1EYHA

Crystal structure of the epsin n-terminal homology (enth) domain at 1.56 angstrom resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
144
structure length
144
Chain Sequence
HNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF THE EPSIN N-TERMINAL HOMOLOGY (ENTH) DOMAIN AT 1.56 ANGSTROM RESOLUTION
rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords EPSIN
total genus 60
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2000-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1eyhA00
1INZA 1EDUA 2MOWA 3ZYMA 4FU3A 3D9OA 3D9PA 3ONKA 5CMWA 3D9NA 4FLBA 4NACA 3RRUA 3D9KA 4JXTA 4Q94A 1HG5A 4Q96A 2DIWA 5J08A 3G2VA 3D9IA 3D9MA 3G2UA 4AVXA 1JWFA 4HFGA 2V8SE 3D9LA 1MHQA 1HF8A 4GZCA 1PY1A 1DVPA 5CMYA 2LO6A 1UJKA 1VDYA 5LP0A 3CLJA 2KM4A 3G2WA 3ZYKA 3LDZA 3ONLA 1HFAA 1SZAA 1JWGA 1XGWA 2DCPA 4GZDA 3D9JA 1HG2A 1SZ9A 1UJJA 1X5BA 2L0TB 2BF0X 2QY7A 3ZYQA 3ZYLA 2L0IA 1HX8A 1JPLA 3G2TA 1ELKA 1LF8A 3G2SA 1JUQA 5LOZA 1H0AA 1EYHA
chains in the Genus database with same CATH superfamily
1B89A 3ZYMA 3BU8A 3RU0A 3JUEA 4HBDA 1Y8MA 4OYSA 3CVXA 4C0MA 4GPMA 2WVIA 3BG1B 4FC8A 1ELWA 3VLFA 2VSOE 4PH4B 5CHEE 5FIOA 5CCMA 2XZTG 3QWWA 2XPIA 3ML9A 3MYVA 3ZUVB 2HE0A 3HXDA 3DRAA 3FTUA 1K3ZD 2VGYA 1UN9A 2LSUA 3ZHEA 2XPYA 1MX4A 3FY4A 3ONKA 4EZLA 3ESKA 4LRZA 4RVBA 3LJNA 2DZOA 4R7LA 5E76A 1IHBA 2OVFA 4A1GA 3TAXA 3PNLB 4G8LA 2OEWA 3NOCD 5D2MC 4QFVA 2P58C 2VSXE 2A4ZA 2KZTB 3DSUA 3LCAA 1HG2A 4HVBA 3TWRA 3NOGD 4N5CA 3CGHA 2CFZA 2YQ8A 2KCKA 1E8WA 3CHPA 3JCKC 3EHRA 3Q75A 2XS8A 4B8CB 3APDA 3TJPA 1INZA 4TUMA 1L5JA 3SFZA 4DI3A 3FULA 3SBSA 2Y0BG 4HI8A 1E8YA 4TXPA 3TGOA 3NBNB 1DC2A 5AQ7A 3VLDA 2IU1A 4D10C 2WXFA 3AG2E 4DK5A 4AY5A 2VGXB 2L6JA 3KD7A 1ZBPA 2J08A 5EYPF 5JMND 3CSFA 1YYHA 2HR2A 3HXBA 1BPOA 2R17C 4KBQA 3DSWA 2R59A 4I1AA 1UG3A 2OOEA 3QKYA 4XZ4A 4JL0A 1N0RA 1NFIE 3LVQE 1JCRA 4HI9A 2WXOA 5JHBA 3UM0A 3V79K 5KJNA 3PZ4A 3VTYA 1IHGA 4K5CA 3S2AA 3TWVA 3IKOB 1IYGA 3MZLB 3FHEA 2FI7A 2Q7FA 3FEYA 5JHAA 1TNYA 3O48A 3FP3A 5EN5D 2CG3A 3UIPC 3UX4A 1TN8A 3FUHA 4F1PA 1HH8A 3BEEA 4CT0A 2H6FA 2IO2C 2PQNA 5FQ8A 1SVXA 4LNBA 4UQYA 1U3DA 1HF8A 4G2VA 3SFXA 5FINA 3LKUA 3CLJA 4OVVA 5EKQD 3ASOE 4I2WA 5BUZA 1K1BA 1TEZA 2L0IA 4WNGA 4J6IA 2CFUA 4PS8A 2IOSA 3JUIA 3UM1A 1H6KA 3C3OA 1DCQA 1NL4A 1WDYA 5T3RA 5EIBE 3AJIA 3ZYKA 2P9LG 4NIKA 1U3CA 4BT8A 2BKGA 3NZSA 3L08A 1V55E 4FLBA 1N4RA 2FEZA 1TR4A 4IYPA 5HQ8A 2UY1A 3W9FA 2XGSA 1P5QA 2IEJA 4CDMA 3I4RB 1FVHA 1N95A 5BNWA 4P29A 1E7UA 4XKCA 3GZ1A 3ASGA 3NB2A 5JJTA 2V5FA 1H6OA 2V8SE 3CK8A 4N5QA 1KZPA 4A3TA 3QDNA 2WXJA 2AVPA 4GCOA 4JA9A 2GRLA 3PRZA 4X8QA 3WXXA 3ZYLA 4CGWA 3V30A 3G2UA 1NA3A 5LFAA 2I6HA 4BT9A 3W9GA 2WQ7A 3HG0D 4L7TA 3UUXA 3ZFWA 3D9JA 3FTVA 1O1TA 4DLQA 3SGHA 5CRVA 5KBAA 4JC8A 3EHMA 2XHEA 5HI7A 4K5AB 5B1BE 3KSLA 4GMRA 1BD8A 4RSYA 5AN8A 1OUVA 1FT2A 3HVEB 2XRZA 4ILHB 4YDWA 3CQCB 2I1KA 3E32A 3RJVA 3RRUA 3SZ7A 4FU3A 3D9PA 4EQFA 4NQ0A 1HE8A 4DX1A 2KC7A 3FTXA 2RD0A 3G2WA 4XKBA 2LAHA 4EECA 3CVVA 5AQ9A 2DYRE 3DXMG 1FVFA 3CHOA 3SQVA 3GW4A 5FQ4A 1YCSB 1KT1A 3FUDA 4HXIA 5H7PA 5G2NA 1OWNA 3ASNE 1RW2A 3NAWA 4G24A 2MYOA 4BX9A 4HNAD 2J09A 2DWZA 5JA4D 5EX3A 3R7RA 4C9BB 2Y4UA 2B6CA 3ENEA 3KS2A 2WB2A 3FDHA 1O1RA 5ENRD 4J8SA 2OEVA 4JHKA 2LXMA 3LYAA 2MHKA 2JEKA 4K0RA 4N2SA 2ZISA 3FTSA 3T5XA 3TWWA 4I43A 1KPSB 4F6RD 2XEEA 1ZU2A 3FH5A 5ENOD 4Q69A 3FU5A 5CMWA 1H2TC 3PDNA 4ATGA 5FQ7A 2WXGA 3UTMA 5D66A 2F0YA 3RIBA 1O5MA 1IXVA 3E37A 3DWLG 1UW4B 1X81A 2WPVA 4PS3A 1PC2A 5AJLA 4GZDA 4K5BA 4AP2A 4EHMA 4XE0A 4HORA 3I5PA 3NF1A 5A23A 2WXQA 3UT7A 2EIME 4J8FA 3APFA 2QFCA 4U63A 2VJ8A 1TYQG 3PZ1A 3Q79A 5C2YA 2C2LA 2GRPB 2DVWA 2KCVA 3DSXA 3J5QB 1AWCB 3D9OA 3D3MA 1WM5A 5HKPA 5G55A 2J9QA 4A63B 4LSZE 4U0ZA 2NC9A 5B3SE 3HXFA 5FZSA 1TNOA 3MA5A 2AW6A 1U2VG 3MV2B 3O4ZA 4GTPA 4PS7A 3ZW3A 4XX5A 3MCXA 5ENNA 3EIQC 2RG8A 2XENA 1W3BA 5KCMA 3FWVA 3GZSA 3I3NA 4AEZC 1JWGA 4CDNA 1E90A 2L0TB 4B89A 4EPZA 4HLLA 3HDXA 1JUQA 3S7BA 3DPDA 3QC1A 2OVBA 3D9KA 3WG7E 3CSTA 4ANUA 3OXGA 3CHQA 3ASFA 3EJNA 1IQRA 4G1TA 2ZXWE 4DPRA 4PUCA 5CBNA 5ARFA 5FZQA 3FUEA 4QQIA 4UQXA 2VSYA 4HQDA 4C0EA 4UWHA 2C0MA 2X38A 4DJAA 2F37A 4GCNA 2FULA 5AYWD 3EUVA 5G04J 1N11A 2YHCA 2H6GA 4FHJA 2Y3AA 4YVOA 4IN3B 1SW6A 3D9MA 5KNGA 3P1UA 1O1SA 4I9CA 3T9KA 3PS6A 4GZ3A 3MJWA 3L22A 2X6KA 3Q9NC 4TUUA 1ELKA 4JD2G 5LOZA 3UXGA 3Q4AB 5ENSD 3FUNA 4U95D 3CK7A 4GU5A 4ANXA 3Q7AA 3UT4A 3UKUG 4F7AA 4XI9A 3ML8A 3DSTA 1HO8A 3G2SA 3RRMB 4CZ2D 1EPUA 4LCTA 2R2LA 1NP7A 4UI9K 4H7YA 1FPPA 2ZGDA 2ETCA 3EU9A 3PVLA 5CBOA 2EQXA 2ZIRA 2VTBA 4BTBA 4AOFA 3CHMA 4OVUA 3QJZA 2ZGGA 4U8YD 4TXQA 1N54A 1FCHA 3TWSA 3PUJA 4I6EA 4BWRA 5JJ7A 4UUCA 1RZ4A 3PEUB 3T8MA 3IXEA 3ABLE 1SZ9A 2AXUA 4LG6A 4I6JA 1H19A 3MV3B 3CVUA 5BXOA 3PUKA 2LXLA 5ENPD 4GTOA 2EILE 4NURA 3RSEG 2XGMA 2X6FA 4RQIA 3VLEA 2BTDA 2Y4TA 3C98A 3EIJA 3UIOC 3ZVVA 2BUGA 3FUKA 2XQ0A 2LNIA 