH 1H9MA 4DUYQ 2K5NA 2MUYA 4DV1Q 2BE5C 2K32A 4JCVE 4GZYC 1K28A 5M5XB 2D62A 5IGCA 2JA8G 2Z6BA 4XIGS 1CKOA 4IPHA 4IOAA 1Q90A 2KJXA 4DUZL 4R8IA 1B4OA 3DWAA 5D65A 3ULLA 3MHBA 5FLXc 3UDXA 1UUPA 4NW2A 4V0BA 1EFWA 2JA6H 5CV4A 2EYMA 3T51B 1SAPA 1BBUA 1LYLA 3JAML 3PUXA 3GTKB 1E1OA 5JEAH 4LF4Q 2KBNA 3S17B 2KHIA 2ID0A 1BBXC 1AH9A 1STAA 4LF5Q 2EZVA 1VQGA 4X65L 5BR8L 2NWGA 1TT2A 3NTHA 2B2YA 2EYPA 4JI0Q 1HNZQ 1AFPA 2VZAA 2NN6I 1XMQQ 4DR7Q 1IBML 1G2SA 1EIGA 4A93B 2TMPA 4IUVA 4FF2A 4IPCA 4A3MH 4QUFA 2L5TA 1QOHA 3FMCA 3PIP3 3BDCA 1VQOA 3GV3A 3NENA 1S72A 4RH6A 2PQAA 1SDFA 1Y8NB 3FRPB 2ZTCA 3I4OA 4LFCL 2X69A 4C3IB 1IBKQ 2F3IA 2NVYB 3M4QA 4J8QA 2HCCA 3JAMc 3Q24A 4RA8A 1B1ZA 2Z6KC 1MD2D 4MZ9A 4F87A 1H9SB 3S14H 2MPMA 1LUZA 1WTXA 2EXDA 4MIUA 4DK0A 1BKBA 3TN2A 5LMNL 5JJLA 4O2DA 4L5QA 2FMCA 2B2TA 1U5KA 2E76C 4RFBA 1F2ZA 3K7AB 3H3VI 4DV5Q 2WACA 5EQ0A 1HNXQ 3MFGA 4C3JH 1AE2A 3CD6A 1A6XA 3U9OA 3M4OH 3NHHA 5I4DA 1TVXA 3P7JA 3TS2A 3NSWA 3PF4A 3TP6A 1UE7A 1HZAA 3HOUG 4AQYQ 4C2MH 4KHVA 3J81L 1WJJA 4A3EH 4L5SA 4DR6Q 1MBYA 5C3XA 1RCVD 4J6HA 3GTQB 4A3DG 2B2VA 5LMUQ 2HT1A 2QW7A 3BVGA 2F52A 3TZDA 1LTAD 3D3RA 5KEEA 2OTLA 1KIXA 1FJGQ 3OWEB 1MIUA 2RF4A 4KHPL 3T16A 3GTPB 4A76A 1SMYC 2F0EA 1VF5C 2LFNA 4IUQA 3MC0B 3OWFA 1Q82C 1JJCB 1BCPD 3A8IE 3CHBD 4P71A 4B08A 1BBWA 2B8FA 2YYZA 4A3JH 3IKJA 4K2KA 4FF4A 3OIQA 3T56B 2KENA 3GTGB 1LTRD 5CORA 2NN6G 1I50B 4LJZC 1ZYRC 1B7YB 3J80L 3H0GH 1WCMG 5CYUA 4A3BH 5C0XH 2BA0A 2UUCL 4K0KL 3EIVA 1W6KA 4IUNA 1K3RA 5EKIA 4HIKA 5CR3A 2VXWA 4P74A 4YY3L 5HGTA 2FMMA 1FL0A 1O78A 4YHHQ 4CDEC 3M3YH 5C3EH 3E6ZX 2F0DA 1H95A 4GLXA 2FINB 3BG3A 3T1YL 1PXUA 4JI1L 3WDNA 4L5RC 4PZ8A 2B2YC 2NVTB 4JI4L 1CQVA 3I4MG 5IGBA 1E2WA 1M90C 5FK9C 4JI2Q 4JI8L 4JI3L 3TDQA 4BBRG 2BDOA 4JI5L 1HQMC 2R93H 1IKLA 3J81j 3J80c 1QZHA 1XMOL 5I6YA 2WB1G 3MXNB 4GOPA 3HKZE 4GS3A 2EPBA 1V8QA 5FKAC 4WRDA 2SOBA 5E7NA 1HPCA 4KKUA 5AJ3L 4RKLA 2Q8TA 3PO3B 5I9OA 3SDZA 1STYA 2J4XA 2F0MA 1QCBD 2KHSA 3KBXA 4OX9Q 3OSOA 2F03A 1JOKA 5JEAJ 3K57A 5M3MB 2YV5A 2HD3A 3A7AB 3H94A 2DN8A 5FO8B 2JA7H 3QR8A 3PV0A 4UY8C 5IYCG 2ZT9C 1E0BA 4FXKC 5IYBH 1SE4A 3RN2A 4YWKA 2JA9A 1TY0A 5IWAQ 1VF7A 2WINB 1EQQA 1B3QA 5J1ZA 2IWHA 1GVPA 3F1ZA 1B3AA 4NKLA 3AFQA 5JAVA 3CCEA 4ZK9B 1DOLA 4WFN3 1NAPA 4I65A 3U58A 2K4KA 5GAEC 1GUNA 5M5YH 3RZOH 4FNFA 5GQOA 1P8LA 2H5XA 1I94L 4K14A 1LTSD 1HZ9A 3PUVA 4DV3L 2RVLA 3UDFA 1ICWA 2LSSA 4OWXB 1CUKA 5ELOA 4Y7NB 4TKOB 2WAQG 3Q22A 4DUYL 1FR3A 4DV1L 1N9WA 4XYQA 4OO1I 5C44H 2C35B 3E0EA 3CF5A 4IJHA 4IURA 4JBKA 3NTKA 1S3OA 5JJIA 5M5XH 2WP8J 3K0XA 5I9PA 1ZEQX 2EY6A 1BNZA 1K8GA 3SVMA 2L11A 3ND8A 3STBC 1IYJB 1YITA 2F0TA 4OONA 1VQNA 4PMCA 2TSSA 3TS0A 2H4OA 1PH2A 2E5LQ 2HCIA 1WVLA 1Y1WB 1VQIA 4LAAA 4A3IG 2ENBA 1S40A 2JSOA 3CQZB 1HRJA 1ESRA 4LF4L 2Z8LA 1SYGA 3DWQA 5C4JB 1Q3LA 4BS9A 3GTKH 4HTHA 3TRZA 4QIWB 4J15A 4LF5L 4ZLTF 3S17H 1HFGA 1YNND 1KABA 2EJFC 4MTKA 4WJWA 2AKWB 4JI0L 1N34Q 5LMNW 4FYDA 1XTDA 3CMAA 5CV5A 1B44D 2XTIA 4PQXA 5A2QL 1CQFA 1CZWA 1KTKA 3I2ZA 2F0UA 1XYIA 1JORA 1XMQL 3KJPA 5EAYA 2RCFA 4EGVA 1JWSD 1SYCA 4L63B 4NDXA 1C4QA 4A93H 1Z7TA 3T13A 4CJ2C 3PIO3 3DEPA 4FDBA 4F8MA 4HIOA 1D5MC 4HSVA 1QUQB 5JPNC 2N88A 3ZJYC 1QWYA 4A3CH 1HUMA 1IBKL 3LWUA 2ZM6Q 3FPUB 4YCWA 3I4NG 2VUMG 1LT5D 4C3IH 4KKTA 5ISRA 2NVYH 4R4CA 4EX5A 3OTOQ 1GUOA 4KMUC 5IOCA 3KF6B 4BY1G 3AFPA 3AYHB 2K04A 2WIIB 4I7ZC 3HS0C 2JA5B 1YBYA 1NNXA 5ELEA 2L15A 2OQ0A 2PQEA 1WTQA 1UEAB 4AIMA 1TXYA 4LMQD 2ICIA 1I4RA 3MA2B 4DV5L 1HNXL 1MHWC 2FHTA 2WKCA 4APVA 3K7AH 3CW2C 4A3LG 4OO1G 2F0GA 1GHJA 4KY5A 3UE0A 4DNIA 2D2CC 1A3VA 1ESFA 2KQ3A 1HFNA 4AYBE 1KDBA 3HFZB 1S5ED 4DR6L 2EY2A 4N8X1 1XJVA 4YCVA 3T1HQ 5DNFA 1A15A 4R9WA 1YI2A 3GTQH 3I72A 2KVMA 2AUKA 4IFDI 3C2PA 1UNSA 3TQYA 4ZRZA 4N8FA 3I70A 5M3FG 4G7ZC 1LM0A 3GTPH 1H9SA 2Z4HA 3TBIB 1X3EA 4FP5D 3NTIA 1K9MC 4K5XA 4DV4Q 1VQFA 5G3LF 3TP8A 1NCVA 2JQOA 4H44C 3UE1A 4DV0Q 3ICEA 1RF2D 2LMCB 2QEJC 2O5JC 3RNUA 3F8TA 2JN4A 4BY7G 3NBHB 1I6HB 3GTGH 4CKCA 1I50H 2DUDA 5D3DA 1DD2A 2O4XA 3CCUA 2YTYA 4MTNA 2MQHA 4YHHL 2OTJA 5I6WA 5KIXA 3K5MA 3VR5A 2L12A 2IJ0A 1ILQA 5JOBA 3HGBA 3VDYA 3A0JA 3CC7A 5GADC 1VMPA 1PTOF 3PO2B 4X3SA 4CKEA 1EYAA 1BCPC 3OIPA 2NVTH 3S1MB 5IP7G 4JI2L 1EZ6A 1UEBA 3GTLB 3W5OA 4HJ7A 1EY7A 3HOVB 1MI2A 3RLOA 1VQBA 1RJTA 5DEHA 1M1KC 4QL5A 3QJYA 4A3FG 1WCMB 1FGBD 3TSSA 1CHQD 2KCNA 3S24A 1UAPA 5FJ8H 3KLSX 2AWOA 5GAHC 2MP1A 2I46A 2UXDQ 1K0RA 4ZUJA 3FKIB 2K5HA 2IL8A 3PO3H 3PF5A 1DYQA 4BA2I 1X3FA 4M1UB 2UXCQ 3F2DA 4IFDG 2Z6KA 1GM5A 3S14B 3ERSX 1BXTA 4XQQA 1JOOA 4OXPA 1J5EL 3BS1A 2F0WA 3UI2A 1SYDA 5M3MH 1BVSA 1O7IA 4LNQA 3R93A 4LF6L 1SXTA 3SGIA 1IW7D 2F0OA 5IWAL 5FLMG 1EQVA 3IL8A 1PH6A 3I7FA 3U9SA 3X3NA 5DLQE 3NUCA 2CW0D 2ZXRA 2R7ZB 1DONA 1EWCA 4OGQC 3BZCA 1F2LA 3MXNA 4ZKBB 3HZXA 1EY5A 2O2LD 2MGSA 1QNUA 3OYYA 1RDPD 4A3KG 1SN8A 4CDDC 5HY6A 3MWYW 4JBMA 3F2UA 3U4VA 1WFQA 2UUBQ 2WB1E 1I4PA 1L1OB 1T5EA 2NYZD 1BUVT 1EYDA 2X6GA 5ELCA 4V190 1F9RA 1SYFA 2M2LA 5F2DA 3CRLC 1CKMA 1OXTA 1JWUD 5C4XG 2BH8A 5J3BA 4Q5VA 3NXWA 5L37A 3NK9A 3IAYA 5COYA 2Z4IA 1CK1A 2KOLA 2F4IA 3EJIA 3NPPA 4KN4C 1BCPB 2WFWA 1QJOA 4ZAIA 2PI2A 3A8KE 4KJOA 3J81E 2Q2HA 3EROA 2JA6G 2PPBC 4PMWA 1N36Q 5CGKA 2E5LL 1I3QB 4UHVA 4RHSA 3T4AC 4JW0A 5JEAG 1Y1WH 1O7LA 1NSNS 1Q1EA 3L7ZC 4WORA 2VQEL 5GROA 1SYEA 3CQZH 2SNMA 4B3RL 1PTOB 2I0QA 1EY6A 3I4LA 5C4JH 3R8BA 4NB3A 4KN7C 4NP5A 4DXFA 1N34L 2OEOA 2IY5B 3RMHA 5HGQA 1V1OA 2F0LA 3E3XA 1GOZA 3HEJA 1LTGD 4XQNA 5CV6A 5M9OA 1AZQA 2L4NA 2Y0SG 3AB9A 1A2UA 2P5ZX 2E2IB 3PUYA 5C0XI 2A69D 1QB5D 4K8JA 3K81C 2VNUD 1D8LA 4ZYSA 4A3MG 1BF4A 2VQFQ 3V2TA 1GKHA 3JAMi 2WAQE 4EQ5A 1L0YB 2XVSA 3A54A 1JR0D 4AYBG 3HOWB 1FGUA 1D5ZC 5D14A 1JMCA 2ZM6L 1UWVA 1DCZA 2AWNA 4XT3B 5IGGA 2KCMA 4P72A 3W1GA 3V05A 1FVIA 5IT9L 3E9IA 2F3VA 2B8GA 1Y1VB 1F9SA 1TS4A 3I55A 1CHPD 4IZ8A 2IT1A 4RWSC 2JYOA 2I5HA 1SJHD 4QJFA 1VQJA 2RSOA 2DY8A 1WTOA 2JA5H 5IYDH 1SLJA 1EIYB 1YNNC 4HJ8A 1HTLD 1TWHB 4RCNA 5LL6S 3OOCA 1Z9FA 4AH6A 2D0OA 2ZTEA 4UAIA 4FVMA 2G9DA 2NZHA 1U4RA 4C3JG 2A6HD 1JE4A 1IL2A 1TS2A 4R8NA 1WTHA 1Q8IA 1LTLA 1BOSA 3ERQA 2E74C 3PSIA 3S9WA 4B3SQ 5ELFA 4GN3B 1H9JA 3A8JE 4HCSA 3AU7A 4A3EG 1JB3A 1CA6A 4DAPA 1MSHA 3T1HL 2RCNA 5JVG3 2HQLA 1QUQA 4HJ9A 1JQYD 1EZ8A 2K5WA 1NMGA 2B63B 4BBSB 5IT9c 1TWFB 5EBDA 5G3LD 3KF6A 2IHFA 3CP0A 4IOCA 5JVH3 4JI6Q 2XN9C 3J7YW 4JVZA 5CV7A 1TS3A 4DV4L 1BDOA 4A3JG 4DV0L 4RG1A 1S5BD 2PW7A 1I4XA 3BZDB 1JCKB 2RQXA 1CM9A 3ZYYX 4DV6Q 3BYTB 2ZJRA 3J81i 5H1SE 1GJXA 3M4PA 4RGMA 3NBIA 1X6OA 2XWJB 3H0GG 1I6HH 4A3BG 5C0XG 2NTSA 3F2BA 3KDFB 1KD1C 1M4VA 3A7LA 1PRTD 3WWVA 3FVQA 4A3GB 1QNKA 4B3TL 2EYFA 3P75A 4IFDJ 1PH3A 1CKNB 1YEZA 4X3KA 5IODA 4GNXB 2PNHA 4WJ4A 3EQLC 5C3EG 2IHEA 4HAEA 1L0WA 3KJOA 1N8RC 1IHZA 1PH4A 1VCIA 1N33Q 1JJGA 1J9OA 4DV2Q 4OIJA 1PTOD 3NQIA 4CDCC 3M85A 3DHQA 1Z47A 2ICEC 4R4IA 1RODA 2N78A 3KUPA 3A74A 4HJAA 4CJ0B 1SNPA 3E9HA 3PO2H 1PVOA 3FHWA 4OEMB 2N3SA 3PMFA 3HP3A 1Y8OB 2DJFC 2LXKA 5NUCA 3S1MH 1NR4A 1SJED 2CH4A 2R93G 3NBHA 3GTLH 1HQRD 3U50C 2HQEA 2NVXB 2RDHA 3HOVH 4PZ6A 4KI0A 2XGTA 1YNJC 3VR2A 1Y14B 2E2HB 1KXLA 2IPKD 3HKZB 1F2YA 2B3GA 5C5MA 2UXDL 3SK5A 3URYA 2F4VQ 1C48A 3CCMA 3FKIH 1DJRD 5FOBB 4HSPA 3HOYB 2UXCL 4LF8L 1ENCA 1DM0B 3KFUA 1XPOA 4DR1Q 1G8ZD 1PYSB 3CRKC 1JT8A 4J1MA 3W2DA 4U68A 1LT4D 3H09A 2F0VA 3W3AA 2JA7G 3NP8A 2CVRA 5IYBG 3CPWA 5IIFA 3K5NA 2NTTA 3D4WA 4DF7A 3MTSA 1EIFA 3I3CA 3HOXB 5FO7B 2LS01 4OWWB 4F7XA 1ENFA 3F2CA 2ZJQA 1ASZA 1X32A 4IUPA 4M8AA 2R7ZH 4JBJA 1FNUA 3PGZA 1SNCA 1K83B 5IY0A 4GKKL 4KLKA 1QILA 2E2DC 4KHZA 1XXGA 4LF7Q 1KNAA 1PLFA 1SE3A 4QY7A 2XRQD 5J22A 3SXHA 5IP9H 2NBFA 1I4QA 1CFMA 5D3IB 5ELBA 4NMZA 2SDFA 2L1BA 5E4XA 3I91A 4KD4A 5C44G 4JYAQ 2L0CA 5JJKA 3G6EA 4HEDA 3D0FA 2VL6A 2K7VA 1R9TB 1SROA 1JOQA 5KNBA 3PUWA 3SHLA 3MXUA 1L0XB 4XT1B 3N6RA 1SFOB 1PZID 3Q6SA 5C3WA 1XNRQ 4B3MQ 1IW7C 2Q2UA 1N36L 3D31A 3O13A 5EPKA 3BDLA 4YCUA 2A6EC 1K8MA 4PV1C 1X55A 2CW0C 1I3QH 2AQ3B 3HOZB 4ZKCB 3J7ZC 1LO5D 1KC8C 2K5DA 4OELB 3TP7A 2VW9A 4DR3Q 4ILWA 3FP9A 2LKVA 4JK1C 4A3KB 3K0YA 1E1TA 1PTOH 1P16A 1T9HA 2I5MX 4C3HB 1L1OA 3ND9A 3OPOA 4GKJQ 3A5UA 1STBA 2LY7A 4GLVB 4JOIC 1GD7A 1OXXK 2R92B 3FEWX 2PO4A 2KEDA 1ONLA 1ASYA 3S2HB 2K5VA 4UPAA 1WTRA 1LTBD 1SE2A 2OWOA 1V1PB 2E2IH 1HNZL 4A93G 