1EYHA

Crystal structure of the epsin n-terminal homology (enth) domain at 1.56 angstrom resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
144
structure length
144
Chain Sequence
b'HNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSIN
publication title CRYSTAL STRUCTURE OF THE EPSIN N-TERMINAL HOMOLOGY (ENTH) DOMAIN AT 1.56 ANGSTROM RESOLUTION
rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 60
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2000-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1eyhA00
1HX8A 5J08A 4FLBA 1X5BA 2DIWA 2BF0X 3G2SA 3ONKA 5LOZA 1LF8A 1JUQA 3ZYKA 3G2UA 1PY1A 3RRUA 2MOWA 5CMWA 2LO6A 3ZYLA 3G2TA 4AVXA 3ONLA 1EDUA 1ELKA 1HG5A 1MHQA 3D9KA 2KM4A 1JWGA 3D9IA 3G2VA 4GZCA 4JXTA 2DCPA 3LDZA 1SZ9A 1JPLA 2L0IA 4Q94A 4FU3A 4Q96A 3G2WA 3ZYMA 1INZA 1H0AA 1DVPA 3ZYQA 1EYHA 1UJKA 3D9NA 1JWFA 1VDYA 2V8SE 3D9MA 1HF8A 1HG2A 3D9LA 1HFAA 4GZDA 1SZAA 4NACA 5CMYA 4HFGA 1XGWA 3D9JA 3D9OA 5LP0A 3CLJA 3D9PA 2L0TB 1UJJA 2QY7A
chains in the Genus database with same CATH superfamily
1SQMA 4WNDA 3UINC 3HXFA 3APCA 3Q5MA 2WXNA 1U3DA 3AJIA 3VLFA 4RLYA 1N52A 4YNDA 1Y6IA 2LXMA 5A7DB 3B95A 2FBNA 1G3NB 4APFA 4RVBA 1OUVA 1E7VA 2XEEA 1HH8A 2Y69E 4FJYA 4N3BA 4M3OA 3G2UA 2LUHA 4GTTA 1E8WA 2QC9A 2VGYA 3HDXA 3FTUA 3DPYA 4KVOA 3LXUX 3G2WA 4HOSA 2XGOA 1O1TA 3DEOA 3DPDA 3QK0A 3MKQA 4WNFA 3L16A 5FQ6A 2L6JA 3QARA 5FQ7A 1H19A 3CQGB 3G2SA 2Y1LE 3ML8A 4JHRA 1BPOA 4K0RA 2J49A 2XRYA 3C3OA 2P58C 4A63B 2IQCA 4HI9A 1N11A 5AYWD 5CCLA 3ASOE 2IOSA 3FUKA 3RO2A 3PZ4A 3CVXA 4OVUA 3GZ2A 5LOZA 1D8DA 3KEZA 4YVQC 2P9SG 3FUMA 3EU5A 3CK7A 3ZW3A 2V5FA 3HVEB 1ELRA 3OXLA 3Q78A 5ENQD 3UM0A 3V30A 1DCEA 2CHWA 2XPIA 5AQBA 5AQ7A 4ILIA 1N9AA 4LUNU 4U0UA 1NA3A 3IKOB 5EKQD 3ZFWA 2NSZA 3IHVA 3EHRA 3FH8A 1UJKA 4B94A 2PL2A 2AXVA 4U8VD 4DI3A 3EDTB 3UM3A 3MEKA 2WXOA 4Y6WA 4A3VA 2DBAA 2EQXA 2X6HA 3EHQA 1DC2A 3KEAA 2EINE 3ZIMA 2KBXA 5HQ8A 1WDYA 2FO1E 1HXIA 3JXJA 1K3ZD 3GW4A 4RSYA 2B6CA 4W9RA 4F6RD 3FUJA 3CVLA 3RJVA 2DIWA 3SD5A 3VLDA 5EDSA 2KATA 1FT2A 4TXPA 5CBNA 3IEGA 3SNXA 3SBTB 4K5AB 5IY5E 3CHMA 4DI4A 2DVWA 5EYLA 3UM1A 1HU3A 4A3TA 3B7RL 4U0SA 3MV3B 3QKYA 3ULYA 4MRUA 4PH4B 3O4ZA 3MX3A 3TWXA 2H6HA 1KZPA 3OXGA 2YINA 5JHAA 5FZSA 5FWQA 4E6HA 4QFVA 3RRMB 2E2EA 5ARFA 3TWUA 4FHJA 1H0AA 2WM9A 1V54E 3L6AA 4HQDA 4WWNA 3EIQC 2P9UG 4N3AA 4L1BA 4UWGA 4O1PA 1V55E 1OXJA 2JABA 1UN8A 3SHFA 1TNOA 1N4PA 1KPSB 3WG7E 5AIJA 3DSTA 4HXIA 3DRAA 4WNEA 3SGHA 4AV7A 3FUNA 5B1AE 4GTSA 3Q15A 5KWDA 1TR4A 3JUIA 1E8XA 3MA5A 2UWJG 5JJTA 2BF0X 4Y6CA 3T8MA 2MOWA 4UWLA 4OVVA 1HG5A 1NP7A 4LSZE 5CEAA 5EN5D 5FZQA 4G8LA 2GGFA 5AENA 4KYOB 1NZNA 3UIPC 1SZAA 4G11A 5LP0A 3CLJA 3ZKJA 3TWVA 4R7LA 1Z3YA 2Y4UA 2ZU6B 5ENRD 4FADA 1YA0A 4XKBA 3QAQA 3E34A 2HR2A 4YDWA 1BLXB 3MCXA 2VQ2A 3NQPA 3EHMA 3SF4A 4HOTA 1H2TC 2WXPA 1HZ4A 4EBAA 4JHJA 3TXNA 5DBKA 4GYWA 2F37A 1O5MA 4PS8A 3ZPJA 4G24A 4BTAA 3ZYMA 3UPVA 2MHKA 4V3IA 4GMRA 3E4BA 4GZ3A 1H6PA 5ENSD 2XRZA 3I4RB 3V2XA 3V2OA 2HO1A 4I9CA 1TN8A 1E8ZA 2JEKA 2WQ6A 4JC8A 3BU8A 4UQZA 2I6HA 3PZ2A 2OVBA 2R02A 4YDYA 5D66A 4PS7A 3JCKC 4LNUD 4OAUC 4H7YA 5AAOA 3E37A 2R59A 5CMWA 5B3SE 1JCRA 4KXKB 4CDRA 2XZTG 3MKQB 3ML9A 3FU6A 2DZNA 1KT0A 2WPVA 2YQ8A 3FTSA 5BPPA 5T8IA 3KD7A 1Y8MA 3B13A 3PE4A 3C5RA 3QWWA 5FINA 5CECB 3SZ7A 3MJWA 4GPMA 3JUEA 5ANRA 4KVMA 3PNTB 3D9HA 3DBSA 1S0PA 4N3CA 3CKBA 4UWFA 3P2BA 3ULQA 2ILRA 1QQEA 1RW2A 3FDHA 4IRUA 2IF4A 2XENA 2VYIA 3D9PA 4JHKA 4I6GA 4J0UA 3UKUG 4J8EA 5DIZA 1HO8A 4J7WA 1SZ9A 4EHMA 4L2YA 5CRUA 3TWSA 1YYHA 4DX1A 4UI9K 3GZSA 3NB2A 1HE8A 1E8YA 3TWTA 3D9OA 3EIJA 4FULA 5J90A 4RG6A 2J4DA 4MBGA 2QYUA 3TWQA 1LF8A 2ONDA 3L08A 4XKCA 4Q69A 4JL0A 4JD2G 4HLEA 4G8KA 3LKUA 4PUCA 3ASFA 2WXKA 1UOHA 4CZ2D 4OAVB 3FTXA 5G04J 1K8KG 2X6IA 3HHMA 3QWVA 4XI0A 3PZ3A 2WXIA 1OCCE 4EZKA 4I1AA 3SFXA 1JWGA 2DCPA 4J8SA 3TWRA 2WB2A 4J8YA 2CG3A 4BT8A 1MJ0A 2FF4A 2I1KA 3FULA 4I1OB 1OT8A 2L9BA 1SW6A 3AG4E 1OWOA 4UI9J 3Q49B 4TXRA 4HI8A 5CERB 3FEYA 1QNFA 3Q79A 4HLLA 2VSOE 4PDXA 5AN8A 3FU3A 4U8HA 2UY1A 4WWOA 2BEDA 2NXPA 4GTRA 4MS6A 1UW4B 2CG2A 3ASDA 4X8QA 5EIDA 3UTMA 4DX5D 2ZISA 2I2OA 2AJAA 4N5CA 1H2UA 3BEEA 3GZ1A 3CVWA 2EIME 3PS6A 4CGWA 4AIFA 4CT4A 4J6IA 5AQAA 1QZ2A 4DLQA 1PY1A 5BV0A 3ASGA 2VGXB 3ESLA 2HE0A 3DXMG 3QOUA 2YHEA 3T5XA 4TUUA 5ARGA 5LX8A 3FUHA 3V31A 5AARA 1HF8A 2OV8A 1IQRA 3D9JA 1YMPA 5HKPA 1MQSA 5FT9A 2I1JA 3KSQA 1BD8A 3NBNB 3Q73A 4U63A 4DJAA 1N0QA 3TXMA 5ENTD 3AS8A 2KCLA 3D9NA 1FVFA 2YNQA 2X6JA 4UQYA 2IO2C 4GZ5A 4A1SA 1OWLA 4GTMA 4BETA 2VTBA 4GAAA 3U4TA 4FU3A 4JA9A 2XPYA 3SI5A 5LCWJ 3ZVVA 3FY4A 3B7UX 2DYRE 4C48B 2NYJA 3AU5A 4TXQA 3C98A 4KT6B 1N0RA 3I4GA 4BESA 3LS8A 2KCVA 3D9IA 1IKND 4FP7A 1LD7A 1JCSA 4O60A 5ENOD 1HG2A 3PRZA 2VSXE 4B8AA 3PE3A 3ASHA 1N4SA 1RZ4A 3ZHEA 3NZUA 2XEHA 1TYQG 3UT8A 4U8YD 2M63A 5G05C 1Z5SC 5JJ6A 4GTVA 2FI7A 4FLHA 1KZOA 2L0TB 2XS1A 1SA5A 