3CVNA 2NXPA 4NACA 3EHNA 3IBEA 1MQSA 5A7DB 1OT8A 4RG6A 2IONA 4YNDA 3LY9A 4V3IA 3BUAA 4M7CA 1TN6A 4N3AA 1BI7B 3L82A 3LY8A 4AV7A 2P9KG 2J4DA 4IULA 3HIZA 3ZGQA 1ELRA 1H0AA 4CCAA 2M63A 2V4LA 3CHRA 4WUYA 4IRUA 4BTAA 5EYLA 2KM4A 3ZNGA 4BX8A 3SBTB 3ABME 2P9IG 2GGFA 4Y6CA 2VQ2A 2IF4A 4ABNA 3DEOA 4YDOA 4LUNU 4HRNA 1S63A 2XEVA 1MX6A 3OXFA 4B8AA 4UWKA 2HM8A 5G04C 5B1AE 5AQBA 5KJKA 1D8DA 4GA0A 4YVQC 3ZYQA 5E75A 2XCCA 3G2TA 4J0UA 3B7SA 3DEPA 3FU0A 4KT6B 2BKKB 3FH7A 4JVSA 5J90A 3EU5A 1YMPA 4CYMD 1SZAA 4BFRA 2KBXA 4BEPA 4DX6D 3CVQA 3RO3A 1FT1A 3TWQA 4J8DA 1MZCA 2R02A 1HZ4A 4I6GA 5G05C 3B95A 4U8HA 5FTPA 3PH0C 3C72A 2I2OA 4YDYA 2IQCA 4ILIA 3QB2A 2EIJE 3JYSA 4WNFA 4AM9A 4WWPA 2FO7A 5BPPA 4BY6A 2F8XK 5EX0A 2AXVA 4AVXA 3S7DA 1Z5SC 4I9EA 2WXKA 1TJCA 2DCPA 4XI0A 1K8KG 4OAUC 4HRMB 2EINE 2DZNA 4JHRA 3QWVA 4F53A 4GTRA 1OXJA 2LUHA 3DBSA 5HRYA 1Q2ZA 1G3NB 2P2CP 2LO6A 4G11A 3MEKA 4Y6WA 3APCA 2IFUA 1MX2A 2EIKE 3SO8A 3U4TA 1BI8B 4JW1A 3Q5MA 4Q94A 2DIWA 4HFGA 1IKND 4C48B 1WG0A 2C0LA 2Y69E 4K03A 4XIFA 1QQEA 1KZOA 3FTWA 1EF1C 3AS4A 3CEQA 1SA4A 3HRAA 5BW8C 2J8SD 3CVWA 5AJDA 3MKQB 3UT8A 3MX3A 5J08A 3D9IA 4JEHA 4YDEA 1OWLA 2FO1E 3ULEG 4ATZD 3IEGA 3IHYA 2PM6A 1QBQA 3LPZA 5T8IA 2ETBA 3Q15A 2HYZA 3ULQA 1TNBA 3SF4A 3ISMC 2RKKA 1SA5A 1PY1A 5T4YA 2X6HA 3HXEA 4FHKA 3HXCA 3RAUA 1V54E 1N4QA 3B13A 2KCLA 2MOWA 3HHMA 4FADA 4LEUA 5BT1A 3E34A 5KWDA 2GW1A 4TV3A 4MBGA 3SI5A 2ZU6B 5KNHD 3JXIA 4A55A 1N4PA 3CVPA 5AENA 2DYSE 3FEXA 4FJYA 3OAWA 1KLXA 5ITZF 2KZTA 4GA1A 3PZ2A 4WWOA 4XEIG 4GTTA 3ZPJA 4U0UA 2WXLA 2A5UA 3VTXA 4U0SA 2JLBA 3BQOA 3V31A 2YINA 4G26A 3K9IA 2E0IA 1PAQA 2Y1LE 3NQPA 4DX7D 4G23A 2IY0C 4FLHA 2UWJG 3JXJA 3PE4A 4GZ5A 3QOUA 1HXIA 4UQZA 3OTNA 3ESLA 3V2XA 2XPZA 1NZNA 4N3BA 4G8KA 3TG4A 1K1AA 1A17A 1Z6TA 2CG2A 2AXZA 3J5PA 1UOHA 2QYJA 3URZA 4HB5A 4HLEA 3UM3A 4N2QA 4WNEA 4ACKA 4LNUD 4HOSA 3UI2A 5IY5E 2E2EA 3E30A 4UWLA 4GYWA 3Q47B 4BSZB 3FFLA 5EILA 2KATA 3MGBA 3U3WA 1N52A 3UQ3A 3FUIA 3LY7A 4I2ZA 3E4BA 3U9WA 2IO3C 1XNFA 1D9SA 3R9MA 1UJJA 1H2UA 3E33A 2P9SG 3EHQA 2LAIA 3U64A 3ZXSA 4FP7A 4HS2A 3L17A 3QNKA 2GRNB 3G2VA 4L9PA 1H6PA 3QARA 1TNUA 3TG5A 3LXUX 2VGEA 1E7VA 3ASHA 4G25A 2R05A 4MLPA 5HS0A 3Q78A 1N0QA 4H7XA 4GTQA 4JZYA 2CHZA 4N3CA 1S70B 4JXTA 4PDXA 3X2QE 2H6HA 3GYZA 3JQ1A 5D0OD 4GZ6A 1ZB1A 1OWOA 4EBAA 3UM2A 1JPLA 4U07A 1QNFA 2GRMA 1JCQA 3RKVA 1NA0A 3ZXPA 1MHQA 3P2BA 3B7BA 3N71A 3ULYA 2FF4A 3B7RL 1HX8A 2WXHA 2WM9A 5ARGA 1UN8A 2RFAA 3R9AB 3CKCA 5EIDA 5AIJA 5CEDB 4WWNA 4WNDA 2X6IA 4CRWA 4U04A 3B7UX 3ASDA 3AS8A 3FUFA 3DXKG 4E6HA 3AG4E 3F6QA 4ZHBA 2WXMA 5AQAA 4B93B 4DLOA 5LX8A 4URKA 4UWFA 2IOLA 1E96B 4B0ZA 2YNQA 5ANRA 2VSNA 4KYOB 1A5EA 5CRUA 3RK6A 2BF0X 5C1DA 4GTVA 4MRUA 1TNZA 3ABKE 5M72A 2KXPC 4KXKB 5LCWJ 3SHFA 2I1JA 2UY1B 4KZCA 2ONDA 5D0QD 4BERA 3PEVB 1HU3A 1N9AA 3QWPA 4EZKA 1N94A 2PL2A 5KJLA 5A6CA 5FT9A 3UKRG 4CT4A 4FULA 4KZ0A 4A3VA 2WMOA 5DBKA 4CDRA 2V0PA 3SY2A 5BXUA 1E8XA 2GRQB 3KSQA 4I1OB 2ETAA 4GMLA 3HVEA 3QK0A 1OCOE 2RFMA 2L6BA 2LSVA 4HRLA 5ENQD 2MRIA 3CK9A 3D9HA 1NI1A 2WXPA 4DX5D 1OY3D 1OCRE 3CR3A 5FQ6A 1HG5A 1JWFA 4DX2A 5FZRA 4APFA 4TRQA 3FH8A 4F3VA 4DI4A 1D8EA 4BSXA 2X6JA 1MYOA 4L2LA 3AS5A 1QYMA 3Q7FA 3DSSA 1JCSA 2XGOA 4GA2A 5CEAA 1DNPA 2L9BA 3PNTB 4ANVA 3CV0A 3DPYA 1S64A 4UI9J 1IQUA 3OXLA 1HFAA 1HS6A 4M3OA 4U7EB 4FA6A 2QY7A 1KT0A 1WAO1 1OWMA 5AAOA 3Q49B 4RG9A 4HOUA 4BESA 2A5EA 4ME2A 1S0PA 2V5QC 3JQ0A 2GRRB 3ZN3A 1BU9A 3C3RA 3V2OA 2WXNA 4O1OA 4F1SA 4AY6A 3PZDA 4Z68A 4J7WA 3AAAC 2WQ6A 3ZHEB 2AWIA 4DRXE 3CVYA 2DBAA 3TWXA 1N4SA 4DUIA 3BG0B 2XRYA 1BLXB 4JHJA 2QC9A 2OV8A 2WMNA 5LP0A 1DCEA 4B94A 2GROB 4GB9A 4LERA 3KEAA 4N39A 1LF8A 3UINC 5KJMA 1EDUA 2WXRA 3TWUA 3D9NA 3L13A 3CQGB 1H2VC 3Q73A 3FUMA 4L1BA 1SQMA 2BEDA 1DVPA 5CMYA 1UJKA 3SFYA 2J4BA 5CECB 3FU3A 3I4GA 3L54A 5BV1A 2H6IA 2VYIA 3FTYA 2P9NG 3PZ3A 4GPKA 3LEWA 2XEHA 4BETA 3IV0A 2R03A 3Q9UC 2NSZA 4GAAA 3EDTB 4W9RA 3FTZA 3FUJA 2NYJA 3B7TA 1VDYA 2I9CA 3DSVA 2PQRA 5FWQA 4JPSA 3AU5A 4WAFA 4GMJA 3CIAA 2IJGX 5CERB 3C5RA 5JJ6A 4NRHB 3CHSA 2CHWA 4A1SA 5LCWC 4Q96A 1Z3YA 1Z3XA 3AG3E 4GZCA 5BV0A 2F8YA 3MKQA 4GTMA 4GTSA 1XGWA 4GYOA 4MKTA 1MJ0A 1LD8A 1X5BA 3QAQA 4AIFA 5DIZA 5FJYA 4O1PA 2JABA 2PZIA 4KMOA 4EBAG 4JEUA 4HOQA 5ENTD 4AXHA 4U8VD 1OCZE 2VGXA 3PREA 3TWTA 3MKRA 2OCCE 2B0OE 5EDSA 4OAVB 2WXIA 4U96D 2P9PG 3LVRE 2V4HC 3AU4A 1YA0A 4J8EA 4APOA 3UPVA 3ZKJA 4UWGA 1Y6IA 1EYHA 3S7JA 3FU6A 1TN7A 1OCCE 1QZ2A 3ZEFA 4LNGA 3ZRHA 2XZDG 4CGVA 4O60A 2PNNA 2WQHA 3LJ3A 4FJZA 2XS1A 3SD5A 3CKBA 2VTBB 4JA7A 4JB8P 2YHEA 2XCBA 3T5VA 4KVMA 4I17A 5G05J 4TXRA 3ONLA 4AJWA 4CEMA 3SNXA 3ZIMA 3AG1E 4L2YA 2PM7A 1TJFA 4ANWA 1WY6A 2J49A 2HO1A 4O6FA 3NZUA 4MS6A 4UI9C 2CHXA 4EZJA 2ILRA 3KEZA 5ANLA 3CVLA 3L9TA 2X3MA 1AP7A 2QZAA 4HOTA 3TL5A 2FBNA 3HYMB 4J8YA 3RRNB 3GZ2A 4ILGA 3L16A 3T8KA 4L23A 3TXMA 4ACLA 1GW6A 4GYYA 4RLYA 4I1MA 4ZFHA 2AJAA 3RO2A 3PE3A 3C3QA 2J07A 2P9UG 2QYUA 1LTXA 4KVOA 3U66A 4E85A 5AARA 1E8ZA 1OWPA 3ZU7B 1LD7A 3TXNA 3D9LA 2R5SA 3LS8A 3R7QA 3LDZA 3UMVA 3KAEA 3L6AA 5CCLA 3S7FA 3IHVA