2KEEA 1PYWD 2VQFL 4RHRA 1KRSA 2F0NA 1WTWA 4LFBQ 1YHQA 1MGSA 2QF7A 5HURA 5GAGC 4DUZQ 4DR7L 2EQSA 2VB2X 2QDLA 3HKSA 3S16B 3HOWH 1MKHA 4A3CG 2B2UA 2A5HA 2GVAA 3VA5A 4DR4Q 2PQAB 1OXUA 4YWMA 1II3A 2Z1CA 4C3IG 2JA8B 4KK7A 2MO1A 1F9QA 3B6YA 3RLNA 3SK6A 1CSPA 1W3SA 2K01A 4TRDA 1VQHA 1Y1VH 1PFBA 1RIPA 3HG9A 4RAUC 2ZJPA 2A68D 1KRTA 3CCLA 2RHSB 2A74C 2VS1A 5BR8Q 2WV6D 4L8JA 5C0XJ 3PIPA 1IBLQ 1HZCA 1QZGA 2EYHA 2G5DA 1TWHH 1ET6A 5I2YA 1KDAA 4ULLA 3S2DB 3K8AA 2AQ2B 1HXYD 4B3SL 2PNRC 2M00A 4BXXH 3QIAA 2A69C 3ER0A 4JI7Q 2EXZA 2FXQA 5EPJA 2Y0SE 4TSSA 4IO9A 1D7QA 1EYGA 1EWIA 4MNOA 1Q81C 1NBWA 5C4HA 1SE8A 1TKWB 4AYBB 3KF8B 3OW7A 1EIHA 2ATWA 1STNA 2FJ2A 3TREA 2PMZE 2K52A 4LFCQ 4AQYL 2B63H 3DEOA 3PQIA 4BBSH 3GTOB 4QGUA 1HH2P 1KLGD 3NWTA 1TWFH 2EDGA 3BYYB 3AMUA 5LMUL 1V1QA 2ASBA 3WOEA 1VQ8A 1O80A 1MJEA 2CQOA 4PZ7A 2F0JA 3GV6A 1X9NA 1FJGL 4QB4A 4DV6L 2ZTDA 3Q23A 4GN4B 3FDTA 1V43A 3K7UC 1AEXA 2A6HC 3KOJA 1PYBA 2Z0SA 4TVAB 1OO9B 3OMCA 4KTAA 1S5CD 2CWPA 5BN3A 5FLXE 5C5LA 3AEVA 1PHJA 3D6CA 1VS0A 4A4IA 4A3GH 3EFXD 4CJ1B 1N32Q 1LT3D 4Q0FA 3H3VC 4CKBA 1N33L 2RBMA 5CMDA 4BA1I 3GP7A 4X64Q 4DV2L 1F9PA 1PH9A 2K03A 1B8AA 1WTPA 3EN2A 1XPRA 1HTPA 2PYKA 1C7YA 2IW3A 2Q8IB 1D5XC 3HOUB 4P75A 3NE5B 2UXBQ 1PRTF 2C5CA 1L1OC 4A3DB 1W6JA 4X62Q 2GVBA 5CV9A 4IQZA 3NELA 1PA6A 1GHKA 4FF1A 2L9HA 2G9HD 5KYIA 2OCEA 1EOTA 1EY8A 1ML0D 2XSCA 3MVVA 3L0OA 3BZKA 3VYUA 3L2PA 1C8CA 2NVXH 3KDFA 3M4YA 1G51A 4ALPA 5FJ8G 2F0KA 3R3OA 1OTCA 2E2HH 4L6TB 3QOJA 1CKNA 1PFSA 3PO3G 2B2UC 2E2JB 4GNXA 1ET9A 4EVOA 1A63A 4IN3A 4KJNA 3JAME 4YY3Q 1UE5A 2DGYA 2UUAQ 2EVBA 2SNSA 3TMEA 1KNEA 1A3TA 3HOYH 4GLAC 5C6AA 1PTOC 1EFID 2K33A 5M3MG 1LTTD 1D1IA 2CWAA 1T5XD 2B2WC 2IX3A 2AQ1B 4DNTB 1YJNA 4KY6A 1WYDA 1JE5A 4QCLA 2MNAA 4OX9L 4LUZA 3A55A 4JI4Q 2F0FA 3AQQA 5BN5A 2RSNA 2XIWA 3TP5A 4G7OC 3HOXH 4XTCS 1VQKA 4JI5Q 2BDNA 3H91A 4N9TA 4OWTB 3C3LA 3I4MB 2N55A 1XMOQ 1KQSA 4I7AA 2JEBI 1K83H 1IYUA 1TQOA 1VQ5A 4LF7L 4BBRB 4U673 2NVQB 1XPUA 1I5FA 1YJ9A 2WB1B 5IGFA 1SBBB 1B9NA 1PH1A 4DAVA 4JYAL 1CTMA 2QDBA 1EEFD 2WKDA 1DOKA 3OHXC 3RZDB 5K36H 3U4ZA 3X3MA 1R9TH 2JJQA 3VYRA 2UU9Q 1IXRA 4JC0A 4X3UA 3NQTA 4EQNA 1XNRL 1HR0Q 1GUGA 2JEAI 2JA7B 4B3ML 3QOLA 1SFOH 1TY2A 1Q46A 2KCTA 3RLFA 4Y7NH 1HHVA 4P73A 3H15A 5DM73 4S3SA 3VR3A 1M8AA 5KRUA 1NE3A 1FYCA 3MAQA 5DAUA 3WOFA 1Y1WG 3GO5A 2BA1A 3S1QB 1K3BC 1GUWA 3KLRA 3E5SA 3RD4A 3UDGA 3V96A 4HCEA 1PRTB 1XWEA 3C1EA 4DR3L 4N9PA 3HOZH 2R61A 4IJLA 3G48A 4IPDA 1HNWQ 3TZUA 3RZOB 2M9VA 4C3HH 4B9WA 3K80C 3GD7A 5JJZA 1TWGB 2CFMA 3HRZC 2R92H 3PUZA 3RUZA 3S2HH 4R1JA 5CC4A 4DAYB 1RTNA 2JE6I 3SEBA 1WD1A 1W2BA 1Q86C 4LFBL 2GA4B 3IRBA 1Q12A 1JWMD 2X6LA 1LTID 1XNQQ 1PDQA 5EKKA 2WAQB 3J80E 1VQ9A 5E4WC 5EBCA 1VQEA 4H0LC 1ICFB 4G7HC 4DR4L 3S16H 5EJWA 2VB3X 2K75A 1R4QB 1BR9A 4DAMA 1STGA 2F0PA 3M9BA 2JA8H 1A2TA 1ZXTA 4R4QA 5FO9B 4DR5Q 4GNXC 2JA5G 5IYDG 5T1GA 1EEID 2F0QA 4A3IB 1KLUD 1IBLL 3OTOL 4K6DA 4C56C 3S15B 4K5WA 3PIOA 3CCJA 2R7FA 4WJ3M 1IYVA 1LLRD 3MZ5A 1V1PA 3MEHA 3LNNA 3S2DH 1BQQT 1TS5A 4DNRB 1NUCA 4JI7L 4X6AH 1VDZA 3I90A 4BWGB 3PCOB 4LFAQ 4KV6A 1EWHA 4GN5A 5IGDA 4DR2Q 1WTVA 4OIKA 1G2TA 1SR3A 2Q2TA 1CI3M 4TQUS 1YNXA 2I5LX 4CHTB 1H9RA 1RD9D 1EQTA 1YHAA 3N52A 4LK1C 2JP1A 1NY4A 1MSGA 3K5OA 1UE6A 4OHJA 2N49A 1AN8A 4JV5Q 5TSSA 3JC66 2V1CC 4C1NI 3DMUA 3G6JB 3GTOH 3L9AX 3MFYA 3QG1A 3DLLA 4FO2A 2A68C 2KA7A 1U4MA 3VR6A 2BOSA 3M7NA 3I4NB 2GN5A 2VUMB 2CKZB 3BU2A 3TEHB 1HZBA 4BY1B 3CPFA 3R2TA 5M5WB 3S1NB 4KY7A 2DY7A 1VQAA 3K59A 4FXGC 4H13C 1U0LA 2QEXA 2D9UA 3D4RA 3D6WA 1B50A 4QMGA 1WOCA 1N32L 4RGTA 2CCZA 3KF8A 3SR1A 4Y52H 1LT6D 1VMCA 4X64L 2B29A 4QUCA 4B9XA 3CCRA 4RGNA 2QKIC 3GTMB 4G57A 1STHA 1BO0A 1A3UA 4K6LA 2UXBL 2YU9B 1HJPA 2XWBB 3HOUH 3W1BA 3PO2G 3CU7A 3P1HA 4JOIA 3RR5A 3UDIA 4X62L 3CCVA 4NXNQ 3CKIB 2K1BA 2NZOA 2NZ1D 4A3DH 3I56A 3CC4A 3K58A 1TWAB 4PMBA 3HOVG 1GXDC 1B70B 3J80i 3R2IA 5M3FB 1U4LA 1C9OA 1SMXA 3EVQA 4DKAC 3J7AV 2KHJA 1GUSA 3RN5A 3KK7A 4BY7B 4LF9Q 4XDXA 3J81c 3FKIG 1E3PA 5C4ZA 4PNYA 4UDUC 2NN6H 2QGQA 2E2JH 2N8NA 2UUAL 1GO3E 2K6AA 2A73B 1WCMH 2R7DA 1R4PB 3G4SA 4HR7B 2ZXOA 1LV9A 4O1NA 1NR2A 1XTCD 2DNEA 2PW5A 2DJGC 3D4DA 2RDGA 5EPLA 3SK8A 3ULPA 1HUNA 5A2QE 3CCQA 3IFTA 2OT2A 4HMIA 2SEBD 1CSQA 3Q0AA 3G71A 3A56A 3QO2A 1WI5A 1RL2A 4K2LA 1KHIA 1MJCA 3BDOA 5IE8A 3S1RB 2HIVA 4NXMQ 1TWCB 2R7ZG 1SEBD 2F1MA 3DM1A 4X66Q 2EYOA 2J7ZA 3I4MH 2CH4W 1EQRA 3EBEA 1I4GA 3KLWA 1YIJA 5IP9G 1VQMA 1EU3A 3BVZA 4BBRH 1G291 3H3VH 4EQOA 2NVQH 1D2BA 3OW2A 5ELDA 2HIXA 3DXJC 1EU4A 4A3FB 2HDLA 1C0AA 2HHHQ 4G4KA 2EE1A 2UUBL 2VY3A 4DK6C 1J5EQ 3CCSA 2HDMA 4P2CB 2UU9L 1X54A 3RZDH 2A1AA 3KYHC 4IPGA 4H02A 1HR0L 2A19A 2B2TC 4LF6Q 1OXSC 2BE5D 3GTJB 1SSOA 4KKSA 1E7ZA 2ES2A 2YTVA 2CHBD 2MJ8A 3KLSA 2QCPX 1F77A 2EIFA 3S1QH 2PI2E 3I73A 3G7LA 4ZUIA 1LACA 4O42A 4DV7Q 2OXPA 1ILPA 5IYCH 1HNWL 1G6ZA 2Q2IA 5KNCA 4HJ5A 1G91A 2KECA 3SK4A 1EY9A 1HA5A 2B2VC 2PCFB 4ZCKA 2I07B 1J8IA 2F0SA 5CV8A 1QVFA 2PZWA 1O7YA 3C1FA 1B2TA 1TWGH 2JXMB 4YWLA 2YTXA 1K0SA 1Z6HA 2EJGC 1PZJD 2MO0A 3DUZA 4R4TA 1PH8A 2EYLA 4DA2A 2L55A 4C1NK 5LL6X 2MFIA 4IUUA 2DNCA 1U4PA 2EYJA 2OQKA 3NWSA 3I8ZA 3OMGA 5LHY1 1HA6A 2D0PA 3T53B 1XNQL 5C4XB 3HOWG 1JICA 1GUTA 1CZGA 3H6MA 3GDEA 5DM63 3QB3A 4JPBW 3K6OA 1VQCA 5KNDA 4HIDA 4UP8A 1JC7A 1D6EC 1Y1VG 3A5ZB 2VQEQ 4DR5L 2H1EA 4KD3A 4B3RQ 2JA6B 1EUJA 3VA7A 3Q8DA 4POGA 3J7A5 1Q1BA 3NEMA 2RKSA 3CMEA 1DXMA 2PZUA 2RDFA 4RCOA 4O0AA 5BN4A 4A3IH 1YVCA 4QIWE 3S15H 1YJWA 1PFMA 4DAYA 1E2ZA 2B2WA 3ULJA 4BXXG 1S4ZA 2Q8RE 4ODGA 4F88A 5E3FA 3CAMA 4X65Q 4LFAL 1E22A 1EY0A 1U9RA 4OL7A 1ZKOA 4DGZA 1QG7A 2OF1A 4DR2L 1I6VC 1FNVA 2Y0SB 2C9OA 1SYBA 1PV4A 1DGSA 4ZQ3A 2R6GA 4IUTA 1X3GA 1G6PA 2D5DA 4K5VA 4FXDA 3ITPA 1IBMQ 4ID6A 2B63G 4A3MB 4BBSG 4DN4M 4JV5L 4GOPC 4MN3A 2PMZB 2F3WA 4XXEA 4UP9A 2EJMA 5A35A 2F0HA 1KL9A 3MEFA 2RA4A 1STEA 1SRUA 1AW7A 1O7ZA 3I4NH 2VUMH 1SMYD 2K5QA 4JI6L 2EOTA 4H7BA 1PFNA 3VYTA
chains in the Genus database with same CATH topology
4BY1H 3PV0A 1QUQA 5IYCG 4UY8C 4HJ9A 4JYAL 5M5WH 5IYBH 3RN2A 4YWKA 2JA9A 5IWAQ 3S1NH 4RMFA 1EQQA 1NMGA 5LMNQ 1JB7A 1GVPA 4A3GG 5IT9c 4DPGA 3U4ZA 1KAWA 3F1ZA 1R9TH 2JJQA 2IHFA 3KF6A 3CP0A 4LW1A 2UU9Q 4IOCA 1K73C 3AFQA 1IXRA 4JC0A 3CCEA 1XNRL 2JEAI 1HR0Q 4JI6Q 4B3ML 4DV4L 1SFOH 4PG3A 1NTGA 1Q46A 2KCTA 3RLFA 4Y7NH 4A3LH 4A3JG 4DV0L 4RG1A 1Q8KA 2K4KA 4P73A 5GAEC 3H15A 3U58A 5M5YH 3RZOH 1NE3A 4DV6Q 5GQOA 1P8LA 1X56A 2H5XA 2BA1A 3GO5A 2ZJRA 1Y1WG 3GTMH 1I94L 3J81i 1HZ9A 3PUVA 5H1SE 4DV3L 3M4PA 3UDGA 2YU9H 1X6OA 3H0GG 4NXNL 2LSSA 3UDFA 4OWXB 3DM3A 4DR3L 3HOZH 4A3BG 1CUKA 5ELOA 5C0XG 1I6HH 2WAQG 3F2BA 3KDFB 4IJLA 4DUYL 4DV1L 1KD1C 1N9WA 4OO1I 3G48A 4IPDA 5C44H 2C35B 1HNWQ 3E0EA 3WWVA 1E24A 3CF5A 4IJHA 4JBKA 4C3HH 1L2FA 4B3TL 3K80C 1S3OA 5JJIA 5M5XH 4KHPQ 3GD7A 4IFDJ 1TWAH 2WP8J 1PH3A 3K0XA 1CKNB 1YEZA 2CFMA 2R92H 3PUZA 2PNHA 4GNXB 1K8GA 4WJ4A 5C3EG 5M3FH 2IHEA 3KJOA 1L0WA 1N8RC 1PH4A 1N33Q 3S2HH 1VCIA 4R1JA 3STBC 1JJGA 1IYJB 1YZ6A 4DAYB 4DV2Q 1YITA 2JE6I 4OONA 1VQNA 3M85A 1Z47A 3TS0A 3HKZG 1PH2A 2E5LQ 4LUVA 4R4IA 1VQIA 1W2BA 4A3IG 1QVCA 1S40A 4UP7A 1Q86C 2N78A 3IRBA 4B3TQ 4LF9L 4LFBL 1Q12A 4LF4L 3A74A 4HJAA 4BY7H 4NPSA 1XNQQ 4LWCA 3GTKH 3E9HA 3PO2H 1PVOA 3TRZA 1VQ9A 3FHWA 2AMCB 4J15A 1VQEA 4GOPB 4LF5L 3HOYG 2N3SA 3S17H 4DR4L 2LXKA 3S16H 3S1MH 2AKWB 2UUCQ 1N34Q 5LMNW 4JI0L 1XTDA 2R93G 2F4VL 3GTLH 3U50C 2K75A 3CMAA 4K0KQ 1IZ6A 4DAMA 2XTIA 3M9BA 2JA8H 3HOVH 4PZ6A 3I2ZA 1A8VA 1AE3A 2XGTA 4KI0A 1YHBA 4LUOA 3LGJA 4R4QA 1HR0W 1XMQL 1Y14B 3KJPA 4DR5Q 5EAYA 2JK8A 1VQPA 4GNXC 2JA5G 5IYDG 1KXLA 4DR1L 3BJUA 3HOXG 4NXML 1JJ2A 2B3GA 2BH2A 2UXDL 1A62A 4A93H 4L5TA 1IBLL 3OTOL 5ELNA 3S1RH 3PIOA 3T1YQ 3CCJA 2F4VQ 4JI1Q 1TWCH 2R7FA 4FDBA 3CCMA 4HIOA 3FKIH 4WJ3M 4X66L 4LF8L 2UXCL 4QQBX 3CC2A 3KFUA 3S2DH 1QUQB 1OXVA 1XPOA 3ZJYC 4JI7L 1Q7YC 4A3CH 1IBKL 4X6AH 4JI8Q 5IP7H 2ZM6Q 4JI3Q 3PCOB 4LFAQ 4YCWA 4DR1Q 3I4NG 1PYSB 2VUMG 1JT8A 4C3IH 4JBWA 1VQ7A 2NVYH 4GN5A 4DR2Q 4R4CA 4EX5A 3OTOQ 1VQDA 3KF6B 2JA7G 4BY1G 1SR3A 2Q2TA 3AFPA 2HHHL 1J6QA 1EOVA 3AYHB 4TQUS 5IYBG 3CPWA 1UE1A 1YNXA 2I5LX 1YBYA 1NJIC 4A3FH 1EIFA 1YHAA 4LF8Q 2K14A 2L15A 2OQ0A 4OWWB 1NY4A 5K36G 1UE6A 5AJ3Q 2N49A 3F2CA 2ZJQA 4POFA 4AIMA 1ASZA 4JV5Q 1TXYA 3JC66 2V1CC 