2EIJE 4GCOA 3CVNA 3ZRHA 2Y0BG 3FEXA 4CYMD 4BX8A 2XPZA 2A4ZA 3AG2E 4B89A 4EZLA 4I6EA 2AW6A 1XGWA 4NRHB 2WQ7A 2KM4A 1GW6A 4PS3A 4JVSA 4YDEA 4GZDA 4HB5A 4HBDA 3IHYA 4ACLA 2XCBA 3FUDA 1N4QA 1X81A 4L2LA 3GYZA 1DCQA 3QC1A 3SO8A 3FUIA 5ANLA 3CGHA 3CKCA 3RO3A 4BERA 2IOLA 4EPZA 1OWMA 5T4YA 1H6KA 2AXUA 2CFUA 1PAQA 1DNPA 5KJLA 3VTXA 3CHQA 4BFRA 3PH0C 4K5BA 2OEWA 3QNKA 3LYAA 3R9MA 3S2AA 2E0IA 5A23A 4H7XA 3CHOA 4HORA 3DXKG 3L13A 2IONA 3LPZA 2QY7A 3FTYA 1SA4A 3TAXA 4I43A 3VTYA 4ANVA 1MZCA 1MHQA 4WWPA 5G05J 5BNWA 4DPRA 5EX3A 5FQ8A 4GU5A 5G2NA 3ESKA 3B7SA 4HFGA 2Y3AA 2RFMA 1E90A 3I3NA 2CFZA 3SFYA 3RSEG 1TN6A 4NIKA 4RG9A 4C0MA 3JYSA 3MKRA 3FU0A 4TRQA 5JA4D 2DZOA 3CIAA 1A17A 3T5VA 1S64A 1N54A 2R2LA 3FTVA 3L17A 2ZIRA 3HG0D 2X3MA 1UG3A 3UMVA 4AVXA 3CVQA 2J07A 3UI2A 2XS8A 3MV2B 4GYYA 2UY1B 4YDOA 3UM2A 2MRIA 4NURA 2EILE 5HRYA 4G2VA 3PEVB 5BW8C 2P9PG 1BI7B 1Q2ZA 3KAEA 4B0ZA 2R05A 3LY8A 2GRNB 2NC9A 2AXZA 4C9BB 2RFAA 4BSZB 4EECA 3QDNA 4DUIA 4F7AA 3ONKA 4TUMA 1L5JA 3TL5A 1Z6TA 4FHKA 4ILHB 2KZTA 3OAWA 3IV0A 1AP7A 2XEVA 5KNGA 4DX7D 3ZU7B 5CMYA 2WXFA 3IXEA 3K9IA 4XE0A 5ENNA 1LTXA 4N2QA 4E85A 2GW1A 3UT7A 2XGMA 1O1SA 1SVXA 3L9TA 3UXGA 2WVIA 2KXPC 3LEWA 2P9IG 2BKKB 3TGOA 4KZCA 3BG1B 2IY0C 4GCNA 4G23A 4JEHA 2J9QA 3CVUA 4Z68A 1ELWA 4AXHA 3FUEA 3C3QA 5JMND 5AQ9A 1TEZA 3HXEA 2VTBB 4J8FA 3DSXA 1K1AA 3U9WA 1XNFA 4DLOA 2F0YA 4ATZD 2GRPB 3MGBA 2FO7A 4QQIA 1AWCB 4HOQA 5D2MC 2KC7A 2PNNA 3HXCA 3U64A 2P9KG 4LERA 2V5QC 1IXVA 3ENEA 2P2CP 3ZEFA 4URKA 5D0OD 3UQ3A 2X6FA 4K5CA 4AOFA 1N94A 4L7TA 1N4RA 2WXLA 2V8SE 4I6JA 2ETCA 4UWHA 5JHBA 4A55A 1TNZA 4HRMB 3EUVA 1H6OA 1JUQA 1WG0A 2LO6A 2J8SD 1E7UA 3Q9NC 1S63A 4JW1A 4ZHBA 3AAAC 4IN3B 4BTBA 4ACKA 2RG8A 4BSXA 3HXDA 4DRXE 5CEDB 4GMJA 5CHEE 4EQFA 1HX8A 4WAFA 1TNYA 4HRLA 3AS4A 3B7TA 3UT4A 3OXFA 2LAIA 2KCKA 5E75A 3R7RA 3S7DA 3SBSA 5T3RA 4DK5A 2BUGA 2XQ0A 1UJJA 2LAHA 5CRVA 2PQNA 4I2WA 2FULA 3Q4AB 3BUAA 3RU0A 3CHSA 2H6GA 1OWPA 3PZDA 2J4BA 3J5PA 3L22A 3BG0B 5BXUA 2DYSE 3BQOA 5G55A 2WXGA 1ZU2A 3AG3E 4HVBA 1QYMA 4LNGA 3DEPA 3KS2A 4TV3A 1X5BA 3ABKE 1W3BA 1WM5A 3FU5A 1IHGA 3ASNE 3G2TA 4DX6D 4F1SA 4AY6A 2XZDG 3CQCB 3SFZA 3E30A 1U2VG 4DX2A 3RAUA 3FWVA 3HXBA 3CK8A 5LFAA 2JLBA 4F3VA 4N2SA 1MX6A 3URZA 4AY5A 1Z3XA 3ZN3A 2WMOA 3LY9A 3NOGD 4U04A 1ZB1A 1LD8A 4U7EB 3G2VA 4G1TA 2QZAA 4AP2A 1PC2A 2X6KA 2YHCA 4GTQA 3QWPA 2GRRB 4HS2A 2C0LA 3PZ1A 1FT1A 2IJGX 3P1UA 5C2YA 3ZXSA 5E76A 3JQ1A 3B7BA 2QYJA 3FUFA 5AJLA 2RD0A 2DWZA 2IEJA 4O1OA 1EYHA 3OTNA 1TN7A 2FEZA 2BTDA 1MYOA 1BU9A 5KBAA 3ABME 4D10C 2F8YA 3E33A 3PVLA 2WQHA 2L6BA 3CSFA 5EILA 1OCZE 5FZRA 4U0ZA 4K03A 2VGEA 2RKKA 2HM8A 4WNGA 3NZSA 2VJ8A 4ME2A 1IHBA 5HS0A 3O48A 3EJNA 4CGVA 4CDMA 3DWLG 4L9PA 3V79K 3ZYQA 2R17C 3Q7FA 2BKGA 1FVHA 3EU9A 3TJPA 5CBOA 4XI9A 3LY7A 1D9SA 2WXQA 3NAWA 1EDUA 2OEVA 3LJNA 3CVYA 2IFUA 1BI8B 2EIKE 1OCRE 2OVFA 2I9CA 1JWFA 3DSVA 2ETBA 3W9FA 5ITZF 1MX4A 4GYOA 5BT1A 2F8XK 2VSYA 3ZYKA 2XHEA 2KZTB 3AS5A 5KJNA 3DSSA 2IU1A 3QJZA 3IBEA 4CRWA 4LEUA 3ULEG 3LVQE 4ATGA 3ZUVB 1YCSB 2AVPA 4BEPA 4JB8P 1UN9A 3RKVA 4ABNA 2AWIA 3S7JA 1KT1A 1TNBA 4UWKA 2A5EA 3APFA 1KLXA 4GA2A 2GRQB 1HS6A 3FHEA 4NACA 5KJMA 4JZYA 2WXHA 2LNIA 3PREA 2P9NG 4M7CA 4UUCA 2XGSA 3PNLB 4UQXA 1H2VC 3WXXA 4B93B 1OY3D 3W9GA 3ZXPA 2L0IA 3D3MA 4U96D 5KJKA 3D9LA 2H6IA 2B0OE 4RQIA 2A5UA 5FJYA 5BXOA 3UX4A 4AJWA 4CDNA 4BT9A 4A1GA 3U66A 1K1BA 2GROB 1JCQA 4GB9A 2WXJA 1OCOE 4CEMA 5KCMA 1FPPA 1S70B 3NOCD 1TJFA 3MYVA 5D0QD 2VSNA 5EYPF 3ISMC 3HIZA 3CEQA 2J08A 3PDNA 4NQ0A 3UKRG 3KSLA 1IYGA 4CCAA 3D9KA 2VGXA 4JXTA 2V4LA 4O6FA 5C1DA 4Q96A 3PUJA 1D8EA 1OWNA 1ZBPA 2V4HC 5BV1A 1NL4A 4JPSA 3JXIA 2CHXA 4HRNA 5EIBE 4ANUA 3HYMB 2HYZA 4AM9A 3CV0A 2WXRA 4APOA 1NFIE 4N5QA 4KMOA 2PM6A 4FC8A 4ANXA 5HI7A 3Q7AA 3CHPA 2GRMA 1ELKA 4JEUA 3FH7A 4GZCA 1B89A 4JA7A 3UIOC 3FTWA 4IULA 4J8DA 2WMNA 3CHRA 3HVEA 5A6CA 3J5QB 1N95A 4FLBA 4GTOA 4GZ6A 3F6QA 5B1BE 3U3WA 2LXLA 3UUXA 2R03A 3DSUA 2ETAA 3NF1A 1DVPA 2ZXWE 3PEUB 4BX9A 2PM7A 3S7FA 3LCAA 2QFCA 2P9LG 4ZFHA 5AJDA 4KBQA 5BUZA 5M72A 3Q75A 2MYOA 4IYPA 3C3RA 3FFLA 3SY2A 4GA1A 1JPLA 4F1PA 3VLEA 2X38A 2ZGDA 1TJCA 5G04C 2PQRA 3CVVA 2V0PA 1NA0A 3TWWA 2OCCE 4I2ZA 2IO3C 3SQVA 4GPKA 4BWRA 3TG5A 4HNAD 4C0EA 2Q7FA 3D9MA 4I9EA 5JJ7A 5CCMA 4XIFA 3TG4A 4MLPA 4N39A 4LCTA 4UI9C 5H7PA 3FH5A 3LJ3A 3ZGQA 4BY6A 4FJZA 4U07A 5FQ4A 3QB2A 2LSUA 1VDYA 4XZ4A 1HFAA 4I17A 3Q47B 2CHZA 4YVOA 4B8CB 1QBQA 3MZLB 4LRZA 3CVPA 3E32A 4CT0A 4OYSA 3S7BA 3DSWA 3ONLA 3AG1E 2R5SA 3R9AB 4KZ0A 2OOEA 2GRLA 1O1RA 2XCCA 3RRNB 2ZGGA 4L23A 3R7QA 3RIBA 3ZNGA 3N71A 3EHNA 4EZJA 3L82A 4ANWA 1A5EA 3ZHEB 2C0MA 1U3CA 3Q9UC 2H6FA 4G26A 4GMLA 1EPUA 4LNBA 3FTZA 1E96B 3CK9A 1EF1C 3T9KA 1NI1A 5EX0A 3JQ0A 3HRAA 3ZYLA 3CR3A 2WXMA 4F53A 3T8KA 4HOUA 4Q94A 4ILGA 4WUYA 3PUKA 5ENPD 2LSVA 1FCHA 4GTPA 4AEZC 3ABLE 3X2QE 4LG6A 1WAO1 4P29A 4XX5A 2C2LA 5KNHD 3LDZA 4GA0A 2J09A 5FTPA 1INZA 2Y4TA 3FP3A 5LCWC 4XEIG 3CSTA 4EBAG 3I5PA 4MKTA 3C72A 3APDA 5J08A 3L54A 3RK6A 1P5QA 1TNUA 3RRUA 2PZIA 4I1MA 4G25A 4FA6A 1WY6A 4U95D 3AU4A 3LVRE 1MX2A 5FIOA 1IQUA