chains in the Genus database with same CATH topology
1B89A 5M72A 3ZYMA 4J8SA 4JHKA 4KXKB 3CVQA 3RO3A 5LCWJ 3SHFA 3LYAA 3RU0A 2I1JA 2MHKA 4J8DA 2JEKA 2UY1B 1Y8MA 4K0RA 4OYSA 4N2SA 4KZCA 1HZ4A 2ONDA 3CVXA 4I6GA 5D0QD 5G05C 4U8HA 5FTPA 4C0MA 3PH0C 3FTSA 3T5XA 2I2OA 3PEVB 2WVIA 3BG1B 4FC8A 4I43A 1ELWA 3VLFA 1HU3A 2IQCA 4ILIA 3QWPA 3QB2A 3JYSA 4EZKA 4WNFA 2VSOE 4AM9A 4PH4B 5CHEE 1ZU2A 3FH5A 2PL2A 4WWPA 4Q69A 3QWWA 2FO7A 5CCMA 3FU5A 2XPIA 5CMWA 5KJLA 5BPPA 1H2TC 5A6CA 3PDNA 3ML9A 3MYVA 4BY6A 4ATGA 5FQ7A 5EX0A 2WXGA 2AXVA 5FT9A 4AVXA 4CT4A 4FULA 3S7DA 4KZ0A 3RIBA 4A3VA 2WMOA 3FTUA 4I9EA 2WXKA 2VGYA 5DBKA 1TJCA 4CDRA 1UW4B 2V0PA 1UN9A 2LSUA 2WPVA 4PS3A 1PC2A 2DCPA 1E8XA 4GZDA 5AJLA 3ZHEA 4XI0A 4AP2A 2XPYA 4XE0A 4I1OB 4GMLA 3HVEA 4HORA 3QK0A 4JHRA 3I5PA 3QWVA 3FY4A 3NF1A 3ONKA 4F53A 5A23A 2LSVA 2WXQA 3UT7A 4EZLA 3ESKA 4J8FA 3APFA 4LRZA 3DBSA 4RVBA 2QFCA 2MRIA 3CK9A 4R7LA 5E76A 2OVFA 2LO6A 4G11A 4U63A 2VJ8A 3MEKA 5C2YA 2WXPA 3APCA 4Y6WA 2IFUA 2C2LA 4A1GA 3TAXA 2KCVA 3PNLB 3U4TA 4JW1A 4QFVA 3Q5MA 3CR3A 3D9OA 2P58C 2VSXE 5FQ6A 2A4ZA 3D3MA 4Q94A 1WM5A 1HG5A 2DIWA 1JWFA 2KZTB 4HFGA 5G55A 2C0LA 2J9QA 4K03A 5FZRA 4XIFA 4U0ZA 2NC9A 3LCAA 4APFA 4TRQA 3FH8A 1QQEA 5FZSA 4F3VA 1HG2A 3FTWA 4DI4A 1EF1C 3AS4A 3CEQA 4BSXA 2X6JA 3MA5A 5BW8C 4HVBA 2AW6A 3MV2B 3CVWA 4L2LA 3O4ZA 3AS5A 5AJDA 4N5CA 3CGHA 2CFZA 3MKQB 3UT8A 4PS7A 3ZW3A 3MX3A 4XX5A 2YQ8A 3D9IA 5J08A 4JEHA 2KCKA 2XGOA 3MCXA 1E8WA 5ENNA 3EIQC 3CHPA 2RG8A 3JCKC 1OWLA 4GA2A 1W3BA 5KCMA 3IEGA 1DNPA 2L9BA 3FWVA 3GZSA 3I3NA 3PNTB 3CV0A 4ANVA 4AEZC 4UI9J 1IQUA 3IHYA 1HFAA 3OXLA 1HS6A 1JWGA 4M3OA 2PM6A 4FA6A 4B8CB 4CDNA 1E90A 2L0TB 2QY7A 3LPZA 1KT0A 1WAO1 4B89A 1OWMA 4EPZA 3APDA 3HDXA 5T8IA 1JUQA 3TJPA 1INZA 3Q49B 3DPDA 3Q15A 3S7BA 2HYZA 4RG9A 3ULQA 1L5JA 3QC1A 3SFZA 4DI3A 4HOUA 4ME2A 2OVBA 1S0PA 3FULA 3SBSA 3SF4A 3D9KA 3CSTA 1E8YA 3JQ0A 3TGOA 4ANUA 3VLDA 2IU1A 4D10C 1PY1A 5T4YA 2WXFA 3ZN3A 3OXGA 3CHQA 4DK5A 2X6HA 4AY5A 2VGXB 2L6JA 2WXNA 3KD7A 1ZBPA 4FHKA 3ASFA 2J08A 3EJNA 1IQRA 3CSFA 4G1TA 3B13A 2HR2A 4DPRA 1BPOA 4PUCA 2R17C 4F1SA 4KBQA 4AY6A 2KCLA 3PZDA 2MOWA 2WQ6A 5ARFA 3ZHEB 3HHMA 4FADA 4LEUA 2AWIA 2R59A 4I1AA 5BT1A 5FZQA 1UG3A 2GW1A 2OOEA 4TV3A 3CVYA 2DBAA 3FUEA 3SI5A 3QKYA 4XZ4A 2ZU6B 4JL0A 3BG0B 2XRYA 4UQXA 2VSYA 3LVQE 4C0EA 4JHJA 4UWHA 2C0MA 4A55A 2OV8A 2WMNA 3CVPA 2X38A 5AENA 5LP0A 4DJAA 3FEXA 2WXOA 4FJYA 4B94A 3OAWA 1KLXA 5JHBA 4GB9A 4LERA 5KJNA 2KZTA 4GCNA 4GA1A 3VTYA 1IHGA 4N39A 2FULA 1LF8A 3S2AA 3IKOB 5G04J 5AYWD 3MZLB 1IYGA 3FHEA 5KJMA 1EDUA 4WWOA 2WXRA 2YHCA 2FI7A 2Q7FA 3D9NA 3FEYA 5JHAA 3O48A 2Y3AA 3L13A 4FHJA 3ZPJA 3FP3A 3CQGB 4YVOA 4IN3B 4U0UA 2WXLA 1H2VC 3D9MA 2CG3A 2A5UA 3VTXA 3FUMA 4L1BA 1SQMA 3P1UA 3UX4A 1DVPA 4U0SA 5CMYA 1UJKA 2JLBA 2J4BA 2YINA 3FUHA 4I9CA 3FU3A 1HH8A 3I4GA 3L54A 4G26A 3BEEA 3PS6A 4CT0A 4GZ3A 3K9IA 2E0IA 3MJWA 1PAQA 3L22A 5BV1A 2PQNA 2VYIA 2X6KA 3FTYA 3NQPA 4TUUA 1ELKA 5LOZA 4GPKA 3LEWA 3Q4AB 5FQ8A 4G23A 4FLHA 2UWJG 3IV0A 2NSZA 3FUNA 3PE4A 4UQYA 3CK7A 4GAAA 3EDTB 4GU5A 4GZ5A 4W9RA 3FTZA 1U3DA 1HF8A 3FUJA 3QOUA 4G2VA 4ANXA 3B7TA 1VDYA 2I9CA 3LKUA 3UT4A 1HXIA 3CLJA 4UQZA 3OTNA 3ESLA 2XPZA 4OVVA 2PQRA 5EKQD 1NZNA 4JPSA 3AU5A 4WAFA 4I2WA 4N3BA 5FWQA 4F7AA 5BUZA 4XI9A 4GMJA 3ML8A 1TEZA 3CIAA 2L0IA 4WNGA 1HO8A 4J6IA 3TG4A 1A17A 2CFUA 2IJGX 4PS8A 3G2SA 5JJ6A 2IOSA 1Z6TA 3JUIA 4NRHB 1H6KA 3RRMB 2CG2A 3CHSA 2CHWA 1EPUA 2AXZA 4A1SA 5LCWC 4LCTA 4Q96A 1Z3YA 1Z3XA 1NP7A 3URZA 5T3RA 4GZCA 5BV0A 4UI9K 3MKQA 4H7YA 3ZYKA 4HLEA 4N2QA 1XGWA 4GYOA 4MKTA 3PVLA 4WNEA 2EQXA 1X5BA 4ACKA 2VTBA 3QAQA 4AIFA 5DIZA 4BTBA 5FJYA 4AOFA 1U3CA 4BT8A 2PZIA 4KMOA 3CHMA 3NZSA 4OVUA 4EBAG 3QJZA 4JEUA 4HOSA 4HOQA 3L08A 4AXHA 2VGXA 3PREA 2E2EA 4FLBA 4UWLA 4GYWA 3MKRA 2FEZA 1N54A 4IYPA 3Q47B 1FCHA 3FFLA 5EDSA 2KATA 2UY1A 3MGBA 3PUJA 4I6EA 5HQ8A 3U3WA 2WXIA 1N52A 3UQ3A 3FUIA 3LY7A 4I2ZA 3E4BA 2XGSA 3U9WA 4BWRA 5JJ7A 3LVRE 3PEUB 1P5QA 3T8MA 1XNFA 3AU4A 1SZ9A 2AXUA 1UJJA 4I6JA 4CDMA 3I4RB 1FVHA 1H2UA 1H19A 1YA0A 4J8EA 4APOA 3MV3B 3UPVA 5BNWA 3CVUA 4UWGA 1Y6IA 2LAIA 4P29A 1E7UA 1EYHA 3U64A 4XKCA 3PUKA 3GZ1A 3ASGA 3ZXSA 4FP7A 4HS2A 3L17A 5JJTA 3QNKA 3S7JA 3G2VA 3FU6A 2V5FA 1QZ2A 3ZEFA 4NURA 2V8SE 3CK8A 3ZRHA 3QARA 2XGMA 4CGVA 2X6FA 3TG5A 3LXUX 4A3TA 3QDNA 3VLEA 2BTDA 2WXJA 2AVPA 1E7VA 2Y4TA 3ASHA 4GCOA 4JA9A 2WQHA 2GRLA 3LJ3A 3C98A 3EIJA 3PRZA 4G25A 3WXXA 4FJZA 3ZVVA 2BUGA 3SD5A 3CKBA 3ZYLA 4MLPA 4CGWA 2VTBB 3FUKA 2XQ0A 2LNIA 3G2UA 4JA7A 3CVNA 2NXPA 1NA3A 4H7XA 5LFAA 2YHEA 2I6HA 3EHNA 3IBEA 4JZYA 4NACA 4BT9A 2CHZA 4N3CA 4JXTA 1MQSA 2XCBA 5A7DB 3T5VA 2WQ7A 4RG6A 4PDXA 2IONA 4KVMA 4I17A 4YNDA 3LY9A 4V3IA 3GYZA 3JQ1A 5G05J 4L7TA 5D0OD 4GZ6A 3ONLA 4N3AA 