1EZ8A

Structure of s. nuclease stabilizing mutant t33v
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ez8A00
1SNQA 2EY5A 2F0WA 3P75A 1EY7A 3HZXA 3R3OA 3H6MA 4HTHA 4KD4A 4QB4A 2OF1A 3QB3A 2SNSA 2OEOA 4H7BA 3NQTA 2PW5A 5C3XA 5J39A 5KIXA 5EKLA 5IODA 3OMCA 1SYEA 1II3A 2PZWA 2PYKA 2F0HA 4B9XA 3MHBA 2EYHA 3LX0A 2EYJA 2EYFA 4KHVA 1STNA 3MZ5A 3RUZA 4KY5A 3MEHA 1A3TA 3QOJA 4HMJA 3C1FA 5CR3A 1EY0A 1EYAA 3MVVA 1EZ6A 4IALA 4K5VA 3NHHA 4EQPA 1STGA 4J6HA 4F8MA 3V2TA 4K14A 3BDLA 5IGDA 5I9PA 5IGBA 1JORA 5CV8A 4DF7A 5C4ZA 1EY6A 2F3VA 2PZUA 2EYOA 1EZ8A 3MXPA 5HURA 2F0SA 5IGFA 1RKNA 4J1MA 5CV6A 3P1HA 1KABA 3HEJA 4EVOA 2KQ3A 2F0FA 2F3WA 4EQNA 2RDFA 4IUNA 4NDXA 2F0DA 3SR1A 5DAUA 3SK8A 4F7XA 1EQVA 1F2ZA 1F2YA 1SYDA 1IHZA 2KHSA 2PQEA 1SNMA 5C6AA 4PMBA 5HGTA 1NSNS 1SNPA 3NK9A 5EGTA 4ID6A 3SK6A 1STHA 5E3FA 3D6CA 4KY7A 4N9TA 2ENBA 1F2MA 3QOLA 4B9WA 5ISRA 2EYPA 4K2LA 2F0QA 2PW7A 4WORA 2F0JA 2SOBA 4DU9A 1EYCA 4EQOA 5IGGA 3OSOA 4LAAA 4ZQ3A 3TP8A 1EY8A 1STYA 3SK4A 3TP6A 3SXHA 2F0IA 3ITPA 1A2TA 4K5XA 2F0UA 5I9OA 1TT2A 2F0NA 5JAVA 3NXWA 1A3UA 1KDAA 2NUCA 3NUCA 4KJOA 4KY6A 1JOKA 1TR5A 1SNOA 2O4XA 1EY5A 3D8GA 4NMZA 1KDBA 3SHLA 1EYDA 5C3WA 3ERQA 4MIUA 5KYIA 4QF4A 4QMGA 2EYMA 3C1EA 1STAA 1ENCA 5C5LA 2RKSA 4KD3A 4OL7A 2HQEA 3DMUA 4IZ8A 5C5MA 3TP7A 1EY9A 5CC4A 1SYBA 2EYLA 4K2KA 5K5PA 1NUCA 1SNCA 1EY4A 3OMGA 3TP5A 5KEEA 2F0OA 2QDBA 2WACA 4I65A 4K5WA 4DFAA 2F0KA 4R8NA 4WRDA 3OWFA 5KRUA 1JOOA 4KV6A 5IIFA 3U9OA 1TQOA 5EKKA 5KYLA 2F0LA 4PMCA 3NP8A 3D4DA 4RKBA 2LKVA 4YIJA 5E1FA 3TMEA 5IOCA 4K8JA 2EY1A 2EY2A 3VA5A 1A3VA 4KJNA 1ENAA 4ME5A 4ZUIA 3SK5A 3T13A 4S3SA 1SYGA 1U9RA 2RBMA 5I6WA 5J22A 5M9OA 5CV9A 3D4WA 1AEXA 