chains in the Genus database with same CATH topology
3I3NA 1E90A 1S0PA 1SQMA 4GYOA 4WNDA 5BT1A 3APCA 3Q5MA 2VSYA 3ZYKA 4N3CA 2WXNA 2CFZA 3CKBA 2XHEA 1U3DA 4UWFA 3P2BA 3VLFA 2KZTB 4RG9A 3ULQA 3AS5A 4C0MA 5KJNA 1N52A 4YNDA 3JYSA 1Y6IA 3MKRA 2IU1A 3FU0A 4TRQA 3QJZA 2ILRA 5A7DB 3IBEA 4CRWA 1QQEA 4LEUA 3FDHA 4IRUA 3CIAA 3LVQE 1A17A 2IF4A 4ATGA 2FBNA 4APFA 3T5VA 4RVBA 2VYIA 3D9PA 1OUVA 1N54A 3FTVA 1E7VA 2AVPA 4JHKA 3L17A 1HH8A 4FJYA 1UN9A 4M3OA 4N3BA 3RKVA 4I6GA 4ABNA 4J0UA 3G2UA 2X3MA 2AWIA 1E8WA 1UG3A 4J8EA 3UMVA 4AVXA 3S7JA 5DIZA 2VGYA 1HO8A 3CVQA 3HDXA 3FTUA 1KT1A 4UWKA 4KVOA 1SZ9A 4L2YA 2J07A 3LXUX 3G2WA 4HOSA 2XGOA 3APFA 1KLXA 4UI9K 3DPDA 3MV2B 3QK0A 2UY1B 4GA2A 4GYYA 3MKQA 1HS6A 3GZSA 2MRIA 4NURA 1HE8A 3FHEA 1E8YA 4NACA 4WNFA 5KJMA 3L16A 3D9OA 5FQ6A 2L6JA 3QARA 4JZYA 4G2VA 2WXHA 2LNIA 3EIJA 4FULA 5FQ7A 1H19A 3PREA 5J90A 3CQGB 3G2SA 2J4DA 3PEVB 4RG6A 1LF8A 2XGSA 2ONDA 3L08A 3ML8A 3PNLB 4XKCA 4Q69A 4UQXA 1H2VC 4JHRA 5BW8C 3WXXA 4JL0A 1BPOA 3KAEA 4B0ZA 3LY8A 4K0RA 2J49A 2XRYA 4HLEA 2P58C 3LKUA 4PUCA 2L0IA 3D3MA 2NC9A 2IQCA 2AXZA 4C9BB 5AYWD 5CCLA 5KJKA 3ASFA 2IOSA 2WXKA 3FUKA 3RO2A 3D9LA 3CVXA 4OVUA 3FTXA 4EECA 2A5UA 3GZ2A 5G04J 5LOZA 5FJYA 3QDNA 2X6IA 3KEZA 4F7AA 3HHMA 3UX4A 3ONKA 3QWVA 4AJWA 4XI0A 4BT9A 4CDNA 4A1GA 3U66A 2WXIA 1L5JA 4GB9A 2WXJA 3TL5A 4EZKA 4I1AA 1Z6TA 4CEMA 1JWGA 5KCMA 4FHKA 4ILHB 2KZTA 3OAWA 2DCPA 3IV0A 4J8SA 4YVQC 2XEVA 3FUMA 3CK7A 2WB2A 1TJFA 3ZW3A 2CG3A 2V5FA 4BT8A 3HVEB 2FF4A 2I1KA 3MYVA 1ELRA 5D0QD 3FULA 5CMYA 2WXFA 3K9IA 3OXLA 2VSNA 4I1OB 4XE0A 5ENNA 2L9BA 4N2QA 3HIZA 4E85A 1OWOA 2GW1A 2XGMA 3CEQA 3Q49B 4UI9J 2CHWA 2J08A 2XPIA 3PDNA 3UT7A 4NQ0A 3FEYA 2WVIA 4ILIA 1QNFA 3LEWA 4LUNU 4U0UA 1IYGA 1NA3A 3IKOB 3D9KA 4CCAA 2VGXA 4JXTA 2V4LA 5EKQD 2VSOE 4O6FA 3ZFWA 2NSZA 4PDXA 5C1DA 4Q96A 3IHVA 3FU3A 3TGOA 4KZCA 3BG1B 3FH8A 4U8HA 1UJKA 4B94A 2PL2A 3PUJA 4GCNA 4G23A 4JEHA 2UY1A 2J9QA 2AXVA 4WWOA 2NXPA 3CVUA 1OWNA 1ZBPA 4DI3A 1ELWA 4AXHA 4MS6A 1UW4B 2CG2A 5BV1A 3ASDA 4JPSA 3EDTB 2CHXA 3FUEA 3MEKA 2WXOA 4ANUA 1TEZA 2VTBB 4J8FA 4Y6WA 3HYMB 4A3VA 3U9WA 1XNFA 4DLOA 2DBAA 2EQXA 2HYZA 2I2OA 2X6HA 4N5CA 1H2UA 3BEEA 4AM9A 3GZ1A 3CVWA 3CV0A 2WXRA 4APOA 3ZIMA 5HQ8A 1HXIA 3MGBA 2FO7A 3PS6A 4CGWA 4HOQA 4AIFA 2KC7A 3GW4A 4CT4A 4RSYA 4W9RA 3FUJA 4J6IA 3CVLA 3U64A 4KMOA 2PM6A 4FC8A 3RJVA 2DIWA 4ANXA 5HI7A 4LERA 1QZ2A 3SD5A 3VLDA 3CHPA 4DLQA 1PY1A 3ENEA 5BV0A 3ASGA 5EDSA 2GRMA 2KATA 3ZEFA 4URKA 5D0OD 1ELKA 2VGXB 3IEGA 3ESLA 4JEUA 3SBTB 3QOUA 3SNXA 3UQ3A 3FH7A 4GZCA 1B89A 2YHEA 2X6FA 3T5XA 4JA7A 4TUUA 4AOFA 5ARGA 5LX8A 4L7TA 3CHMA 3FTWA 3FUHA 4DI4A 4IULA 4J8DA 2WMNA 2V8SE 2WXLA 4I6JA 3CHRA 4UWHA 1HF8A 2OV8A 1IQRA 5JHBA 3HVEA 3D9JA 1HU3A 4A3TA 4A55A 3B7RL 5A6CA 1MQSA 4U0SA 5FT9A 4FLBA 3MV3B 2I1JA 4GZ6A 3QKYA 1JUQA 4U63A 4DJAA 2LO6A 4MRUA 3U3WA 1E7UA 4PH4B 3TXMA 4JW1A 3UUXA 3O4ZA 4IN3B 4BTBA 3MX3A 4ACKA 3AS8A 2RG8A 4BSXA 3NF1A 1DVPA 2KCLA 3D9NA 1FVFA 4GMJA 3OXGA 5CHEE 4EQFA 2YINA 3PEUB 4BX9A 2PM7A 1HX8A 3LCAA 3S7FA 5JHAA 2YNQA 2QFCA 2X6JA 5FZSA 4WAFA 4UQYA 5FWQA 5AJDA 4E6HA 3AS4A 4GZ5A 4KBQA 4A1SA 1OWLA 4QFVA 5BUZA 3RRMB 5M72A 4IYPA 2E2EA 3FFLA 5ARFA 2VTBA 4GAAA 3B7TA 3U4TA 4GA1A 1JPLA 4FU3A 4FHJA 3UT4A 4JA9A 3OXFA 1H0AA 2WM9A 2LAIA 3L6AA 2KCKA 2XPYA 5E75A 3R7RA 3SI5A 4WWNA 3S7DA 5LCWJ 3EIQC 3SBSA 4N3AA 3ZVVA 3VLEA 4L1BA 4UWGA 5T3RA 4DK5A 3FY4A 2X38A 3B7UX 2BUGA 2XQ0A 1TJCA 5G04C 2PQRA 1UJJA 2LAHA 3AU5A 2PQNA 3CVVA 4I2WA 2FULA 2V0PA 3C98A 1UN8A 3Q4AB 4KT6B 1NA0A 3I4GA 3RU0A 3CHSA 3LS8A 3SHFA 1OWPA 4I2ZA 3PZDA 2J4BA 2KCVA 3L22A 3BG0B 5AIJA 4GPKA 3D9IA 4HXIA 4WNEA 3SGHA 4FP7A 4BWRA 3TG5A 4AV7A 3FUNA 5G55A 2WXGA 4C0EA 2Q7FA 3D9MA 4I9EA 1HG2A 1ZU2A 5JJ7A 4HVBA 3Q15A 3PRZA 2VSXE 4B8AA 5CCMA 3JUIA 1E8XA 4XIFA 3TG4A 3MA5A 2UWJG 3KS2A 3PE3A 4LCTA 4MLPA 1X5BA 4N39A 2BF0X 4TV3A 4UI9C 4Y6CA 5JJTA 3FH5A 3LJ3A 3ZGQA 3ASHA 4BY6A 4FJZA 3T8MA 2MOWA 3ZHEA 1W3BA 1WM5A 3FU5A 4U07A 4UWLA 1IHGA 3G2TA 3NZUA 4OVVA 5FQ4A 4F1SA 4AY6A 1HG5A 3QB2A 1NP7A 3CQCB 3UT8A 5FZQA 3SFZA 2M63A 5G05C 2GGFA 2LSUA 4KYOB 3FWVA 5JJ6A 1NZNA 1VDYA 2FI7A 5AENA 4XZ4A 1HFAA 4I17A 1SZAA 3CK8A 4FLHA 4G11A 5LFAA 2JLBA 3Q47B 4F3VA 4N2SA 5LP0A 2CHZA 3CLJA 4YVOA 2L0TB 3URZA 4B8CB 4R7LA 1Z3YA 2Y4UA 4AY5A 1Z3XA 3ZN3A 3MZLB 4LRZA 3CVPA 2WMOA 4GCOA 3LY9A 4CT0A 2ZU6B 3CVNA 4U04A 3ZRHA 4OYSA 3S7BA 4FADA 1YA0A 3FEXA 3ONLA 2R5SA 3R9AB 4KZ0A 4BX8A 2OOEA 2XPZA 4XKBA 3G2VA 3QAQA 2GRLA 4G1TA 2A4ZA 2HR2A 4AP2A 1PC2A 2X6KA 2YHCA 4B89A 4EZLA 2XCCA 4I6EA 3MCXA 3QWPA 4HS2A 3RRNB 2AW6A 4L23A 3R7QA 2VQ2A 2C0LA 3RIBA 1XGWA 3N71A 3NQPA 3EHMA 3SF4A 4HOTA 2WXPA 1H2TC 3EHNA 1HZ4A 4EBAA 2IJGX 3P1UA 4EZJA 4ANWA 3ZHEB 4NRHB 4JHJA 2C0MA 5C2YA 