3LY8A 4AJWA 3UUXA 3SNXA 3ZIMA 4AV7A 3ZFWA 4CEMA 1OWOA 2J4DA 3D9JA 3FTVA 4IULA 4EBAA 4L2YA 3HIZA 2PM7A 1JPLA 4U07A 3ZGQA 1TJFA 3SGHA 4ANWA 4DLQA 1WY6A 2J49A 1ELRA 2HO1A 1QNFA 1H0AA 4O6FA 3NZUA 4MS6A 4UI9C 2CHXA 4CCAA 4EZJA 2GRMA 2M63A 2V4LA 4JC8A 3EHMA 3CHRA 3RKVA 2ILRA 4WUYA 3KEZA 5ANLA 4IRUA 2XHEA 3CVLA 1NA0A 2X3MA 4BTAA 1MHQA 3P2BA 5HI7A 4HOTA 3N71A 2KM4A 3TL5A 2FBNA 3HYMB 2FF4A 4RSYA 3RRNB 4BX8A 3GZ2A 1OUVA 3HVEB 4ILGA 3L16A 3SBTB 2XRZA 4ILHB 3CQCB 2GGFA 3B7RL 4L23A 3TXMA 1HX8A 2I1KA 4Y6CA 2WXHA 2VQ2A 3RJVA 3RRUA 4ACLA 3SZ7A 2WM9A 1GW6A 2IF4A 4GYYA 4FU3A 3D9PA 5ARGA 1UN8A 4ABNA 4EQFA 4I1MA 4NQ0A 1HE8A 3R9AB 2KC7A 4LUNU 3CKCA 5AIJA 2XEVA 4WWNA 3FTXA 3OXFA 3RO2A 3PE3A 4UWKA 2RD0A 2HM8A 3G2WA 4WNDA 4XKBA 2LAHA 5G04C 4B8AA 2X6IA 4EECA 3CVVA 4CRWA 4U04A 5KJKA 2J07A 3B7UX 3ASDA 3AS8A 3FUFA 4GA0A 4YVQC 3ZYQA 5E75A 2XCCA 3G2TA 4KVOA 4E85A 1FVFA 4E6HA 3CHOA 3U66A 1E8ZA 3GW4A 5FQ4A 1KT1A 3FUDA 4J0UA 3B7SA 3FU0A 4KT6B 4HXIA 1OWPA 5G2NA 1OWNA 2WXMA 4DLOA 5LX8A 3FH7A 4UWFA 4URKA 2IOLA 1E96B 3D9LA 4G24A 2YNQA 4JVSA 3TXNA 2R5SA 4B0ZA 4BX9A 5ANRA 2VSNA 4KYOB 5J90A 3LS8A 3R7QA 3LDZA 3UMVA 3RK6A 3KAEA 2J09A 3L6AA 1SZAA 4BFRA 5EX3A 3R7RA 4C9BB 2Y4UA 5CCLA 3S7FA 2BF0X 3IHVA 3ENEA 5C1DA 3KS2A 2WB2A 3FDHA 4MRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1INZ A;  1EDU A;  2MOW A;  3ZYM A;  4FU3 A;  3D9O A;  3D9P A;  3ONK A;  5CMW A;  3D9N A;  4FLB A;  4NAC A;  3RRU A;  3D9K A;  4JXT A;  4Q94 A;  1HG5 A;  4Q96 A;  2DIW A;  5J08 A;  3G2V A;  3D9I A;  3D9M A;  3G2U A;  4AVX A;  1JWF A;  4HFG A;  2V8S E;  3D9L A;  1MHQ A;  1HF8 A;  4GZC A;  1PY1 A;  1DVP A;  5CMY A;  2LO6 A;  1UJK A;  1VDY A;  5LP0 A;  3CLJ A;  2KM4 A;  3G2W A;  3ZYK A;  3LDZ A;  3ONL A;  1HFA A;  1SZA A;  1JWG A;  1XGW A;  2DCP A;  4GZD A;  3D9J A;  1HG2 A;  1SZ9 A;  1UJJ A;  1X5B A;  2L0T B;  2BF0 X;  2QY7 A;  3ZYQ A;  3ZYL A;  2L0I A;  1HX8 A;  1JPL A;  3G2T A;  1ELK A;  1LF8 A;  3G2S A;  1JUQ A;  5LOZ A;  1H0A A;  1EYH A; 
#chains in the Genus database with same CATH topology
 1B89 A;  3ZYM A;  3BU8 A;  3RU0 A;  3JUE A;  4HBD A;  1Y8M A;  4OYS A;  3CVX A;  4C0M A;  4GPM A;  2WVI A;  3BG1 B;  4FC8 A;  1ELW A;  3VLF A;  2VSO E;  4PH4 B;  5CHE E;  5FIO A;  5CCM A;  2XZT G;  3QWW A;  2XPI A;  3ML9 A;  3MYV A;  3ZUV B;  2HE0 A;  3HXD A;  3DRA A;  3FTU A;  1K3Z D;  2VGY A;  1UN9 A;  2LSU A;  3ZHE A;  2XPY A;  1MX4 A;  3FY4 A;  3ONK A;  4EZL A;  3ESK A;  4LRZ A;  4RVB A;  3LJN A;  2DZO A;  4R7L A;  5E76 A;  1IHB A;  2OVF A;  4A1G A;  3TAX A;  3PNL B;  4G8L A;  2OEW A;  3NOC D;  5D2M C;  4QFV A;  2P58 C;  2VSX E;  2A4Z A;  2KZT B;  3DSU A;  3LCA A;  1HG2 A;  4HVB A;  3TWR A;  3NOG D;  4N5C A;  3CGH A;  2CFZ A;  2YQ8 A;  2KCK A;  1E8W A;  3CHP A;  3JCK C;  3EHR A;  3Q75 A;  2XS8 A;  4B8C B;  3APD A;  3TJP A;  1INZ A;  4TUM A;  1L5J A;  3SFZ A;  4DI3 A;  3FUL A;  3SBS A;  2Y0B G;  4HI8 A;  1E8Y A;  4TXP A;  3TGO A;  3NBN B;  1DC2 A;  5AQ7 A;  3VLD A;  2IU1 A;  4D10 C;  2WXF A;  3AG2 E;  4DK5 A;  4AY5 A;  2VGX B;  2L6J A;  3KD7 A;  1ZBP A;  2J08 A;  5EYP F;  5JMN D;  3CSF A;  1YYH A;  2HR2 A;  3HXB A;  1BPO A;  2R17 C;  4KBQ A;  3DSW A;  2R59 A;  4I1A A;  1UG3 A;  2OOE A;  3QKY A;  4XZ4 A;  4JL0 A;  1N0R A;  1NFI E;  3LVQ E;  1JCR A;  4HI9 A;  2WXO A;  5JHB A;  3UM0 A;  3V79 K;  5KJN A;  3PZ4 A;  3VTY A;  1IHG A;  4K5C A;  3S2A A;  3TWV A;  3IKO B;  1IYG A;  3MZL B;  3FHE A;  2FI7 A;  2Q7F A;  3FEY A;  5JHA A;  1TNY A;  3O48 A;  3FP3 A;  5EN5 D;  2CG3 A;  3UIP C;  3UX4 A;  1TN8 A;  3FUH A;  4F1P A;  1HH8 A;  3BEE A;  4CT0 A;  2H6F A;  2IO2 C;  2PQN A;  5FQ8 A;  1SVX A;  4LNB A;  4UQY A;  1U3D A;  1HF8 A;  4G2V A;  3SFX A;  5FIN A;  3LKU A;  3CLJ A;  4OVV A;  5EKQ D;  3ASO E;  4I2W A;  5BUZ A;  1K1B A;  1TEZ A;  2L0I A;  4WNG A;  4J6I A;  2CFU A;  4PS8 A;  2IOS A;  3JUI A;  3UM1 A;  1H6K A;  3C3O A;  1DCQ A;  1NL4 A;  1WDY A;  5T3R A;  5EIB E;  3AJI A;  3ZYK A;  2P9L G;  4NIK A;  1U3C A;  4BT8 A;  2BKG A;  3NZS A;  3L08 A;  1V55 E;  4FLB A;  1N4R A;  2FEZ A;  1TR4 A;  4IYP A;  5HQ8 A;  2UY1 A;  3W9F A;  2XGS A;  1P5Q A;  2IEJ A;  4CDM A;  3I4R B;  1FVH A;  1N95 A;  5BNW A;  4P29 A;  1E7U A;  4XKC A;  3GZ1 A;  3ASG A;  3NB2 A;  5JJT A;  2V5F A;  1H6O A;  2V8S E;  3CK8 A;  4N5Q A;  1KZP A;  4A3T A;  3QDN A;  2WXJ A;  2AVP A;  4GCO A;  4JA9 A;  2GRL A;  3PRZ A;  4X8Q A;  3WXX A;  3ZYL A;  4CGW A;  3V30 A;  3G2U A;  1NA3 A;  5LFA A;  2I6H A;  4BT9 A;  3W9G A;  2WQ7 A;  3HG0 D;  4L7T A;  3UUX A;  3ZFW A;  3D9J A;  3FTV A;  1O1T A;  4DLQ A;  3SGH A;  5CRV A;  5KBA A;  4JC8 A;  3EHM A;  2XHE A;  5HI7 A;  4K5A B;  5B1B E;  3KSL A;  4GMR A;  1BD8 A;  4RSY A;  5AN8 A;  1OUV A;  1FT2 A;  3HVE B;  2XRZ A;  4ILH B;  4YDW A;  3CQC B;  2I1K A;  3E32 A;  3RJV A;  3RRU A;  3SZ7 A;  4FU3 A;  