3EVQA 5I6YA 1SNDA 3PMFA 3T16A 4TRDA 1SYCA 4NKLA 2F0MA 5DEHA 2SNMA 2EXZA 5IGEA 4ZUJA 5JOBA 4RKLA 2OXPA 3E5SA 1JOQA 2PZTA 4N9PA 2F0EA 5CV7A 1KDCA 5F2DA 4NP5A 1SYFA 3BDCA 2F0TA 1STBA 2EY6A 5NUCA 4PNYA 4DGZA 3DHQA 3S9WA 5IGCA 4ODGA 1A2UA 5CV5A 2F0VA 3EROA 5CV4A 5C4HA 5J1ZA 2M00A 2F0PA 4G57A 4K8IA 4KTAA 4E6IA 4K6DA 5CGKA 5KGUA 1KAAA 2F0GA 4HMIA 3EJIA
chains in the Genus database with same CATH superfamily
2ATWA 1BVSA 5JJIA 2E8GA 4ZRZA 2ID0A 1D7QA 5ELBA 2N78A 1LT5D 1AH9A 4JI4L 1B1ZA 2IX0A 5FJ8H 1TS3A 1SDFA 4JVZA 1S40A 3MEHA 4LF7L 2FMCA 1J9OA 2NN6I 2NTSA 4X62Q 5IP9G 4FF1A 3MEFA 3MC0B 5K36H 2GN5A 1DGSA 5CV8A 4A3EH 2L15A 1YZ6A 4KHPQ 5CORA 3IL8A 2IWHA 2PMZE 4RGTA 2PQEA 4TVAB 2I07B 1B44D 2E76C 1SNPA 1GUOA 1PYWD 5T1IA 1HJPA 3CRKC 5E3FA 1I50B 4N9TA 3KUPA 3QOLA 4IJLA 4ZYSA 1CKMA 1TU2B 3D4RA 2CW0C 3RD4A 3TP8A 2IX1A 3MTSA 4GNXA 3IKJA 3T53B 1EIHA 2G5DA 3K59A 1HHVA 1WTWA 4JBMA 4HIOA 1EIFA 1KDAA 3PO3G 3F2DA 1WCMB 4FNFA 1Z47A 1AE3A 1WJJA 3ZYYX 1KHIA 2CKZB 4RH6A 1PRTC 4P75A 2IX3A 1Q81C 1PH1A 2K05A 2E75C 1HTLD 1U5KA 2HDLA 2BDNA 3X3MA 4KLKA 4LF6L 4X6AH 4CKEA 1CZGA 1VQHA 5CV9A 5JPMC 1JWUD 1SNDA 1SMXA 1F77A 2Z9HA 4G7HC 4A3DH 1Y8OB 3VR4A 4ZUJA 4JI7L 2E2HH 1YNND 2LFNA 3FHWA 4PNYA 5IWAQ 3STBC 3L2PA 1LACA 2RHQB 3JAMi 1AW7A 3GO5A 4L5RC 3KF8A 4AH6A 4C3HH 1LABA 2RVLA 5JEAH 4U68A 2BA1A 2BA0A 2A74C 1GKHA 4UAIA 5BN5A 2R92H 2OEOA 1E24A 1W3SA 2QKIC 4P2CB 4XYOA 4DR5L 1EU4A 1JR0D 1SYEA 2Z6KA 3LX0A 1CQFA 5COYA 1DONA 4UDUC 2Q8IB 4F87A 1JJCB 4X3SA 1B9NA 1K9MC 5EQ0A 3F2CA 2R92B 3UDFA 3PUXA 1K8AC 2CFMA 2RCNA 1YVCA 2IHEA 3RLNA 1FVIA 2Z6BA 5FLMH 2X69A 4IUNA 1NTGA 3PQIA 1JB3A 2BE5C 3AYHB 1V1PB 1HQRD 2AMCB 1X32A 3SK6A 4B3RL 