1U3CA 3TXNA 5DBKA 4GYWA 3ZXSA 2WQ7A 2KM4A 5E76A 3JQ1A 4PS8A 3ZPJA 1GW6A 4G26A 4PS3A 4G24A 3FUFA 5AJLA 4BTAA 3ZYMA 4JVSA 4GMLA 2RD0A 3UPVA 1EPUA 2MHKA 1EYHA 4V3IA 3FTZA 3E4BA 4GZ3A 1E96B 3OTNA 4GZDA 3CK9A 2XRZA 1EF1C 3IHYA 4ACLA 2FEZA 2XCBA 2BTDA 3I4RB 3FUDA 2HO1A 5EX0A 4I9CA 3JQ0A 3ZYLA 3CR3A 4L2LA 2WXMA 3GYZA 4D10C 1E8ZA 3PVLA 4F53A 2JEKA 2WQHA 2WQ6A 4JC8A 3QC1A 4HOUA 4Q94A 3CSFA 3FUIA 5FZRA 4U0ZA 4UQZA 5ANLA 4K03A 4ILGA 3CGHA 2I6HA 3CKCA 4WUYA 3RO3A 2IOLA 3PUKA 2OVBA 4EPZA 2HM8A 1OWMA 4WNGA 1H6KA 3NZSA 5T4YA 2LSVA 2AXUA 2VJ8A 4PS7A 4ME2A 2CFUA 3JCKC 1PAQA 1FCHA 1DNPA 4AEZC 4H7YA 5KJLA 1WAO1 3VTXA 3CHQA 5CMWA 2R59A 4P29A 4XX5A 4BFRA 3O48A 3PH0C 3EJNA 2C2LA 4CGVA 4CDMA 3LDZA 4KXKB 4GA0A 2J09A 3MKQB 3ML9A 5FTPA 3QNKA 3LYAA 4CDRA 1INZA 3FU6A 2Y4TA 3S2AA 3ZYQA 3FP3A 1KT0A 2E0IA 2R17C 5A23A 5LCWC 4H7XA 2WPVA 3CSTA 4EBAG 3I5PA 3CHOA 1FVHA 2YQ8A 4MKTA 4HORA 3FTSA 3L13A 5BPPA 2IONA 3LPZA 2QY7A 3APDA 3L54A 5J08A 3FTYA 5T8IA 3TJPA 3RK6A 4XI9A 3KD7A 1P5QA 3LY7A 3RRUA 1Y8MA 2WXQA 3TAXA 4I43A 3B13A 3VTYA 2PZIA 4ANVA 1EDUA 1MHQA 4I1MA 3PE4A 3CVYA 4G25A 2IFUA 4WWPA 3QWWA 4FA6A 5G05J 5BNWA 4DPRA 2OVFA 5EX3A 5FQ8A 3SZ7A 4GU5A 3MJWA 2I9CA 5ANRA 3ESKA 5G2NA 1JWFA 4KVMA 1WY6A 3PNTB 3B7SA 3AU4A 4HFGA 3DBSA 3LVRE 2Y3AA 1IQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX8 A;  5J08 A;  4FLB A;  1X5B A;  2DIW A;  2BF0 X;  3G2S A;  3ONK A;  5LOZ A;  1LF8 A;  1JUQ A;  3ZYK A;  3G2U A;  1PY1 A;  3RRU A;  2MOW A;  5CMW A;  2LO6 A;  3ZYL A;  3G2T A;  4AVX A;  3ONL A;  1EDU A;  1ELK A;  1HG5 A;  1MHQ A;  3D9K A;  2KM4 A;  1JWG A;  3D9I A;  3G2V A;  4GZC A;  4JXT A;  2DCP A;  3LDZ A;  1SZ9 A;  1JPL A;  2L0I A;  4Q94 A;  4FU3 A;  4Q96 A;  3G2W A;  3ZYM A;  1INZ A;  1H0A A;  1DVP A;  3ZYQ A;  1EYH A;  1UJK A;  3D9N A;  1JWF A;  1VDY A;  2V8S E;  3D9M A;  1HF8 A;  1HG2 A;  3D9L A;  1HFA A;  4GZD A;  1SZA A;  4NAC A;  5CMY A;  4HFG A;  1XGW A;  3D9J A;  3D9O A;  5LP0 A;  3CLJ A;  3D9P A;  2L0T B;  1UJJ A;  2QY7 A; 
#chains in the Genus database with same CATH topology
 1SQM A;  4WND A;  3UIN C;  3HXF A;  3APC A;  3Q5M A;  2WXN A;  1U3D A;  3AJI A;  3VLF A;  4RLY A;  1N52 A;  4YND A;  1Y6I A;  2LXM A;  5A7D B;  3B95 A;  2FBN A;  1G3N B;  4APF A;  4RVB A;  1OUV A;  1E7V A;  2XEE A;  1HH8 A;  2Y69 E;  4FJY A;  4N3B A;  4M3O A;  3G2U A;  2LUH A;  4GTT A;  1E8W A;  2QC9 A;  2VGY A;  3HDX A;  3FTU A;  3DPY A;  4KVO A;  3LXU X;  3G2W A;  4HOS A;  2XGO A;  1O1T A;  3DEO A;  3DPD A;  3QK0 A;  3MKQ A;  4WNF A;  3L16 A;  5FQ6 A;  2L6J A;  3QAR A;  5FQ7 A;  1H19 A;  3CQG B;  3G2S A;  2Y1L E;  3ML8 A;  4JHR A;  1BPO A;  4K0R A;  2J49 A;  2XRY A;  3C3O A;  2P58 C;  4A63 B;  2IQC A;  4HI9 A;  1N11 A;  5AYW D;  5CCL A;  3ASO E;  2IOS A;  3FUK A;  3RO2 A;  3PZ4 A;  3CVX A;  4OVU A;  3GZ2 A;  5LOZ A;  1D8D A;  3KEZ A;  4YVQ C;  2P9S G;  3FUM A;  3EU5 A;  3CK7 A;  3ZW3 A;  2V5F A;  3HVE B;  1ELR A;  3OXL A;  3Q78 A;  5ENQ D;  3UM0 A;  3V30 A;  1DCE A;  2CHW A;  2XPI A;  5AQB A;  5AQ7 A;  4ILI A;  1N9A A;  4LUN U;  4U0U A;  1NA3 A;  3IKO B;  5EKQ D;  3ZFW A;  2NSZ A;  3IHV A;  3EHR A;  3FH8 A;  1UJK A;  4B94 A;  2PL2 A;  2AXV A;  4U8V D;  4DI3 A;  3EDT B;  3UM3 A;  3MEK A;  2WXO A;  4Y6W A;  4A3V A;  2DBA A;  2EQX A;  2X6H A;  3EHQ A;  1DC2 A;  3KEA A;  2EIN E;  3ZIM A;  2KBX A;  5HQ8 A;  1WDY A;  2FO1 E;  1HXI A;  3JXJ A;  1K3Z D;  3GW4 A;  4RSY A;  2B6C A;  4W9R A;  4F6R D;  3FUJ A;  3CVL A;  3RJV A;  2DIW A;  3SD5 A;  3VLD A;  5EDS A;  2KAT A;  1FT2 A;  4TXP A;  5CBN A;  3IEG A;  3SNX A;  3SBT B;  4K5A B;  5IY5 E;  3CHM A;  4DI4 A;  2DVW A;  5EYL A;  3UM1 A;  1HU3 A;  4A3T A;  3B7R L;  4U0S A;  3MV3 B;  3QKY A;  3ULY A;  4MRU A;  4PH4 B;  3O4Z A;  3MX3 A;  3TWX A;  2H6H A;  1KZP A;  3OXG A;  2YIN A;  5JHA A;  5FZS A;  5FWQ A;  4E6H A;  4QFV A;  3RRM B;  2E2E A;  5ARF A;  3TWU A;  4FHJ A;  1H0A A;  2WM9 A;  1V54 E;  3L6A A;  4HQD A;  4WWN A;  3EIQ C;  2P9U G;  4N3A A;  4L1B A;  4UWG A;  4O1P A;  1V55 E;  1OXJ A;  2JAB A;  1UN8 A;  3SHF A;  1TNO A;  1N4P A;  1KPS B;  3WG7 E;  5AIJ A;  3DST A;  4HXI A;  3DRA A;  4WNE A;  3SGH A;  4AV7 A;  3FUN A;  5B1A E;  4GTS A;  3Q15 A;  5KWD A;  1TR4 A;  3JUI A;  1E8X A;  3MA5 A;  2UWJ G;  5JJT A;  2BF0 X;  4Y6C A;  3T8M A;  2MOW A;  4UWL A;  4OVV A;  1HG5 A;  1NP7 A;  4LSZ E;  5CEA A;  5EN5 D;  5FZQ A;  4G8L A;  2GGF A;  5AEN A;  4KYO B;  1NZN A;  3UIP C;  1SZA A;  4G11 A;  5LP0 A;  3CLJ A;  3ZKJ A;  3TWV A;  4R7L A;  1Z3Y A;  2Y4U A;  2ZU6 B;  5ENR D;  4FAD A;  1YA0 A;  4XKB A;  3QAQ A;  3E34 A;  2HR2 A;  4YDW A;  1BLX B;  3MCX A;  2VQ2 A;  3NQP A;  3EHM A;  3SF4 A;  4HOT A;  1H2T C;  2WXP A;  1HZ4 A;  4EBA A;  4JHJ A;  3TXN A;  5DBK A;  4GYW A;  2F37 A;  1O5M A;  4PS8 A;  3ZPJ A;  4G24 A;  4BTA A;  3ZYM A;  3UPV A;  2MHK A;  