3D9P A;  4EQF A;  4NQ0 A;  1HE8 A;  4DX1 A;  2KC7 A;  3FTX A;  2RD0 A;  3G2W A;  4XKB A;  2LAH A;  4EEC A;  3CVV A;  5AQ9 A;  2DYR E;  3DXM G;  1FVF A;  3CHO A;  3SQV A;  3GW4 A;  5FQ4 A;  1YCS B;  1KT1 A;  3FUD A;  4HXI A;  5H7P A;  5G2N A;  1OWN A;  3ASN E;  1RW2 A;  3NAW A;  4G24 A;  2MYO A;  4BX9 A;  4HNA D;  2J09 A;  2DWZ A;  5JA4 D;  5EX3 A;  3R7R A;  4C9B B;  2Y4U A;  2B6C A;  3ENE A;  3KS2 A;  2WB2 A;  3FDH A;  1O1R A;  5ENR D;  4J8S A;  2OEV A;  4JHK A;  2LXM A;  3LYA A;  2MHK A;  2JEK A;  4K0R A;  4N2S A;  2ZIS A;  3FTS A;  3T5X A;  3TWW A;  4I43 A;  1KPS B;  4F6R D;  2XEE A;  1ZU2 A;  3FH5 A;  5ENO D;  4Q69 A;  3FU5 A;  5CMW A;  1H2T C;  3PDN A;  4ATG A;  5FQ7 A;  2WXG A;  3UTM A;  5D66 A;  2F0Y A;  3RIB A;  1O5M A;  1IXV A;  3E37 A;  3DWL G;  1UW4 B;  1X81 A;  2WPV A;  4PS3 A;  1PC2 A;  5AJL A;  4GZD A;  4K5B A;  4AP2 A;  4EHM A;  4XE0 A;  4HOR A;  3I5P A;  3NF1 A;  5A23 A;  2WXQ A;  3UT7 A;  2EIM E;  4J8F A;  3APF A;  2QFC A;  4U63 A;  2VJ8 A;  1TYQ G;  3PZ1 A;  3Q79 A;  5C2Y A;  2C2L A;  2GRP B;  2DVW A;  2KCV A;  3DSX A;  3J5Q B;  1AWC B;  3D9O A;  3D3M A;  1WM5 A;  5HKP A;  5G55 A;  2J9Q A;  4A63 B;  4LSZ E;  4U0Z A;  2NC9 A;  5B3S E;  3HXF A;  5FZS A;  1TNO A;  3MA5 A;  2AW6 A;  1U2V G;  3MV2 B;  3O4Z A;  4GTP A;  4PS7 A;  3ZW3 A;  4XX5 A;  3MCX A;  5ENN A;  3EIQ C;  2RG8 A;  2XEN A;  1W3B A;  5KCM A;  3FWV A;  3GZS A;  3I3N A;  4AEZ C;  1JWG A;  4CDN A;  1E90 A;  2L0T B;  4B89 A;  4EPZ A;  4HLL A;  3HDX A;  1JUQ A;  3S7B A;  3DPD A;  3QC1 A;  2OVB A;  3D9K A;  3WG7 E;  3CST A;  4ANU A;  3OXG A;  3CHQ A;  3ASF A;  3EJN A;  1IQR A;  4G1T A;  2ZXW E;  4DPR A;  4PUC A;  5CBN A;  5ARF A;  5FZQ A;  3FUE A;  4QQI A;  4UQX A;  2VSY A;  4HQD A;  4C0E A;  4UWH A;  2C0M A;  2X38 A;  4DJA A;  2F37 A;  4GCN A;  2FUL A;  5AYW D;  3EUV A;  5G04 J;  1N11 A;  2YHC A;  2H6G A;  4FHJ A;  2Y3A A;  4YVO A;  4IN3 B;  1SW6 A;  3D9M A;  5KNG A;  3P1U A;  1O1S A;  4I9C A;  3T9K A;  3PS6 A;  4GZ3 A;  3MJW A;  3L22 A;  2X6K A;  3Q9N C;  4TUU A;  1ELK A;  4JD2 G;  5LOZ A;  3UXG A;  3Q4A B;  5ENS D;  3FUN A;  4U95 D;  3CK7 A;  4GU5 A;  4ANX A;  3Q7A A;  3UT4 A;  3UKU G;  4F7A A;  4XI9 A;  3ML8 A;  3DST A;  1HO8 A;  3G2S A;  3RRM B;  4CZ2 D;  1EPU A;  4LCT A;  2R2L A;  1NP7 A;  4UI9 K;  4H7Y A;  1FPP A;  2ZGD A;  2ETC A;  3EU9 A;  3PVL A;  5CBO A;  2EQX A;  2ZIR A;  2VTB A;  4BTB A;  4AOF A;  3CHM A;  4OVU A;  3QJZ A;  2ZGG A;  4U8Y D;  4TXQ A;  1N54 A;  1FCH A;  3TWS A;  3PUJ A;  4I6E A;  4BWR A;  5JJ7 A;  4UUC A;  1RZ4 A;  3PEU B;  3T8M A;  3IXE A;  3ABL E;  1SZ9 A;  2AXU A;  4LG6 A;  4I6J A;  1H19 A;  3MV3 B;  3CVU A;  5BXO A;  3PUK A;  2LXL A;  5ENP D;  4GTO A;  2EIL E;  4NUR A;  3RSE G;  2XGM A;  2X6F A;  4RQI A;  3VLE A;  2BTD A;  2Y4T A;  3C98 A;  3EIJ A;  3UIO C;  3ZVV A;  2BUG A;  3FUK A;  2XQ0 A;  2LNI A;  3CVN A;  2NXP A;  4NAC A;  3EHN A;  3IBE A;  1MQS A;  5A7D B;  1OT8 A;  4RG6 A;  2ION A;  4YND A;  3LY9 A;  4V3I A;  3BUA A;  4M7C A;  1TN6 A;  4N3A A;  1BI7 B;  3L82 A;  3LY8 A;  4AV7 A;  2P9K G;  2J4D A;  4IUL A;  3HIZ A;  3ZGQ A;  1ELR A;  1H0A A;  4CCA A;  2M63 A;  2V4L A;  3CHR A;  4WUY A;  4IRU A;  4BTA A;  5EYL A;  2KM4 A;  3ZNG A;  4BX8 A;  3SBT B;  3ABM E;  2P9I G;  2GGF A;  4Y6C A;  2VQ2 A;  2IF4 A;  4ABN A;  3DEO A;  4YDO A;  4LUN U;  4HRN A;  1S63 A;  2XEV A;  1MX6 A;  3OXF A;  4B8A A;  4UWK A;  2HM8 A;  5G04 C;  5B1A E;  5AQB A;  5KJK A;  1D8D A;  4GA0 A;  4YVQ C;  3ZYQ A;  5E75 A;  2XCC A;  3G2T A;  4J0U A;  3B7S A;  3DEP A;  3FU0 A;  4KT6 B;  2BKK B;  3FH7 A;  4JVS A;  5J90 A;  3EU5 A;  1YMP A;  4CYM D;  1SZA A;  4BFR A;  2KBX A;  4BEP A;  4DX6 D;  3CVQ A;  3RO3 A;  1FT1 A;  3TWQ A;  4J8D A;  1MZC A;  2R02 A;  1HZ4 A;  4I6G A;  5G05 C;  3B95 A;  4U8H A;  5FTP A;  3PH0 C;  3C72 A;  2I2O A;  4YDY A;  2IQC A;  4ILI A;  3QB2 A;  2EIJ E;  3JYS A;  4WNF A;  4AM9 A;  4WWP A;  2FO7 A;  5BPP A;  4BY6 A;  2F8X K;  5EX0 A;  2AXV A;  4AVX A;  3S7D A;  1Z5S C;  4I9E A;  2WXK A;  1TJC A;  2DCP A;  4XI0 A;  1K8K G;  4OAU C;  4HRM B;  2EIN E;  2DZN A;  4JHR A;  3QWV A;  4F53 A;  4GTR A;  1OXJ A;  2LUH A;  3DBS A;  5HRY A;  1Q2Z A;  1G3N B;  2P2C P;  2LO6 A;  4G11 A;  3MEK A;  4Y6W A;  3APC A;  2IFU A;  1MX2 A;  2EIK E;  3SO8 A;  3U4T A;  1BI8 B;  4JW1 A;  3Q5M A;  4Q94 A;  2DIW A;  4HFG A;  1IKN D;  4C48 B;  1WG0 A;  2C0L A;  2Y69 E;  4K03 A;  4XIF A;  1QQE A;  1KZO A;  3FTW A;  1EF1 C;  3AS4 A;  3CEQ A;  1SA4 A;  3HRA A;  5BW8 C;  2J8S D;  3CVW A;  5AJD A;  3MKQ B;  3UT8 A;  3MX3 A;  5J08 A;  3D9I A;  4JEH A;  4YDE A;  1OWL A;  2FO1 E;  3ULE G;  4ATZ D;  3IEG A;  3IHY A;  2PM6 A;  1QBQ A;  3LPZ A;  5T8I A;  2ETB A;  3Q15 A;  2HYZ A;  3ULQ A;  1TNB A;  3SF4 A;  3ISM C;  2RKK A;  1SA5 A;  1PY1 A;  5T4Y A;  2X6H A;  