1EYHA

Crystal structure of the epsin n-terminal homology (enth) domain at 1.56 angstrom resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
144
structure length
144
Chain Sequence
HNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF THE EPSIN N-TERMINAL HOMOLOGY (ENTH) DOMAIN AT 1.56 ANGSTROM RESOLUTION
rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords EPSIN
total genus 60
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2000-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1eyhA00
2KM4A 3D9IA 3G2SA 2DCPA 1HG2A 1EDUA 1EYHA 3D9MA 2DIWA 3G2WA 1JUQA 4HFGA 3D9LA 1ELKA 3ONKA 2QY7A 5CMWA 2BF0X 3CLJA 1UJJA 2LO6A 3D9PA 3ONLA 3LDZA 5J08A 2L0IA 2MOWA 1SZAA 4JXTA 3ZYMA 1HFAA 1HF8A 1JPLA 1X5BA 1INZA 1PY1A 4NACA 1VDYA 4Q96A 1UJKA 2L0TB 3ZYKA 3G2VA 1HX8A 3ZYQA 1SZ9A 1XGWA 4Q94A 3D9NA 4GZDA 3D9OA 1HG5A 4FLBA 4GZCA 2V8SE 3G2TA 3RRUA 1H0AA 5LP0A 5LOZA 3ZYLA 4FU3A 1MHQA 5CMYA 3G2UA 1LF8A 3D9JA 4AVXA 1JWGA 1DVPA 3D9KA 1JWFA
chains in the Genus database with same CATH superfamily
2J4DA 3MZLB 2AJAA 1N0RA 3PZ3A 1N54A 2FO7A 4LG6A 3TL5A 5KNHD 3E33A 2AXVA 4B8AA 4NACA 4PDXA 1YMPA 2WMOA 5JJ6A 3ZXPA 1N0QA 2FI7A 3MV2B 2J08A 5LCWC 5CEAA 4JEHA 4YDYA 3C98A 5AJDA 1ELWA 2I6HA 5ARGA 3CKCA 3AG1E 2P9PG 2ZXWE 4ZFHA 3ONKA 5CERB 5AARA 2BTDA 2NYJA 4BSXA 3HYMB 1N52A 2IEJA 2J07A 5EIBE 2ETAA 2HM8A 3J5PA 4CCAA 3CVYA 1WAO1 4GMLA 3FUEA 3SQVA 3CQCB 5ENNA 5JA4D 2V4HC 2WXGA 2LSUA 1ZU2A 4G2VA 2JABA 1IYGA 1A5EA 1O1RA 4ME2A 4GPMA 3ZYQA 4DRXE 2LUHA 2Y69E 3FY4A 1MHQA 3KEAA 3PZDA 3IEGA 4JEUA 1G3NB 5FQ8A 3L13A 3ZGQA 4G25A 3S7BA 4DLQA 1TJCA 1TNYA 2EIJE 2J9QA 1VDYA 4WWPA 3ZYKA 1SZ9A 3UM1A 2VTBA 1BU9A 2PL2A 2PZIA 4KBQA 2R05A 2IOSA 4HOUA 2XENA 3OXLA 1DC2A 4J7WA 4GTSA 4WWNA 2Q7FA 3L22A 4NRHB 4K5CA 4DI4A 1H0AA 5LP0A 2WVIA 4GTOA 3D9JA 1OWOA 1XNFA 2R5SA 3PREA 3B13A 2FEZA 4MS6A 3PUJA 3IHVA 4GCOA 1GW6A 5ENOD 1HX8A 4FP7A 3QWVA 3BG1B 2VGEA 1MQSA 4BESA 4U07A 4GAAA 5ENPD 3PZ2A 4B8CB 4UWHA 3NQPA 5CRVA 3DSSA 3IBEA 3QC1A 2YQ8A 2YHCA 3FWVA 3FTVA 4GZ6A 3S7DA 2WXQA 4EPZA 3ZFWA 2FBNA 3P1UA 2XZTG 3AG4E 1KT1A 3PEUB 3KS2A 2X6FA 2A4ZA 4KYOB 3CVWA 3EHNA 4BX8A 3ZN3A 3PEVB 4GZDA 4A3VA 3ENEA 4QFVA 4UWGA 3Q79A 1MYOA 2P9NG 1NA0A 3NBNB 2ZGGA 5CMWA 4RQIA 4BX9A 1TNUA 3KSLA 2CHWA 2ZU6B 1E8ZA 1X5BA 3ZXSA 2WPVA 1DNPA 2XGSA 3E4BA 1SQMA 2VGYA 4IYPA 3GZ1A 3RRUA 2R17C 3PNLB 4MKTA 3SBTB 1SW6A 5LCWJ 2IO2C 2KZTA 3FUNA 4JA7A 4FHKA 5AN8A 4CRWA 3AU4A 4GMRA 2CHXA 3QWWA 5AYWD 5HKPA 3PVLA 4DLOA 3CV0A 4AY5A 2EILE 3LY9A 3EHMA 2XQ0A 3FEXA 5T4YA 4KZCA 4UWFA 5D2MC 2HO1A 2WXJA 1INZA 1QQEA 5KJKA 1Y6IA 2WQHA 1IQUA 4EBAA 2V8SE 2M63A 3PRZA 3U64A 2ZGDA 2H6IA 5BNWA 3SFZA 4CGWA 3ABKE 3GZSA 4BWRA 1EF1C 3U4TA 2DBAA 5DBKA 2KCLA 4KVMA 3KSQA 3TXNA 3ASNE 4GZ3A 5EYPF 3SI5A 4U0SA 4TV3A 5A7DB 3Q47B 4XX5A 4BFRA 1TN6A 5DIZA 2DZOA 5ENTD 5ENSD 4GB9A 4U0ZA 2OV8A 3DEPA 2AW6A 3RAUA 3BG0B 5BV1A 5ANLA 2P9IG 4UQYA 3G2VA 1WDYA 3MGBA 4C0EA 4LNBA 2KM4A 4DPRA 2GRRB 2HYZA 2BF0X 3Q73A 1ZBPA 4TXRA 2VGXA 1N95A 3O48A 4YNDA 2KBXA 3R7RA 4ANWA 4JW1A 3NOGD 1OCRE 5JHBA 3MEKA 5FQ6A 4JB8P 2X38A 1MJ0A 4Y6CA 4LSZE 1N9AA 2ONDA 2B6CA 4N2QA 5KBAA 3UIOC 3C72A 3TWSA 4LUNU 3ZNGA 3FUDA 3BQOA 2RFMA 4WWOA 4ACLA 2JEKA 4EZJA 4ATZD 1HZ4A 3SFXA 2YHEA 2WMNA 2E0IA 5EILA 3E32A 4CGVA 3UM3A 5D0QD 4DI3A 1BD8A 5G55A 2WXHA 5CECB 3JUIA 2AXZA 3DRAA 4I17A 3VTYA 2MYOA 1K1AA 3ASOE 1NZNA 1NA3A 4I43A 4UI9J 3EUVA 4CDRA 4BEPA 4EHMA 2WXMA 4AV7A 2IO3C 4ILHB 4JHJA 1MZCA 3L9TA 4C48B 3R9AB 4AXHA 2L0IA 3LJNA 3LYAA 5JHAA 4UWLA 1P5QA 2WXNA 4HLLA 3V2OA 1RZ4A 2I9CA 4APOA 4F1PA 5KJLA 3CVXA 4WNDA 3RKVA 1OT8A 3BEEA 2WQ6A 5T8IA 4I1MA 1OWNA 3TJPA 2QZAA 4UWKA 3ZVVA 3HRAA 4U0UA 4G26A 2R2LA 2XEEA 3DSWA 1W3BA 4AEZC 4OAUC 1L5JA 3EU5A 1TN8A 3HIZA 4HI8A 1UN9A 2AVPA 2A5UA 3DSXA 3S7JA 3DPYA 4O60A 4L2YA 1K3ZD 1YYHA 3EJNA 3ABLE 4MRUA 3IXEA 5E76A 2PM6A 2RG8A 1JWGA 3QNKA 3G2SA 4J8SA 1V54E 1MX6A 3SO8A 3AAAC 3IV0A 2EIME 4ILGA 4HVBA 4EBAG 3CVVA 4BY6A 1DVPA 1H2TC 2IFUA 4AIFA 3NZUA 2VSXE 4GCNA 4W9RA 3EIJA 2XPYA 4F53A 3Q7AA 2R59A 1Z3XA 3FP3A 3NB2A 4Q96A 4JA9A 4GA1A 3HXEA 2CG2A 3B95A 1MX4A 4B94A 5JJ7A 4CZ2D 2VJ8A 4PS8A 3Q49B 1ELKA 3LKUA 4WAFA 1Y8MA 3AG3E 3CHQA 2P9UG 4LRZA 5G04C 5BV0A 3ZHEA 2IF4A 2WXFA 2VYIA 1WM5A 3B7SA 2XRZA 4UI9K 3UT7A 2X6KA 4JC8A 4O1OA 4JZYA 2H6HA 4YDEA 2HR2A 3AJIA 3ISMC 4EQFA 3MA5A 4Q69A 3LDZA 4G1TA 1KLXA 3EHQA 5G05C 2DYRE 2IONA 1TNBA 4KT6B 5FZRA 4U96D 3I5PA 3V79K 4F1SA 4GTVA 4HNAD 3UI2A 4AOFA 3QDNA 1D8EA 4TRQA 3UTMA 1NL4A 4L9PA 2R02A 3AS8A 4GTPA 4B93B 4B89A 1S70B 1A17A 4HOSA 3LCAA 4TUUA 1H6KA 4WNEA 3T5VA 4J8YA 3ZU7B 4ATGA 2XGMA 4XI0A 3UIPC 4YDOA 4HRMB 2KXPC 4CT4A 4E6HA 5BPPA 1BLXB 2LXLA 3TWXA 2NSZA 3CIAA 4A3TA 1E8YA 1AP7A 5BUZA 1ZB1A 4OYSA 5D0OD 1H6OA 4BETA 3PZ1A 3QK0A 2XCCA 3TG5A 1E96B 2GRLA 2YINA 1AWCB 3F6QA 2CFUA 3ASGA 5EN5D 4APFA 4L7TA 4WUYA 3Q4AB 3CLJA 1OWPA 3Q75A 5AQAA 3HXCA 