4V3I A;  4GMR A;  3E4B A;  4GZ3 A;  1H6P A;  5ENS D;  2XRZ A;  3I4R B;  3V2X A;  3V2O A;  2HO1 A;  4I9C A;  1TN8 A;  1E8Z A;  2JEK A;  2WQ6 A;  4JC8 A;  3BU8 A;  4UQZ A;  2I6H A;  3PZ2 A;  2OVB A;  2R02 A;  4YDY A;  5D66 A;  4PS7 A;  3JCK C;  4LNU D;  4OAU C;  4H7Y A;  5AAO A;  3E37 A;  2R59 A;  5CMW A;  5B3S E;  1JCR A;  4KXK B;  4CDR A;  2XZT G;  3MKQ B;  3ML9 A;  3FU6 A;  2DZN A;  1KT0 A;  2WPV A;  2YQ8 A;  3FTS A;  5BPP A;  5T8I A;  3KD7 A;  1Y8M A;  3B13 A;  3PE4 A;  3C5R A;  3QWW A;  5FIN A;  5CEC B;  3SZ7 A;  3MJW A;  4GPM A;  3JUE A;  5ANR A;  4KVM A;  3PNT B;  3D9H A;  3DBS A;  1S0P A;  4N3C A;  3CKB A;  4UWF A;  3P2B A;  3ULQ A;  2ILR A;  1QQE A;  1RW2 A;  3FDH A;  4IRU A;  2IF4 A;  2XEN A;  2VYI A;  3D9P A;  4JHK A;  4I6G A;  4J0U A;  3UKU G;  4J8E A;  5DIZ A;  1HO8 A;  4J7W A;  1SZ9 A;  4EHM A;  4L2Y A;  5CRU A;  3TWS A;  1YYH A;  4DX1 A;  4UI9 K;  3GZS A;  3NB2 A;  1HE8 A;  1E8Y A;  3TWT A;  3D9O A;  3EIJ A;  4FUL A;  5J90 A;  4RG6 A;  2J4D A;  4MBG A;  2QYU A;  3TWQ A;  1LF8 A;  2OND A;  3L08 A;  4XKC A;  4Q69 A;  4JL0 A;  4JD2 G;  4HLE A;  4G8K A;  3LKU A;  4PUC A;  3ASF A;  2WXK A;  1UOH A;  4CZ2 D;  4OAV B;  3FTX A;  5G04 J;  1K8K G;  2X6I A;  3HHM A;  3QWV A;  4XI0 A;  3PZ3 A;  2WXI A;  1OCC E;  4EZK A;  4I1A A;  3SFX A;  1JWG A;  2DCP A;  4J8S A;  3TWR A;  2WB2 A;  4J8Y A;  2CG3 A;  4BT8 A;  1MJ0 A;  2FF4 A;  2I1K A;  3FUL A;  4I1O B;  1OT8 A;  2L9B A;  1SW6 A;  3AG4 E;  1OWO A;  4UI9 J;  3Q49 B;  4TXR A;  4HI8 A;  5CER B;  3FEY A;  1QNF A;  3Q79 A;  4HLL A;  2VSO E;  4PDX A;  5AN8 A;  3FU3 A;  4U8H A;  2UY1 A;  4WWO A;  2BED A;  2NXP A;  4GTR A;  4MS6 A;  1UW4 B;  2CG2 A;  3ASD A;  4X8Q A;  5EID A;  3UTM A;  4DX5 D;  2ZIS A;  2I2O A;  2AJA A;  4N5C A;  1H2U A;  3BEE A;  3GZ1 A;  3CVW A;  2EIM E;  3PS6 A;  4CGW A;  4AIF A;  4CT4 A;  4J6I A;  5AQA A;  1QZ2 A;  4DLQ A;  1PY1 A;  5BV0 A;  3ASG A;  2VGX B;  3ESL A;  2HE0 A;  3DXM G;  3QOU A;  2YHE A;  3T5X A;  4TUU A;  5ARG A;  5LX8 A;  3FUH A;  3V31 A;  5AAR A;  1HF8 A;  2OV8 A;  1IQR A;  3D9J A;  1YMP A;  5HKP A;  1MQS A;  5FT9 A;  2I1J A;  3KSQ A;  1BD8 A;  3NBN B;  3Q73 A;  4U63 A;  4DJA A;  1N0Q A;  3TXM A;  5ENT D;  3AS8 A;  2KCL A;  3D9N A;  1FVF A;  2YNQ A;  2X6J A;  4UQY A;  2IO2 C;  4GZ5 A;  4A1S A;  1OWL A;  4GTM A;  4BET A;  2VTB A;  4GAA A;  3U4T A;  4FU3 A;  4JA9 A;  2XPY A;  3SI5 A;  5LCW J;  3ZVV A;  3FY4 A;  3B7U X;  2DYR E;  4C48 B;  2NYJ A;  3AU5 A;  4TXQ A;  3C98 A;  4KT6 B;  1N0R A;  3I4G A;  4BES A;  3LS8 A;  2KCV A;  3D9I A;  1IKN D;  4FP7 A;  1LD7 A;  1JCS A;  4O60 A;  5ENO D;  1HG2 A;  3PRZ A;  2VSX E;  4B8A A;  3PE3 A;  3ASH A;  1N4S A;  1RZ4 A;  3ZHE A;  3NZU A;  2XEH A;  1TYQ G;  3UT8 A;  4U8Y D;  2M63 A;  5G05 C;  1Z5S C;  5JJ6 A;  4GTV A;  2FI7 A;  4FLH A;  1KZO A;  2L0T B;  2XS1 A;  1SA5 A;  2EIJ E;  4GCO A;  3CVN A;  3ZRH A;  2Y0B G;  3FEX A;  4CYM D;  4BX8 A;  2XPZ A;  2A4Z A;  3AG2 E;  4B89 A;  4EZL A;  4I6E A;  2AW6 A;  1XGW A;  4NRH B;  2WQ7 A;  2KM4 A;  1GW6 A;  4PS3 A;  4JVS A;  4YDE A;  4GZD A;  4HB5 A;  4HBD A;  3IHY A;  4ACL A;  2XCB A;  3FUD A;  1N4Q A;  1X81 A;  4L2L A;  3GYZ A;  1DCQ A;  3QC1 A;  3SO8 A;  3FUI A;  5ANL A;  3CGH A;  3CKC A;  3RO3 A;  4BER A;  2IOL A;  4EPZ A;  1OWM A;  5T4Y A;  1H6K A;  2AXU A;  2CFU A;  1PAQ A;  1DNP A;  5KJL A;  3VTX A;  3CHQ A;  4BFR A;  3PH0 C;  4K5B A;  2OEW A;  3QNK A;  3LYA A;  3R9M A;  3S2A A;  2E0I A;  5A23 A;  4H7X A;  3CHO A;  4HOR A;  3DXK G;  3L13 A;  2ION A;  3LPZ A;  2QY7 A;  3FTY A;  1SA4 A;  3TAX A;  4I43 A;  3VTY A;  4ANV A;  1MZC A;  1MHQ A;  4WWP A;  5G05 J;  5BNW A;  4DPR A;  5EX3 A;  5FQ8 A;  4GU5 A;  5G2N A;  3ESK A;  3B7S A;  4HFG A;  2Y3A A;  2RFM A;  1E90 A;  3I3N A;  2CFZ A;  3SFY A;  3RSE G;  1TN6 A;  4NIK A;  4RG9 A;  4C0M A;  3JYS A;  3MKR A;  3FU0 A;  4TRQ A;  5JA4 D;  2DZO A;  3CIA A;  1A17 A;  3T5V A;  1S64 A;  1N54 A;  2R2L A;  3FTV A;  3L17 A;  2ZIR A;  3HG0 D;  2X3M A;  1UG3 A;  3UMV A;  4AVX A;  3CVQ A;  2J07 A;  3UI2 A;  2XS8 A;  3MV2 B;  4GYY A;  2UY1 B;  4YDO A;  3UM2 A;  2MRI A;  4NUR A;  2EIL E;  5HRY A;  4G2V A;  3PEV B;  5BW8 C;  2P9P G;  1BI7 B;  1Q2Z A;  3KAE A;  4B0Z A;  2R05 A;  3LY8 A;  2GRN B;  2NC9 A;  2AXZ A;  4C9B B;  2RFA A;  4BSZ B;  4EEC A;  3QDN A;  4DUI A;  4F7A A;  3ONK A;  4TUM A;  1L5J A;  3TL5 A;  1Z6T A;  4FHK A;  4ILH B;  2KZT A;  3OAW A;  3IV0 A;  1AP7 A;  2XEV A;  5KNG A;  4DX7 D;  3ZU7 B;  5CMY A;  2WXF A;  3IXE A;  3K9I A;  4XE0 A;  5ENN A;  1LTX A;  4N2Q A;  4E85 A;  2GW1 A;  3UT7 A;  2XGM A;  1O1S A;  1SVX A;  3L9T A;  3UXG A;  2WVI A;  2KXP C;  3LEW A;  2P9I G;  2BKK B;  3TGO A;  4KZC A;  3BG1 B;  2IY0 C;  4GCN A;  4G23 A;  4JEH A;  2J9Q A;  3CVU A;  4Z68 A;  1ELW A;  4AXH A;  3FUE A;  3C3Q A;  5JMN D;  