2R7ZH 4JBJA 1VQLA 4DV5L 1HNXL 1PH7A 2AHOB 3GTOH 2IX0A 4APVA 3K7AH 3PGZA 3CW2C 5IY0A 4A3LG 4OO1G 4GKKL 4KLKA 3DLLA 1V9PA 4KHZA 3UE0A 4DNIA 2IX1A 4ME3A 4LF7Q 3M7NA 2GN5A 4A75A 4QY7A 3GTJH 2CKZB 5IP9H 2ALYB 4AYBE 3HFZB 3BU2A 3TEHB 1HZBA 1K8AC 3HOZG 4R4OA 4DR6L 3CPFA 1XJVA 2A8VA 4DK3C 4YCVA 3T1HQ 3STBD 4DV7L 1YI2A 4LFBQ 5C44G 4JYAQ 4GKKQ 1VQ6A 1VQAA 3GTQH 5JJKA 3G6EA 5FLMH 3D0FA 2VL6A 2QA4A 1QVGA 4IFDI 1PH5A 1U0LA 2E8GA 1SROA 4HIMA 2QEXA 3TQYA 1X65A 3PUWA 1WOCA 1N32L 2R92G 2CCZA 5M3FG 1LM0A 4Y52H 3GTPH 1XNRQ 4X64L 1X3EA 2B29A 4B3MQ 1K9MC 4DV4Q 1VQ4A 2Q2UA 1N36L 3D31A 1VQFA 3CCRA 4A3KH 3ICEA 2JQOA 3UE1A 2K50A 4YCUA 4DV0Q 4GKJL 3CXCA 2LXJA 1A0IA 1X55A 2UXBL 3RNUA 1I3QH 3F8TA 4BY7G 1NMFA 3NBHB 1HJPA 1I94Q 3GTGH 3HOUH 4DV3Q 3W1BA 4JG2A 3PO2G 2RHQB 3J7ZC 4JOIA 1I50H 3RR5A 2DUDA 3UDIA 4X62L 2VW9A 3CCVA 4DR3Q 5C4XH 1KC8C 2NZOA 3FP9A 4A3DH 4DUYQ 2K5NA 4DV1Q 1E1TA 3I56A 1P16A 1T9HA 2I5MX 4JCVE 3CC4A 1L1OA 4GKJQ 2D62A 3A5UA 4GLVB 4JOIC 1GD7A 2JA8G 3HOVG 1OXXK 3CCUA 2YTYA 1B70B 4XIGS 1CKOA 4IPHA 3J80i 1ASYA 4MTNA 4IOAA 2K5VA 2MQHA 4DUZL 4YHHL 2OTJA 1C9OA 4UPAA 3ULLA 1SMXA 5FLXc 4DKAC 3UDXA 2OWOA 1EFWA 2E2IH 1HNZL 2JA6H 4A93G 3VDYA 3A0JA 2KHJA 2VQFL 3RN5A 1BBUA 1KRSA 4LF9Q 1LYLA 3CC7A 3J81c 3FKIG 1E3PA 3PUXA 5GADC 1YHQA 1E1OA 4LF4Q 2KBNA 2QGQA 2E2JH 2N8NA 2UUAL 5GAGC 1GO3E 4DUZQ 2KHIA 2ID0A 4DR7L 2EQSA 2NVTH 3HKSA 1AH9A 3HOWH 1MKHA 1WCMH 2R7DA 5IP7G 4JI2L 1VQGA 4X65L 2GVAA 3G4SA 4LF5Q 1UEBA 4DR4Q 5BR8L 2PQAB 1OXUA 4YWMA 3W5OA 4HJ7A 4JI0Q 1HNZQ 2MO1A 2VZAA 3B6YA 3RLNA 3RLOA 1CSPA 1VQBA 1M1KC 1W3SA 3ULPA 3CCQA 2NN6I 4QL5A 1CSQA 4A3FG 3G71A 1VQHA 1Y1VH 1RIPA 2ZJPA 1XMQQ 4DR7Q 1KRTA 1WI5A 1RL2A 1IBML 3S24A 3CCLA 1KHIA 1MJCA 2RHSB 5IE8A 5FJ8H 2VS1A 2AWOA 2HIVA 4NXMQ 5GAHC 5BR8Q 2UXDQ 1K0RA 5C0XJ 2R7ZG 3PIPA 1IBLQ 4IPCA 1HZCA 1QZGA 4A3MH 2K5HA 1TWHH 3PO3H 1VQOA 3NENA 3PF5A 1S72A 4BA2I 1X3FA 3K8AA 2PQAA 4X66Q 4B3SL 2UXCQ 3F2DA 4IFDG 2Z6KA 1GM5A 3I4MH 4BXXH 2ZTCA 3ERSX 3I4OA 4LFCL 1EQRA 3EBEA 4OXPA 4JI7Q 3ER0A 3KLWA 1YIJA 1J5EL 1IBKQ 2FXQA 2F3IA 2Y0SE 3M4QA 5IP9G 4IO9A 1VQMA 1D7QA 5M3MH 3JAMc 4BBRH 1EYGA 1EWIA 1BVSA 1G291 4MNOA 3H3VH 1Q81C 2NVQH 2Z6KC 1NBWA 1O7IA 3OW2A 4LNQA 2HIXA 1SE8A 4MZ9A 4LF6L 1C0AA 3KF8B 3SGIA 2HHHQ 3S14H 5IWAL 5FLMG 1LUZA 2ATWA 2EXDA 2UUBL 2VY3A 1BKBA 5LMNL 5JJLA 4O2DA 3TREA 2PMZE 2K52A 3I7FA 4L5QA 1PH6A 5DLQE 4LFCQ 4AQYL 1U5KA 4DK6C 1J5EQ 2B63H 4BBSH 3CCSA 2UU9L 4QGUA 1X54A 3RZDH 3BZCA 1HH2P 3H3VI 2A1AA 1TWFH 3KYHC 4IPGA 4H02A 4DV5Q 1HNXQ 1HR0L 5LMUL 1V1QA 2ASBA 2A19A 3OYYA 4LF6Q 1OXSC 4C3JH 1AE2A 1SN8A 4A3KG 1MJEA 1VQ8A 3CD6A 2CQOA 4PZ7A 5HY6A 4JBMA 3M4OH 3U4VA 1X9NA 1FJGL 1WFQA 4DV6L 2UUBQ 3TS2A 3PF4A 1E7ZA 1UE7A 2WB1E 2YTVA 1L1OB 2ZTDA 2ES2A 1HZAA 3HOUG 4AQYQ 4C2MH 2EIFA 4GN4B 4A3CG 1V43A 2PI2E 1WJJA 4A3EH 1CKMA 1OXTA 1PH1A 4L5SA 3S1QH 4DR6Q 5C4XG 2BH8A 3K7UC 5J3BA 4A3DG 4DV7Q 3KOJA 5LMUQ 2HT1A 1PYBA 2Z0SA 5IYCH 4TVAB 1HNWL 2F52A 2Q2IA 2CWPA 2OTLA 1KIXA 1FJGQ 3AEVA 1MIUA 2RF4A 4KHPL 1PHJA 4A3GH 1VS0A 4A4IA 4A76A 1N32Q 2WFWA 1QVFA 2PI2A 1N33L 1Q82C 1JJCB 1TWGH 4P71A 4YWLA 2YTXA 4BA1I 4X64Q 2Q2HA 4DV2L 1PH9A 1BBWA 2YYZA 2JA6G 1B8AA 4PMWA 3EN2A 1N36Q 2MO0A 1XPRA 2E5LL 4A3JH 1C7YA 4R4TA 1PH8A 2MFIA 2KENA 4P75A 2UXBQ 2OQKA 5JEAG 1Y1WH 2NN6G 3L7ZC 1Q1EA 2D0PA 2VQEL 1XNQL 1L1OC 5GROA 1B7YB 3CQZH 4B3RL 3HOWG 3H0GH 1WCMG 4X62Q 2I0QA 5C4JH 2GVBA 4A3BH 4NB3A 2BA0A 3GDEA 3NELA 1PA6A 2UUCL 1N34L 2OCEA 2IY5B 4K0KL 1VQCA 3EIVA 5HGQA 4HIDA 1K3RA 4UP8A 4HIKA 4YY3L 4P74A 2Y0SG 3L0OA 3BZKA 3L2PA 2NVXH 1Y1VG 1FL0A 3A5ZB 1G51A 3KDFA 4YHHQ 2VQEQ 4DR5L 4B3RQ 3M3YH 5C3EH 3PUYA 4ALPA 1EUJA 5FJ8G 3Q8DA 5C0XI 4POGA 3J7A5 1OTCA 2E2HH 1Q1BA 3NEMA 1H95A 3K81C 3CMEA 2VNUD 1D8LA 4GLXA 4A3MG 4O0AA 2VQFQ 3T1YL 1CKNA 1PFSA 1GKHA 3JAMi 3PO3G 2WAQE 4JI1L 4EQ5A 4GNXA 4A3IH 1YVCA 1A63A 4L5RC 4PZ8A 4QIWE 3S15H 4AYBG 4YY3Q 1YJWA 1UE5A 2DGYA 4JI4L 3ULJA 2UUAQ 3I4MG 4BXXG 1FGUA 1JMCA 3HOYH 1M90C 4GLAC 4JI8L 3CAMA 4JI2Q 1UWVA 4JI3L 2AWNA 1E22A 4X65Q 2ZM6L 5M3MG 4LFAL 4BBRG 2KCMA 4P72A 2CWAA 4JI5L 3W1GA 2R93H 1FVIA 3J81j 4DR2L 3E9IA 1YJNA 3J80c 1WYDA 1QZHA 1JE5A 1XMOL 3I55A 2WB1G 1PV4A 3MXNB 1DGSA 2MNAA 2R6GA 2IT1A 3HKZE 4GS3A 4GOPA 4OX9L 2I5HA 1X3GA 4LUZA 4QJFA 4JI4Q 4NXNQ 1VQJA 1G6PA 5E7NA 3AQQA 1IBMQ 2JA5H 5IYDH 1SLJA 5AJ3L 1EIYB 2B63G 4HJ8A 4BBSG 3HOXH 4JV5L 4GOPC 1Z9FA 4XTCS 2D0OA 4AH6A 2ZTEA 4OWTB 1VQKA 4JI5Q 2NZHA 4UP9A 1XMOQ 1KQSA 1KL9A 1IL2A 2JEBI 3MEFA 4OX9Q 1LTLA 1K83H 4B3SQ 3PSIA 5JEAJ 1VQ5A 4LF7L 4GN3B 1SRUA 2YV5A 1XPUA 3I4NH 1I5FA 2VUMH 4A3EG 1YJ9A 4JI6L 3T1HL 2RCNA 4HJ5A 2HQLA 2JA7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 H;  3PV0 A;  1QUQ A;  5IYC G;  4UY8 C;  4HJ9 A;  4JYA L;  5M5W H;  5IYB H;  3RN2 A;  4YWK A;  2JA9 A;  5IWA Q;  3S1N H;  4RMF A;  1EQQ A;  1NMG A;  5LMN Q;  1JB7 A;  1GVP A;  4A3G G;  5IT9 c;  4DPG A;  3U4Z A;  1KAW A;  3F1Z A;  1R9T H;  2JJQ A;  2IHF A;  3KF6 A;  3CP0 A;  4LW1 A;  2UU9 Q;  4IOC A;  1K73 C;  3AFQ A;  1IXR A;  4JC0 A;  3CCE A;  1XNR L;  2JEA I;  1HR0 Q;  4JI6 Q;  4B3M L;  4DV4 L;  1SFO H;  4PG3 A;  1NTG A;  1Q46 A;  2KCT A;  3RLF A;  4Y7N H;  4A3L H;  4A3J G;  4DV0 L;  4RG1 A;  1Q8K A;  2K4K A;  4P73 A;  5GAE C;  3H15 A;  3U58 A;  5M5Y H;  3RZO H;  1NE3 A;  4DV6 Q;  5GQO A;  1P8L A;  1X56 A;  2H5X A;  2BA1 A;  3GO5 A;  2ZJR A;  1Y1W G;  3GTM H;  1I94 L;  3J81 i;  1HZ9 A;  3PUV A;  5H1S E;  4DV3 L;  3M4P A;  3UDG A;  2YU9 H;  1X6O A;  3H0G G;  4NXN L;  2LSS A;  3UDF A;  4OWX B;  3DM3 A;  4DR3 L;  3HOZ H;  4A3B G;  1CUK A;  5ELO A;  5C0X G;  1I6H H;  2WAQ G;  3F2B A;  3KDF B;  4IJL A;  4DUY L;  4DV1 L;  1KD1 C;  1N9W A;  4OO1 I;  3G48 A;  4IPD A;  5C44 H;  2C35 B;  1HNW Q;  3E0E A;  3WWV A;  1E24 A;  3CF5 A;  4IJH A;  4JBK A;  4C3H H;  1L2F A;  4B3T L;  3K80 C;  1S3O A;  5JJI A;  5M5X H;  4KHP Q;  3GD7 A;  4IFD J;  1TWA H;  2WP8 J;  1PH3 A;  3K0X A;  1CKN B;  1YEZ A;  2CFM A;  2R92 H;  3PUZ A;  2PNH A;  4GNX B;  1K8G A;  4WJ4 A;  5C3E G;  5M3F H;  2IHE A;  3KJO A;  1L0W A;  1N8R C;  1PH4 A;  1N33 Q;  3S2H H;  1VCI A;  4R1J A;  3STB C;  1JJG A;  1IYJ B;  1YZ6 A;  4DAY B;  4DV2 Q;  1YIT A;  2JE6 I;  4OON A;  1VQN A;  3M85 A;  1Z47 A;  3TS0 A;  3HKZ G;  1PH2 A;  2E5L Q;  4LUV A;  4R4I A;  1VQI A;  1W2B A;  4A3I G;  1QVC A;  1S40 A;  4UP7 A;  1Q86 C;  2N78 A;  3IRB A;  4B3T Q;  4LF9 L;  4LFB L;  1Q12 A;  4LF4 L;  3A74 A;  4HJA A;  4BY7 H;  4NPS A;  1XNQ Q;  4LWC A;  3GTK H;  3E9H A;  3PO2 H;  1PVO A;  3TRZ A;  1VQ9 A;  3FHW A;  2AMC B;  4J15 A;  1VQE A;  4GOP B;  4LF5 L;  3HOY G;  2N3S A;  3S17 H;  4DR4 L;  2LXK A;  3S16 H;  3S1M H;  2AKW B;  2UUC Q;  1N34 Q;  5LMN W;  4JI0 L;  1XTD A;  2R93 G;  2F4V L;  3GTL H;  3U50 C;  2K75 A;  3CMA A;  4K0K Q;  1IZ6 A;  4DAM A;  2XTI A;  3M9B A;  2JA8 H;  3HOV H;  4PZ6 A;  3I2Z A;  1A8V A;  1AE3 A;  2XGT A;  4KI0 A;  1YHB A;  4LUO A;  3LGJ A;  4R4Q A;  1HR0 W;  1XMQ L;  1Y14 B;  3KJP A;  4DR5 Q;  5EAY A;  2JK8 A;  1VQP A;  4GNX C;  2JA5 G;  5IYD G;  1KXL A;  4DR1 L;  3BJU A;  3HOX G;  4NXM L;  1JJ2 A;  2B3G A;  2BH2 A;  2UXD L;  1A62 A;  4A93 H;  4L5T A;  1IBL L;  3OTO L;  5ELN A;  3S1R H;  3PIO A;  3T1Y Q;  3CCJ A;  2F4V Q;  4JI1 Q;  1TWC H;  2R7F A;  4FDB A;  3CCM A;  4HIO A;  3FKI H;  4WJ3 M;  4X66 L;  4LF8 L;  2UXC L;  4QQB X;  3CC2 A;  3KFU A;  3S2D H;  1QUQ B;  1OXV A;  1XPO A;  3ZJY C;  4JI7 L;  1Q7Y C;  4A3C H;  1IBK L;  4X6A H;  4JI8 Q;  5IP7 H;  2ZM6 Q;  4JI3 Q;  3PCO B;  4LFA Q;  4YCW A;  4DR1 Q;  3I4N G;  1PYS B;  2VUM G;  1JT8 A;  4C3I H;  4JBW A;  1VQ7 A;  2NVY H;  4GN5 A;  4DR2 Q;  4R4C A;  4EX5 A;  3OTO Q;  1VQD A;  3KF6 B;  2JA7 G;  4BY1 G;  1SR3 A;  2Q2T A;  3AFP A;  2HHH L;  1J6Q A;  1EOV A;  3AYH B;  4TQU S;  5IYB G;  3CPW A;  1UE1 A;  1YNX A;  2I5L X;  1YBY A;  1NJI C;  4A3F H;  1EIF A;  1YHA A;  4LF8 Q;  2K14 A;  2L15 A;  2OQ0 A;  4OWW B;  1NY4 A;  5K36 G;  1UE6 A;  5AJ3 Q;  2N49 A;  3F2C A;  2ZJQ A;  4POF A;  4AIM A;  1ASZ A;  4JV5 Q;  1TXY A;  3JC6 6;  2V1C C;  2R7Z H;  4JBJ A;  1VQL A;  4DV5 L;  1HNX L;  1PH7 A;  2AHO B;  3GTO H;  2IX0 A;  4APV A;  3K7A H;  3PGZ A;  3CW2 C;  5IY0 A;  4A3L G;  4OO1 G;  4GKK L;  4KLK A;  