3HXE A;  4FHK A;  3HXC A;  3RAU A;  1V54 E;  1N4Q A;  3B13 A;  2KCL A;  2MOW A;  3HHM A;  4FAD A;  4LEU A;  5BT1 A;  3E34 A;  5KWD A;  2GW1 A;  4TV3 A;  4MBG A;  3SI5 A;  2ZU6 B;  5KNH D;  3JXI A;  4A55 A;  1N4P A;  3CVP A;  5AEN A;  2DYS E;  3FEX A;  4FJY A;  3OAW A;  1KLX A;  5ITZ F;  2KZT A;  4GA1 A;  3PZ2 A;  4WWO A;  4XEI G;  4GTT A;  3ZPJ A;  4U0U A;  2WXL A;  2A5U A;  3VTX A;  4U0S A;  2JLB A;  3BQO A;  3V31 A;  2YIN A;  4G26 A;  3K9I A;  2E0I A;  1PAQ A;  2Y1L E;  3NQP A;  4DX7 D;  4G23 A;  2IY0 C;  4FLH A;  2UWJ G;  3JXJ A;  3PE4 A;  4GZ5 A;  3QOU A;  1HXI A;  4UQZ A;  3OTN A;  3ESL A;  3V2X A;  2XPZ A;  1NZN A;  4N3B A;  4G8K A;  3TG4 A;  1K1A A;  1A17 A;  1Z6T A;  2CG2 A;  2AXZ A;  3J5P A;  1UOH A;  2QYJ A;  3URZ A;  4HB5 A;  4HLE A;  3UM3 A;  4N2Q A;  4WNE A;  4ACK A;  4LNU D;  4HOS A;  3UI2 A;  5IY5 E;  2E2E A;  3E30 A;  4UWL A;  4GYW A;  3Q47 B;  4BSZ B;  3FFL A;  5EIL A;  2KAT A;  3MGB A;  3U3W A;  1N52 A;  3UQ3 A;  3FUI A;  3LY7 A;  4I2Z A;  3E4B A;  3U9W A;  2IO3 C;  1XNF A;  1D9S A;  3R9M A;  1UJJ A;  1H2U A;  3E33 A;  2P9S G;  3EHQ A;  2LAI A;  3U64 A;  3ZXS A;  4FP7 A;  4HS2 A;  3L17 A;  3QNK A;  2GRN B;  3G2V A;  4L9P A;  1H6P A;  3QAR A;  1TNU A;  3TG5 A;  3LXU X;  2VGE A;  1E7V A;  3ASH A;  4G25 A;  2R05 A;  4MLP A;  5HS0 A;  3Q78 A;  1N0Q A;  4H7X A;  4GTQ A;  4JZY A;  2CHZ A;  4N3C A;  1S70 B;  4JXT A;  4PDX A;  3X2Q E;  2H6H A;  3GYZ A;  3JQ1 A;  5D0O D;  4GZ6 A;  1ZB1 A;  1OWO A;  4EBA A;  3UM2 A;  1JPL A;  4U07 A;  1QNF A;  2GRM A;  1JCQ A;  3RKV A;  1NA0 A;  3ZXP A;  1MHQ A;  3P2B A;  3B7B A;  3N71 A;  3ULY A;  2FF4 A;  3B7R L;  1HX8 A;  2WXH A;  2WM9 A;  5ARG A;  1UN8 A;  2RFA A;  3R9A B;  3CKC A;  5EID A;  5AIJ A;  5CED B;  4WWN A;  4WND A;  2X6I A;  4CRW A;  4U04 A;  3B7U X;  3ASD A;  3AS8 A;  3FUF A;  3DXK G;  4E6H A;  3AG4 E;  3F6Q A;  4ZHB A;  2WXM A;  5AQA A;  4B93 B;  4DLO A;  5LX8 A;  4URK A;  4UWF A;  2IOL A;  1E96 B;  4B0Z A;  2YNQ A;  5ANR A;  2VSN A;  4KYO B;  1A5E A;  5CRU A;  3RK6 A;  2BF0 X;  5C1D A;  4GTV A;  4MRU A;  1TNZ A;  3ABK E;  5M72 A;  2KXP C;  4KXK B;  5LCW J;  3SHF A;  2I1J A;  2UY1 B;  4KZC A;  2OND A;  5D0Q D;  4BER A;  3PEV B;  1HU3 A;  1N9A A;  3QWP A;  4EZK A;  1N94 A;  2PL2 A;  5KJL A;  5A6C A;  5FT9 A;  3UKR G;  4CT4 A;  4FUL A;  4KZ0 A;  4A3V A;  2WMO A;  5DBK A;  4CDR A;  2V0P A;  3SY2 A;  5BXU A;  1E8X A;  2GRQ B;  3KSQ A;  4I1O B;  2ETA A;  4GML A;  3HVE A;  3QK0 A;  1OCO E;  2RFM A;  2L6B A;  2LSV A;  4HRL A;  5ENQ D;  2MRI A;  3CK9 A;  3D9H A;  1NI1 A;  2WXP A;  4DX5 D;  1OY3 D;  1OCR E;  3CR3 A;  5FQ6 A;  1HG5 A;  1JWF A;  4DX2 A;  5FZR A;  4APF A;  4TRQ A;  3FH8 A;  4F3V A;  4DI4 A;  1D8E A;  4BSX A;  2X6J A;  1MYO A;  4L2L A;  3AS5 A;  1QYM A;  3Q7F A;  3DSS A;  1JCS A;  2XGO A;  4GA2 A;  5CEA A;  1DNP A;  2L9B A;  3PNT B;  4ANV A;  3CV0 A;  3DPY A;  1S64 A;  4UI9 J;  1IQU A;  3OXL A;  1HFA A;  1HS6 A;  4M3O A;  4U7E B;  4FA6 A;  2QY7 A;  1KT0 A;  1WAO 1;  1OWM A;  5AAO A;  3Q49 B;  4RG9 A;  4HOU A;  4BES A;  2A5E A;  4ME2 A;  1S0P A;  2V5Q C;  3JQ0 A;  2GRR B;  3ZN3 A;  1BU9 A;  3C3R A;  3V2O A;  2WXN A;  4O1O A;  4F1S A;  4AY6 A;  3PZD A;  4Z68 A;  4J7W A;  3AAA C;  2WQ6 A;  3ZHE B;  2AWI A;  4DRX E;  3CVY A;  2DBA A;  3TWX A;  1N4S A;  4DUI A;  3BG0 B;  2XRY A;  1BLX B;  4JHJ A;  2QC9 A;  2OV8 A;  2WMN A;  5LP0 A;  1DCE A;  4B94 A;  2GRO B;  4GB9 A;  4LER A;  3KEA A;  4N39 A;  1LF8 A;  3UIN C;  5KJM A;  1EDU A;  2WXR A;  3TWU A;  3D9N A;  3L13 A;  3CQG B;  1H2V C;  3Q73 A;  3FUM A;  4L1B A;  1SQM A;  2BED A;  1DVP A;  5CMY A;  1UJK A;  3SFY A;  2J4B A;  5CEC B;  3FU3 A;  3I4G A;  3L54 A;  5BV1 A;  2H6I A;  2VYI A;  3FTY A;  2P9N G;  3PZ3 A;  4GPK A;  3LEW A;  2XEH A;  4BET A;  3IV0 A;  2R03 A;  3Q9U C;  2NSZ A;  4GAA A;  3EDT B;  4W9R A;  3FTZ A;  3FUJ A;  2NYJ A;  3B7T A;  1VDY A;  2I9C A;  3DSV A;  2PQR A;  5FWQ A;  4JPS A;  3AU5 A;  4WAF A;  4GMJ A;  3CIA A;  2IJG X;  5CER B;  3C5R A;  5JJ6 A;  4NRH B;  3CHS A;  2CHW A;  4A1S A;  5LCW C;  4Q96 A;  1Z3Y A;  1Z3X A;  3AG3 E;  4GZC A;  5BV0 A;  2F8Y A;  3MKQ A;  4GTM A;  4GTS A;  1XGW A;  4GYO A;  4MKT A;  1MJ0 A;  1LD8 A;  1X5B A;  3QAQ A;  4AIF A;  5DIZ A;  5FJY A;  4O1P A;  2JAB A;  2PZI A;  4KMO A;  4EBA G;  4JEU A;  4HOQ A;  5ENT D;  4AXH A;  4U8V D;  1OCZ E;  2VGX A;  3PRE A;  3TWT A;  3MKR A;  2OCC E;  2B0O E;  5EDS A;  4OAV B;  2WXI A;  4U96 D;  2P9P G;  3LVR E;  2V4H C;  3AU4 A;  1YA0 A;  4J8E A;  4APO A;  3UPV A;  3ZKJ A;  4UWG A;  1Y6I A;  1EYH A;  3S7J A;  3FU6 A;  1TN7 A;  1OCC E;  1QZ2 A;  3ZEF A;  4LNG A;  3ZRH A;  2XZD G;  4CGV A;  4O60 A;  2PNN A;  2WQH A;  3LJ3 A;  4FJZ A;  2XS1 A;  3SD5 A;  3CKB A;  2VTB B;  4JA7 A;  4JB8 P;  2YHE A;  2XCB A;  3T5V A;  4KVM A;  4I17 A;  5G05 J;  4TXR A;  3ONL A;  4AJW A;  4CEM A;  3SNX A;  3ZIM A;  3AG1 E;  4L2Y A;  2PM7 A;  1TJF A;  4ANW A;  1WY6 A;  2J49 A;  2HO1 A;  4O6F A;  3NZU A;  4MS6 A;  4UI9 C;  2CHX A;  4EZJ A;  2ILR A;  3KEZ A;  5ANL A;  3CVL A;  3L9T A;  2X3M A;  1AP7 A;  2QZA A;  4HOT A;  3TL5 A;  2FBN A;  3HYM B;  4J8Y A;  3RRN B;  3GZ2 A;  4ILG A;  3L16 A;  3T8K A;  4L23 A;  3TXM A;  4ACL A;  1GW6 A;  4GYY A;  4RLY A;  4I1M A;  4ZFH A;  2AJA A;  3RO2 A;  3PE3 A;  3C3Q A;  2J07 A;  2P9U G;  2QYU A;  1LTX A;  4KVO A;  3U66 A;  4E85 A;  5AAR A;  1E8Z A;  1OWP A;  3ZU7 B;  1LD7 A;  3TXN A;  3D9L A;  2R5S A;  3LS8 A;  3R7Q A;  3LDZ A;  3UMV A;  3KAE A;  3L6A A;  5CCL A;  3S7F A;  3IHV A; 