5AQ9 A;  1TEZ A;  3HXE A;  2VTB B;  4J8F A;  3DSX A;  1K1A A;  3U9W A;  1XNF A;  4DLO A;  2F0Y A;  4ATZ D;  2GRP B;  3MGB A;  2FO7 A;  4QQI A;  1AWC B;  4HOQ A;  5D2M C;  2KC7 A;  2PNN A;  3HXC A;  3U64 A;  2P9K G;  4LER A;  2V5Q C;  1IXV A;  3ENE A;  2P2C P;  3ZEF A;  4URK A;  5D0O D;  3UQ3 A;  2X6F A;  4K5C A;  4AOF A;  1N94 A;  4L7T A;  1N4R A;  2WXL A;  2V8S E;  4I6J A;  2ETC A;  4UWH A;  5JHB A;  4A55 A;  1TNZ A;  4HRM B;  3EUV A;  1H6O A;  1JUQ A;  1WG0 A;  2LO6 A;  2J8S D;  1E7U A;  3Q9N C;  1S63 A;  4JW1 A;  4ZHB A;  3AAA C;  4IN3 B;  4BTB A;  4ACK A;  2RG8 A;  4BSX A;  3HXD A;  4DRX E;  5CED B;  4GMJ A;  5CHE E;  4EQF A;  1HX8 A;  4WAF A;  1TNY A;  4HRL A;  3AS4 A;  3B7T A;  3UT4 A;  3OXF A;  2LAI A;  2KCK A;  5E75 A;  3R7R A;  3S7D A;  3SBS A;  5T3R A;  4DK5 A;  2BUG A;  2XQ0 A;  1UJJ A;  2LAH A;  5CRV A;  2PQN A;  4I2W A;  2FUL A;  3Q4A B;  3BUA A;  3RU0 A;  3CHS A;  2H6G A;  1OWP A;  3PZD A;  2J4B A;  3J5P A;  3L22 A;  3BG0 B;  5BXU A;  2DYS E;  3BQO A;  5G55 A;  2WXG A;  1ZU2 A;  3AG3 E;  4HVB A;  1QYM A;  4LNG A;  3DEP A;  3KS2 A;  4TV3 A;  1X5B A;  3ABK E;  1W3B A;  1WM5 A;  3FU5 A;  1IHG A;  3ASN E;  3G2T A;  4DX6 D;  4F1S A;  4AY6 A;  2XZD G;  3CQC B;  3SFZ A;  3E30 A;  1U2V G;  4DX2 A;  3RAU A;  3FWV A;  3HXB A;  3CK8 A;  5LFA A;  2JLB A;  4F3V A;  4N2S A;  1MX6 A;  3URZ A;  4AY5 A;  1Z3X A;  3ZN3 A;  2WMO A;  3LY9 A;  3NOG D;  4U04 A;  1ZB1 A;  1LD8 A;  4U7E B;  3G2V A;  4G1T A;  2QZA A;  4AP2 A;  1PC2 A;  2X6K A;  2YHC A;  4GTQ A;  3QWP A;  2GRR B;  4HS2 A;  2C0L A;  3PZ1 A;  1FT1 A;  2IJG X;  3P1U A;  5C2Y A;  3ZXS A;  5E76 A;  3JQ1 A;  3B7B A;  2QYJ A;  3FUF A;  5AJL A;  2RD0 A;  2DWZ A;  2IEJ A;  4O1O A;  1EYH A;  3OTN A;  1TN7 A;  2FEZ A;  2BTD A;  1MYO A;  1BU9 A;  5KBA A;  3ABM E;  4D10 C;  2F8Y A;  3E33 A;  3PVL A;  2WQH A;  2L6B A;  3CSF A;  5EIL A;  1OCZ E;  5FZR A;  4U0Z A;  4K03 A;  2VGE A;  2RKK A;  2HM8 A;  4WNG A;  3NZS A;  2VJ8 A;  4ME2 A;  1IHB A;  5HS0 A;  3O48 A;  3EJN A;  4CGV A;  4CDM A;  3DWL G;  4L9P A;  3V79 K;  3ZYQ A;  2R17 C;  3Q7F A;  2BKG A;  1FVH A;  3EU9 A;  3TJP A;  5CBO A;  4XI9 A;  3LY7 A;  1D9S A;  2WXQ A;  3NAW A;  1EDU A;  2OEV A;  3LJN A;  3CVY A;  2IFU A;  1BI8 B;  2EIK E;  1OCR E;  2OVF A;  2I9C A;  1JWF A;  3DSV A;  2ETB A;  3W9F A;  5ITZ F;  1MX4 A;  4GYO A;  5BT1 A;  2F8X K;  2VSY A;  3ZYK A;  2XHE A;  2KZT B;  3AS5 A;  5KJN A;  3DSS A;  2IU1 A;  3QJZ A;  3IBE A;  4CRW A;  4LEU A;  3ULE G;  3LVQ E;  4ATG A;  3ZUV B;  1YCS B;  2AVP A;  4BEP A;  4JB8 P;  1UN9 A;  3RKV A;  4ABN A;  2AWI A;  3S7J A;  1KT1 A;  1TNB A;  4UWK A;  2A5E A;  3APF A;  1KLX A;  4GA2 A;  2GRQ B;  1HS6 A;  3FHE A;  4NAC A;  5KJM A;  4JZY A;  2WXH A;  2LNI A;  3PRE A;  2P9N G;  4M7C A;  4UUC A;  2XGS A;  3PNL B;  4UQX A;  1H2V C;  3WXX A;  4B93 B;  1OY3 D;  3W9G A;  3ZXP A;  2L0I A;  3D3M A;  4U96 D;  5KJK A;  3D9L A;  2H6I A;  2B0O E;  4RQI A;  2A5U A;  5FJY A;  5BXO A;  3UX4 A;  4AJW A;  4CDN A;  4BT9 A;  4A1G A;  3U66 A;  1K1B A;  2GRO B;  1JCQ A;  4GB9 A;  2WXJ A;  1OCO E;  4CEM A;  5KCM A;  1FPP A;  1S70 B;  3NOC D;  1TJF A;  3MYV A;  5D0Q D;  2VSN A;  5EYP F;  3ISM C;  3HIZ A;  3CEQ A;  2J08 A;  3PDN A;  4NQ0 A;  3UKR G;  3KSL A;  1IYG A;  4CCA A;  3D9K A;  2VGX A;  4JXT A;  2V4L A;  4O6F A;  5C1D A;  4Q96 A;  3PUJ A;  1D8E A;  1OWN A;  1ZBP A;  2V4H C;  5BV1 A;  1NL4 A;  4JPS A;  3JXI A;  2CHX A;  4HRN A;  5EIB E;  4ANU A;  3HYM B;  2HYZ A;  4AM9 A;  3CV0 A;  2WXR A;  4APO A;  1NFI E;  4N5Q A;  4KMO A;  2PM6 A;  4FC8 A;  4ANX A;  5HI7 A;  3Q7A A;  3CHP A;  2GRM A;  1ELK A;  4JEU A;  3FH7 A;  4GZC A;  1B89 A;  4JA7 A;  3UIO C;  3FTW A;  4IUL A;  4J8D A;  2WMN A;  3CHR A;  3HVE A;  5A6C A;  3J5Q B;  1N95 A;  4FLB A;  4GTO A;  4GZ6 A;  3F6Q A;  5B1B E;  3U3W A;  2LXL A;  3UUX A;  2R03 A;  3DSU A;  2ETA A;  3NF1 A;  1DVP A;  2ZXW E;  3PEU B;  4BX9 A;  2PM7 A;  3S7F A;  3LCA A;  2QFC A;  2P9L G;  4ZFH A;  5AJD A;  4KBQ A;  5BUZ A;  5M72 A;  3Q75 A;  2MYO A;  4IYP A;  3C3R A;  3FFL A;  3SY2 A;  4GA1 A;  1JPL A;  4F1P A;  3VLE A;  2X38 A;  2ZGD A;  1TJC A;  5G04 C;  2PQR A;  3CVV A;  2V0P A;  1NA0 A;  3TWW A;  2OCC E;  4I2Z A;  2IO3 C;  3SQV A;  4GPK A;  4BWR A;  3TG5 A;  4HNA D;  4C0E A;  2Q7F A;  3D9M A;  4I9E A;  5JJ7 A;  5CCM A;  4XIF A;  3TG4 A;  4MLP A;  4N39 A;  4LCT A;  4UI9 C;  5H7P A;  3FH5 A;  3LJ3 A;  3ZGQ A;  4BY6 A;  4FJZ A;  4U07 A;  5FQ4 A;  3QB2 A;  2LSU A;  1VDY A;  4XZ4 A;  1HFA A;  4I17 A;  3Q47 B;  2CHZ A;  4YVO A;  4B8C B;  1QBQ A;  3MZL B;  4LRZ A;  3CVP A;  3E32 A;  4CT0 A;  4OYS A;  3S7B A;  3DSW A;  3ONL A;  3AG1 E;  2R5S A;  3R9A B;  4KZ0 A;  2OOE A;  2GRL A;  1O1R A;  2XCC A;  3RRN B;  2ZGG A;  4L23 A;  3R7Q A;  3RIB A;  3ZNG A;  3N71 A;  3EHN A;  4EZJ A;  3L82 A;  4ANW A;  1A5E A;  3ZHE B;  2C0M A;  1U3C A;  3Q9U C;  2H6F A;  4G26 A;  4GML A;  1EPU A;  4LNB A;  3FTZ A;  1E96 B;  3CK9 A;  1EF1 C;  3T9K A;  1NI1 A;  5EX0 A;  3JQ0 A;  3HRA A;  3ZYL A;  3CR3 A;  2WXM A;  4F53 A;  3T8K A;  4HOU A;  4Q94 A;  4ILG A;  4WUY A;  3PUK A;  5ENP D;  2LSV A;  1FCH A;  4GTP A;  4AEZ C;  3ABL E;  3X2Q E;  4LG6 A;  1WAO 1;  4P29 A;  4XX5 A;  2C2L A;  5KNH D;  3LDZ A;  4GA0 A;  2J09 A;  5FTP A;  1INZ A;  2Y4T A;  3FP3 A;  5LCW C;  4XEI G;  3CST A;  4EBA G;  3I5P A;  4MKT A;  3C72 A;  3APD A;  5J08 A;  3L54 A;  3RK6 A;  1P5Q A;  1TNU A;  3RRU A;  2PZI A;  4I1M A;  4G25 A;  4FA6 A;  1WY6 A;  4U95 D;  3AU4 A;  3LVR E;  1MX2 A;  5FIO A;  1IQU A; 