3DLL A;  1V9P A;  4KHZ A;  3UE0 A;  4DNI A;  2IX1 A;  4ME3 A;  4LF7 Q;  3M7N A;  2GN5 A;  4A75 A;  4QY7 A;  3GTJ H;  2CKZ B;  5IP9 H;  2ALY B;  4AYB E;  3HFZ B;  3BU2 A;  3TEH B;  1HZB A;  1K8A C;  3HOZ G;  4R4O A;  4DR6 L;  3CPF A;  1XJV A;  2A8V A;  4DK3 C;  4YCV A;  3T1H Q;  3STB D;  4DV7 L;  1YI2 A;  4LFB Q;  5C44 G;  4JYA Q;  4GKK Q;  1VQ6 A;  1VQA A;  3GTQ H;  5JJK A;  3G6E A;  5FLM H;  3D0F A;  2VL6 A;  2QA4 A;  1QVG A;  4IFD I;  1PH5 A;  1U0L A;  2E8G A;  1SRO A;  4HIM A;  2QEX A;  3TQY A;  1X65 A;  3PUW A;  1WOC A;  1N32 L;  2R92 G;  2CCZ A;  5M3F G;  1LM0 A;  4Y52 H;  3GTP H;  1XNR Q;  4X64 L;  1X3E A;  2B29 A;  4B3M Q;  1K9M C;  4DV4 Q;  1VQ4 A;  2Q2U A;  1N36 L;  3D31 A;  1VQF A;  3CCR A;  4A3K H;  3ICE A;  2JQO A;  3UE1 A;  2K50 A;  4YCU A;  4DV0 Q;  4GKJ L;  3CXC A;  2LXJ A;  1A0I A;  1X55 A;  2UXB L;  3RNU A;  1I3Q H;  3F8T A;  4BY7 G;  1NMF A;  3NBH B;  1HJP A;  1I94 Q;  3GTG H;  3HOU H;  4DV3 Q;  3W1B A;  4JG2 A;  3PO2 G;  2RHQ B;  3J7Z C;  4JOI A;  1I50 H;  3RR5 A;  2DUD A;  3UDI A;  4X62 L;  2VW9 A;  3CCV A;  4DR3 Q;  5C4X H;  1KC8 C;  2NZO A;  3FP9 A;  4A3D H;  4DUY Q;  2K5N A;  4DV1 Q;  1E1T A;  3I56 A;  1P16 A;  1T9H A;  2I5M X;  4JCV E;  3CC4 A;  1L1O A;  4GKJ Q;  2D62 A;  3A5U A;  4GLV B;  4JOI C;  1GD7 A;  2JA8 G;  3HOV G;  1OXX K;  3CCU A;  2YTY A;  1B70 B;  4XIG S;  1CKO A;  4IPH A;  3J80 i;  1ASY A;  4MTN A;  4IOA A;  2K5V A;  2MQH A;  4DUZ L;  4YHH L;  2OTJ A;  1C9O A;  4UPA A;  3ULL A;  1SMX A;  5FLX c;  4DKA C;  3UDX A;  2OWO A;  1EFW A;  2E2I H;  1HNZ L;  2JA6 H;  4A93 G;  3VDY A;  3A0J A;  2KHJ A;  2VQF L;  3RN5 A;  1BBU A;  1KRS A;  4LF9 Q;  1LYL A;  3CC7 A;  3J81 c;  3FKI G;  1E3P A;  3PUX A;  5GAD C;  1YHQ A;  1E1O A;  4LF4 Q;  2KBN A;  2QGQ A;  2E2J H;  2N8N A;  2UUA L;  5GAG C;  1GO3 E;  4DUZ Q;  2KHI A;  2ID0 A;  4DR7 L;  2EQS A;  2NVT H;  3HKS A;  1AH9 A;  3HOW H;  1MKH A;  1WCM H;  2R7D A;  5IP7 G;  4JI2 L;  1VQG A;  4X65 L;  2GVA A;  3G4S A;  4LF5 Q;  1UEB A;  4DR4 Q;  5BR8 L;  2PQA B;  1OXU A;  4YWM A;  3W5O A;  4HJ7 A;  4JI0 Q;  1HNZ Q;  2MO1 A;  2VZA A;  3B6Y A;  3RLN A;  3RLO A;  1CSP A;  1VQB A;  1M1K C;  1W3S A;  3ULP A;  3CCQ A;  2NN6 I;  4QL5 A;  1CSQ A;  4A3F G;  3G71 A;  1VQH A;  1Y1V H;  1RIP A;  2ZJP A;  1XMQ Q;  4DR7 Q;  1KRT A;  1WI5 A;  1RL2 A;  1IBM L;  3S24 A;  3CCL A;  1KHI A;  1MJC A;  2RHS B;  5IE8 A;  5FJ8 H;  2VS1 A;  2AWO A;  2HIV A;  4NXM Q;  5GAH C;  5BR8 Q;  2UXD Q;  1K0R A;  5C0X J;  2R7Z G;  3PIP A;  1IBL Q;  4IPC A;  1HZC A;  1QZG A;  4A3M H;  2K5H A;  1TWH H;  3PO3 H;  1VQO A;  3NEN A;  3PF5 A;  1S72 A;  4BA2 I;  1X3F A;  3K8A A;  2PQA A;  4X66 Q;  4B3S L;  2UXC Q;  3F2D A;  4IFD G;  2Z6K A;  1GM5 A;  3I4M H;  4BXX H;  2ZTC A;  3ERS X;  3I4O A;  4LFC L;  1EQR A;  3EBE A;  4OXP A;  4JI7 Q;  3ER0 A;  3KLW A;  1YIJ A;  1J5E L;  1IBK Q;  2FXQ A;  2F3I A;  2Y0S E;  3M4Q A;  5IP9 G;  4IO9 A;  1VQM A;  1D7Q A;  5M3M H;  3JAM c;  4BBR H;  1EYG A;  1EWI A;  1BVS A;  1G29 1;  4MNO A;  3H3V H;  1Q81 C;  2NVQ H;  2Z6K C;  1NBW A;  1O7I A;  3OW2 A;  4LNQ A;  2HIX A;  1SE8 A;  4MZ9 A;  4LF6 L;  1C0A A;  3KF8 B;  3SGI A;  2HHH Q;  3S14 H;  5IWA L;  5FLM G;  1LUZ A;  2ATW A;  2EXD A;  2UUB L;  2VY3 A;  1BKB A;  5LMN L;  5JJL A;  4O2D A;  3TRE A;  2PMZ E;  2K52 A;  3I7F A;  4L5Q A;  1PH6 A;  5DLQ E;  4LFC Q;  4AQY L;  1U5K A;  4DK6 C;  1J5E Q;  2B63 H;  4BBS H;  3CCS A;  2UU9 L;  4QGU A;  1X54 A;  3RZD H;  3BZC A;  1HH2 P;  3H3V I;  2A1A A;  1TWF H;  3KYH C;  4IPG A;  4H02 A;  4DV5 Q;  1HNX Q;  1HR0 L;  5LMU L;  1V1Q A;  2ASB A;  2A19 A;  3OYY A;  4LF6 Q;  1OXS C;  4C3J H;  1AE2 A;  1SN8 A;  4A3K G;  1MJE A;  1VQ8 A;  3CD6 A;  2CQO A;  4PZ7 A;  5HY6 A;  4JBM A;  3M4O H;  3U4V A;  1X9N A;  1FJG L;  1WFQ A;  4DV6 L;  2UUB Q;  3TS2 A;  3PF4 A;  1E7Z A;  1UE7 A;  2WB1 E;  2YTV A;  1L1O B;  2ZTD A;  2ES2 A;  1HZA A;  3HOU G;  4AQY Q;  4C2M H;  2EIF A;  4GN4 B;  4A3C G;  1V43 A;  2PI2 E;  1WJJ A;  4A3E H;  1CKM A;  1OXT A;  1PH1 A;  4L5S A;  3S1Q H;  4DR6 Q;  5C4X G;  2BH8 A;  3K7U C;  5J3B A;  4A3D G;  4DV7 Q;  3KOJ A;  5LMU Q;  2HT1 A;  1PYB A;  2Z0S A;  5IYC H;  4TVA B;  1HNW L;  2F52 A;  2Q2I A;  2CWP A;  2OTL A;  1KIX A;  1FJG Q;  3AEV A;  1MIU A;  2RF4 A;  4KHP L;  1PHJ A;  4A3G H;  1VS0 A;  4A4I A;  4A76 A;  1N32 Q;  2WFW A;  1QVF A;  2PI2 A;  1N33 L;  1Q82 C;  1JJC B;  1TWG H;  4P71 A;  4YWL A;  2YTX A;  4BA1 I;  4X64 Q;  2Q2H A;  4DV2 L;  1PH9 A;  1BBW A;  2YYZ A;  2JA6 G;  1B8A A;  4PMW A;  3EN2 A;  1N36 Q;  2MO0 A;  1XPR A;  2E5L L;  4A3J H;  1C7Y A;  4R4T A;  1PH8 A;  2MFI A;  2KEN A;  4P75 A;  2UXB Q;  2OQK A;  5JEA G;  1Y1W H;  2NN6 G;  3L7Z C;  1Q1E A;  2D0P A;  2VQE L;  1XNQ L;  1L1O C;  5GRO A;  1B7Y B;  3CQZ H;  4B3R L;  3HOW G;  3H0G H;  1WCM G;  4X62 Q;  2I0Q A;  5C4J H;  2GVB A;  4A3B H;  4NB3 A;  2BA0 A;  3GDE A;  3NEL A;  1PA6 A;  2UUC L;  1N34 L;  2OCE A;  2IY5 B;  4K0K L;  1VQC A;  3EIV A;  5HGQ A;  4HID A;  1K3R A;  4UP8 A;  4HIK A;  4YY3 L;  4P74 A;  2Y0S G;  3L0O A;  3BZK A;  3L2P A;  2NVX H;  1Y1V G;  1FL0 A;  3A5Z B;  1G51 A;  3KDF A;  4YHH Q;  2VQE Q;  4DR5 L;  4B3R Q;  3M3Y H;  5C3E H;  3PUY A;  4ALP A;  1EUJ A;  5FJ8 G;  3Q8D A;  5C0X I;  4POG A;  3J7A 5;  1OTC A;  2E2H H;  1Q1B A;  3NEM A;  1H95 A;  3K81 C;  3CME A;  2VNU D;  1D8L A;  4GLX A;  4A3M G;  4O0A A;  2VQF Q;  3T1Y L;  1CKN A;  1PFS A;  1GKH A;  3JAM i;  3PO3 G;  2WAQ E;  4JI1 L;  4EQ5 A;  4GNX A;  4A3I H;  1YVC A;  1A63 A;  4L5R C;  4PZ8 A;  4QIW E;  3S15 H;  4AYB G;  4YY3 Q;  1YJW A;  1UE5 A;  2DGY A;  4JI4 L;  3ULJ A;  2UUA Q;  3I4M G;  4BXX G;  1FGU A;  1JMC A;  3HOY H;  1M90 C;  4GLA C;  4JI8 L;  3CAM A;  4JI2 Q;  1UWV A;  4JI3 L;  2AWN A;  1E22 A;  4X65 Q;  2ZM6 L;  5M3M G;  4LFA L;  4BBR G;  2KCM A;  4P72 A;  2CWA A;  4JI5 L;  3W1G A;  2R93 H;  1FVI A;  3J81 j;  4DR2 L;  3E9I A;  1YJN A;  3J80 c;  1WYD A;  1QZH A;  1JE5 A;  1XMO L;  3I55 A;  2WB1 G;  1PV4 A;  3MXN B;  1DGS A;  2MNA A;  2R6G A;  2IT1 A;  3HKZ E;  4GS3 A;  4GOP A;  4OX9 L;  2I5H A;  1X3G A;  4LUZ A;  4QJF A;  4JI4 Q;  4NXN Q;  1VQJ A;  1G6P A;  5E7N A;  3AQQ A;  1IBM Q;  2JA5 H;  5IYD H;  1SLJ A;  5AJ3 L;  1EIY B;  2B63 G;  4HJ8 A;  4BBS G;  3HOX H;  4JV5 L;  4GOP C;  1Z9F A;  4XTC S;  2D0O A;  4AH6 A;  2ZTE A;  4OWT B;  1VQK A;  4JI5 Q;  2NZH A;  4UP9 A;  1XMO Q;  1KQS A;  1KL9 A;  1IL2 A;  2JEB I;  3MEF A;  4OX9 Q;  1LTL A;  1K83 H;  4B3S Q;  3PSI A;  5JEA J;  1VQ5 A;  4LF7 L;  4GN3 B;  1SRU A;  2YV5 A;  1XPU A;  3I4N H;  1I5F A;  2VUM H;  4A3E G;  1YJ9 A;  4JI6 L;  3T1H L;  2RCN A;  4HJ5 A;  2HQL A;  2JA7 H; 
#chains in the Genus database with same CATH topology
 1AZP A;  4BY1 H;  2B39 A;  5M5W H;  3SE0 A;  3S1N H;  4RMF A;  5LMN Q;  1ENA A;  1JB7 A;  4HMJ A;  4A3G G;  4DPG A;  1KAW A;  2AUJ D;  4LW1 A;  5KGU A;  1K73 C;  1ZYR D;  1S5D D;  3FPP A;  3J7A F;  4C3J B;  1SNQ A;  3M4O B;  4XYO A;  4PG3 A;  1NTG A;  3IFD A;  4OO1 H;  4A3L H;  1TII D;  1AP0 A;  1Q8K A;  5JPM C;  4C2M B;  1X56 A;  3GTM H;  3E0J A;  1RHP A;  4A3E B;  1X3P A;  4QF4 A;  1WD0 A;  2PZT A;  4EQP A;  2EY5 A;  2YU9 H;  4CGY B;  1TR5 A;  4NXN L;  5AFW A;  3DM3 A;  4FF3 A;  2XRS D;  3VR4 A;  1KDC A;  5T1I A;  1E24 A;  1L2F A;  3LWE A;  2O5I C;  2KCC A;  1H9K A;  4KHP Q;  1B53 A;  1DOM A;  1TWA H;  1FD7 D;  1EYC A;  3M7G A;  1SND A;  2NB0 A;  5IGE A;  5M3F H;  1YNJ D;  4YIJ A;  3ONA B;  4A3J B;  1RTO A;  1YZ6 A;  3HKZ G;  4RKB A;  2MHV A;  3KBG A;  4K8I A;  4LUV A;  5EGT A;  2F0I A;  1BCP F;  4ME5 A;  1QVC A;  4LF9 L;  4UP7 A;  4B3T Q;  5K5P A;  2NUC A;  1KAA A;  1IKM A;  3H0G B;  4NPS A;  4BY7 H;  4A3B B;  3MXP A;  4LWC A;  5CBE E;  5EKL A;  2AMC B;  3HOY G;  4GOP B;  1PRT C;  2UUC Q;  4Z9C B;  1Y8P B;  3L3O C;  2F4V L;  3QWN A;  4K0K Q;  1IZ6 A;  2E75 C;  4DK1 A;  1CA5 A;  2CQA A;  3M3Y B;  5C3E B;  1A8V A;  1AE3 A;  4IAL A;  4QQB X;  1YHB A;  4LUO A;  3LGJ A;  1HR0 W;  4E6I A;  2JK8 A;  1VQP A;  1TU2 B;  4X3T A;  1Y69 U;  4DR1 L;  2KUM A;  3BJU A;  3HOX G;  4NXM L;  1JJ2 A;  2BH2 A;  1EL0 A;  1F2M A;  1A62 A;  4L5T