3DSTA 2XEVA 2XS8A 2KCVA 3CK8A 4K03A 4O1PA 5ANRA 2EQXA 5AQ9A 3Q9UC 3TGOA 4LEUA 2BUGA 2ILRA 4K0RA 4YVQC 3L54A 4CDNA 5KJMA 1K1BA 5EYLA 1QBQA 3PDNA 4GA0A 5EKQD 4ANXA 3B7BA 2LAIA 1SA4A 1SVXA 1H19A 3HXBA 3NF1A 1IXVA 3QAQA 3JQ0A 4HBDA 5E75A 4GU5A 5HQ8A 3HXFA 3JCKC 1TYQG 1HF8A 4U7EB 4FLHA 3QB2A 3LY7A 4M7CA 3APFA 4LNUD 3RSEG 2OVFA 2PNNA 4N3AA 4BT8A 1OWMA 4ACKA 2YNQA 1OUVA 4M3OA 3ZW3A 2WXKA 3Q15A 1ELRA 2GRQB 3BU8A 2XRYA 3SFYA 3L82A 2XEHA 3E34A 3QARA 3FUIA 3D9NA 1U2VG 5BXOA 5BT1A 3ASHA 3UKUG 4ANUA 5B1BE 3VLDA 3R7QA 2V4LA 3FH5A 2C0LA 3RRMB 5EDSA 2V0PA 5FQ4A 2LO6A 3ZYMA 4GTMA 2QYJA 1HU3A 4I6GA 2GRPB 2XGOA 3TWRA 1HE8A 3VTXA 4PS3A 3ZYLA 2KATA 5B1AE 4JHKA 4FA6A 3D3MA 3G2WA 2DVWA 4J8EA 3W9FA 2XZDG 4URKA 4U95D 3MJWA 4EZLA 1K8KG 1E7UA 1BPOA 3FFLA 3FUFA 1PC2A 1IKND 3GW4A 4CT0A 3FDHA 3CHOA 1TJFA 4U8VD 4BTAA 1KT0A 2A5EA 3CHMA 1JUQA 2R03A 1TR4A 5D66A 2VQ2A 3UM2A 4J8FA 1N11A 4YVOA 4JPSA 3CKBA 2GW1A 3PUKA 2C0MA 1Z3YA 1E90A 4AJWA 3HG0D 3U9WA 1N4RA 2PM7A 5KWDA 3HHMA 1DCEA 4FHJA 1S0PA 4UUCA 2KC7A 2CG3A 2VGXB 1FVHA 3LY8A 5CEDB 3ULYA 2EIKE 2NC9A 4OVVA 4A1GA 1QZ2A 3FTUA 3AS4A 3X2QE 5LFAA 3FU3A 4WNFA 4LNGA 3CVPA 1S64A 3S7FA 2XPIA 1XGWA 4ILIA 3ZRHA 3CSTA 1RW2A 3C5RA 4WNGA 3HVEA 3I3NA 5A23A 4DX1A 1IQRA 2FO1E 3E37A 5BXUA 5IY5E 3U3WA 2UWJG 1JCRA 2VSOE 1U3DA 4U63A 3ZUVB 5JJTA 1EPUA 3L6AA 3RK6A 3FUMA 1N4PA 3V2XA 5KNGA 1OWLA 4RG9A 1FT1A 2OEVA 2IOLA 3EHRA 3G2TA 4GYOA 1NI1A 3RIBA 3NOCD 4C9BB 4TXQA 3C3RA 3CVUA 1IHGA 4LERA 4UQXA 4DX7D 4I9CA 1LTXA 1DCQA 2OCCE 4G8LA 5C2YA 3EIQC 3CHPA 3IKOB 2FULA 2JLBA 1TNOA 3FTZA 1WY6A 3OAWA 4DX6D 3JUEA 3ML9A 3UMVA 4GA2A 1WG0A 1E8WA 5AQ7A 1JCSA 3FTXA 3SD5A 4GMJA 3SBSA 2FF4A 4FADA 1EYHA 2DZNA 4CEMA 3DPDA 1UJJA 2KZTB 3ZHEB 4CYMD 4HRLA 3UXGA 1TEZA 1D8DA 4HI9A 1H6PA 2EINE 5FIOA 3QOUA 4DX2A 3ZEFA 3VLEA 2WB2A 2CHZA 4MLPA 3D9MA 3OXFA 3HDXA 3Q7FA 3UINC 3UKRG 2XS1A 1FVFA 1E7VA 5CBOA 4YDWA 3I4GA 5CCMA 4J0UA 4GYWA 4LCTA 3FU6A 2GGFA 4I1OB 4J8DA 3U66A 2I1JA 3FTSA 3AS5A 3RO2A 4HB5A 4HFGA 1HXIA 2OVBA 4JD2G 3ASFA 3ESLA 1HS6A 5KJNA 4TUMA 1PAQA 3CVQA 2WXIA 4N5QA 2CFZA 4G8KA 2P9LG 2OOEA 4ZHBA 3MV3B 3W9GA 3V31A 3QWPA 2B0OE 3CR3A 5AAOA 3RO3A 2DYSE 1LD8A 3LS8A 5G2NA 4V3IA 3ABME 3FUJA 4BSZB 3TWWA 4ANVA 2KCKA 2X6JA 3N71A 3JXJA 4OAVB 4I2ZA 3WXXA 3LPZA 2V5QC 4HRNA 5FTPA 2UY1B 3UUXA 3UT8A 3ULQA 3MYVA 4JXTA 4P29A 1BI8B 5FWQA 2J4BA 2L6BA 3S2AA 2ZISA 2XPZA 4DX5D 2I1KA 2XCBA 4GTQA 3DXKG 3ESKA 1IHBA 2F8YA 2WXRA 4F3VA 3PNTB 3SF4A 4DUIA 3FTYA 3SNXA 4FC8A 1OCCE 2P9SG 1U3CA 3B7UX 4D10C 3CGHA 4GZCA 1HG5A 4L2LA 5EX3A 4TXPA 5J90A 3PZ4A 1OCZE 4A1SA 3D9IA 2VSNA 1FCHA 2WQ7A 5FINA 2Y3AA 3TAXA 4GZ5A 3DXMG 4BT9A 2RFAA 1HO8A 5AENA 3T8MA 1KZPA 2X3MA 4F6RD 2Y4TA 2ZIRA 4KZ0A 4A55A 5LOZA 1N94A 4JL0A 3TWQA 5JMND 1MX2A 3D9KA 3JXIA 4R7LA 5FT9A 4AP2A 2BKGA 4XI9A 1X81A 3P2BA 2HE0A 4H7XA 5J08A 2IY0C 2Y4UA 4RLYA 5CCLA 4FLBA 4HOTA 2LSVA 2Y1LE 4KMOA 3UT4A 5FZSA 4HXIA 1Z5SC 4HQDA 1OCOE 2QY7A 4U8YD 3D9PA 3UPVA 3MX3A 3UX4A 3APDA 1D9SA 4PUCA 2E2EA 4N39A 3MKQA 4EZKA 3HXDA 4HS2A 4G23A 4I2WA 3SY2A 5CRUA 3T9KA 3ULEG 1EDUA 5FZQA 1S63A 4G24A 5G05J 2MOWA 3FULA 1OXJA 3UM0A 2AXUA 1LD7A 3CK9A 2QFCA 3EU9A 3GYZA 2GROB 4XKBA 3IHYA 5EIDA 4H7YA 4GPKA 4RG6A 4K5BA 2H6FA 4NIKA 5C1DA 2VTBB 4N3CA 1UN8A 4I9EA 5AJLA 4GTRA 2LAHA 5EX0A 2QYUA 1BI7B 3DEOA 4PH4B 5ENRD 3JQ1A 3EDTB 3AU5A 3URZA 3JYSA 3QJZA 4FJYA 3FEYA 2P58C 4GYYA 4XEIG 2AWIA 3D9OA 2IQCA 3FH7A 3Q5MA 3CSFA 4HOQA 3D9HA 2WXPA 1YCSB 3LVQE 5G04J 5BW8C 4Z68A 1NFIE 3R9MA 3ONLA 4N5CA 5FQ7A 1KZOA 1SA5A 3KAEA 5KCMA 4NQ0A 3K9IA 2ETCA 1FPPA 4IRUA 4XE0A 4B0ZA 4PS7A 2WXLA 3NAWA 3ZPJA 3CVNA 3FHEA 3AG2E 2IJGX 1NP7A 4QQIA 3L16A 1FT2A 4RSYA 3WG7E 3PS6A 3I4RB 3APCA 4FJZA 4XKCA 2J09A 3DSUA 4Y6WA 5ARFA 2Y0BG 3CEQA 1UW4B 3VLFA 3LXUX 5FJYA 3ZKJA 4U04A 1O1SA 1JPLA 4IULA 2F37A 4KVOA 4I6EA 1YA0A 3DWLG 2ETBA 2H6GA 4RVBA 3RRNB 1E8XA 2MRIA 5ENQD 3G2UA 2I2OA 3MCXA 1H2VC 4AVXA 4DK5A 1HG2A 2BEDA 3PE4A 4E85A 2F0YA 2WM9A 3T8KA 3CK7A 2RKKA 3B7RL 2P9KG 5B3SE 1Z6TA 3NZSA 3TWUA 1O5MA 4A63B 3HVEB 3ML8A 2C2LA 2J8SD 2IU1A 2OEWA 4HORA 5AIJA 4NURA 3ZIMA 3D9LA 1Q2ZA 4C0MA 1SZAA 5A6CA 2GRMA 3CQGB 4N3BA 4CDMA 5HI7A 3TXMA 1QNFA 3LJ3A 4JVSA 3L08A 3Q9NC 3C3QA 2UY1A 4N2SA 3TG4A 3FUHA 3LEWA 3B7TA 4MBGA 2GRNB 4UI9C 4HLEA 4I6JA 5M72A 4BTBA 2X6HA 3PH0C 3FTWA 1LF8A 1N4QA 3UQ3A 3C3OA 4L1BA 2BKKB 2P2CP 4IN3B 1TN7A 4FULA 4EECA 3FU5A 4Q94A 1H2UA 2PQNA 4U8HA 3CHSA 5HRYA 2DCPA 2VSYA 5ITZF 2NXPA 4L23A 3V30A 2J49A 1HFAA 1KPSB 3J5QB 3TWTA 3KD7A 2PQRA 2LNIA 4AM9A 4X8QA 3GZ2A 4UQZA 3RJVA 3SZ7A 3SHFA 4G11A 4XIFA 2DIWA 3TWVA 3OXGA 3MKRA 1PY1A 4AY6A 2L9BA 2L0TB 3RU0A 3CHRA 5CHEE 3ASDA 2WXOA 1OY3D 1JWFA 3FH8A 5CBNA 4J6IA 3MKQB 2F8XK 4GTTA 3SGHA 1TNZA 5LX8A 4XZ4A 4KXKB 3CVLA 2XHEA 3LVRE 4DJAA 3Q78A 2LXMA 4JHRA 3OTNA 3PE3A 4OVUA 3E30A 3DBSA 1B89A 1JCQA 1UG3A 3KEZA 2L6JA 3O4ZA 4K5AB 5AQBA 4BERA 4ABNA 1V55E 3L17A 2X6IA 2DWZA 3BUAA 4I1AA 5CMYA 1HH8A 1O1TA 5H7PA 1N4SA 2QC9A 2V5FA 3FU0A 1UOHA 2RD0A 3T5XA 3DSVA 4F7AA 1UJKA 5HS0A 2MHKA 5T3RA 4FU3A 3FUKA 4O6FA 3QKYA 1QYMA