#chains in the Genus database with same CATH homology
 1B89 A;  5M72 A;  3ZYM A;  4J8S A;  4JHK A;  4KXK B;  3CVQ A;  3RO3 A;  5LCW J;  3SHF A;  3LYA A;  3RU0 A;  2I1J A;  2MHK A;  4J8D A;  2JEK A;  2UY1 B;  1Y8M A;  4K0R A;  4OYS A;  4N2S A;  4KZC A;  1HZ4 A;  2OND A;  3CVX A;  4I6G A;  5D0Q D;  5G05 C;  4U8H A;  5FTP A;  4C0M A;  3PH0 C;  3FTS A;  3T5X A;  2I2O A;  3PEV B;  2WVI A;  3BG1 B;  4FC8 A;  4I43 A;  1ELW A;  3VLF A;  1HU3 A;  2IQC A;  4ILI A;  3QWP A;  3QB2 A;  3JYS A;  4EZK A;  4WNF A;  2VSO E;  4AM9 A;  4PH4 B;  5CHE E;  1ZU2 A;  3FH5 A;  2PL2 A;  4WWP A;  4Q69 A;  3QWW A;  2FO7 A;  5CCM A;  3FU5 A;  2XPI A;  5CMW A;  5KJL A;  5BPP A;  1H2T C;  5A6C A;  3PDN A;  3ML9 A;  3MYV A;  4BY6 A;  4ATG A;  5FQ7 A;  5EX0 A;  2WXG A;  2AXV A;  5FT9 A;  4AVX A;  4CT4 A;  4FUL A;  3S7D A;  4KZ0 A;  3RIB A;  4A3V A;  2WMO A;  3FTU A;  4I9E A;  2WXK A;  2VGY A;  5DBK A;  1TJC A;  4CDR A;  1UW4 B;  2V0P A;  1UN9 A;  2LSU A;  2WPV A;  4PS3 A;  1PC2 A;  2DCP A;  1E8X A;  4GZD A;  5AJL A;  3ZHE A;  4XI0 A;  4AP2 A;  2XPY A;  4XE0 A;  4I1O B;  4GML A;  3HVE A;  4HOR A;  3QK0 A;  4JHR A;  3I5P A;  3QWV A;  3FY4 A;  3NF1 A;  3ONK A;  4F53 A;  5A23 A;  2LSV A;  2WXQ A;  3UT7 A;  4EZL A;  3ESK A;  4J8F A;  3APF A;  4LRZ A;  3DBS A;  4RVB A;  2QFC A;  2MRI A;  3CK9 A;  4R7L A;  5E76 A;  2OVF A;  2LO6 A;  4G11 A;  4U63 A;  2VJ8 A;  3MEK A;  5C2Y A;  2WXP A;  3APC A;  4Y6W A;  2IFU A;  2C2L A;  4A1G A;  3TAX A;  2KCV A;  3PNL B;  3U4T A;  4JW1 A;  4QFV A;  3Q5M A;  3CR3 A;  3D9O A;  2P58 C;  2VSX E;  5FQ6 A;  2A4Z A;  3D3M A;  4Q94 A;  1WM5 A;  1HG5 A;  2DIW A;  1JWF A;  2KZT B;  4HFG A;  5G55 A;  2C0L A;  2J9Q A;  4K03 A;  5FZR A;  4XIF A;  4U0Z A;  2NC9 A;  3LCA A;  4APF A;  4TRQ A;  3FH8 A;  1QQE A;  5FZS A;  4F3V A;  1HG2 A;  3FTW A;  4DI4 A;  1EF1 C;  3AS4 A;  3CEQ A;  4BSX A;  2X6J A;  3MA5 A;  5BW8 C;  4HVB A;  2AW6 A;  3MV2 B;  3CVW A;  4L2L A;  3O4Z A;  3AS5 A;  5AJD A;  4N5C A;  3CGH A;  2CFZ A;  3MKQ B;  3UT8 A;  4PS7 A;  3ZW3 A;  3MX3 A;  4XX5 A;  2YQ8 A;  3D9I A;  5J08 A;  4JEH A;  2KCK A;  2XGO A;  3MCX A;  1E8W A;  5ENN A;  3EIQ C;  3CHP A;  2RG8 A;  3JCK C;  1OWL A;  4GA2 A;  1W3B A;  5KCM A;  3IEG A;  1DNP A;  2L9B A;  3FWV A;  3GZS A;  3I3N A;  3PNT B;  3CV0 A;  4ANV A;  4AEZ C;  4UI9 J;  1IQU A;  3IHY A;  1HFA A;  3OXL A;  1HS6 A;  1JWG A;  4M3O A;  2PM6 A;  4FA6 A;  4B8C B;  4CDN A;  1E90 A;  2L0T B;  2QY7 A;  3LPZ A;  1KT0 A;  1WAO 1;  4B89 A;  1OWM A;  4EPZ A;  3APD A;  3HDX A;  5T8I A;  1JUQ A;  3TJP A;  1INZ A;  3Q49 B;  3DPD A;  3Q15 A;  3S7B A;  2HYZ A;  4RG9 A;  3ULQ A;  1L5J A;  3QC1 A;  3SFZ A;  4DI3 A;  4HOU A;  4ME2 A;  2OVB A;  1S0P A;  3FUL A;  3SBS A;  3SF4 A;  3D9K A;  3CST A;  1E8Y A;  3JQ0 A;  3TGO A;  4ANU A;  3VLD A;  2IU1 A;  4D10 C;  1PY1 A;  5T4Y A;  2WXF A;  3ZN3 A;  3OXG A;  3CHQ A;  4DK5 A;  2X6H A;  4AY5 A;  2VGX B;  2L6J A;  2WXN A;  3KD7 A;  1ZBP A;  4FHK A;  3ASF A;  2J08 A;  3EJN A;  1IQR A;  3CSF A;  4G1T A;  3B13 A;  2HR2 A;  4DPR A;  1BPO A;  4PUC A;  2R17 C;  4F1S A;  4KBQ A;  4AY6 A;  2KCL A;  3PZD A;  2MOW A;  2WQ6 A;  5ARF A;  3ZHE B;  3HHM A;  4FAD A;  4LEU A;  2AWI A;  2R59 A;  4I1A A;  5BT1 A;  5FZQ A;  1UG3 A;  2GW1 A;  2OOE A;  4TV3 A;  3CVY A;  2DBA A;  3FUE A;  3SI5 A;  3QKY A;  4XZ4 A;  2ZU6 B;  4JL0 A;  3BG0 B;  2XRY A;  4UQX A;  2VSY A;  3LVQ E;  4C0E A;  4JHJ A;  4UWH A;  2C0M A;  4A55 A;  2OV8 A;  2WMN A;  3CVP A;  2X38 A;  5AEN A;  5LP0 A;  4DJA A;  3FEX A;  2WXO A;  4FJY A;  4B94 A;  3OAW A;  1KLX A;  5JHB A;  4GB9 A;  4LER A;  5KJN A;  2KZT A;  4GCN A;  4GA1 A;  3VTY A;  1IHG A;  4N39 A;  2FUL A;  1LF8 A;  3S2A A;  3IKO B;  5G04 J;  5AYW D;  3MZL B;  1IYG A;  3FHE A;  5KJM A;  1EDU A;  4WWO A;  2WXR A;  2YHC A;  2FI7 A;  2Q7F A;  3D9N A;  3FEY A;  5JHA A;  3O48 A;  2Y3A A;  3L13 A;  4FHJ A;  3ZPJ A;  3FP3 A;  3CQG B;  4YVO A;  4IN3 B;  4U0U A;  2WXL A;  1H2V C;  3D9M A;  2CG3 A;  2A5U A;  3VTX A;  3FUM A;  4L1B A;  1SQM A;  3P1U A;  3UX4 A;  1DVP A;  4U0S A;  5CMY A;  1UJK A;  2JLB A;  2J4B