3GTQH 4QCLA 2F0QA 4JBKA 4JOIA 4DU9A 5BN4A 3DWQA 3H3VC 4WJ4A 1TS5A 4BY1B 1VQDA 3KF6B 3O13A 3VR2A 1Q86C 2NUCA 2B2WA 2WAQE 2O2LD 3TSSA 4KKSA 1C4QA 4JI1L 2A6EC 3RZOH 5C5LA 1KLGD 1FYCA 2L11A 3BS1A 3W3AA 2CQAA 5I2YA 3GQBA 1QCBD 4LFCL 4BBSB 4LJZC 3P20A 5AJ3L 2F0LA 1ONLA 4OO1I 3MXNA 3CCRA 1S5DD 2EY1A 1Y8PB 4OHJA 1ILQA 3CQZH 3J81i 4ME5A 3GV6A 3OYYA 2F52A 1R9TH 2K32A 1HPCA 2LY7A 3KK7A 4DUYL 1XJVA 1QJOA 4TRDA 1LTAD 1SYCA 5DEHA 2KA7A 1PTOF 2OXPA 1SN8A 1X3FA 4A3MH 2VUMH 1E2ZA 1STBA 2HIVA 1IBML 1QUQB 3HOWG 1NBWA 1A2UA 5E7NA 3V05A 4L5QA 3W2DA 4A3JB 4DV5L 2XRQD 1YHAA 1TWCB 1RD9D 2NVQB 1TWFH 5J39A 4BY7B 4A3LG 3I91A 2GVAA 4L6TB 4DKAC 1LTID 2Q2HA 4G7OC 4KN7C 4LF8Q 4HJ8A 2N3SA 1Y1WH 2E74C 1HNXQ 2SDFA 1VQ5A 4BA2I 1KLUD 1IL2A 3DWAA 2VS1A 1CSPA 2CW0D 4DF7A 4YWKA 4OGQC 4HJ5A 1GUTA 1E1OA 1TWAH 3S16H 4APVA 5E4XA 4GLVB 1SAPA 2V4DA 3TN2A 1N33L 4GKKL 2EIFA 1Y1WB 2K5HA 1SROA 4ID6A 2ICIA 1SRUA 1H9SA 3S2DH 3I4NB 4IN3A 3GTPB 4NW2A 1PFMA 1AZQA 3MFYA 4WORA 4DR2L 4LF7Q 5M3MH 1HXYD 1PRTD 1K3BC 1STYA 4F88A 2F0IA 3KYHC 4IQZA 3H15A 3K5MA 3Q23A 5C4XG 4MN3A 1J5EL 2N88A 1B70B 3KDFB 3A7LA 4R8NA 2IPKD 3J7AV 2OCEA 3ERQA 4IFDH 4KI0A 1I4GA 5C44H 2UXDL 1MBYA 4DV0L 1QZHA 2L12A 4NB3A 4LMQD 2K5DA 4QY7A 3I4MG 4QL5A 4GOPB 1QG7A 4CBVA 4KKTA 5GQOA 4DFAA 1SJHD 4DXGA 2Z1CA 3JAME 1ASYA 2E2JB 5M5YH 3HOYG 4A3IB 1PFBA 2B39A 3STBD 3TMEA 5C44B 1E2WA 4KK7A 1N32L 1WYDA 1OO9B 2PCFB 3S2HB 3CCVA 3R2TA 3HOVH 4ZKBB 2EJMA 2HD3A 1QOHA 4OWWB 2XSCA 2Y0SG 5NUCA 2I5MX 1XMQQ 3TDQA 2N55A 4ODGA 1IBKL 1Y1VB 5CV5A 1I3QB 3T56B 1I94Q 1BBUA 4DUZL 4E6IA 1GJXA 1VQOA 3CCJA 4HMIA 4WJWA 1SNQA 5JJKA 1WVLA 2KBNA 1D5MC 3OIQA 4KD4A 4LF6Q 1UE6A 3DWPA 1X56A 4A93B 2WIIB 2OTJA 