chains in the Genus database with same CATH topology
3G2WA 4LUNU 2J4DA 2QY7A 3MZLB 4J8EA 3FUDA 1N54A 2FO7A 3TL5A 3D9PA 3UPVA 3MX3A 4URKA 2AXVA 4WWOA 4ACLA 2JEKA 3MJWA 3UX4A 4NACA 4PDXA 4B8AA 3APDA 1E7UA 1HZ4A 4PUCA 5JJ6A 2WMOA 1BPOA 2E2EA 3FFLA 3FUFA 2FI7A 4N39A 1PC2A 2YHEA 2WMNA 3GW4A 3MV2B 3MKQA 2E0IA 4CT0A 4EZKA 3FDHA 3CHOA 2J08A 1TJFA 5LCWC 4HS2A 4JEHA 4G23A 4CGVA 3C98A 5AJDA 4I2WA 1KT0A 1ELWA 4BTAA 2I6HA 5ARGA 3CKCA 1EDUA 5D0QD 4DI3A 3CHMA 5FZQA 1JUQA 3ONKA 4G24A 5G55A 2WXHA 2VQ2A 5G05J 2BTDA 2MOWA 3JUIA 2AXZA 4J8FA 3FULA 4I17A 4YVOA 4BSXA 3HYMB 2AXUA 1N52A 3VTYA 2J07A 4JPSA 2HM8A 3CK9A 4CCAA 1NZNA 1NA3A 3CVYA 2QFCA 4I43A 3CKBA 1WAO1 2GW1A 3GYZA 3PUKA 4GMLA 4UI9J 3FUEA 4XKBA 2C0MA 4CDRA 1Z3YA 3IHYA 4H7YA 2WXMA 4GPKA 3CQCB 4RG6A 1E90A 4AJWA 4AV7A 5ENNA 3U9WA 2WXGA 5C1DA 4ILHB 2LSUA 1ZU2A 4JHJA 2PM7A 2VTBB 4G2VA 3R9AB 4AXHA 2L0IA 3HHMA 1IYGA 3LYAA 4FHJA 4N3CA 5JHAA 4UWLA 4ME2A 1UN8A 4I9EA 1P5QA 5AJLA 2WXNA 2LAHA 3ZYQA 2I9CA 4APOA 5EX0A 1S0PA 4EZJA 5KJLA 2KC7A 3FY4A 2CG3A 3CVXA 1MHQA 2VGXB 1FVHA 4WNDA 3RKVA 3LY8A 3PZDA 3BEEA 2WQ6A 5T8IA 3IEGA 2NC9A 4I1MA 4JEUA 4OVVA 1OWNA 3TJPA 4A1GA 5FQ8A 4UWKA 3L13A 1QZ2A 4PH4B 3FTUA 3AS4A 3ZGQA 3JQ1A 4U0UA 3ZVVA 5LFAA 3EDTB 3AU5A 3FU3A 4G25A 3S7BA 4DLQA 1TJCA 4WNFA 3URZA 4G26A 2J9QA 3JYSA 3QJZA 4FJYA 1W3BA 2P58C 3CVPA 3FEYA 4GYYA 1VDYA 3S7FA 4AEZC 4WWPA 2XPIA 3ZYKA 1SZ9A 1XGWA 2AWIA 4ILIA 3D9OA 2VTBA 3ZRHA 1L5JA 2IQCA 3CSTA 2PL2A 3FH7A 3Q5MA 3CSFA 3HIZA 4WNGA 3HVEA 4HOQA 3I3NA 5A23A 1UN9A 2AVPA 2WXPA 1IQRA 2A5UA 2PZIA 4KBQA 3S7JA 3LVQE 5G04J 2IOSA 5BW8C 4HOUA 4L2YA 3ONLA 3OXLA 4N5CA 3EJNA 3U3WA 5FQ7A 2UWJG 4WWNA 2Q7FA 3L22A 2VSOE 4MRUA 4NRHB 3KAEA 5KCMA 4DI4A 1H0AA 5LP0A 2WVIA 4NQ0A 3K9IA 1U3DA 5E76A 3D9JA 1OWOA 2PM6A 2RG8A 1JWGA 4IRUA 4XE0A 4B0ZA 3QNKA 4PS7A 1XNFA 2WXLA 3G2SA 4J8SA 4U63A 2R5SA 5JJTA 3PREA 3B13A 3ZPJA 3CVNA 1EPUA 2FEZA 3L6AA 3RK6A 3FUMA 3FHEA 4MS6A 1OWLA 2IJGX 3PUJA 1NP7A 3IV0A 4RG9A 3L16A 3IHVA 4GCOA 1GW6A 4RSYA 4ILGA 4HVBA 2IOLA 1HX8A 4FP7A 4EBAG 3CVVA 3QWVA 3PS6A 3BG1B 3I4RB 3APCA 3G2TA 4FJZA 4XKCA 1MQSA 2J09A 4U07A 4GYOA 4BY6A 4GAAA 4Y6WA 5ARFA 1DVPA 3RIBA 1H2TC 4C9BB 3CEQA 2IFUA 4AIFA 3NZUA 2VSXE 4GCNA 1UW4B 3VLFA 3CVUA 4W9RA 3LXUX 1IHGA 5FJYA 3EIJA 4LERA 4B8CB 4U04A 4UQXA 4UWHA 2XPYA 3NQPA 4F53A 4I9CA 2R59A 1Z3XA 1JPLA 4IULA 3IBEA 3FP3A 4Q96A 4KVOA 4I6EA 1YA0A 3QC1A 4GA1A 4JA9A 5C2YA 2CG2A 2YQ8A 3CHPA 3EIQC 2FULA 2YHCA 3FWVA 3IKOB 4RVBA 3RRNB 4B94A 1E8XA 2JLBA 2MRIA 3G2UA 3FTVA 2I2OA 3MCXA 1H2VC 3FTZA 1WY6A 4GZ6A 2WXQA 3S7DA 4AVXA 4DK5A 3ZFWA 4EPZA 2VJ8A 4PS8A 1HG2A 3OAWA 2FBNA 3PE4A 3P1UA 4E85A 3Q49B 1ELKA 3LKUA 1KT1A 4WAFA 1Y8MA 3ML9A 3CHQA 3KS2A 2X6FA 2WM9A 3PEUB 4GA2A 4LRZA 5G04C 2A4ZA 3UMVA 4KYOB 3CK7A 3CVWA 1E8WA 3B7RL 1Z6TA 3EHNA 3FTXA 4BX8A 3NZSA 3ZN3A 5BV0A 3ZHEA 3SD5A 3HVEB 3ML8A 2C2LA 2IF4A 2WXFA 3PEVB 2VYIA 1WM5A 4GZDA 4A3VA 2IU1A 3ENEA 3B7SA 2XRZA 4GMJA 4UI9K 4QFVA 4UWGA 3UT7A 4HORA 3SBSA 5AIJA 2FF4A 2X6KA 4FADA 4NURA 1EYHA 1NA0A 3ZIMA 4JC8A 4CEMA 3D9LA 4JZYA 5CMWA 4BX9A 2HR2A 3DPDA 4EQFA 3MA5A 4Q69A 1UJJA 2KZTB 3ZHEB 2CHWA 3LDZA 2ZU6B 1E8ZA 4G1TA 4C0MA 1SZAA 1X5BA 1KLXA 5A6CA 5G05C 3ZXSA 2WPVA 2IONA 2GRMA 1DNPA 3CQGB 1TEZA 4N3BA 2XGSA 3E4BA 4KT6B 1SQMA 2VGYA 4IYPA 5FZRA 3GZ1A 4CDMA 3I5PA 3RRUA 4F1SA 5HI7A 2R17C 3TXMA 3PNLB 4MKTA 3SBTB 3QOUA 3ZEFA 3VLEA 1QNFA 3LJ3A 5LCWJ 4AOFA 4JVSA 2CHZA 4MLPA 2WB2A 2KZTA 3D9MA 3FUNA 3L08A 3OXFA 3QDNA 4FHKA 4JA7A 2UY1A 3HDXA 4TRQA 4CRWA 4N2SA 3AU4A 3AS8A 2CHXA 4B89A 3TG4A 1A17A 1FVFA 3FUHA 3QWWA 4HOSA 1E7VA 3LCAA 3I4GA 5CCMA 3LEWA 3B7TA 4J0UA 5AYWD 4UI9C 4TUUA 4GYWA 4HLEA 4I6JA 1H6KA 4WNEA 5M72A 3PVLA 3T5VA 4LCTA 3FU6A 4BTBA 2GGFA 2X6HA 2XGMA 4I1OB 4J8DA 3CV0A 4XI0A 4ATGA 4AY5A 4DLOA 3U66A 2I1JA 3FTWA 3FTSA 3AS5A 1LF8A 3LY9A 3PH0C 3EHMA 3UQ3A 3RO2A 2XQ0A 3FEXA 5T4YA 4CT4A 4E6HA 4L1BA 4HFGA 4KZCA 1HXIA 2OVBA 5BPPA 4UWFA 3ASFA 3ESLA 1HS6A 2NSZA 5KJNA 2HO1A 2WXJA 1PAQA 3CVQA 3CIAA 4A3TA 1E8YA 2WXIA 4IN3B 1INZA 4FULA 2CFZA 4EECA 1QQEA 5BUZA 5KJKA 1Y6IA 2WQHA 4OYSA 3FU5A 5D0OD 1IQUA 4Q94A 4EBAA 1H2UA 2V8SE 3QK0A 2M63A 2OOEA 2XCCA 2PQNA 3MV3B 3TG5A 1E96B 3CHSA 4U8HA 2GRLA 2YINA 2CFUA 3QWPA 3ASGA 2DCPA 3CR3A 2VSYA 3PRZA 4APFA 4L7TA 3RO3A 4WUYA 3U64A 3Q4AB 5BNWA 3LS8A 5G2NA 2NXPA 3SFZA 3CLJA 4CGWA 4V3IA 1OWPA 4L23A 3GZSA 5JJ7A 4BWRA 2J49A 3FUJA 1HFAA 1EF1C 3U4TA 2DBAA 5DBKA 2XEVA 3KD7A 2KCLA 3CK8A 2KCVA 4K03A 2PQRA 4ANVA 2LNIA 4KVMA 4AM9A 2KCKA 2X6JA 5ANRA 2EQXA 3N71A 3GZ2A 3TGOA 3TXNA 4LEUA 4UQZA 3RJVA 3SZ7A 2BUGA 3SHFA 2ILRA 4G11A 3LPZA 4GZ3A 4I2ZA 2DIWA 4K0RA 4XIFA 3SI5A 3WXXA 5FTPA 2UY1B 3UUXA 4YVQC 3UT8A 3L54A 4U0SA 3ULQA 3OXGA 4TV3A 3MYVA 4JXTA 3MKRA 4CDNA 5A7DB 