#chains in the Genus database with same CATH homology
 3I3N A;  1E90 A;  1S0P A;  1SQM A;  4GYO A;  4WND A;  5BT1 A;  3APC A;  3Q5M A;  2VSY A;  3ZYK A;  4N3C A;  2WXN A;  2CFZ A;  3CKB A;  2XHE A;  1U3D A;  4UWF A;  3P2B A;  3VLF A;  2KZT B;  4RG9 A;  3ULQ A;  3AS5 A;  4C0M A;  5KJN A;  1N52 A;  4YND A;  3JYS A;  1Y6I A;  3MKR A;  2IU1 A;  3FU0 A;  4TRQ A;  3QJZ A;  2ILR A;  5A7D B;  3IBE A;  4CRW A;  1QQE A;  4LEU A;  3FDH A;  4IRU A;  3CIA A;  3LVQ E;  1A17 A;  2IF4 A;  4ATG A;  2FBN A;  4APF A;  3T5V A;  4RVB A;  2VYI A;  3D9P A;  1OUV A;  1N54 A;  3FTV A;  1E7V A;  2AVP A;  4JHK A;  3L17 A;  1HH8 A;  4FJY A;  1UN9 A;  4M3O A;  4N3B A;  3RKV A;  4I6G A;  4ABN A;  4J0U A;  3G2U A;  2X3M A;  2AWI A;  1E8W A;  1UG3 A;  4J8E A;  3UMV A;  4AVX A;  3S7J A;  5DIZ A;  2VGY A;  1HO8 A;  3CVQ A;  3HDX A;  3FTU A;  1KT1 A;  4UWK A;  4KVO A;  1SZ9 A;  4L2Y A;  2J07 A;  3LXU X;  3G2W A;  4HOS A;  2XGO A;  3APF A;  1KLX A;  4UI9 K;  3DPD A;  3MV2 B;  3QK0 A;  2UY1 B;  4GA2 A;  4GYY A;  3MKQ A;  1HS6 A;  3GZS A;  2MRI A;  4NUR A;  1HE8 A;  3FHE A;  1E8Y A;  4NAC A;  4WNF A;  5KJM A;  3L16 A;  3D9O A;  5FQ6 A;  2L6J A;  3QAR A;  4JZY A;  4G2V A;  2WXH A;  2LNI A;  3EIJ A;  4FUL A;  5FQ7 A;  1H19 A;  3PRE A;  5J90 A;  3CQG B;  3G2S A;  2J4D A;  3PEV B;  4RG6 A;  1LF8 A;  2XGS A;  2OND A;  3L08 A;  3ML8 A;  3PNL B;  4XKC A;  4Q69 A;  4UQX A;  1H2V C;  4JHR A;  5BW8 C;  3WXX A;  4JL0 A;  1BPO A;  3KAE A;  4B0Z A;  3LY8 A;  4K0R A;  2J49 A;  2XRY A;  4HLE A;  2P58 C;  3LKU A;  4PUC A;  2L0I A;  3D3M A;  2NC9 A;  2IQC A;  2AXZ A;  4C9B B;  5AYW D;  5CCL A;  5KJK A;  3ASF A;  2IOS A;  2WXK A;  3FUK A;  3RO2 A;  3D9L A;  3CVX A;  4OVU A;  3FTX A;  4EEC A;  2A5U A;  3GZ2 A;  5G04 J;  5LOZ A;  5FJY A;  3QDN A;  2X6I A;  3KEZ A;  4F7A A;  3HHM A;  3UX4 A;  3ONK A;  3QWV A;  4AJW A;  4XI0 A;  4BT9 A;  4CDN A;  4A1G A;  3U66 A;  2WXI A;  1L5J A;  4GB9 A;  2WXJ A;  3TL5 A;  4EZK A;  4I1A A;  1Z6T A;  4CEM A;  1JWG A;  5KCM A;  4FHK A;  4ILH B;  2KZT A;  3OAW A;  2DCP A;  3IV0 A;  4J8S A;  4YVQ C;  2XEV A;  3FUM A;  3CK7 A;  2WB2 A;  1TJF A;  3ZW3 A;  2CG3 A;  2V5F A;  4BT8 A;  3HVE B;  2FF4 A;  2I1K A;  3MYV A;  1ELR A;  5D0Q D;  3FUL A;  5CMY A;  2WXF A;  3K9I A;  3OXL A;  2VSN A;  4I1O B;  4XE0 A;  5ENN A;  2L9B A;  4N2Q A;  3HIZ A;  4E85 A;  1OWO A;  2GW1 A;  2XGM A;  3CEQ A;  3Q49 B;  4UI9 J;  2CHW A;  2J08 A;  2XPI A;  3PDN A;  3UT7 A;  4NQ0 A;  3FEY A;  2WVI A;  4ILI A;  1QNF A;  3LEW A;  4LUN U;  4U0U A;  1IYG A;  1NA3 A;  3IKO B;  3D9K A;  4CCA A;  2VGX A;  4JXT A;  2V4L A;  5EKQ D;  2VSO E;  4O6F A;  3ZFW A;  2NSZ A;  4PDX A;  5C1D A;  4Q96 A;  3IHV A;  3FU3 A;  3TGO A;  4KZC A;  3BG1 B;  3FH8 A;  4U8H A;  1UJK A;  4B94 A;  2PL2 A;  3PUJ A;  4GCN A;  4G23 A;  4JEH A;  2UY1 A;  2J9Q A;  2AXV A;  4WWO A;  2NXP A;  3CVU A;  1OWN A;  1ZBP A;  4DI3 A;  1ELW A;  4AXH A;  4MS6 A;  1UW4 B;  2CG2 A;  5BV1 A;  3ASD A;  4JPS A;  3EDT B;  2CHX A;  3FUE A;  3MEK A;  2WXO A;  4ANU A;  1TEZ A;  2VTB B;  4J8F A;  4Y6W A;  3HYM B;  4A3V A;  3U9W A;  1XNF A;  4DLO A;  2DBA A;  2EQX A;  2HYZ A;  2I2O A;  2X6H A;  4N5C A;  1H2U A;  3BEE A;  4AM9 A;  3GZ1 A;  3CVW A;  3CV0 A;  2WXR A;  4APO A;  3ZIM A;  5HQ8 A;  1HXI A;  3MGB A;  2FO7 A;  3PS6 A;  4CGW A;  4HOQ A;  4AIF A;  2KC7 A;  3GW4 A;  4CT4 A;  4RSY A;  4W9R A;  3FUJ A;  4J6I A;  3CVL A;  3U64 A;  4KMO A;  2PM6 A;  4FC8 A;  3RJV A;  2DIW A;  4ANX A;  5HI7 A;  4LER A;  1QZ2 A;  3SD5 A;  3VLD A;  3CHP A;  4DLQ A;  1PY1 A;  3ENE A;  5BV0 A;  3ASG A;  5EDS A;  2GRM A;  2KAT A;  3ZEF A;  4URK A;  5D0O D;  1ELK A;  2VGX B;  3IEG A;  3ESL A;  4JEU A;  3SBT B;  3QOU A;  3SNX A;  3UQ3 A;  3FH7 A;  4GZC A;  1B89 A;  2YHE A;  2X6F A;  3T5X A;  4JA7 A;  4TUU A;  4AOF A;  5ARG A;  5LX8 A;  4L7T A;  3CHM A;  3FTW A;  3FUH A;  4DI4 A;  4IUL A;  4J8D A;  2WMN A;  2V8S E;  2WXL A;  4I6J A;  3CHR A;  4UWH A;  1HF8 A;  2OV8 A;  1IQR A;  5JHB A;  3HVE A;  3D9J A;  1HU3 A;  4A3T A;  4A55 A;  3B7R L;  5A6C A;  1MQS A;  4U0S A;  5FT9 A;  4FLB A;  3MV3 