3RR5A 1N36Q 2GVBA 4A4IA 3A8IE 4QUCA 2LSSA 2VQEQ 4JI2L 2H1EA 1Q1BA 2BE5D 2LMCB 4JI7Q 2R3ZA 1VF5C 4GLAC 1MKHA 1YJWA 3KLRA 2F1MA 1SEBD 5CR3A 1EZ6A 3S17B 2FJ2A 1SLJA 3MXUA 3I56A 1XPRA 1OXVA 2WKCA 1EWCA 1TVXA 4PZ7A 1ET6A 1FJGL 4LF5L 4Y7NB 3G6EA 2WFWA 4IPHA 2MP1A 2PPBC 2JSOA 1WTOA 3OWEB 1STHA 2F4IA 4DR5Q 2JJQA 1CKNB 2A6ED 2HIXA 3S1MH 2KCCA 1FNWA 3SEBA 4A3KG 5C4JH 3HOXB 5M3FB 2SOBA 3NTIA 2F03A 2B63G 2EJGC 4LF4L 1XPUA 5JEAJ 3VYRA 1BUVT 3KOJA 3V2TA 4BA1I 3J81E 1G6ZA 4YCUA 1EYDA 4RAUC 2TMPA 1S72A 4C2MH 4DV4L 1IW7C 1PH8A 1IYUA 1STAA 3CCSA 2NVXB 1B3AA 2A68C 3GTJB 2EYLA 1NUCA 3OMGA 1HR0W 1L1OA 2F0OA 4K0KL 1KD1C 2K52A 4HSVA 1AFPA 3CCLA 1GUNA 2ZTEA 4IOAA 3LWEA 3HOUH 4RKBA 3VR6A 3GTGH 3FDTA 4JOIC 3VA5A 4DV7L 4EGVA 4C3IB 2ZXOA 5IT9c 1VQNA 3GTLH 2QA4A 3EVQA 2M2LA 2RCFA 4Q5VA 4JI1Q 2QEXA 1DOMA 2MHVA 1QE6A 2B2WC 2JXMB 4NXNL 1PA6A 1JOQA 2YYZA 1PDQA 3VR3A 2AQ3B 4LNQA 1W2BA 3VA7A 3A8JE 1CUKA 3GTGB 2HT1A 4G7ZC 3DEOA 1E0BA 1JC7A 1I6VC 1VQEA 4LFCQ 2VL6A 1XXGA 3EBEA 3K6OA 4M8AA 5AJ3Q 1RL2A 3M3YH 2NN6G 4A3BG 4J15A 1EY7A 3N6RA 1SE4A 3R3OA 2C9OA 2JA6B 4QB4A 2K28A 5C3XA 3OW7A 1DOLA 1PH4A 5C3EG 2ZM6L 3PO2B 2NZ1D 4DUYQ 2HCIA 3W1BA 4JK1C 2R7ZH 1ESRA 1STNA 1A8VA 1RIPA 3Q24A 1LTLA 3I7FA 5LMNW 5LMNL 3HOZH 5IE8A 3MVVA 3CCUA 1YHQA 1DZ1A 3AU7A 1EEFD 2BOSA 3D6WA 5C4ZA 2PZUA 2EVBA 4R1JA 1T5EA 5IYDG 4DV5Q 1RKNA 1B53A 3D3RA 3PIO3 2XRSD 1NR2A 1F2YA 1IHZA 2Q2IA 2AUJD 1A63A 2BH2A 3L9AX 3NBIA 3L3OC 5DNFA 3NQIA 1PYSB 5IT9L 4POGA 3CCMA 4JYAL 1SXTA 4AYBE 3OIPA 1B50A 2NVYH 1MSHA 3T1HL 2HUGA 3SK4A 3SXHA 2KECA 3U4ZA 1BCPC 3ITPA 2B8GA 1JE5A 1IKMA 5JAVA 4B3TL 5EBCA 1JOKA 1TR5A 3U9SA 3H94A 2MUYA 1MJCA 3KJPA 2EYMA 3C1EA 4P71A 2RKSA 