5KJMA 4P29A 1PY1A 3Q47B 4XX5A 4BFRA 5FWQA 2J4BA 4AY6A 2L9BA 2L0TB 3RU0A 3CHRA 3S2AA 3PDNA 5CHEE 2XPZA 4GA0A 5EKQD 4ANXA 2LAIA 2I1KA 2XCBA 2WXOA 3ASDA 5DIZA 4U0ZA 4GB9A 1H19A 2OV8A 3ESKA 3NF1A 1JWFA 3FH8A 3QAQA 4J6IA 3JQ0A 2WXRA 4F3VA 3MKQB 3PNTB 4GU5A 5E75A 3SF4A 5HQ8A 3FTYA 2AW6A 3JCKC 3SNXA 3SGHA 4FC8A 5LX8A 4XZ4A 3BG0B 4KXKB 5BV1A 3CVLA 5ANLA 1HF8A 2XHEA 4FLHA 3LVRE 1U3CA 3QB2A 3B7UX 4DJAA 4D10C 3LY7A 4UQYA 3G2VA 3CGHA 4JHRA 3APFA 3MGBA 4GZCA 1HG5A 4C0EA 3OTNA 3PE3A 2OVFA 4L2LA 4N3AA 5EX3A 5J90A 4OVUA 4BT8A 1OWMA 3DBSA 4A1SA 4ACKA 2YNQA 1OUVA 1B89A 4M3OA 2KM4A 4DPRA 3D9IA 2VSNA 3ZW3A 1FCHA 2WQ7A 2WXKA 2HYZA 3Q15A 1ELRA 1UG3A 2Y3AA 3KEZA 2BF0X 2L6JA 2XRYA 3TAXA 4GZ5A 4BT9A 1ZBPA 1HO8A 5AENA 3O4ZA 3T8MA 2VGXA 2X3MA 2Y4TA 3QARA 3FUIA 4KZ0A 3L17A 4ABNA 4A55A 2X6IA 3D9NA 3O48A 5BT1A 5LOZA 4I1AA 3ASHA 4JL0A 5CMYA 4YNDA 4ANUA 1HH8A 3VLDA 3D9KA 3R7QA 4R7LA 5FT9A 3R7RA 4AP2A 2V4LA 3FH5A 2C0LA 3RRMB 4ANWA 2V5FA 5EDSA 3FU0A 2V0PA 4XI9A 2RD0A 4JW1A 5FQ4A 3T5XA 3P2BA 2LO6A 5JHBA 4H7XA 3MEKA 5FQ6A 4EZLA 5J08A 4F7AA 3ZYMA 2X38A 2Y4UA 1HU3A 1UJKA 4I6GA 2XGOA 4Y6CA 2MHKA 4FLBA 5CCLA 1HE8A 5T3RA 4PS3A 2ONDA 3VTXA 3ZYLA 2KATA 4FU3A 4N2QA 3FUKA 2LSVA 4HOTA 4JHKA 3QKYA 4KMOA 4O6FA 3UT4A 5FZSA 4FA6A 3D3MA 4HXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KM4 A;  3D9I A;  3G2S A;  2DCP A;  1HG2 A;  1EDU A;  1EYH A;  3D9M A;  2DIW A;  3G2W A;  1JUQ A;  4HFG A;  3D9L A;  1ELK A;  3ONK A;  2QY7 A;  5CMW A;  2BF0 X;  3CLJ A;  1UJJ A;  2LO6 A;  3D9P A;  3ONL A;  3LDZ A;  5J08 A;  2L0I A;  2MOW A;  1SZA A;  4JXT A;  3ZYM A;  1HFA A;  1HF8 A;  1JPL A;  1X5B A;  1INZ A;  1PY1 A;  4NAC A;  1VDY A;  4Q96 A;  1UJK A;  2L0T B;  3ZYK A;  3G2V A;  1HX8 A;  3ZYQ A;  1SZ9 A;  1XGW A;  4Q94 A;  3D9N A;  4GZD A;  3D9O A;  1HG5 A;  4FLB A;  4GZC A;  2V8S E;  3G2T A;  3RRU A;  1H0A A;  5LP0 A;  5LOZ A;  3ZYL A;  4FU3 A;  1MHQ A;  5CMY A;  3G2U A;  1LF8 A;  3D9J A;  4AVX A;  1JWG A;  1DVP A;  3D9K A;  1JWF A; 
#chains in the Genus database with same CATH topology
 2J4D A;  3MZL B;  2AJA A;  1N0R A;  3PZ3 A;  1N54 A;  2FO7 A;  4LG6 A;  3TL5 A;  5KNH D;  3E33 A;  2AXV A;  4B8A A;  4NAC A;  4PDX A;  1YMP A;  2WMO A;  5JJ6 A;  3ZXP A;  1N0Q A;  2FI7 A;  3MV2 B;  2J08 A;  5LCW C;  5CEA A;  4JEH A;  4YDY A;  3C98 A;  5AJD A;  1ELW A;  2I6H A;  5ARG A;  3CKC A;  3AG1 E;  2P9P G;  2ZXW E;  4ZFH A;  3ONK A;  5CER B;  5AAR A;  2BTD A;  2NYJ A;  4BSX A;  3HYM B;  1N52 A;  2IEJ A;  2J07 A;  5EIB E;  2ETA A;  2HM8 A;  3J5P A;  4CCA A;  3CVY A;  1WAO 1;  4GML A;  3FUE A;  3SQV A;  3CQC B;  5ENN A;  5JA4 D;  2V4H C;  2WXG A;  2LSU A;  1ZU2 A;  4G2V A;  2JAB A;  1IYG A;  1A5E A;  1O1R A;  4ME2 A;  4GPM A;  3ZYQ A;  4DRX E;  2LUH A;  2Y69 E;  3FY4 A;  1MHQ A;  3KEA A;  3PZD A;  3IEG A;  4JEU A;  1G3N B;  5FQ8 A;  3L13 A;  3ZGQ A;  4G25 A;  3S7B A;  4DLQ A;  1TJC A;  1TNY A;  2EIJ E;  2J9Q A;  1VDY A;  4WWP A;  3ZYK A;  1SZ9 A;  3UM1 A;  2VTB A;  1BU9 A;  2PL2 A;  2PZI A;  4KBQ A;  2R05 A;  2IOS A;  4HOU A;  2XEN A;  3OXL A;  1DC2 A;  4J7W A;  4GTS A;  4WWN A;  2Q7F A;  3L22 A;  4NRH B;  4K5C A;  4DI4 A;  1H0A A;  5LP0 A;  2WVI A;  4GTO A;  3D9J A;  1OWO A;  1XNF A;  2R5S A;  3PRE A;  3B13 A;  2FEZ A;  4MS6 A;  3PUJ A;  3IHV A;  4GCO A;  1GW6 A;  5ENO D;  1HX8 A;  4FP7 A;  3QWV A;  3BG1 B;  2VGE A;  1MQS A;  4BES A;  4U07 A;  4GAA A;  5ENP D;  3PZ2 A;  4B8C B;  4UWH A;  3NQP A;  5CRV A;  3DSS A;  3IBE A;  3QC1 A;  2YQ8 A;  2YHC A;  3FWV A;  3FTV A;  4GZ6 A;  3S7D A;  2WXQ A;  4EPZ A;  3ZFW A;  2FBN A;  3P1U A;  2XZT G;  3AG4 E;  1KT1 A;  3PEU B;  3KS2 A;  2X6F A;  2A4Z A;  4KYO B;  3CVW A;  3EHN A;  4BX8 A;  3ZN3 A;  3PEV B;  4GZD A;  4A3V A;  3ENE A;  4QFV A;  4UWG A;  3Q79 A;  1MYO A;  2P9N G;  1NA0 A;  3NBN B;  2ZGG A;  5CMW A;  4RQI A;  4BX9 A;  1TNU A;  3KSL A;  2CHW A;  2ZU6 B;  1E8Z A;  1X5B A;  3ZXS A;  2WPV A;  1DNP A;  2XGS A;  3E4B A;  1SQM A;  2VGY A;  4IYP A;  3GZ1 A;  3RRU A;  2R17 C;  3PNL B;  4MKT A;  3SBT B;  1SW6 A;  5LCW J;  2IO2 C;  2KZT A;  3FUN A;  4JA7 A;  4FHK A;  5AN8 A;  4CRW A;  3AU4 A;  4GMR A;  2CHX A;  3QWW A;  5AYW D;  5HKP A;  3PVL A;  4DLO A;  3CV0 A;  4AY5 A;  2EIL E;  3LY9 A;  3EHM A;  2XQ0 A;  3FEX A;  5T4Y A;  4KZC A;  4UWF A;  5D2M C;  2HO1 A;  2WXJ A;  1INZ A;  1QQE A;  5KJK A;  1Y6I A;  2WQH A;  1IQU A;  4EBA A;  2V8S E;  2M63 A;  3PRZ A;  3U64 A;  2ZGD A;  2H6I A;  5BNW A;  3SFZ A;  4CGW A;  3ABK E;  3GZS A;  4BWR A;  1EF1 C;  3U4T A;  2DBA A;  5DBK A;  2KCL A;  4KVM A;  3KSQ A;  3TXN A;  3ASN E;  4GZ3 A;  5EYP F;  3SI5 A;  4U0S A;  4TV3 A;  5A7D B;  3Q47 B;  4XX5 A;  4BFR A;  1TN6 A;  5DIZ A;  2DZO A;  5ENT D;  5ENS D;  4GB9 A;  4U0Z A;  2OV8 A;  3DEP A;  2AW6 A;  3RAU A;  3BG0 B;  5BV1 A;  5ANL A;  2P9I G;  4UQY A;  3G2V A;  