B;  2I1J A;  4GZ6 A;  3QKY A;  1JUQ A;  4U63 A;  4DJA A;  2LO6 A;  4MRU A;  3U3W A;  1E7U A;  4PH4 B;  3TXM A;  4JW1 A;  3UUX A;  3O4Z A;  4IN3 B;  4BTB A;  3MX3 A;  4ACK A;  3AS8 A;  2RG8 A;  4BSX A;  3NF1 A;  1DVP A;  2KCL A;  3D9N A;  1FVF A;  4GMJ A;  3OXG A;  5CHE E;  4EQF A;  2YIN A;  3PEU B;  4BX9 A;  2PM7 A;  1HX8 A;  3LCA A;  3S7F A;  5JHA A;  2YNQ A;  2QFC A;  2X6J A;  5FZS A;  4WAF A;  4UQY A;  5FWQ A;  5AJD A;  4E6H A;  3AS4 A;  4GZ5 A;  4KBQ A;  4A1S A;  1OWL A;  4QFV A;  5BUZ A;  3RRM B;  5M72 A;  4IYP A;  2E2E A;  3FFL A;  5ARF A;  2VTB A;  4GAA A;  3B7T A;  3U4T A;  4GA1 A;  1JPL A;  4FU3 A;  4FHJ A;  3UT4 A;  4JA9 A;  3OXF A;  1H0A A;  2WM9 A;  2LAI A;  3L6A A;  2KCK A;  2XPY A;  5E75 A;  3R7R A;  3SI5 A;  4WWN A;  3S7D A;  5LCW J;  3EIQ C;  3SBS A;  4N3A A;  3ZVV A;  3VLE A;  4L1B A;  4UWG A;  5T3R A;  4DK5 A;  3FY4 A;  2X38 A;  3B7U X;  2BUG A;  2XQ0 A;  1TJC A;  5G04 C;  2PQR A;  1UJJ A;  2LAH A;  3AU5 A;  2PQN A;  3CVV A;  4I2W A;  2FUL A;  2V0P A;  3C98 A;  1UN8 A;  3Q4A B;  4KT6 B;  1NA0 A;  3I4G A;  3RU0 A;  3CHS A;  3LS8 A;  3SHF A;  1OWP A;  4I2Z A;  3PZD A;  2J4B A;  2KCV A;  3L22 A;  3BG0 B;  5AIJ A;  4GPK A;  3D9I A;  4HXI A;  4WNE A;  3SGH A;  4FP7 A;  4BWR A;  3TG5 A;  4AV7 A;  3FUN A;  5G55 A;  2WXG A;  4C0E A;  2Q7F A;  3D9M A;  4I9E A;  1HG2 A;  1ZU2 A;  5JJ7 A;  4HVB A;  3Q15 A;  3PRZ A;  2VSX E;  4B8A A;  5CCM A;  3JUI A;  1E8X A;  4XIF A;  3TG4 A;  3MA5 A;  2UWJ G;  3KS2 A;  3PE3 A;  4LCT A;  4MLP A;  1X5B A;  4N39 A;  2BF0 X;  4TV3 A;  4UI9 C;  4Y6C A;  5JJT A;  3FH5 A;  3LJ3 A;  3ZGQ A;  3ASH A;  4BY6 A;  4FJZ A;  3T8M A;  2MOW A;  3ZHE A;  1W3B A;  1WM5 A;  3FU5 A;  4U07 A;  4UWL A;  1IHG A;  3G2T A;  3NZU A;  4OVV A;  5FQ4 A;  4F1S A;  4AY6 A;  1HG5 A;  3QB2 A;  1NP7 A;  3CQC B;  3UT8 A;  5FZQ A;  3SFZ A;  2M63 A;  5G05 C;  2GGF A;  2LSU A;  4KYO B;  3FWV A;  5JJ6 A;  1NZN A;  1VDY A;  2FI7 A;  5AEN A;  4XZ4 A;  1HFA A;  4I17 A;  1SZA A;  3CK8 A;  4FLH A;  4G11 A;  5LFA A;  2JLB A;  3Q47 B;  4F3V A;  4N2S A;  5LP0 A;  2CHZ A;  3CLJ A;  4YVO A;  2L0T B;  3URZ A;  4B8C B;  4R7L A;  1Z3Y A;  2Y4U A;  4AY5 A;  1Z3X A;  3ZN3 A;  3MZL B;  4LRZ A;  3CVP A;  2WMO A;  4GCO A;  3LY9 A;  4CT0 A;  2ZU6 B;  3CVN A;  4U04 A;  3ZRH A;  4OYS A;  3S7B A;  4FAD A;  1YA0 A;  3FEX A;  3ONL A;  2R5S A;  3R9A B;  4KZ0 A;  4BX8 A;  2OOE A;  2XPZ A;  4XKB A;  3G2V A;  3QAQ A;  2GRL A;  4G1T A;  2A4Z A;  2HR2 A;  4AP2 A;  1PC2 A;  2X6K A;  2YHC A;  4B89 A;  4EZL A;  2XCC A;  4I6E A;  3MCX A;  3QWP A;  4HS2 A;  3RRN B;  2AW6 A;  4L23 A;  3R7Q A;  2VQ2 A;  2C0L A;  3RIB A;  1XGW A;  3N71 A;  3NQP A;  3EHM A;  3SF4 A;  4HOT A;  2WXP A;  1H2T C;  3EHN A;  1HZ4 A;  4EBA A;  2IJG X;  3P1U A;  4EZJ A;  4ANW A;  3ZHE B;  4NRH B;  4JHJ A;  2C0M A;  5C2Y A;  1U3C A;  3TXN A;  5DBK A;  4GYW A;  3ZXS A;  2WQ7 A;  2KM4 A;  5E76 A;  3JQ1 A;  4PS8 A;  3ZPJ A;  1GW6 A;  4G26 A;  4PS3 A;  4G24 A;  3FUF A;  5AJL A;  4BTA A;  3ZYM A;  4JVS A;  4GML A;  2RD0 A;  3UPV A;  1EPU A;  2MHK A;  1EYH A;  4V3I A;  3FTZ A;  3E4B A;  4GZ3 A;  1E96 B;  3OTN A;  4GZD A;  3CK9 A;  2XRZ A;  1EF1 C;  3IHY A;  4ACL A;  2FEZ A;  2XCB A;  2BTD A;  3I4R B;  3FUD A;  2HO1 A;  5EX0 A;  4I9C A;  3JQ0 A;  3ZYL A;  3CR3 A;  4L2L A;  2WXM A;  3GYZ A;  4D10 C;  1E8Z A;  3PVL A;  4F53 A;  2JEK A;  2WQH A;  2WQ6 A;  4JC8 A;  3QC1 A;  4HOU A;  4Q94 A;  3CSF A;  3FUI A;  5FZR A;  4U0Z A;  4UQZ A;  5ANL A;  4K03 A;  4ILG A;  3CGH A;  2I6H A;  3CKC A;  4WUY A;  3RO3 A;  2IOL A;  3PUK A;  2OVB A;  4EPZ A;  2HM8 A;  1OWM A;  4WNG A;  1H6K A;  3NZS A;  5T4Y A;  2LSV A;  2AXU A;  2VJ8 A;  4PS7 A;  4ME2 A;  2CFU A;  3JCK C;  1PAQ A;  1FCH A;  1DNP A;  4AEZ C;  4H7Y A;  5KJL A;  1WAO 1;  3VTX A;  3CHQ A;  5CMW A;  2R59 A;  4P29 A;  4XX5 A;  4BFR A;  3O48 A;  3PH0 C;  3EJN A;  2C2L A;  4CGV A;  4CDM A;  3LDZ A;  4KXK B;  4GA0 A;  2J09 A;  3MKQ B;  3ML9 A;  5FTP A;  3QNK A;  3LYA A;  4CDR A;  1INZ A;  3FU6 A;  2Y4T A;  3S2A A;  3ZYQ A;  3FP3 A;  1KT0 A;  2E0I A;  2R17 C;  5A23 A;  5LCW C;  4H7X A;  2WPV A;  3CST A;  4EBA G;  3I5P A;  3CHO A;  1FVH A;  2YQ8 A;  4MKT A;  4HOR A;  3FTS A;  3L13 A;  5BPP A;  2ION A;  3LPZ A;  2QY7 A;  3APD A;  3L54 A;  5J08 A;  3FTY A;  5T8I A;  3TJP A;  3RK6 A;  4XI9 A;  3KD7 A;  1P5Q A;  3LY7 A;  3RRU A;  1Y8M A;  2WXQ A;  3TAX A;  4I43 A;  3B13 A;  3VTY A;  2PZI A;  4ANV A;  1EDU A;  1MHQ A;  4I1M A;  3PE4 A;  3CVY A;  4G25 A;  2IFU A;  4WWP A;  3QWW A;  4FA6 A;  5G05 J;  5BNW A;  4DPR A;  2OVF A;  5EX3 A;  5FQ8 A;  3SZ7 A;  4GU5 A;  3MJW A;  2I9C A;  5ANR A;  3ESK A;  5G2N A;  1JWF A;  4KVM A;  1WY6 A;  3PNT B;  3B7S A;  3AU4 A;  4HFG A;  3DBS A;  3LVR E;  2Y3A A;  1IQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...