A;  5ELN A;  3S1R H;  3T1Y Q;  4JI1 Q;  1TWC H;  2FFK B;  1FNW A;  4CBV A;  1DZ1 A;  4X66 L;  2R3Z A;  1K8O A;  3CC2 A;  4DU9 A;  1OXV A;  2EY1 A;  5I2X A;  1Q7Y C;  4JI8 Q;  5IP7 H;  4JI3 Q;  2R93 B;  1RKN A;  4JBW A;  1VQ7 A;  1S5F D;  4MHE A;  1VQD A;  5IT9 E;  2K28 A;  3C46 A;  5CBA E;  1HCZ A;  2HHH L;  1J6Q A;  1EOV A;  1UE1 A;  2XNA C;  1NJI C;  4A3F H;  4LF8 Q;  2K14 A;  5K36 G;  5AJ3 Q;  3P20 A;  4POF A;  1SNO A;  1I4H A;  1SNM A;  3GQB A;  2V4D A;  1VQL A;  1PMR A;  1PH7 A;  2AHO B;  2IX0 A;  2ZXP A;  4CDF C;  2Z9H A;  1V9P A;  1LAB A;  2IX1 A;  4IFD H;  4ME3 A;  2A6E D;  5E1F A;  4A75 A;  1B9M A;  3GTJ H;  2ALY B;  1K8A C;  3EA6 A;  3HOZ G;  4R4O A;  1EY4 A;  2K05 A;  1D1K A;  4HN7 A;  4DK3 C;  2A8V A;  3STB D;  4DV7 L;  1XX8 A;  2BCO A;  4GKK Q;  1PZK D;  1VQ6 A;  5FLX L;  2J0T D;  3D8G A;  4C3H G;  5FLM H;  2QIL A;  2QA4 A;  1QVG A;  1PH5 A;  2E8G A;  4HIM A;  3DWP A;  1X65 A;  3MXG A;  2R92 G;  4ABN A;  4RGO S;  3VYS A;  5KYL A;  4DFA A;  1X3Q A;  5M5Y B;  1VQ4 A;  4A3K H;  4GKJ L;  2K50 A;  4XQJ A;  3CXC A;  2HUG A;  2LXJ A;  1IL8 A;  1QE6 A;  1A0I A;  3LX0 A;  5J39 A;  1NMF A;  3K5L A;  1I94 Q;  1E2V A;  4DV3 Q;  1CT1 D;  4DXG A;  4JG2 A;  2RHQ B;  3BVM A;  5C44 B;  5C4X H;  1H9M A;  4DUY Q;  2K5N A;  2MUY A;  4DV1 Q;  2BE5 C;  2K32 A;  4JCV E;  4GZY C;  1K28 A;  5M5X B;  2D62 A;  5IGC A;  2JA8 G;  2Z6B A;  4XIG S;  1CKO A;  4IPH A;  4IOA A;  1Q90 A;  2KJX A;  4DUZ L;  4R8I A;  1B4O A;  3DWA A;  5D65 A;  3ULL A;  3MHB A;  5FLX c;  3UDX A;  1UUP A;  4NW2 A;  4V0B A;  1EFW A;  2JA6 H;  5CV4 A;  2EYM A;  3T51 B;  1SAP A;  1BBU A;  1LYL A;  3JAM L;  3PUX A;  3GTK B;  1E1O A;  5JEA H;  4LF4 Q;  2KBN A;  3S17 B;  2KHI A;  2ID0 A;  1BBX C;  1AH9 A;  1STA A;  4LF5 Q;  2EZV A;  1VQG A;  4X65 L;  5BR8 L;  2NWG A;  1TT2 A;  3NTH A;  2B2Y A;  2EYP A;  4JI0 Q;  1HNZ Q;  1AFP A;  2VZA A;  2NN6 I;  1XMQ Q;  4DR7 Q;  1IBM L;  1G2S A;  1EIG A;  4A93 B;  2TMP A;  4IUV A;  4FF2 A;  4IPC A;  4A3M H;  4QUF A;  2L5T A;  1QOH A;  3FMC A;  3PIP 3;  3BDC A;  1VQO A;  3GV3 A;  3NEN A;  1S72 A;  4RH6 A;  2PQA A;  1SDF A;  1Y8N B;  3FRP B;  2ZTC A;  3I4O A;  4LFC L;  2X69 A;  4C3I B;  1IBK Q;  2F3I A;  2NVY B;  3M4Q A;  4J8Q A;  2HCC A;  3JAM c;  3Q24 A;  4RA8 A;  1B1Z A;  2Z6K C;  1MD2 D;  4MZ9 A;  4F87 A;  1H9S B;  3S14 H;  2MPM A;  1LUZ A;  1WTX A;  2EXD A;  4MIU A;  4DK0 A;  1BKB A;  3TN2 A;  5LMN L;  5JJL A;  4O2D A;  4L5Q A;  2FMC A;  2B2T A;  1U5K A;  2E76 C;  4RFB A;  1F2Z A;  3K7A B;  3H3V I;  4DV5 Q;  2WAC A;  5EQ0 A;  1HNX Q;  3MFG A;  4C3J H;  1AE2 A;  3CD6 A;  1A6X A;  3U9O A;  3M4O H;  3NHH A;  5I4D A;  1TVX A;  3P7J A;  3TS2 A;  3NSW A;  3PF4 A;  3TP6 A;  1UE7 A;  1HZA A;  3HOU G;  4AQY Q;  4C2M H;  4KHV A;  3J81 L;  1WJJ A;  4A3E H;  4L5S A;  4DR6 Q;  1MBY A;  5C3X A;  1RCV D;  4J6H A;  3GTQ B;  4A3D G;  2B2V A;  5LMU Q;  2HT1 A;  2QW7 A;  3BVG A;  2F52 A;  3TZD A;  1LTA D;  3D3R A;  5KEE A;  2OTL A;  1KIX A;  1FJG Q;  3OWE B;  1MIU A;  2RF4 A;  4KHP L;  3T16 A;  3GTP B;  4A76 A;  1SMY C;  2F0E A;  1VF5 C;  2LFN A;  4IUQ A;  3MC0 B;  3OWF A;  1Q82 C;  1JJC B;  1BCP D;  3A8I E;  3CHB D;  4P71 A;  4B08 A;  1BBW A;  2B8F A;  2YYZ A;  4A3J H;  3IKJ A;  4K2K A;  4FF4 A;  3OIQ A;  3T56 B;  2KEN A;  3GTG B;  1LTR D;  5COR A;  2NN6 G;  1I50 B;  4LJZ C;  1ZYR C;  1B7Y B;  3J80 L;  3H0G H;  1WCM G;  5CYU A;  4A3B H;  5C0X H;  2BA0 A;  2UUC L;  4K0K L;  3EIV A;  1W6K A;  4IUN A;  1K3R A;  5EKI A;  4HIK A;  5CR3 A;  2VXW A;  4P74 A;  4YY3 L;  5HGT A;  2FMM A;  1FL0 A;  1O78 A;  4YHH Q;  4CDE C;  3M3Y H;  5C3E H;  3E6Z X;  2F0D A;  1H95 A;  4GLX A;  2FIN B;  3BG3 A;  3T1Y L;  1PXU A;  4JI1 L;  3WDN A;  4L5R C;  4PZ8 A;  2B2Y C;  2NVT B;  4JI4 L;  1CQV A;  3I4M G;  5IGB A;  1E2W A;  1M90 C;  5FK9 C;  4JI2 Q;  4JI8 L;  4JI3 L;  3TDQ A;  4BBR G;  2BDO A;  4JI5 L;  1HQM C;  2R93 H;  1IKL A;  3J81 j;  3J80 c;  1QZH A;  1XMO L;  5I6Y A;  2WB1 G;  3MXN B;  4GOP A;  3HKZ E;  4GS3 A;  2EPB A;  1V8Q A;  5FKA C;  4WRD A;  2SOB A;  5E7N A;  1HPC A;  4KKU A;  5AJ3 L;  4RKL A;  2Q8T A;  3PO3 B;  5I9O A;  3SDZ A;  1STY A;  2J4X A;  2F0M A;  1QCB D;  2KHS A;  3KBX A;  4OX9 Q;  3OSO A;  2F03 A;  1JOK A;  5JEA J;  3K57 A;  5M3M B;  2YV5 A;  2HD3 A;  3A7A B;  3H94 A;  2DN8 A;  5FO8 B;  2JA7 H;  3QR8 A;  3PV0 A;  4UY8 C;  5IYC G;  2ZT9 C;  1E0B A;  4FXK C;  5IYB H;  1SE4 A;  3RN2 A;  4YWK A;  2JA9 A;  1TY0 A;  5IWA Q;  1VF7 A;  2WIN B;  1EQQ A;  1B3Q A;  5J1Z A;  2IWH A;  1GVP A;  3F1Z A;  1B3A A;  4NKL A;  3AFQ A;  5JAV A;  3CCE A;  4ZK9 B;  1DOL A;  4WFN 3;  1NAP A;  4I65 A;  3U58 A;  2K4K A;  5GAE C;  1GUN A;  5M5Y H;  3RZO H;  4FNF A;  5GQO A;  1P8L A;  2H5X A;  1I94 L;  4K14 A;  1LTS D;  1HZ9 A;  3PUV A;  4DV3 L;  2RVL A;  3UDF A;  1ICW A;  2LSS A;  4OWX B;  1CUK A;  5ELO A;  4Y7N B;  4TKO B;  2WAQ G;  3Q22 A;  4DUY L;  1FR3 A;  4DV1 L;  1N9W A;  4XYQ A;  4OO1 I;  5C44 H;  2C35 B;  3E0E A;  3CF5 A;  4IJH A;  4IUR A;  4JBK A;  3NTK A;  1S3O A;  5JJI A;  5M5X H;  2WP8 J;  3K0X A;  5I9P A;  1ZEQ X;  2EY6 A;  1BNZ A;  1K8G A;  3SVM A;  2L11 A;  3ND8 A;  3STB C;  1IYJ B;  1YIT A;  2F0T A;  4OON A;  1VQN A;  4PMC A;  2TSS A;  3TS0 A;  2H4O A;  1PH2 A;  2E5L Q;  2HCI A;  1WVL A;  1Y1W B;  1VQI A;  4LAA A;  4A3I G;  2ENB A;  1S40 A;  2JSO A;  3CQZ B;  1HRJ A;  1ESR A;  4LF4 L;  2Z8L A;  1SYG A;  3DWQ A;  5C4J B;  1Q3L A;  4BS9 A;  3GTK H;  4HTH A;  3TRZ A;  4QIW B;  4J15 A;  4LF5 L;  4ZLT F;  3S17 H;  1HFG A;  1YNN D;  1KAB A;  2EJF C;  4MTK A;  4WJW A;  2AKW B;  4JI0 L;  1N34 Q;  5LMN W;  4FYD A;  1XTD A;  3CMA A;  5CV5 A;  1B44 D;  2XTI A;  4PQX A;  5A2Q L;  1CQF A;  1CZW A;  1KTK A;  3I2Z A;  2F0U A;  1XYI A;  1JOR A;  1XMQ L;  3KJP A;  5EAY A;  2RCF A;  4EGV A;  1JWS D;  1SYC A;  4L63 B;  4NDX A;  1C4Q A;  4A93 H;  1Z7T A;  3T13 A;  4CJ2 C;  3PIO 3;  3DEP A;  4FDB A;  4F8M A;  4HIO A;  1D5M C;  4HSV A;  1QUQ B;  5JPN C;  2N88 A;  3ZJY C;  1QWY A;  4A3C H;  1HUM A;  1IBK L;  3LWU A;  2ZM6 Q;  3FPU B;  4YCW A;  3I4N G;  2VUM G;  1LT5 D;  4C3I H;  4KKT A;  5ISR A;  2NVY H;  4R4C A;  4EX5 A;  3OTO Q;  1GUO A;  4KMU C;  5IOC A;  3KF6 B;  4BY1 G;  3AFP A;  3AYH B;  2K04 A;  2WII B;  4I7Z C;  3HS0 C;  2JA5 B;  1YBY A;  1NNX A;  5ELE A;  2L15 A;  2OQ0 A;  2PQE A;  1WTQ A;  1UEA B;  4AIM A;  1TXY A;  4LMQ D;  2ICI A;  1I4R A;  3MA2 B;  4DV5 L;  1HNX L;  1MHW C;  2FHT A;  2WKC A;  4APV A;  3K7A H;  3CW2 C;  4A3L G;  4OO1 G;  2F0G A;  1GHJ A;  4KY5 A;  3UE0 A;  4DNI A;  2D2C C;  1A3V A;  1ESF A;  2KQ3 A;  1HFN A;  4AYB E;  1KDB A;  3HFZ B;  1S5E D;  4DR6 L;  2EY2 A;  4N8X 1;  1XJV A;  4YCV A;  3T1H Q;  5DNF A;  1A15 A;  4R9W A;  1YI2 A;  3GTQ H;  3I72 A;  2KVM A;  2AUK A;  4IFD I;  3C2P A;  1UNS A;  3TQY A;  4ZRZ A;  4N8F A;  3I70 A;  5M3F G;  4G7Z C;  1LM0 A;  3GTP H;  1H9S A;  2Z4H A;  3TBI B;  1X3E A;  4FP5 D;  3NTI A;  1K9M C;  4K5X A;  4DV4 Q;  1VQF A;  5G3L F;  3TP8 A;  1NCV A;  2JQO A;  4H44 C;  3UE1 A;  4DV0 Q;  3ICE A;  1RF2 D;  2LMC B;  2QEJ C;  2O5J C;  3RNU A;  3F8T A;  2JN4 A;  4BY7 G;  3NBH B;  1I6H B;  3GTG H;  4CKC A;  1I50 H;  2DUD A;  5D3D A;  1DD2 A;  2O4X A;  3CCU A;  2YTY A;  4MTN A;  2MQH A;  4YHH L;  2OTJ A;  5I6W A;  5KIX A;  3K5M A;  3VR5 A;  2L12 A;  2IJ0 A;  1ILQ A;  5JOB A;  3HGB A;  3VDY A;  3A0J A;  3CC7 A;  5GAD C;  1VMP A;  1PTO F;  3PO2 B;  4X3S A;  4CKE A;  1EYA A;  1BCP C;  3OIP A;  2NVT H;  3S1M B;  5IP7 G;  4JI2 L;  1EZ6 A;  1UEB A;  3GTL B;  3W5O A;  4HJ7 A;  1EY7 A;  3HOV B;  1MI2 A;  3RLO A;  1VQB A;  1RJT A;  5DEH A;  1M1K C;  4QL5 A;  3QJY A;  4A3F G;  1WCM B;  1FGB D;  3TSS A;  1CHQ D;  2KCN A;  3S24 A;  1UAP A;  5FJ8 H;  3KLS X;  2AWO A;  5GAH C;  2MP1 A;  2I46 A;  2UXD Q;  1K0R A;  4ZUJ A;  3FKI B;  2K5H A;  2IL8 A;  3PO3 H;  3PF5 A;  1DYQ A;  4BA2 I;  1X3F A;  4M1U B;  2UXC Q;  3F2D A;  4IFD G;  2Z6K A;  1GM5 A;  3S14 B;  3ERS X;  1BXT A;  4XQQ A;  1JOO A;  4OXP A;  1J5E L;  3BS1 A;  2F0W A;  3UI2 A;  1SYD A;  5M3M H;  1BVS A;  1O7I A;  4LNQ A;  3R93 A;  4LF6 L;  1SXT A;  3SGI A;  1IW7 