1WDY A;  3MGB A;  4C0E A;  4LNB A;  2KM4 A;  4DPR A;  2GRR B;  2HYZ A;  2BF0 X;  3Q73 A;  1ZBP A;  4TXR A;  2VGX A;  1N95 A;  3O48 A;  4YND A;  2KBX A;  3R7R A;  4ANW A;  4JW1 A;  3NOG D;  1OCR E;  5JHB A;  3MEK A;  5FQ6 A;  4JB8 P;  2X38 A;  1MJ0 A;  4Y6C A;  4LSZ E;  1N9A A;  2OND A;  2B6C A;  4N2Q A;  5KBA A;  3UIO C;  3C72 A;  3TWS A;  4LUN U;  3ZNG A;  3FUD A;  3BQO A;  2RFM A;  4WWO A;  4ACL A;  2JEK A;  4EZJ A;  4ATZ D;  1HZ4 A;  3SFX A;  2YHE A;  2WMN A;  2E0I A;  5EIL A;  3E32 A;  4CGV A;  3UM3 A;  5D0Q D;  4DI3 A;  1BD8 A;  5G55 A;  2WXH A;  5CEC B;  3JUI A;  2AXZ A;  3DRA A;  4I17 A;  3VTY A;  2MYO A;  1K1A A;  3ASO E;  1NZN A;  1NA3 A;  4I43 A;  4UI9 J;  3EUV A;  4CDR A;  4BEP A;  4EHM A;  2WXM A;  4AV7 A;  2IO3 C;  4ILH B;  4JHJ A;  1MZC A;  3L9T A;  4C48 B;  3R9A B;  4AXH A;  2L0I A;  3LJN A;  3LYA A;  5JHA A;  4UWL A;  1P5Q A;  2WXN A;  4HLL A;  3V2O A;  1RZ4 A;  2I9C A;  4APO A;  4F1P A;  5KJL A;  3CVX A;  4WND A;  3RKV A;  1OT8 A;  3BEE A;  2WQ6 A;  5T8I A;  4I1M A;  1OWN A;  3TJP A;  2QZA A;  4UWK A;  3ZVV A;  3HRA A;  4U0U A;  4G26 A;  2R2L A;  2XEE A;  3DSW A;  1W3B A;  4AEZ C;  4OAU C;  1L5J A;  3EU5 A;  1TN8 A;  3HIZ A;  4HI8 A;  1UN9 A;  2AVP A;  2A5U A;  3DSX A;  3S7J A;  3DPY A;  4O60 A;  4L2Y A;  1K3Z D;  1YYH A;  3EJN A;  3ABL E;  4MRU A;  3IXE A;  5E76 A;  2PM6 A;  2RG8 A;  1JWG A;  3QNK A;  3G2S A;  4J8S A;  1V54 E;  1MX6 A;  3SO8 A;  3AAA C;  3IV0 A;  2EIM E;  4ILG A;  4HVB A;  4EBA G;  3CVV A;  4BY6 A;  1DVP A;  1H2T C;  2IFU A;  4AIF A;  3NZU A;  2VSX E;  4GCN A;  4W9R A;  3EIJ A;  2XPY A;  4F53 A;  3Q7A A;  2R59 A;  1Z3X A;  3FP3 A;  3NB2 A;  4Q96 A;  4JA9 A;  4GA1 A;  3HXE A;  2CG2 A;  3B95 A;  1MX4 A;  4B94 A;  5JJ7 A;  4CZ2 D;  2VJ8 A;  4PS8 A;  3Q49 B;  1ELK A;  3LKU A;  4WAF A;  1Y8M A;  3AG3 E;  3CHQ A;  2P9U G;  4LRZ A;  5G04 C;  5BV0 A;  3ZHE A;  2IF4 A;  2WXF A;  2VYI A;  1WM5 A;  3B7S A;  2XRZ A;  4UI9 K;  3UT7 A;  2X6K A;  4JC8 A;  4O1O A;  4JZY A;  2H6H A;  4YDE A;  2HR2 A;  3AJI A;  3ISM C;  4EQF A;  3MA5 A;  4Q69 A;  3LDZ A;  4G1T A;  1KLX A;  3EHQ A;  5G05 C;  2DYR E;  2ION A;  1TNB A;  4KT6 B;  5FZR A;  4U96 D;  3I5P A;  3V79 K;  4F1S A;  4GTV A;  4HNA D;  3UI2 A;  4AOF A;  3QDN A;  1D8E A;  4TRQ A;  3UTM A;  1NL4 A;  4L9P A;  2R02 A;  3AS8 A;  4GTP A;  4B93 B;  4B89 A;  1S70 B;  1A17 A;  4HOS A;  3LCA A;  4TUU A;  1H6K A;  4WNE A;  3T5V A;  4J8Y A;  3ZU7 B;  4ATG A;  2XGM A;  4XI0 A;  3UIP C;  4YDO A;  4HRM B;  2KXP C;  4CT4 A;  4E6H A;  5BPP A;  1BLX B;  2LXL A;  3TWX A;  2NSZ A;  3CIA A;  4A3T A;  1E8Y A;  1AP7 A;  5BUZ A;  1ZB1 A;  4OYS A;  5D0O D;  1H6O A;  4BET A;  3PZ1 A;  3QK0 A;  2XCC A;  3TG5 A;  1E96 B;  2GRL A;  2YIN A;  1AWC B;  3F6Q A;  2CFU A;  3ASG A;  5EN5 D;  4APF A;  4L7T A;  4WUY A;  3Q4A B;  3CLJ A;  1OWP A;  3Q75 A;  5AQA A;  3HXC A;  3DST A;  2XEV A;  2XS8 A;  2KCV A;  3CK8 A;  4K03 A;  4O1P A;  5ANR A;  2EQX A;  5AQ9 A;  3Q9U C;  3TGO A;  4LEU A;  2BUG A;  2ILR A;  4K0R A;  4YVQ C;  3L54 A;  4CDN A;  5KJM A;  1K1B A;  5EYL A;  1QBQ A;  3PDN A;  4GA0 A;  5EKQ D;  4ANX A;  3B7B A;  2LAI A;  1SA4 A;  1SVX A;  1H19 A;  3HXB A;  3NF1 A;  1IXV A;  3QAQ A;  3JQ0 A;  4HBD A;  5E75 A;  4GU5 A;  5HQ8 A;  3HXF A;  3JCK C;  1TYQ G;  1HF8 A;  4U7E B;  4FLH A;  3QB2 A;  3LY7 A;  4M7C A;  3APF A;  4LNU D;  3RSE G;  2OVF A;  2PNN A;  4N3A A;  4BT8 A;  1OWM A;  4ACK A;  2YNQ A;  1OUV A;  4M3O A;  3ZW3 A;  2WXK A;  3Q15 A;  1ELR A;  2GRQ B;  3BU8 A;  2XRY A;  3SFY A;  3L82 A;  2XEH A;  3E34 A;  3QAR A;  3FUI A;  3D9N A;  1U2V G;  5BXO A;  5BT1 A;  3ASH A;  3UKU G;  4ANU A;  5B1B E;  3VLD A;  3R7Q A;  2V4L A;  3FH5 A;  2C0L A;  3RRM B;  5EDS A;  2V0P A;  5FQ4 A;  2LO6 A;  3ZYM A;  4GTM A;  2QYJ A;  1HU3 A;  4I6G A;  2GRP B;  2XGO A;  3TWR A;  1HE8 A;  3VTX A;  4PS3 A;  3ZYL A;  2KAT A;  5B1A E;  4JHK A;  4FA6 A;  3D3M A;  3G2W A;  2DVW A;  4J8E A;  3W9F A;  2XZD G;  4URK A;  4U95 D;  3MJW A;  4EZL A;  1K8K G;  1E7U A;  1BPO A;  3FFL A;  3FUF A;  1PC2 A;  1IKN D;  3GW4 A;  4CT0 A;  3FDH A;  3CHO A;  1TJF A;  4U8V D;  4BTA A;  1KT0 A;  2A5E A;  3CHM A;  1JUQ A;  2R03 A;  1TR4 A;  5D66 A;  2VQ2 A;  3UM2 A;  4J8F A;  1N11 A;  4YVO A;  4JPS A;  3CKB A;  2GW1 A;  3PUK A;  2C0M A;  1Z3Y A;  1E90 A;  4AJW A;  3HG0 D;  3U9W A;  1N4R A;  2PM7 A;  5KWD A;  3HHM A;  1DCE A;  4FHJ A;  1S0P A;  4UUC A;  2KC7 A;  2CG3 A;  2VGX B;  1FVH A;  3LY8 A;  5CED B;  3ULY A;  2EIK E;  2NC9 A;  4OVV A;  4A1G A;  1QZ2 A;  3FTU A;  3AS4 A;  3X2Q E;  5LFA A;  3FU3 A;  4WNF A;  4LNG A;  3CVP A;  1S64 A;  3S7F A;  2XPI A;  1XGW A;  4ILI A;  3ZRH A;  3CST A;  1RW2 A;  3C5R A;  4WNG A;  3HVE A;  3I3N A;  5A23 A;  4DX1 A;  1IQR A;  2FO1 E;  3E37 A;  5BXU A;  5IY5 E;  3U3W A;  2UWJ G;  1JCR A;  