A;  2YIN A;  3FUH A;  4I9C A;  3FU3 A;  1HH8 A;  3I4G A;  3L54 A;  4G26 A;  3BEE A;  3PS6 A;  4CT0 A;  4GZ3 A;  3K9I A;  2E0I A;  3MJW A;  1PAQ A;  3L22 A;  5BV1 A;  2PQN A;  2VYI A;  2X6K A;  3FTY A;  3NQP A;  4TUU A;  1ELK A;  5LOZ A;  4GPK A;  3LEW A;  3Q4A B;  5FQ8 A;  4G23 A;  4FLH A;  2UWJ G;  3IV0 A;  2NSZ A;  3FUN A;  3PE4 A;  4UQY A;  3CK7 A;  4GAA A;  3EDT B;  4GU5 A;  4GZ5 A;  4W9R A;  3FTZ A;  1U3D A;  1HF8 A;  3FUJ A;  3QOU A;  4G2V A;  4ANX A;  3B7T A;  1VDY A;  2I9C A;  3LKU A;  3UT4 A;  1HXI A;  3CLJ A;  4UQZ A;  3OTN A;  3ESL A;  2XPZ A;  4OVV A;  2PQR A;  5EKQ D;  1NZN A;  4JPS A;  3AU5 A;  4WAF A;  4I2W A;  4N3B A;  5FWQ A;  4F7A A;  5BUZ A;  4XI9 A;  4GMJ A;  3ML8 A;  1TEZ A;  3CIA A;  2L0I A;  4WNG A;  1HO8 A;  4J6I A;  3TG4 A;  1A17 A;  2CFU A;  2IJG X;  4PS8 A;  3G2S A;  5JJ6 A;  2IOS A;  1Z6T A;  3JUI A;  4NRH B;  1H6K A;  3RRM B;  2CG2 A;  3CHS A;  2CHW A;  1EPU A;  2AXZ A;  4A1S A;  5LCW C;  4LCT A;  4Q96 A;  1Z3Y A;  1Z3X A;  1NP7 A;  3URZ A;  5T3R A;  4GZC A;  5BV0 A;  4UI9 K;  3MKQ A;  4H7Y A;  3ZYK A;  4HLE A;  4N2Q A;  1XGW A;  4GYO A;  4MKT A;  3PVL A;  4WNE A;  2EQX A;  1X5B A;  4ACK A;  2VTB A;  3QAQ A;  4AIF A;  5DIZ A;  4BTB A;  5FJY A;  4AOF A;  1U3C A;  4BT8 A;  2PZI A;  4KMO A;  3CHM A;  3NZS A;  4OVU A;  4EBA G;  3QJZ A;  4JEU A;  4HOS A;  4HOQ A;  3L08 A;  4AXH A;  2VGX A;  3PRE A;  2E2E A;  4FLB A;  4UWL A;  4GYW A;  3MKR A;  2FEZ A;  1N54 A;  4IYP A;  3Q47 B;  1FCH A;  3FFL A;  5EDS A;  2KAT A;  2UY1 A;  3MGB A;  3PUJ A;  4I6E A;  5HQ8 A;  3U3W A;  2WXI A;  1N52 A;  3UQ3 A;  3FUI A;  3LY7 A;  4I2Z A;  3E4B A;  2XGS A;  3U9W A;  4BWR A;  5JJ7 A;  3LVR E;  3PEU B;  1P5Q A;  3T8M A;  1XNF A;  3AU4 A;  1SZ9 A;  2AXU A;  1UJJ A;  4I6J A;  4CDM A;  3I4R B;  1FVH A;  1H2U A;  1H19 A;  1YA0 A;  4J8E A;  4APO A;  3MV3 B;  3UPV A;  5BNW A;  3CVU A;  4UWG A;  1Y6I A;  2LAI A;  4P29 A;  1E7U A;  1EYH A;  3U64 A;  4XKC A;  3PUK A;  3GZ1 A;  3ASG A;  3ZXS A;  4FP7 A;  4HS2 A;  3L17 A;  5JJT A;  3QNK A;  3S7J A;  3G2V A;  3FU6 A;  2V5F A;  1QZ2 A;  3ZEF A;  4NUR A;  2V8S E;  3CK8 A;  3ZRH A;  3QAR A;  2XGM A;  4CGV A;  2X6F A;  3TG5 A;  3LXU X;  4A3T A;  3QDN A;  3VLE A;  2BTD A;  2WXJ A;  2AVP A;  1E7V A;  2Y4T A;  3ASH A;  4GCO A;  4JA9 A;  2WQH A;  2GRL A;  3LJ3 A;  3C98 A;  3EIJ A;  3PRZ A;  4G25 A;  3WXX A;  4FJZ A;  3ZVV A;  2BUG A;  3SD5 A;  3CKB A;  3ZYL A;  4MLP A;  4CGW A;  2VTB B;  3FUK A;  2XQ0 A;  2LNI A;  3G2U A;  4JA7 A;  3CVN A;  2NXP A;  1NA3 A;  4H7X A;  5LFA A;  2YHE A;  2I6H A;  3EHN A;  3IBE A;  4JZY A;  4NAC A;  4BT9 A;  2CHZ A;  4N3C A;  4JXT A;  1MQS A;  2XCB A;  5A7D B;  3T5V A;  2WQ7 A;  4RG6 A;  4PDX A;  2ION A;  4KVM A;  4I17 A;  4YND A;  3LY9 A;  4V3I A;  3GYZ A;  3JQ1 A;  5G05 J;  4L7T A;  5D0O D;  4GZ6 A;  3ONL A;  4N3A A;  3LY8 A;  4AJW A;  3UUX A;  3SNX A;  3ZIM A;  4AV7 A;  3ZFW A;  4CEM A;  1OWO A;  2J4D A;  3D9J A;  3FTV A;  4IUL A;  4EBA A;  4L2Y A;  3HIZ A;  2PM7 A;  1JPL A;  4U07 A;  3ZGQ A;  1TJF A;  3SGH A;  4ANW A;  4DLQ A;  1WY6 A;  2J49 A;  1ELR A;  2HO1 A;  1QNF A;  1H0A A;  4O6F A;  3NZU A;  4MS6 A;  4UI9 C;  2CHX A;  4CCA A;  4EZJ A;  2GRM A;  2M63 A;  2V4L A;  4JC8 A;  3EHM A;  3CHR A;  3RKV A;  2ILR A;  4WUY A;  3KEZ A;  5ANL A;  4IRU A;  2XHE A;  3CVL A;  1NA0 A;  2X3M A;  4BTA A;  1MHQ A;  3P2B A;  5HI7 A;  4HOT A;  3N71 A;  2KM4 A;  3TL5 A;  2FBN A;  3HYM B;  2FF4 A;  4RSY A;  3RRN B;  4BX8 A;  3GZ2 A;  1OUV A;  3HVE B;  4ILG A;  3L16 A;  3SBT B;  2XRZ A;  4ILH B;  3CQC B;  2GGF A;  3B7R L;  4L23 A;  3TXM A;  1HX8 A;  2I1K A;  4Y6C A;  2WXH A;  2VQ2 A;  3RJV A;  3RRU A;  4ACL A;  3SZ7 A;  2WM9 A;  1GW6 A;  2IF4 A;  4GYY A;  4FU3 A;  3D9P A;  5ARG A;  1UN8 A;  4ABN A;  4EQF A;  4I1M A;  4NQ0 A;  1HE8 A;  3R9A B;  2KC7 A;  4LUN U;  3CKC A;  5AIJ A;  2XEV A;  4WWN A;  3FTX A;  3OXF A;  3RO2 A;  3PE3 A;  4UWK A;  2RD0 A;  2HM8 A;  3G2W A;  4WND A;  4XKB A;  2LAH A;  5G04 C;  4B8A A;  2X6I A;  4EEC A;  3CVV A;  4CRW A;  4U04 A;  5KJK A;  2J07 A;  3B7U X;  3ASD A;  3AS8 A;  3FUF A;  4GA0 A;  4YVQ C;  3ZYQ A;  5E75 A;  2XCC A;  3G2T A;  4KVO A;  4E85 A;  1FVF A;  4E6H A;  3CHO A;  3U66 A;  1E8Z A;  3GW4 A;  5FQ4 A;  1KT1 A;  3FUD A;  4J0U A;  3B7S A;  3FU0 A;  4KT6 B;  4HXI A;  1OWP A;  5G2N A;  1OWN A;  2WXM A;  4DLO A;  5LX8 A;  3FH7 A;  4UWF A;  4URK A;  2IOL A;  1E96 B;  3D9L A;  4G24 A;  2YNQ A;  4JVS A;  3TXN A;  2R5S A;  4B0Z A;  4BX9 A;  5ANR A;  2VSN A;  4KYO B;  5J90 A;  3LS8 A;  3R7Q A;  3LDZ A;  3UMV A;  3RK6 A;  3KAE A;  2J09 A;  3L6A A;  1SZA A;  4BFR A;  5EX3 A;  3R7R A;  4C9B B;  2Y4U A;  5CCL A;  3S7F A;  2BF0 X;  3IHV A;  3ENE A;  5C1D A;  3KS2 A;  2WB2 A;  3FDH A;  4MRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...