D;  2F0O A;  5IWA L;  5FLM G;  1EQV A;  3IL8 A;  1PH6 A;  3I7F A;  3U9S A;  3X3N A;  5DLQ E;  3NUC A;  2CW0 D;  2ZXR A;  2R7Z B;  1DON A;  1EWC A;  4OGQ C;  3BZC A;  1F2L A;  3MXN A;  4ZKB B;  3HZX A;  1EY5 A;  2O2L D;  2MGS A;  1QNU A;  3OYY A;  1RDP D;  4A3K G;  1SN8 A;  4CDD C;  5HY6 A;  3MWY W;  4JBM A;  3F2U A;  3U4V A;  1WFQ A;  2UUB Q;  2WB1 E;  1I4P A;  1L1O B;  1T5E A;  2NYZ D;  1BUV T;  1EYD A;  2X6G A;  5ELC A;  4V19 0;  1F9R A;  1SYF A;  2M2L A;  5F2D A;  3CRL C;  1CKM A;  1OXT A;  1JWU D;  5C4X G;  2BH8 A;  5J3B A;  4Q5V A;  3NXW A;  5L37 A;  3NK9 A;  3IAY A;  5COY A;  2Z4I A;  1CK1 A;  2KOL A;  2F4I A;  3EJI A;  3NPP A;  4KN4 C;  1BCP B;  2WFW A;  1QJO A;  4ZAI A;  2PI2 A;  3A8K E;  4KJO A;  3J81 E;  2Q2H A;  3ERO A;  2JA6 G;  2PPB C;  4PMW A;  1N36 Q;  5CGK A;  2E5L L;  1I3Q B;  4UHV A;  4RHS A;  3T4A C;  4JW0 A;  5JEA G;  1Y1W H;  1O7L A;  1NSN S;  1Q1E A;  3L7Z C;  4WOR A;  2VQE L;  5GRO A;  1SYE A;  3CQZ H;  2SNM A;  4B3R L;  1PTO B;  2I0Q A;  1EY6 A;  3I4L A;  5C4J H;  3R8B A;  4NB3 A;  4KN7 C;  4NP5 A;  4DXF A;  1N34 L;  2OEO A;  2IY5 B;  3RMH A;  5HGQ A;  1V1O A;  2F0L A;  3E3X A;  1GOZ A;  3HEJ A;  1LTG D;  4XQN A;  5CV6 A;  5M9O A;  1AZQ A;  2L4N A;  2Y0S G;  3AB9 A;  1A2U A;  2P5Z X;  2E2I B;  3PUY A;  5C0X I;  2A69 D;  1QB5 D;  4K8J A;  3K81 C;  2VNU D;  1D8L A;  4ZYS A;  4A3M G;  1BF4 A;  2VQF Q;  3V2T A;  1GKH A;  3JAM i;  2WAQ E;  4EQ5 A;  1L0Y B;  2XVS A;  3A54 A;  1JR0 D;  4AYB G;  3HOW B;  1FGU A;  1D5Z C;  5D14 A;  1JMC A;  2ZM6 L;  1UWV A;  1DCZ A;  2AWN A;  4XT3 B;  5IGG A;  2KCM A;  4P72 A;  3W1G A;  3V05 A;  1FVI A;  5IT9 L;  3E9I A;  2F3V A;  2B8G A;  1Y1V B;  1F9S A;  1TS4 A;  3I55 A;  1CHP D;  4IZ8 A;  2IT1 A;  4RWS C;  2JYO A;  2I5H A;  1SJH D;  4QJF A;  1VQJ A;  2RSO A;  2DY8 A;  1WTO A;  2JA5 H;  5IYD H;  1SLJ A;  1EIY B;  1YNN C;  4HJ8 A;  1HTL D;  1TWH B;  4RCN A;  5LL6 S;  3OOC A;  1Z9F A;  4AH6 A;  2D0O A;  2ZTE A;  4UAI A;  4FVM A;  2G9D A;  2NZH A;  1U4R A;  4C3J G;  2A6H D;  1JE4 A;  1IL2 A;  1TS2 A;  4R8N A;  1WTH A;  1Q8I A;  1LTL A;  1BOS A;  3ERQ A;  2E74 C;  3PSI A;  3S9W A;  4B3S Q;  5ELF A;  4GN3 B;  1H9J A;  3A8J E;  4HCS A;  3AU7 A;  4A3E G;  1JB3 A;  1CA6 A;  4DAP A;  1MSH A;  3T1H L;  2RCN A;  5JVG 3;  2HQL A;  1QUQ A;  4HJ9 A;  1JQY D;  1EZ8 A;  2K5W A;  1NMG A;  2B63 B;  4BBS B;  5IT9 c;  1TWF B;  5EBD A;  5G3L D;  3KF6 A;  2IHF A;  3CP0 A;  4IOC A;  5JVH 3;  4JI6 Q;  2XN9 C;  3J7Y W;  4JVZ A;  5CV7 A;  1TS3 A;  4DV4 L;  1BDO A;  4A3J G;  4DV0 L;  4RG1 A;  1S5B D;  2PW7 A;  1I4X A;  3BZD B;  1JCK B;  2RQX A;  1CM9 A;  3ZYY X;  4DV6 Q;  3BYT B;  2ZJR A;  3J81 i;  5H1S E;  1GJX A;  3M4P A;  4RGM A;  3NBI A;  1X6O A;  2XWJ B;  3H0G G;  1I6H H;  4A3B G;  5C0X G;  2NTS A;  3F2B A;  3KDF B;  1KD1 C;  1M4V A;  3A7L A;  1PRT D;  3WWV A;  3FVQ A;  4A3G B;  1QNK A;  4B3T L;  2EYF A;  3P75 A;  4IFD J;  1PH3 A;  1CKN B;  1YEZ A;  4X3K A;  5IOD A;  4GNX B;  2PNH A;  4WJ4 A;  3EQL C;  5C3E G;  2IHE A;  4HAE A;  1L0W A;  3KJO A;  1N8R C;  1IHZ A;  1PH4 A;  1VCI A;  1N33 Q;  1JJG A;  1J9O A;  4DV2 Q;  4OIJ A;  1PTO D;  3NQI A;  4CDC C;  3M85 A;  3DHQ A;  1Z47 A;  2ICE C;  4R4I A;  1ROD A;  2N78 A;  3KUP A;  3A74 A;  4HJA A;  4CJ0 B;  1SNP A;  3E9H A;  3PO2 H;  1PVO A;  3FHW A;  4OEM B;  2N3S A;  3PMF A;  3HP3 A;  1Y8O B;  2DJF C;  2LXK A;  5NUC A;  3S1M H;  1NR4 A;  1SJE D;  2CH4 A;  2R93 G;  3NBH A;  3GTL H;  1HQR D;  3U50 C;  2HQE A;  2NVX B;  2RDH A;  3HOV H;  4PZ6 A;  4KI0 A;  2XGT A;  1YNJ C;  3VR2 A;  1Y14 B;  2E2H B;  1KXL A;  2IPK D;  3HKZ B;  1F2Y A;  2B3G A;  5C5M A;  2UXD L;  3SK5 A;  3URY A;  2F4V Q;  1C48 A;  3CCM A;  3FKI H;  1DJR D;  5FOB B;  4HSP A;  3HOY B;  2UXC L;  4LF8 L;  1ENC A;  1DM0 B;  3KFU A;  1XPO A;  4DR1 Q;  1G8Z D;  1PYS B;  3CRK C;  1JT8 A;  4J1M A;  3W2D A;  4U68 A;  1LT4 D;  3H09 A;  2F0V A;  3W3A A;  2JA7 G;  3NP8 A;  2CVR A;  5IYB G;  3CPW A;  5IIF A;  3K5N A;  2NTT A;  3D4W A;  4DF7 A;  3MTS A;  1EIF A;  3I3C A;  3HOX B;  5FO7 B;  2LS0 1;  4OWW B;  4F7X A;  1ENF A;  3F2C A;  2ZJQ A;  1ASZ A;  1X32 A;  4IUP A;  4M8A A;  2R7Z H;  4JBJ A;  1FNU A;  3PGZ A;  1SNC A;  1K83 B;  5IY0 A;  4GKK L;  4KLK A;  1QIL A;  2E2D C;  4KHZ A;  1XXG A;  4LF7 Q;  1KNA A;  1PLF A;  1SE3 A;  4QY7 A;  2XRQ D;  5J22 A;  3SXH A;  5IP9 H;  2NBF A;  1I4Q A;  1CFM A;  5D3I B;  5ELB A;  4NMZ A;  2SDF A;  2L1B A;  5E4X A;  3I91 A;  4KD4 A;  5C44 G;  4JYA Q;  2L0C A;  5JJK A;  3G6E A;  4HED A;  3D0F A;  2VL6 A;  2K7V A;  1R9T B;  1SRO A;  1JOQ A;  5KNB A;  3PUW A;  3SHL A;  3MXU A;  1L0X B;  4XT1 B;  3N6R A;  1SFO B;  1PZI D;  3Q6S A;  5C3W A;  1XNR Q;  4B3M Q;  1IW7 C;  2Q2U A;  1N36 L;  3D31 A;  3O13 A;  5EPK A;  3BDL A;  4YCU A;  2A6E C;  1K8M A;  4PV1 C;  1X55 A;  2CW0 C;  1I3Q H;  2AQ3 B;  3HOZ B;  4ZKC B;  3J7Z C;  1LO5 D;  1KC8 C;  2K5D A;  4OEL B;  3TP7 A;  2VW9 A;  4DR3 Q;  4ILW A;  3FP9 A;  2LKV A;  4JK1 C;  4A3K B;  3K0Y A;  1E1T A;  1PTO H;  1P16 A;  1T9H A;  2I5M X;  4C3H B;  1L1O A;  3ND9 A;  3OPO A;  4GKJ Q;  3A5U A;  1STB A;  2LY7 A;  4GLV B;  4JOI C;  1GD7 A;  1OXX K;  2R92 B;  3FEW X;  2PO4 A;  2KED A;  1ONL A;  1ASY A;  3S2H B;  2K5V A;  4UPA A;  1WTR A;  1LTB D;  1SE2 A;  2OWO A;  1V1P B;  2E2I H;  1HNZ L;  4A93 G;  2KEE A;  1PYW D;  2VQF L;  4RHR A;  1KRS A;  2F0N A;  1WTW A;  4LFB Q;  1YHQ A;  1MGS A;  2QF7 A;  5HUR A;  5GAG C;  4DUZ Q;  4DR7 L;  2EQS A;  2VB2 X;  2QDL A;  3HKS A;  3S16 B;  3HOW H;  1MKH A;  4A3C G;  2B2U A;  2A5H A;  2GVA A;  3VA5 A;  4DR4 Q;  2PQA B;  1OXU A;  4YWM A;  1II3 A;  2Z1C A;  4C3I G;  2JA8 B;  4KK7 A;  2MO1 A;  1F9Q A;  3B6Y A;  3RLN A;  3SK6 A;  1CSP A;  1W3S A;  2K01 A;  4TRD A;  1VQH A;  1Y1V H;  1PFB A;  1RIP A;  3HG9 A;  4RAU C;  2ZJP A;  2A68 D;  1KRT A;  3CCL A;  2RHS B;  2A74 C;  2VS1 A;  5BR8 Q;  2WV6 D;  4L8J A;  5C0X J;  3PIP A;  1IBL Q;  1HZC A;  1QZG A;  2EYH A;  2G5D A;  1TWH H;  1ET6 A;  5I2Y A;  1KDA A;  4ULL A;  3S2D B;  3K8A A;  2AQ2 B;  1HXY D;  4B3S L;  2PNR C;  2M00 A;  4BXX H;  3QIA A;  2A69 C;  3ER0 A;  4JI7 Q;  2EXZ A;  2FXQ A;  5EPJ A;  2Y0S E;  4TSS A;  4IO9 A;  1D7Q A;  1EYG A;  1EWI A;  4MNO A;  1Q81 C;  1NBW A;  5C4H A;  1SE8 A;  1TKW B;  4AYB B;  3KF8 B;  3OW7 A;  1EIH A;  2ATW A;  1STN A;  2FJ2 A;  3TRE A;  2PMZ E;  2K52 A;  4LFC Q;  4AQY L;  2B63 H;  3DEO A;  3PQI A;  4BBS H;  3GTO B;  4QGU A;  1HH2 P;  1KLG D;  3NWT A;  1TWF H;  2EDG A;  3BYY B;  3AMU A;  5LMU L;  1V1Q A;  2ASB A;  3WOE A;  1VQ8 A;  1O80 A;  1MJE A;  2CQO A;  4PZ7 A;  2F0J A;  3GV6 A;  1X9N A;  1FJG L;  4QB4 A;  4DV6 L;  2ZTD A;  3Q23 A;  4GN4 B;  3FDT A;  1V43 A;  3K7U C;  1AEX A;  2A6H C;  3KOJ A;  1PYB A;  2Z0S A;  4TVA B;  1OO9 B;  3OMC A;  4KTA A;  1S5C D;  2CWP A;  5BN3 A;  5FLX E;  5C5L A;  3AEV A;  1PHJ A;  3D6C A;  1VS0 A;  4A4I A;  4A3G H;  3EFX D;  4CJ1 B;  1N32 Q;  1LT3 D;  4Q0F A;  3H3V C;  4CKB A;  1N33 L;  2RBM A;  5CMD A;  4BA1 I;  3GP7 A;  4X64 Q;  4DV2 L;  1F9P A;  1PH9 A;  2K03 A;  1B8A A;  1WTP A;  3EN2 A;  1XPR A;  1HTP A;  2PYK A;  1C7Y A;  2IW3 A;  2Q8I B;  1D5X C;  3HOU B;  4P75 A;  3NE5 B;  2UXB Q;  1PRT F;  2C5C A;  1L1O C;  4A3D B;  1W6J A;  4X62 Q;  2GVB A;  5CV9 A;  4IQZ A;  3NEL A;  1PA6 A;  1GHK A;  4FF1 A;  2L9H A;  2G9H D;  5KYI A;  2OCE A;  1EOT A;  1EY8 A;  1ML0 D;  2XSC A;  3MVV A;  3L0O A;  3BZK A;  3VYU A;  3L2P A;  1C8C A;  2NVX H;  3KDF A;  3M4Y A;  1G51 A;  4ALP A;  5FJ8 G;  2F0K A;  3R3O A;  1OTC A;  2E2H H;  4L6T B;  3QOJ A;  1CKN A;  1PFS A;  3PO3 G;  2B2U C;  2E2J B;  4GNX A;  1ET9 A;  4EVO A;  1A63 A;  4IN3 A;  4KJN A;  3JAM E;  4YY3 Q;  1UE5 A;  2DGY A;  2UUA Q;  2EVB A;  2SNS A;  3TME A;  1KNE A;  1A3T A;  3HOY H;  4GLA C;  5C6A A;  1PTO C;  1EFI D;  2K33 A;  5M3M G;  1LTT D;  1D1I A;  2CWA A;  1T5X D;  2B2W C;  2IX3 A;  2AQ1 B;  4DNT B;  1YJN A;  4KY6 A;  1WYD A;  1JE5 A;  4QCL A;  2MNA A;  4OX9 L;  4LUZ A;  3A55 A;  4JI4 Q;  2F0F A;  3AQQ A;  5BN5 A;  2RSN A;  2XIW A;  3TP5 A;  4G7O C;  3HOX H;  4XTC S;  1VQK A;  4JI5 Q;  2BDN A;  3H91 A;  4N9T A;  