2VSO E;  1U3D A;  4U63 A;  3ZUV B;  5JJT A;  1EPU A;  3L6A A;  3RK6 A;  3FUM A;  1N4P A;  3V2X A;  5KNG A;  1OWL A;  4RG9 A;  1FT1 A;  2OEV A;  2IOL A;  3EHR A;  3G2T A;  4GYO A;  1NI1 A;  3RIB A;  3NOC D;  4C9B B;  4TXQ A;  3C3R A;  3CVU A;  1IHG A;  4LER A;  4UQX A;  4DX7 D;  4I9C A;  1LTX A;  1DCQ A;  2OCC E;  4G8L A;  5C2Y A;  3EIQ C;  3CHP A;  3IKO B;  2FUL A;  2JLB A;  1TNO A;  3FTZ A;  1WY6 A;  3OAW A;  4DX6 D;  3JUE A;  3ML9 A;  3UMV A;  4GA2 A;  1WG0 A;  1E8W A;  5AQ7 A;  1JCS A;  3FTX A;  3SD5 A;  4GMJ A;  3SBS A;  2FF4 A;  4FAD A;  1EYH A;  2DZN A;  4CEM A;  3DPD A;  1UJJ A;  2KZT B;  3ZHE B;  4CYM D;  4HRL A;  3UXG A;  1TEZ A;  1D8D A;  4HI9 A;  1H6P A;  2EIN E;  5FIO A;  3QOU A;  4DX2 A;  3ZEF A;  3VLE A;  2WB2 A;  2CHZ A;  4MLP A;  3D9M A;  3OXF A;  3HDX A;  3Q7F A;  3UIN C;  3UKR G;  2XS1 A;  1FVF A;  1E7V A;  5CBO A;  4YDW A;  3I4G A;  5CCM A;  4J0U A;  4GYW A;  4LCT A;  3FU6 A;  2GGF A;  4I1O B;  4J8D A;  3U66 A;  2I1J A;  3FTS A;  3AS5 A;  3RO2 A;  4HB5 A;  4HFG A;  1HXI A;  2OVB A;  4JD2 G;  3ASF A;  3ESL A;  1HS6 A;  5KJN A;  4TUM A;  1PAQ A;  3CVQ A;  2WXI A;  4N5Q A;  2CFZ A;  4G8K A;  2P9L G;  2OOE A;  4ZHB A;  3MV3 B;  3W9G A;  3V31 A;  3QWP A;  2B0O E;  3CR3 A;  5AAO A;  3RO3 A;  2DYS E;  1LD8 A;  3LS8 A;  5G2N A;  4V3I A;  3ABM E;  3FUJ A;  4BSZ B;  3TWW A;  4ANV A;  2KCK A;  2X6J A;  3N71 A;  3JXJ A;  4OAV B;  4I2Z A;  3WXX A;  3LPZ A;  2V5Q C;  4HRN A;  5FTP A;  2UY1 B;  3UUX A;  3UT8 A;  3ULQ A;  3MYV A;  4JXT A;  4P29 A;  1BI8 B;  5FWQ A;  2J4B A;  2L6B A;  3S2A A;  2ZIS A;  2XPZ A;  4DX5 D;  2I1K A;  2XCB A;  4GTQ A;  3DXK G;  3ESK A;  1IHB A;  2F8Y A;  2WXR A;  4F3V A;  3PNT B;  3SF4 A;  4DUI A;  3FTY A;  3SNX A;  4FC8 A;  1OCC E;  2P9S G;  1U3C A;  3B7U X;  4D10 C;  3CGH A;  4GZC A;  1HG5 A;  4L2L A;  5EX3 A;  4TXP A;  5J90 A;  3PZ4 A;  1OCZ E;  4A1S A;  3D9I A;  2VSN A;  1FCH A;  2WQ7 A;  5FIN A;  2Y3A A;  3TAX A;  4GZ5 A;  3DXM G;  4BT9 A;  2RFA A;  1HO8 A;  5AEN A;  3T8M A;  1KZP A;  2X3M A;  4F6R D;  2Y4T A;  2ZIR A;  4KZ0 A;  4A55 A;  5LOZ A;  1N94 A;  4JL0 A;  3TWQ A;  5JMN D;  1MX2 A;  3D9K A;  3JXI A;  4R7L A;  5FT9 A;  4AP2 A;  2BKG A;  4XI9 A;  1X81 A;  3P2B A;  2HE0 A;  4H7X A;  5J08 A;  2IY0 C;  2Y4U A;  4RLY A;  5CCL A;  4FLB A;  4HOT A;  2LSV A;  2Y1L E;  4KMO A;  3UT4 A;  5FZS A;  4HXI A;  1Z5S C;  4HQD A;  1OCO E;  2QY7 A;  4U8Y D;  3D9P A;  3UPV A;  3MX3 A;  3UX4 A;  3APD A;  1D9S A;  4PUC A;  2E2E A;  4N39 A;  3MKQ A;  4EZK A;  3HXD A;  4HS2 A;  4G23 A;  4I2W A;  3SY2 A;  5CRU A;  3T9K A;  3ULE G;  1EDU A;  5FZQ A;  1S63 A;  4G24 A;  5G05 J;  2MOW A;  3FUL A;  1OXJ A;  3UM0 A;  2AXU A;  1LD7 A;  3CK9 A;  2QFC A;  3EU9 A;  3GYZ A;  2GRO B;  4XKB A;  3IHY A;  5EID A;  4H7Y A;  4GPK A;  4RG6 A;  4K5B A;  2H6F A;  4NIK A;  5C1D A;  2VTB B;  4N3C A;  1UN8 A;  4I9E A;  5AJL A;  4GTR A;  2LAH A;  5EX0 A;  2QYU A;  1BI7 B;  3DEO A;  4PH4 B;  5ENR D;  3JQ1 A;  3EDT B;  3AU5 A;  3URZ A;  3JYS A;  3QJZ A;  4FJY A;  3FEY A;  2P58 C;  4GYY A;  4XEI G;  2AWI A;  3D9O A;  2IQC A;  3FH7 A;  3Q5M A;  3CSF A;  4HOQ A;  3D9H A;  2WXP A;  1YCS B;  3LVQ E;  5G04 J;  5BW8 C;  4Z68 A;  1NFI E;  3R9M A;  3ONL A;  4N5C A;  5FQ7 A;  1KZO A;  1SA5 A;  3KAE A;  5KCM A;  4NQ0 A;  3K9I A;  2ETC A;  1FPP A;  4IRU A;  4XE0 A;  4B0Z A;  4PS7 A;  2WXL A;  3NAW A;  3ZPJ A;  3CVN A;  3FHE A;  3AG2 E;  2IJG X;  1NP7 A;  4QQI A;  3L16 A;  1FT2 A;  4RSY A;  3WG7 E;  3PS6 A;  3I4R B;  3APC A;  4FJZ A;  4XKC A;  2J09 A;  3DSU A;  4Y6W A;  5ARF A;  2Y0B G;  3CEQ A;  1UW4 B;  3VLF A;  3LXU X;  5FJY A;  3ZKJ A;  4U04 A;  1O1S A;  1JPL A;  4IUL A;  2F37 A;  4KVO A;  4I6E A;  1YA0 A;  3DWL G;  2ETB A;  2H6G A;  4RVB A;  3RRN B;  1E8X A;  2MRI A;  5ENQ D;  3G2U A;  2I2O A;  3MCX A;  1H2V C;  4AVX A;  4DK5 A;  1HG2 A;  2BED A;  3PE4 A;  4E85 A;  2F0Y A;  2WM9 A;  3T8K A;  3CK7 A;  2RKK A;  3B7R L;  2P9K G;  5B3S E;  1Z6T A;  3NZS A;  3TWU A;  1O5M A;  4A63 B;  3HVE B;  3ML8 A;  2C2L A;  2J8S D;  2IU1 A;  2OEW A;  4HOR A;  5AIJ A;  4NUR A;  3ZIM A;  3D9L A;  1Q2Z A;  4C0M A;  1SZA A;  5A6C A;  2GRM A;  3CQG B;  4N3B A;  4CDM A;  5HI7 A;  3TXM A;  1QNF A;  3LJ3 A;  4JVS A;  3L08 A;  3Q9N C;  3C3Q A;  2UY1 A;  4N2S A;  3TG4 A;  3FUH A;  3LEW A;  3B7T A;  4MBG A;  2GRN B;  4UI9 C;  4HLE A;  4I6J A;  5M72 A;  4BTB A;  2X6H A;  3PH0 C;  3FTW A;  1LF8 A;  1N4Q A;  3UQ3 A;  3C3O A;  4L1B A;  2BKK B;  2P2C P;  4IN3 B;  1TN7 A;  4FUL A;  4EEC A;  3FU5 A;  4Q94 A;  1H2U A;  2PQN A;  4U8H A;  3CHS A;  5HRY A;  2DCP A;  2VSY A;  5ITZ F;  2NXP A;  4L23 A;  3V30 A;  2J49 A;  1HFA A;  1KPS B;  3J5Q B;  3TWT A;  3KD7 A;  2PQR A;  2LNI A;  4AM9 A;  4X8Q A;  3GZ2 A;  4UQZ A;  3RJV A;  3SZ7 A;  3SHF A;  4G11 A;  4XIF A;  2DIW A;  3TWV A;  3OXG A;  3MKR A;  1PY1 A;  4AY6 A;  2L9B A;  2L0T B;  3RU0 A;  3CHR A;  5CHE E;  3ASD A;  2WXO A;  1OY3 D;  1JWF A;  3FH8 A;  5CBN A;  4J6I A;  3MKQ B;  2F8X K;  4GTT A;  3SGH A;  1TNZ A;  5LX8 A;  4XZ4 A;  4KXK B;  3CVL A;  2XHE A;  3LVR E;  4DJA A;  3Q78 A;  2LXM A;  4JHR A;  3OTN A;  3PE3 A;  4OVU A;  3E30 A;  3DBS A;  1B89 A;  1JCQ A;  1UG3 A;  3KEZ A;  2L6J A;  3O4Z A;  4K5A B;  5AQB A;  4BER A;  4ABN A;  1V55 E;  3L17 A;  2X6I A;  2DWZ A;  3BUA A;  4I1A A;  5CMY A;  1HH8 A;  1O1T A;  5H7P A;  1N4S A;  2QC9 A;  2V5F A;  3FU0 A;  1UOH A;  2RD0 A;  3T5X A;  3DSV A;  4F7A A;  1UJK A;  5HS0 A;  2MHK A;  5T3R A;  4FU3 A;  3FUK A;  4O6F A;  3QKY A;  1QYM A; 
#chains in the Genus database with same CATH homology
 3G2W A;  4LUN U;  2J4D A;  2QY7 A;  3MZL B;  4J8E A;  3FUD A;  1N54 A;  2FO7 A;  3TL5 A;  3D9P A;  3UPV A;  3MX3 A;  4URK A;  2AXV A;  4WWO A;  4ACL A;  2JEK A;  3MJW A;  3UX4 A;  4NAC A;  4PDX A;  4B8A A;  3APD A;  1E7U A;  1HZ4 A;  4PUC A;  5JJ6 A;  2WMO A;  1BPO A;  2E2E A;  3FFL A;  3FUF A;  2FI7 A;  4N39 A;  1PC2 A;  2YHE A;  2WMN A;  3GW4 A;  3MV2 B;  3MKQ A;  2E0I A;  4CT0 A;  4EZK A;  3FDH A;  3CHO A;  2J08 A;  1TJF A;  5LCW C;  4HS2 A;  4JEH A;  4G23 A;  4CGV A;  3C98 A;  5AJD A;  4I2W A;  1KT0 A;  1ELW A;  4BTA A;  2I6H A;  5ARG A;  3CKC A;  1EDU A;  5D0Q D;  4DI3 A;  3CHM A;  5FZQ A;  1JUQ A;  3ONK A;  4G24 A;  5G55 A;  2WXH A;  2VQ2 A;  5G05 J;  2BTD A;  2MOW A;  3JUI A;  2AXZ A;  4J8F A;  3FUL A;  4I17 A;  4YVO A;  4BSX A;  3HYM B;  2AXU A;  1N52 A;  3VTY A;  2J07 A;  4JPS A;  2HM8 A;  3CK9 A;  4CCA A;  1NZN A;  1NA3 A;  3CVY A;  2QFC A;  4I43 A;  3CKB A;  1WAO 1;  2GW1 A;  3GYZ A;  3PUK A;  4GML A;  4UI9 J;  3FUE A;  4XKB A;  2C0M A;  4CDR A;  1Z3Y A;  3IHY A;  4H7Y A;  2WXM A;  4GPK A;  3CQC B;  4RG6 A;  1E90 A;  4AJW A;  4AV7 A;  5ENN A;  3U9W A;  2WXG A;  5C1D A;  4ILH B;  2LSU A;  1ZU2 A;  4JHJ A;  2PM7 A;  2VTB B;  4G2V A;  3R9A B;  4AXH A;  2L0I A;  3HHM A;  1IYG A;  3LYA A;  4FHJ A;  4N3C A;  5JHA A;  4UWL A;  4ME2 A;  1UN8 A;  4I9E A;  1P5Q A;  5AJL A;  2WXN A;  2LAH A;  3ZYQ A;  2I9C A;  4APO A;  5EX0 A;  1S0P A;  4EZJ A;  5KJL A;  2KC7 A;  3FY4 A;  2CG3 A;  3CVX A;  1MHQ A;  2VGX B;  1FVH A;  4WND A;  3RKV A;  3LY8 A;  3PZD A;  3BEE A;  2WQ6 A;  5T8I A;  3IEG A;  2NC9 A;  4I1M A;  4JEU A;  4OVV A;  1OWN A;  3TJP A;  4A1G A;  5FQ8 A;  4UWK A;  3L13 A;  1QZ2 A;  4PH4 B;  3FTU A;  3AS4 A;  3ZGQ A;  3JQ1 A;  4U0U A;  3ZVV A;  5LFA A;  3EDT B;  3AU5 A;  3FU3 A;  4G25 A;  3S7B A;  4DLQ A;  1TJC A;  4WNF A;  3URZ A;  4G26 A;  2J9Q A;  3JYS A;  3QJZ A;  4FJY A;  1W3B A;  2P58 C;  3CVP A;  3FEY A;  4GYY A;  1VDY A;  3S7F A;  4AEZ C;  4WWP A;  2XPI A;  3ZYK A;  1SZ9 A;  1XGW A;  2AWI A;  4ILI A;  3D9O A;  2VTB A;  3ZRH A;  1L5J A;  2IQC A;  3CST A;  2PL2 A;  3FH7 A;  3Q5M A;  3CSF A;  3HIZ A;  4WNG A;  3HVE A;  4HOQ A;  3I3N A;  5A23 A;  1UN9 A;  2AVP A;  2WXP A;  1IQR A;  2A5U A;  2PZI A;  4KBQ A;  3S7J A;  3LVQ E;  5G04 J;  2IOS A;  5BW8 C;  4HOU A;  4L2Y A;  3ONL A;  3OXL A;  4N5C A;  3EJN A;  3U3W A;  5FQ7 A;  2UWJ G;  4WWN A;  2Q7F A;  3L22 A;  2VSO E;  4MRU A;  4NRH B;  3KAE A;  5KCM A;  4DI4 A;  1H0A A;  5LP0 A;  2WVI A;  4NQ0 A;  3K9I A;  1U3D A;  5E76 A;  3D9J A;  1OWO A;  2PM6 A;  2RG8 A;  1JWG A;  4IRU A;  4XE0 A;  4B0Z A;  3QNK A;  4PS7 A;  1XNF A;  2WXL A;  3G2S A;  4J8S A;  4U63 A;  2R5S A;  5JJT A;  3PRE A;  3B13 A;  3ZPJ A;  3CVN A;  1EPU A;  2FEZ A;  3L6A A;  3RK6 A;  3FUM A;  3FHE A;  4MS6 A;  1OWL A;  2IJG X;  3PUJ A;  1NP7 A;  3IV0 A;  4RG9 A;  3L16 A;  3IHV A;  4GCO A;  1GW6 A;  4RSY A;  4ILG A;  4HVB A;  2IOL A;  1HX8 A;  4FP7 A;  4EBA G;  3CVV A;  3QWV A;  3PS6 A;  3BG1 B;  3I4R B;  3APC A;  3G2T A;  4FJZ A;  4XKC A;  1MQS A;  2J09 A;  4U07 A;  4GYO A;  4BY6 A;  4GAA A;  4Y6W A;  5ARF A;  1DVP A;  3RIB A;  1H2T C;  4C9B B;  3CEQ A;  2IFU A;  4AIF A;  3NZU A;  2VSX E;  4GCN A;  1UW4 B;  3VLF A;  3CVU A;  4W9R A;  3LXU X;  1IHG A;  5FJY A;  3EIJ A;  4LER A;  4B8C B;  4U04 A;  4UQX A;  4UWH A;  2XPY A;  3NQP A;  4F53 A;  4I9C A;  2R59 A;  1Z3X A;  1JPL A;  4IUL A;  3IBE A;  3FP3 A;  4Q96 A;  4KVO A;  4I6E A;  1YA0 A;  3QC1 A;  4GA1 A;  4JA9 A;  5C2Y A;  2CG2 A;  2YQ8 A;  3CHP A;  3EIQ C;  2FUL A;  2YHC A;  3FWV A;  3IKO B;  4RVB A;  3RRN B;  4B94 A;  1E8X A;  2JLB A;  2MRI A;  3G2U A;  3FTV A;  2I2O A;  3MCX A;  1H2V C;  3FTZ A;  1WY6 A;  4GZ6 A;  2WXQ A;  3S7D A;  4AVX A;  4DK5 A;  3ZFW A;  4EPZ A;  2VJ8 A;  4PS8 A;  1HG2 A;  3OAW A;  2FBN A;  3PE4 A;  3P1U A;  4E85 A;  3Q49 B;  1ELK A;  3LKU A;  1KT1 A;  4WAF A;  1Y8M A;  3ML9 A;  3CHQ A;  3KS2 A;  2X6F A;  2WM9 A;  3PEU B;  4GA2 A;  4LRZ A;  5G04 C;  2A4Z A;  3UMV A;  4KYO B;  3CK7 A;  3CVW A;  1E8W A;  3B7R