4OWT B;  3C3L A;  3I4M B;  2N55 A;  1XMO Q;  1KQS A;  4I7A A;  2JEB I;  1K83 H;  1IYU A;  1TQO A;  1VQ5 A;  4LF7 L;  4BBR B;  4U67 3;  2NVQ B;  1XPU A;  1I5F A;  1YJ9 A;  2WB1 B;  5IGF A;  1SBB B;  1B9N A;  1PH1 A;  4DAV A;  4JYA L;  1CTM A;  2QDB A;  1EEF D;  2WKD A;  1DOK A;  3OHX C;  3RZD B;  5K36 H;  3U4Z A;  3X3M A;  1R9T H;  2JJQ A;  3VYR A;  2UU9 Q;  1IXR A;  4JC0 A;  4X3U A;  3NQT A;  4EQN A;  1XNR L;  1HR0 Q;  1GUG A;  2JEA I;  2JA7 B;  4B3M L;  3QOL A;  1SFO H;  1TY2 A;  1Q46 A;  2KCT A;  3RLF A;  4Y7N H;  1HHV A;  4P73 A;  3H15 A;  5DM7 3;  4S3S A;  3VR3 A;  1M8A A;  5KRU A;  1NE3 A;  1FYC A;  3MAQ A;  5DAU A;  3WOF A;  1Y1W G;  3GO5 A;  2BA1 A;  3S1Q B;  1K3B C;  1GUW A;  3KLR A;  3E5S A;  3RD4 A;  3UDG A;  3V96 A;  4HCE A;  1PRT B;  1XWE A;  3C1E A;  4DR3 L;  4N9P A;  3HOZ H;  2R61 A;  4IJL A;  3G48 A;  4IPD A;  1HNW Q;  3TZU A;  3RZO B;  2M9V A;  4C3H H;  4B9W A;  3K80 C;  3GD7 A;  5JJZ A;  1TWG B;  2CFM A;  3HRZ C;  2R92 H;  3PUZ A;  3RUZ A;  3S2H H;  4R1J A;  5CC4 A;  4DAY B;  1RTN A;  2JE6 I;  3SEB A;  1WD1 A;  1W2B A;  1Q86 C;  4LFB L;  2GA4 B;  3IRB A;  1Q12 A;  1JWM D;  2X6L A;  1LTI D;  1XNQ Q;  1PDQ A;  5EKK A;  2WAQ B;  3J80 E;  1VQ9 A;  5E4W C;  5EBC A;  1VQE A;  4H0L C;  1ICF B;  4G7H C;  4DR4 L;  3S16 H;  5EJW A;  2VB3 X;  2K75 A;  1R4Q B;  1BR9 A;  4DAM A;  1STG A;  2F0P A;  3M9B A;  2JA8 H;  1A2T A;  1ZXT A;  4R4Q A;  5FO9 B;  4DR5 Q;  4GNX C;  2JA5 G;  5IYD G;  5T1G A;  1EEI D;  2F0Q A;  4A3I B;  1KLU D;  1IBL L;  3OTO L;  4K6D A;  4C56 C;  3S15 B;  4K5W A;  3PIO A;  3CCJ A;  2R7F A;  4WJ3 M;  1IYV A;  1LLR D;  3MZ5 A;  1V1P A;  3MEH A;  3LNN A;  3S2D H;  1BQQ T;  1TS5 A;  4DNR B;  1NUC A;  4JI7 L;  4X6A H;  1VDZ A;  3I90 A;  4BWG B;  3PCO B;  4LFA Q;  4KV6 A;  1EWH A;  4GN5 A;  5IGD A;  4DR2 Q;  1WTV A;  4OIK A;  1G2T A;  1SR3 A;  2Q2T A;  1CI3 M;  4TQU S;  1YNX A;  2I5L X;  4CHT B;  1H9R A;  1RD9 D;  1EQT A;  1YHA A;  3N52 A;  4LK1 C;  2JP1 A;  1NY4 A;  1MSG A;  3K5O A;  1UE6 A;  4OHJ A;  2N49 A;  1AN8 A;  4JV5 Q;  5TSS A;  3JC6 6;  2V1C C;  4C1N I;  3DMU A;  3G6J B;  3GTO H;  3L9A X;  3MFY A;  3QG1 A;  3DLL A;  4FO2 A;  2A68 C;  2KA7 A;  1U4M A;  3VR6 A;  2BOS A;  3M7N A;  3I4N B;  2GN5 A;  2VUM B;  2CKZ B;  3BU2 A;  3TEH B;  1HZB A;  4BY1 B;  3CPF A;  3R2T A;  5M5W B;  3S1N B;  4KY7 A;  2DY7 A;  1VQA A;  3K59 A;  4FXG C;  4H13 C;  1U0L A;  2QEX A;  2D9U A;  3D4R A;  3D6W A;  1B50 A;  4QMG A;  1WOC A;  1N32 L;  4RGT A;  2CCZ A;  3KF8 A;  3SR1 A;  4Y52 H;  1LT6 D;  1VMC A;  4X64 L;  2B29 A;  4QUC A;  4B9X A;  3CCR A;  4RGN A;  2QKI C;  3GTM B;  4G57 A;  1STH A;  1BO0 A;  1A3U A;  4K6L A;  2UXB L;  2YU9 B;  1HJP A;  2XWB B;  3HOU H;  3W1B A;  3PO2 G;  3CU7 A;  3P1H A;  4JOI A;  3RR5 A;  3UDI A;  4X62 L;  3CCV A;  4NXN Q;  3CKI B;  2K1B A;  2NZO A;  2NZ1 D;  4A3D H;  3I56 A;  3CC4 A;  3K58 A;  1TWA B;  4PMB A;  3HOV G;  1GXD C;  1B70 B;  3J80 i;  3R2I A;  5M3F B;  1U4L A;  1C9O A;  1SMX A;  3EVQ A;  4DKA C;  3J7A V;  2KHJ A;  1GUS A;  3RN5 A;  3KK7 A;  4BY7 B;  4LF9 Q;  4XDX A;  3J81 c;  3FKI G;  1E3P A;  5C4Z A;  4PNY A;  4UDU C;  2NN6 H;  2QGQ A;  2E2J H;  2N8N A;  2UUA L;  1GO3 E;  2K6A A;  2A73 B;  1WCM H;  2R7D A;  1R4P B;  3G4S A;  4HR7 B;  2ZXO A;  1LV9 A;  4O1N A;  1NR2 A;  1XTC D;  2DNE A;  2PW5 A;  2DJG C;  3D4D A;  2RDG A;  5EPL A;  3SK8 A;  3ULP A;  1HUN A;  5A2Q E;  3CCQ A;  3IFT A;  2OT2 A;  4HMI A;  2SEB D;  1CSQ A;  3Q0A A;  3G71 A;  3A56 A;  3QO2 A;  1WI5 A;  1RL2 A;  4K2L A;  1KHI A;  1MJC A;  3BDO A;  5IE8 A;  3S1R B;  2HIV A;  4NXM Q;  1TWC B;  2R7Z G;  1SEB D;  2F1M A;  3DM1 A;  4X66 Q;  2EYO A;  2J7Z A;  3I4M H;  2CH4 W;  1EQR A;  3EBE A;  1I4G A;  3KLW A;  1YIJ A;  5IP9 G;  1VQM A;  1EU3 A;  3BVZ A;  4BBR H;  1G29 1;  3H3V H;  4EQO A;  2NVQ H;  1D2B A;  3OW2 A;  5ELD A;  2HIX A;  3DXJ C;  1EU4 A;  4A3F B;  2HDL A;  1C0A A;  2HHH Q;  4G4K A;  2EE1 A;  2UUB L;  2VY3 A;  4DK6 C;  1J5E Q;  3CCS A;  2HDM A;  4P2C B;  2UU9 L;  1X54 A;  3RZD H;  2A1A A;  3KYH C;  4IPG A;  4H02 A;  1HR0 L;  2A19 A;  2B2T C;  4LF6 Q;  1OXS C;  2BE5 D;  3GTJ B;  1SSO A;  4KKS A;  1E7Z A;  2ES2 A;  2YTV A;  2CHB D;  2MJ8 A;  3KLS A;  2QCP X;  1F77 A;  2EIF A;  3S1Q H;  2PI2 E;  3I73 A;  3G7L A;  4ZUI A;  1LAC A;  4O42 A;  4DV7 Q;  2OXP A;  1ILP A;  5IYC H;  1HNW L;  1G6Z A;  2Q2I A;  5KNC A;  4HJ5 A;  1G91 A;  2KEC A;  3SK4 A;  1EY9 A;  1HA5 A;  2B2V C;  2PCF B;  4ZCK A;  2I07 B;  1J8I A;  2F0S A;  5CV8 A;  1QVF A;  2PZW A;  1O7Y A;  3C1F A;  1B2T A;  1TWG H;  2JXM B;  4YWL A;  2YTX A;  1K0S A;  1Z6H A;  2EJG C;  1PZJ D;  2MO0 A;  3DUZ A;  4R4T A;  1PH8 A;  2EYL A;  4DA2 A;  2L55 A;  4C1N K;  5LL6 X;  2MFI A;  4IUU A;  2DNC A;  1U4P A;  2EYJ A;  2OQK A;  3NWS A;  3I8Z A;  3OMG A;  5LHY 1;  1HA6 A;  2D0P A;  3T53 B;  1XNQ L;  5C4X B;  3HOW G;  1JIC A;  1GUT A;  1CZG A;  3H6M A;  3GDE A;  5DM6 3;  3QB3 A;  4JPB W;  3K6O A;  1VQC A;  5KND A;  4HID A;  4UP8 A;  1JC7 A;  1D6E C;  1Y1V G;  3A5Z B;  2VQE Q;  4DR5 L;  2H1E A;  4KD3 A;  4B3R Q;  2JA6 B;  1EUJ A;  3VA7 A;  3Q8D A;  4POG A;  3J7A 5;  1Q1B A;  3NEM A;  2RKS A;  3CME A;  1DXM A;  2PZU A;  2RDF A;  4RCO A;  4O0A A;  5BN4 A;  4A3I H;  1YVC A;  4QIW E;  3S15 H;  1YJW A;  1PFM A;  4DAY A;  1E2Z A;  2B2W A;  3ULJ A;  4BXX G;  1S4Z A;  2Q8R E;  4ODG A;  4F88 A;  5E3F A;  3CAM A;  4X65 Q;  4LFA L;  1E22 A;  1EY0 A;  1U9R A;  4OL7 A;  1ZKO A;  4DGZ A;  1QG7 A;  2OF1 A;  4DR2 L;  1I6V C;  1FNV A;  2Y0S B;  2C9O A;  1SYB A;  1PV4 A;  1DGS A;  4ZQ3 A;  2R6G A;  4IUT A;  1X3G A;  1G6P A;  2D5D A;  4K5V A;  4FXD A;  3ITP A;  1IBM Q;  4ID6 A;  2B63 G;  4A3M B;  4BBS G;  4DN4 M;  4JV5 L;  4GOP C;  4MN3 A;  2PMZ B;  2F3W A;  4XXE A;  4UP9 A;  2EJM A;  5A35 A;  2F0H A;  1KL9 A;  3MEF A;  2RA4 A;  1STE A;  1SRU A;  1AW7 A;  1O7Z A;  3I4N H;  2VUM H;  1SMY D;  2K5Q A;  4JI6 L;  2EOT A;  4H7B A;  1PFN A;  3VYT A; 
#chains in the Genus database with same CATH homology
 4BY1 H;  3PV0 A;  1QUQ A;  5IYC G;  4UY8 C;  4HJ9 A;  4JYA L;  5M5W H;  5IYB H;  3RN2 A;  4YWK A;  2JA9 A;  5IWA Q;  3S1N H;  4RMF A;  1EQQ A;  1NMG A;  5LMN Q;  1JB7 A;  1GVP A;  4A3G G;  5IT9 c;  4DPG A;  3U4Z A;  1KAW A;  3F1Z A;  1R9T H;  2JJQ A;  2IHF A;  3KF6 A;  3CP0 A;  4LW1 A;  2UU9 Q;  4IOC A;  1K73 C;  3AFQ A;  1IXR A;  4JC0 A;  3CCE A;  1XNR L;  2JEA I;  1HR0 Q;  4JI6 Q;  4B3M L;  4DV4 L;  1SFO H;  4PG3 A;  1NTG A;  1Q46 A;  2KCT A;  3RLF A;  4Y7N H;  4A3L H;  4A3J G;  4DV0 L;  4RG1 A;  1Q8K A;  2K4K A;  4P73 A;  5GAE C;  3H15 A;  3U58 A;  5M5Y H;  3RZO H;  1NE3 A;  4DV6 Q;  5GQO A;  1P8L A;  1X56 A;  2H5X A;  2BA1 A;  3GO5 A;  2ZJR A;  1Y1W G;  3GTM H;  1I94 L;  3J81 i;  1HZ9 A;  3PUV A;  5H1S E;  4DV3 L;  3M4P A;  3UDG A;  2YU9 H;  1X6O A;  3H0G G;  4NXN L;  2LSS A;  3UDF A;  4OWX B;  3DM3 A;  4DR3 L;  3HOZ H;  4A3B G;  1CUK A;  5ELO A;  5C0X G;  1I6H H;  2WAQ G;  3F2B A;  3KDF B;  4IJL A;  4DUY L;  4DV1 L;  1KD1 C;  1N9W A;  4OO1 I;  3G48 A;  4IPD A;  5C44 H;  2C35 B;  1HNW Q;  3E0E A;  3WWV A;  1E24 A;  3CF5 A;  4IJH A;  4JBK A;  4C3H H;  1L2F A;  4B3T L;  3K80 C;  1S3O A;  5JJI A;  5M5X H;  4KHP Q;  3GD7 A;  4IFD J;  1TWA H;  2WP8 J;  1PH3 A;  3K0X A;  1CKN B;  1YEZ A;  2CFM A;  2R92 H;  3PUZ A;  2PNH A;  4GNX B;  1K8G A;  4WJ4 A;  5C3E G;  5M3F H;  2IHE A;  3KJO A;  1L0W A;  1N8R C;  1PH4 A;  1N33 Q;  3S2H H;  1VCI A;  4R1J A;  3STB C;  1JJG A;  1IYJ B;  1YZ6 A;  4DAY B;  4DV2 Q;  1YIT A;  2JE6 I;  4OON A;  1VQN A;  3M85 A;  1Z47 A;  3TS0 A;  3HKZ G;  1PH2 A;  2E5L Q;  4LUV A;  4R4I A;  1VQI A;  1W2B A;  4A3I G;  1QVC A;  1S40 A;  4UP7 A;  1Q86 C;  2N78 A;  3IRB A;  4B3T Q;  4LF9 L;  4LFB L;  1Q12 A;  4LF4 L;  3A74 A;  4HJA A;  4BY7 H;  4NPS A;  1XNQ Q;  4LWC A;  3GTK H;  3E9H A;  3PO2 H;  1PVO A;  3TRZ A;  1VQ9 A;  3FHW A;  2AMC B;  4J15 A;  1VQE A;  4GOP B;  4LF5 L;  3HOY G;  2N3S A;  3S17 H;  4DR4 L;  2LXK A;  3S16 H;  3S1M H;  2AKW B;  2UUC Q;  1N34 Q;  5LMN W;  4JI0 L;  1XTD A;  2R93 G;  2F4V L;  3GTL H;  3U50 C;  2K75 A;  3CMA A;  4K0K Q;  1IZ6 A;  4DAM A;  2XTI A;  3M9B A;  2JA8 H;  3HOV H;  4PZ6 A;  3I2Z A;  1A8V A;  1AE3 A;  2XGT A;  4KI0 A;  1YHB A;  4LUO A;  3LGJ A;  4R4Q A;  1HR0 W;  1XMQ L;  1Y14 B;  3KJP A;  4DR5 Q;  5EAY A;  2JK8 A;  1VQP A;  4GNX C;  2JA5 G;  5IYD G;  1KXL A;  4DR1 L;  3BJU A;  3HOX G;  4NXM L;  1JJ2 A;  2B3G A;  2BH2 A;  2UXD L;  1A62 A;  4A93 H;  4L5T A;  1IBL L;  3OTO L;  5ELN A;  3S1R H;  3PIO A;  3T1Y Q;  3CCJ A;  2F4V Q;  4JI1 Q;  1TWC H;  2R7F A;  4FDB A;  3CCM A;  4HIO A;  3FKI H;  4WJ3 M;  4X66 L;  4LF8 L;  2UXC L;  4QQB X;  3CC2 A;  3KFU A;  3S2D H;  1QUQ B;  1OXV A;  1XPO A;  3ZJY C;  4JI7 L;  1Q7Y C;  4A3C H;  1IBK L;  4X6A H;  4JI8 Q;  5IP7 H;  2ZM6 Q;  4JI3 Q;  3PCO B;  4LFA Q;  4YCW A;  4DR1 Q;  3I4N G;  1PYS B;  2VUM G;  1JT8 A;  4C3I H;  4JBW A;  1VQ7 A;  2NVY H;  4GN5 A;  4DR2 Q;  4R4C A;  4EX5 A;  3OTO Q;  1VQD A;  3KF6 B;  2JA7 G;  4BY1 G;  1SR3 A;  2Q2T A;  3AFP A;  2HHH L;  1J6Q A;  1EOV A;  3AYH B;  4TQU S;  5IYB G;  3CPW A;  1UE1 A;  1YNX A;  2I5L X;  1YBY A;  1NJI C;  4A3F H;  1EIF A;  1YHA A;  4LF8 Q;  2K14 A;  2L15 A;  2OQ0 A;  4OWW B;  1NY4 A;  5K36 G;  1UE6 A;  5AJ3 Q;  2N49 A;  3F2C A;  2ZJQ A;  4POF A;  4AIM A;  1ASZ A;  4JV5 Q;  1TXY A;  3JC6 6;  2V1C C;  2R7Z H;  4JBJ A;  1VQL A;  4DV5 L;  1HNX L;  1PH7 A;  2AHO B;  3GTO H;  2IX0 A;  4APV A;  3K7A H;  3PGZ A;  3CW2 C;  5IY0 A;  4A3L G;  4OO1 G;  4GKK L;  4KLK A;  3DLL A;  1V9P A;  4KHZ A;  3UE0 A;  4DNI A;  2IX1 A;  4ME3 A;  4LF7 Q;  3M7N A;  2GN5 A;  4A75 A;  4QY7 A;  3GTJ H;  2CKZ B;  5IP9 H;  2ALY B;  4AYB E;  3HFZ B;  3BU2 A;  3TEH B;  1HZB A;  1K8A C;  3HOZ G;  4R4O A;  4DR6 L;  3CPF A;  1XJV A;  2A8V A;  4DK3 C;  4YCV A;  3T1H Q;  3STB D;  4DV7 L;  1YI2 A;  4LFB Q;  5C44 G;  4JYA Q;  4GKK Q;  1VQ6 A;  1VQA A;  3GTQ H;  5JJK A;  3G6E A;  5FLM H;  3D0F A;  2VL6 A;  2QA4 A;  1QVG A;  4IFD I;  1PH5 A;  1U0L A;  2E8G A;  1SRO A;  4HIM A;  2QEX A;  3TQY A;  1X65 A;  3PUW A;  1WOC A;  1N32 L;  2R92 G;  2CCZ A;  5M3F G;  1LM0 A;  4Y52 H;  3GTP H;  1XNR Q;  4X64 L;  1X3E A;  2B29 A;  4B3M Q;  1K9M C;  4DV4 Q;  1VQ4 A;  2Q2U A;  1N36 L;  3D31 A;  1VQF A;  3CCR A;  4A3K H;  3ICE A;  2JQO A;  3UE1 A;  2K50 A;  4YCU A;  4DV0 Q;  4GKJ L;  3CXC A;  2LXJ A;  1A0I A;  1X55 A;  2UXB L;  3RNU A;  1I3Q H;  3F8T A;  4BY7 G;  1NMF A;  3NBH B;  1HJP A;  1I94 Q;  3GTG H;  3HOU H;  4DV3 Q;  3W1B A;  4JG2 A;  3PO2 G;  2RHQ B;  3J7Z C;  4JOI A;  1I50 H;  3RR5 A;  2DUD A;  3UDI A;  4X62 L;  2VW9 A;  3CCV A;  4DR3 Q;  5C4X H;  1KC8 C;  2NZO A;  3FP9 A;  4A3D H;  4DUY Q;  2K5N A;  4DV1 Q;  1E1T A;  3I56 A;  1P16 A;  1T9H A;  2I5M X;  4JCV E;  3CC4 A;  1L1O A;  4GKJ Q;  2D62 A;  3A5U A;  4GLV B;  4JOI C;  1GD7 A;  2JA8 G;  3HOV G;  1OXX K;  3CCU A;  2YTY A;  1B70 B;  4XIG S;  1CKO A;  4IPH A;  3J80 i;  1ASY A;  4MTN A;  4IOA A;  2K5V A;  2MQH A;  4DUZ L;  4YHH L;  2OTJ A;  1C9O A;  4UPA A;  3ULL A;  1SMX A;  5FLX c;  4DKA C;  3UDX A;  2OWO A;  1EFW A;  2E2I H;  1HNZ L;  2JA6 H;  4A93 G;  3VDY A;  3A0J A;  2KHJ A;  2VQF L;  3RN5 A;  1BBU A;  1KRS A;  4LF9 Q;  1LYL A;  3CC7 A;  3J81 c;  3FKI G;  1E3P A;  3PUX A;  5GAD C;  1YHQ A;  1E1O A;  4LF4 Q;  2KBN A;  2QGQ A;  2E2J H;  2N8N A;  2UUA L;  5GAG C;  1GO3 E;  4DUZ Q;  2KHI A;  2ID0 A;  4DR7 L;  2EQS A;  2NVT H;  3HKS A;  1AH9 A;  3HOW H;  1MKH A;  1WCM H;  2R7D A;  5IP7 G;  4JI2 L;  1VQG A;  4X65 L;  2GVA A;  3G4S A;  4LF5 Q;  1UEB A;  4DR4 Q;  5BR8 L;  2PQA B;  1OXU A;  4YWM A;  3W5O A;  4HJ7 A;  4JI0 Q;  1HNZ Q;  2MO1 A;  2VZA A;  3B6Y A;  3RLN A;  3RLO A;  1CSP A;  1VQB A;  1M1K C;  1W3S A;  3ULP A;  3CCQ A;  2NN6 I;  4QL5 A;  1CSQ A;  4A3F G;  3G71 A;  1VQH A;  1Y1V H;  1RIP A;  2ZJP A;  1XMQ Q;  4DR7 Q;  1KRT A;  1WI5 A;  1RL2 A;  1IBM L;  3S24 A;  3CCL A;  1KHI A;  1MJC A;  2RHS B;  5IE8 A;  5FJ8 H;  2VS1 A;  2AWO A;  2HIV A;  4NXM Q;  5GAH C;  5BR8 Q;  2UXD Q;  1K0R A;  5C0X J;  2R7Z G;  3PIP A;  1IBL Q;  4IPC A;  1HZC A;  1QZG A;  4A3M H;  2K5H A;  1TWH H;  3PO3 H;  1VQO A;  3NEN A;  3PF5 A;  1S72 A;  4BA2 I;  1X3F A;  3K8A A;  2PQA A;  4X66 Q;  4B3S L;  2UXC Q;  3F2D A;  4IFD G;  2Z6K A;  1GM5 A;  3I4M H;  4BXX H;  2ZTC A;  3ERS X;  3I4O A;  4LFC L;  1EQR A;  3EBE A;  4OXP A;  4JI7 Q;  3ER0 A;  3KLW A;  1YIJ A;  1J5E L;  1IBK Q;  2FXQ A;  2F3I A;  2Y0S E;  3M4Q A;  5IP9 G;  4IO9 A;  1VQM A;  1D7Q A;  5M3M H;  3JAM c;  4BBR H;  1EYG A;  1EWI A;  1BVS A;  1G29 1;  4MNO A;  3H3V H;  1Q81 C;  2NVQ H;  2Z6K C;  1NBW A;  1O7I A;  3OW2 A;  4LNQ A;  2HIX A;  1SE8 A;  4MZ9 A;  4LF6 L;  1C0A A;  3KF8 B;  3SGI A;  2HHH Q;  3S14 H;  5IWA L;  5FLM G;  1LUZ A;  2ATW A;  2EXD A;  2UUB L;  2VY3 A;  1BKB A;  5LMN L;  5JJL A;  4O2D A;  3TRE A;  2PMZ E;  2K52 A;  3I7F A;  4L5Q A;  1PH6 A;  5DLQ E;  4LFC Q;  4AQY L;  1U5K A;  4DK6 C;  1J5E Q;  2B63 H;  4BBS H;  3CCS A;  2UU9 L;  4QGU A;  1X54 A;  3RZD H;  3BZC A;  1HH2 P;  3H3V I;  2A1A A;  1TWF H;  3KYH C;  4IPG A;  4H02 A;  4DV5 Q;  1HNX Q;  1HR0 L;  5LMU L;  1V1Q A;  2ASB A;  2A19 A;  3OYY A;  4LF6 Q;  1OXS C;  4C3J H;  1AE2 A;  1SN8 A;  4A3K G;  1MJE A;  1VQ8 A;  3CD6 A;  2CQO A;  4PZ7 A;  5HY6 A;  4JBM A;  3M4O H;  3U4V A;  1X9N A;  1FJG L;  1WFQ A;  4DV6 L;  2UUB Q;  3TS2 A;  3PF4 A;  1E7Z A;  1UE7 A;  2WB1 E;  2YTV A;  1L1O B;  2ZTD A;  2ES2 A;  1HZA A;  3HOU G;  4AQY Q;  4C2M H;  2EIF A;  4GN4 B;  4A3C G;  1V43 A;  2PI2 E;  1WJJ A;  4A3E H;  1CKM A;  1OXT A;  1PH1 A;  4L5S A;  3S1Q H;  4DR6 Q;  5C4X G;  2BH8 A;  3K7U C;  5J3B A;  4A3D G;  4DV7 Q;  3KOJ A;  5LMU Q;  2HT1 A;  1PYB A;  2Z0S A;  5IYC H;  4TVA B;  1HNW L;  2F52 A;  2Q2I A;  2CWP A;  2OTL A;  1KIX A;  1FJG Q;  3AEV A;  1MIU A;  2RF4 A;  4KHP L;  1PHJ A;  4A3G H;  1VS0 A;  4A4I A;  4A76 A;  1N32 Q;  2WFW A;  1QVF A;  2PI2 A;  1N33 L;  1Q82 C;  1JJC B;  1TWG H;  4P71 A;  4YWL A;  2YTX A;  4BA1 I;  4X64 Q;  2Q2H A;  4DV2 L;  1PH9 A;  1BBW A;  2YYZ A;  2JA6 G;  1B8A A;  4PMW A;  3EN2 A;  1N36 Q;  2MO0 A;  1XPR A;  2E5L L;  4A3J H;  1C7Y A;  4R4T A;  1PH8 A;  2MFI A;  2KEN A;  4P75 A;  2UXB Q;  2OQK A;  5JEA G;  1Y1W H;  2NN6 G;  3L7Z C;  1Q1E A;  2D0P A;  2VQE L;  1XNQ L;  1L1O C;  5GRO A;  1B7Y B;  3CQZ H;  4B3R L;  3HOW G;  3H0G H;  1WCM G;  4X62 Q;  2I0Q A;  5C4J H;  2GVB A;  4A3B H;  4NB3 A;  2BA0 A;  3GDE A;  3NEL A;  1PA6 A;  2UUC L;  1N34 L;  2OCE A;  2IY5 B;  4K0K L;  1VQC A;  3EIV A;  5HGQ A;  4HID A;  1K3R A;  4UP8 A;  4HIK A;  4YY3 L;  4P74 A;  2Y0S G;  3L0O A;  3BZK A;  3L2P A;  2NVX H;  1Y1V G;  1FL0 A;  3A5Z B;  1G51 A;  3KDF A;  4YHH Q;  2VQE Q;  4DR5 L;  4B3R Q;  3M3Y H;  5C3E H;  3PUY A;  4ALP A;  1EUJ A;  5FJ8 G;  3Q8D A;  5C0X I;  4POG A;  3J7A 5;  1OTC A;  2E2H H;  1Q1B A;  3NEM A;  1H95 A;  3K81 C;  3CME A;  2VNU D;  1D8L A;  4GLX A;  4A3M G;  4O0A A;  2VQF Q;  3T1Y L;  1CKN A;  1PFS A;  1GKH A;  3JAM i;  3PO3 G;  2WAQ E;  4JI1 L;  4EQ5 A;  4GNX A;  4A3I H;  1YVC A;  1A63 A;  4L5R C;  4PZ8 A;  4QIW E;  3S15 H;  4AYB G;  4YY3 Q;  1YJW A;  1UE5 A;  2DGY A;  4JI4 L;  3ULJ A;  2UUA Q;  3I4M G;  4BXX G;  1FGU A;  1JMC A;  3HOY H;  1M90 C;  4GLA C;  4JI8 L;  3CAM A;  4JI2 Q;  1UWV A;  4JI3 L;  2AWN A;  1E22 A;  4X65 Q;  2ZM6 L;  5M3M G;  4LFA L;  4BBR G;  2KCM A;  4P72 A;  2CWA A;  4JI5 L;  3W1G A;  2R93 H;  1FVI A;  3J81 j;  4DR2 L;  3E9I A;  1YJN A;  3J80 c;  1WYD A;  1QZH A;  1JE5 A;  1XMO L;  3I55 A;  2WB1 G;  1PV4 A;  3MXN B;  1DGS A;  2MNA A;  2R6G A;  2IT1 A;  3HKZ E;  4GS3 A;  4GOP A;  4OX9 L;  2I5H A;  1X3G A;  4LUZ A;  4QJF A;  4JI4 Q;  4NXN Q;  1VQJ A;  1G6P A;  5E7N A;  3AQQ A;  1IBM Q;  2JA5 H;  5IYD H;  1SLJ A;  5AJ3 L;  1EIY B;  2B63 G;  4HJ8 A;  4BBS G;  3HOX H;  4JV5 L;  4GOP C;  1Z9F A;  4XTC S;  2D0O A;  4AH6 A;  2ZTE A;  4OWT B;  1VQK A;  4JI5 Q;  2NZH A;  4UP9 A;  1XMO Q;  1KQS A;  1KL9 A;  1IL2 A;  2JEB I;  3MEF A;  4OX9 Q;  1LTL A;  1K83 H;  4B3S Q;  3PSI A;  5JEA J;  1VQ5 A;  4LF7 L;  4GN3 B;  1SRU A;  2YV5 A;  1XPU A;  3I4N H;  1I5F A;  2VUM H;  4A3E G;  1YJ9 A;  4JI6 L;  3T1H L;  2RCN A;  4HJ5 A;  2HQL A;  2JA7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...