L;  1Z6T A;  3EHN A;  3FTX A;  4BX8 A;  3NZS A;  3ZN3 A;  5BV0 A;  3ZHE A;  3SD5 A;  3HVE B;  3ML8 A;  2C2L A;  2IF4 A;  2WXF A;  3PEV B;  2VYI A;  1WM5 A;  4GZD A;  4A3V A;  2IU1 A;  3ENE A;  3B7S A;  2XRZ A;  4GMJ A;  4UI9 K;  4QFV A;  4UWG A;  3UT7 A;  4HOR A;  3SBS A;  5AIJ A;  2FF4 A;  2X6K A;  4FAD A;  4NUR A;  1EYH A;  1NA0 A;  3ZIM A;  4JC8 A;  4CEM A;  3D9L A;  4JZY A;  5CMW A;  4BX9 A;  2HR2 A;  3DPD A;  4EQF A;  3MA5 A;  4Q69 A;  1UJJ A;  2KZT B;  3ZHE B;  2CHW A;  3LDZ A;  2ZU6 B;  1E8Z A;  4G1T A;  4C0M A;  1SZA A;  1X5B A;  1KLX A;  5A6C A;  5G05 C;  3ZXS A;  2WPV A;  2ION A;  2GRM A;  1DNP A;  3CQG B;  1TEZ A;  4N3B A;  2XGS A;  3E4B A;  4KT6 B;  1SQM A;  2VGY A;  4IYP A;  5FZR A;  3GZ1 A;  4CDM A;  3I5P A;  3RRU A;  4F1S A;  5HI7 A;  2R17 C;  3TXM A;  3PNL B;  4MKT A;  3SBT B;  3QOU A;  3ZEF A;  3VLE A;  1QNF A;  3LJ3 A;  5LCW J;  4AOF A;  4JVS A;  2CHZ A;  4MLP A;  2WB2 A;  2KZT A;  3D9M A;  3FUN A;  3L08 A;  3OXF A;  3QDN A;  4FHK A;  4JA7 A;  2UY1 A;  3HDX A;  4TRQ A;  4CRW A;  4N2S A;  3AU4 A;  3AS8 A;  2CHX A;  4B89 A;  3TG4 A;  1A17 A;  1FVF A;  3FUH A;  3QWW A;  4HOS A;  1E7V A;  3LCA A;  3I4G A;  5CCM A;  3LEW A;  3B7T A;  4J0U A;  5AYW D;  4UI9 C;  4TUU A;  4GYW A;  4HLE A;  4I6J A;  1H6K A;  4WNE A;  5M72 A;  3PVL A;  3T5V A;  4LCT A;  3FU6 A;  4BTB A;  2GGF A;  2X6H A;  2XGM A;  4I1O B;  4J8D A;  3CV0 A;  4XI0 A;  4ATG A;  4AY5 A;  4DLO A;  3U66 A;  2I1J A;  3FTW A;  3FTS A;  3AS5 A;  1LF8 A;  3LY9 A;  3PH0 C;  3EHM A;  3UQ3 A;  3RO2 A;  2XQ0 A;  3FEX A;  5T4Y A;  4CT4 A;  4E6H A;  4L1B A;  4HFG A;  4KZC A;  1HXI A;  2OVB A;  5BPP A;  4UWF A;  3ASF A;  3ESL A;  1HS6 A;  2NSZ A;  5KJN A;  2HO1 A;  2WXJ A;  1PAQ A;  3CVQ A;  3CIA A;  4A3T A;  1E8Y A;  2WXI A;  4IN3 B;  1INZ A;  4FUL A;  2CFZ A;  4EEC A;  1QQE A;  5BUZ A;  5KJK A;  1Y6I A;  2WQH A;  4OYS A;  3FU5 A;  5D0O D;  1IQU A;  4Q94 A;  4EBA A;  1H2U A;  2V8S E;  3QK0 A;  2M63 A;  2OOE A;  2XCC A;  2PQN A;  3MV3 B;  3TG5 A;  1E96 B;  3CHS A;  4U8H A;  2GRL A;  2YIN A;  2CFU A;  3QWP A;  3ASG A;  2DCP A;  3CR3 A;  2VSY A;  3PRZ A;  4APF A;  4L7T A;  3RO3 A;  4WUY A;  3U64 A;  3Q4A B;  5BNW A;  3LS8 A;  5G2N A;  2NXP A;  3SFZ A;  3CLJ A;  4CGW A;  4V3I A;  1OWP A;  4L23 A;  3GZS A;  5JJ7 A;  4BWR A;  2J49 A;  3FUJ A;  1HFA A;  1EF1 C;  3U4T A;  2DBA A;  5DBK A;  2XEV A;  3KD7 A;  2KCL A;  3CK8 A;  2KCV A;  4K03 A;  2PQR A;  4ANV A;  2LNI A;  4KVM A;  4AM9 A;  2KCK A;  2X6J A;  5ANR A;  2EQX A;  3N71 A;  3GZ2 A;  3TGO A;  3TXN A;  4LEU A;  4UQZ A;  3RJV A;  3SZ7 A;  2BUG A;  3SHF A;  2ILR A;  4G11 A;  3LPZ A;  4GZ3 A;  4I2Z A;  2DIW A;  4K0R A;  4XIF A;  3SI5 A;  3WXX A;  5FTP A;  2UY1 B;  3UUX A;  4YVQ C;  3UT8 A;  3L54 A;  4U0S A;  3ULQ A;  3OXG A;  4TV3 A;  3MYV A;  4JXT A;  3MKR A;  4CDN A;  5A7D B;  5KJM A;  4P29 A;  1PY1 A;  3Q47 B;  4XX5 A;  4BFR A;  5FWQ A;  2J4B A;  4AY6 A;  2L9B A;  2L0T B;  3RU0 A;  3CHR A;  3S2A A;  3PDN A;  5CHE E;  2XPZ A;  4GA0 A;  5EKQ D;  4ANX A;  2LAI A;  2I1K A;  2XCB A;  2WXO A;  3ASD A;  5DIZ A;  4U0Z A;  4GB9 A;  1H19 A;  2OV8 A;  3ESK A;  3NF1 A;  1JWF A;  3FH8 A;  3QAQ A;  4J6I A;  3JQ0 A;  2WXR A;  4F3V A;  3MKQ B;  3PNT B;  4GU5 A;  5E75 A;  3SF4 A;  5HQ8 A;  3FTY A;  2AW6 A;  3JCK C;  3SNX A;  3SGH A;  4FC8 A;  5LX8 A;  4XZ4 A;  3BG0 B;  4KXK B;  5BV1 A;  3CVL A;  5ANL A;  1HF8 A;  2XHE A;  4FLH A;  3LVR E;  1U3C A;  3QB2 A;  3B7U X;  4DJA A;  4D10 C;  3LY7 A;  4UQY A;  3G2V A;  3CGH A;  4JHR A;  3APF A;  3MGB A;  4GZC A;  1HG5 A;  4C0E A;  3OTN A;  3PE3 A;  2OVF A;  4L2L A;  4N3A A;  5EX3 A;  5J90 A;  4OVU A;  4BT8 A;  1OWM A;  3DBS A;  4A1S A;  4ACK A;  2YNQ A;  1OUV A;  1B89 A;  4M3O A;  2KM4 A;  4DPR A;  3D9I A;  2VSN A;  3ZW3 A;  1FCH A;  2WQ7 A;  2WXK A;  2HYZ A;  3Q15 A;  1ELR A;  1UG3 A;  2Y3A A;  3KEZ A;  2BF0 X;  2L6J A;  2XRY A;  3TAX A;  4GZ5 A;  4BT9 A;  1ZBP A;  1HO8 A;  5AEN A;  3O4Z A;  3T8M A;  2VGX A;  2X3M A;  2Y4T A;  3QAR A;  3FUI A;  4KZ0 A;  3L17 A;  4ABN A;  4A55 A;  2X6I A;  3D9N A;  3O48 A;  5BT1 A;  5LOZ A;  4I1A A;  3ASH A;  4JL0 A;  5CMY A;  4YND A;  4ANU A;  1HH8 A;  3VLD A;  3D9K A;  3R7Q A;  4R7L A;  5FT9 A;  3R7R A;  4AP2 A;  2V4L A;  3FH5 A;  2C0L A;  3RRM B;  4ANW A;  2V5F A;  5EDS A;  3FU0 A;  2V0P A;  4XI9 A;  2RD0 A;  4JW1 A;  5FQ4 A;  3T5X A;  3P2B A;  2LO6 A;  5JHB A;  4H7X A;  3MEK A;  5FQ6 A;  4EZL A;  5J08 A;  4F7A A;  3ZYM A;  2X38 A;  2Y4U A;  1HU3 A;  1UJK A;  4I6G A;  2XGO A;  4Y6C A;  2MHK A;  4FLB A;  5CCL A;  1HE8 A;  5T3R A;  4PS3 A;  2OND A;  3VTX A;  3ZYL A;  2KAT A;  4FU3 A;  4N2Q A;  3FUK A;  2LSV A;  4HOT A;  4JHK A;  3QKY A;  4KMO A;  4O6F A;  3UT4 A;  5FZS A;  4FA6 A;  3D3M A;  4HXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...