4KD3A 3DM1A 5LL6X 5C5MA 3QR8A 1A6XA 4LF9L 2EQSA 1PTOH 1V9PA 4DR2Q 2A8VA 3QO2A 3PUVA 3ND8A 1RJTA 4DV6Q 3T1YL 3PO3B 4V190 4B3SL 2IJ0A 2AWNA 2Q2UA 4ZK9B 2WV6D 3M4QA 2UXDQ 1M1KC 3I73A 2K5WA 2NVTB 2PNHA 5ELFA 3HKSA 4B08A 4DV0Q 5KNBA 4UY8C 3GTKB 3D0FA 4DAPA 1LLRD 4QQBX 2IT1A 1NNXA 4DN4M 1N34L 3HFZB 3A55A 3PSIA 3FKIG 2Z8LA 3EROA 2E2IB 3K81C 1DCZA 4DV3Q 3BYYB 1IL8A 2AWOA 4JV5L 1VQ8A 2JEAI 1YIJA 2JA7G 3P75A 5D14A 3RZDH 4UP8A 2MJ8A 4Y52H 2FXQA 3NPPA 4FO2A 4IFDJ 1N32Q 1QNUA 5BR8Q 1WOCA 3K5NA 2HHHL 4RHRA 3S15H 2F0HA 1CT1D 2ICEC 4ME3A 4XYQA 1TY0A 1EYAA 2JEBI 4GNXB 1IBKQ 1CA6A 2X6LA 4P73A 4DUZQ 3BDLA 5HY6A 3PIOA 5IGBA 1EY6A 1EZ8A 1GHJA 2JN4A 3GTMB 1YJNA 1HQMC 1LTBD 3RN2A 2I5LX 3WDNA 1R4QB 1YNXA 4JI2Q 1IW7D 4IJHA 2KJXA 1F2MA 4IFDI 3E3XA 4YCVA 2A68D 4LAAA 2WB1E 5EPJA 3UI2A 3A54A 1I50H 2LS01 1KC8C 4LFBL 1D6EC 2KVMA 1XNQQ 2R7ZG 1TS4A 3ULLA 3NTKA 1EY5A 1Y8NB 4LF5Q 4DV1L 2B2VA 4OO1G 4HIMA 1F9RA 4DK6C 3I4OA 3I72A 5M5XB 1EFWA 1E2VA 1C9OA 2VB3X 4FXGC 1D1KA 3ULJA 1N9WA 1WCMH 2CH4A 3ERSX 1I6HB 1G51A 1NY4A 1LT6D 3PIPA 3J7A5 1UE1A 1GHKA 1YI2A 2NBFA 3KF8B 1C8CA 2A73B 1K8OA 1Y14B 1PFSA 2XGTA 3DXJC 3DM3A 3J80L 5GAEC 4CDDC 4A3CH 4PQXA 1U9RA 2K33A 1WD0A 1JCKB 4V0BA 4DV4Q 1T5XD 4IPDA 2SEBD 1S5BD 5FOBB 2WAQG 5F2DA 2I5HA 3S9WA 2R6GA 2EY6A 1TWHB 4DNIA 1HFNA 4BBRB 1WTRA 1HA5A 2CCZA 4RFBA 2F0PA 1UWVA 3CRLC 3CXCA 1L1OC 2K5QA 2RDHA 4TQUS 4CKCA 5JVH3 1S3OA 2HCCA 1ICWA 4A3FG 3FPUB 4H7BA 4HIKA 1VQ7A 3B6YA 3OMCA 2NZOA 3ND9A 4EQ5A 4NXNQ 2FHTA 3H09A 2CWAA 2N8NA 3HOWB 1P8LA 1JQYD 4GN4B 1HFGA 2RA4A 2MFIA 4EQPA 2F4VQ 4OIKA 4C3JG 5I9PA 3TZDA 2UUCL 1ESFA 4ABNA 1BCPD 2KQ3A 1Q7YC 1M8AA 1E3PA 3NENA 2O5JC 1XWEA 3S14B 5IYBH 4IUPA 1K83B 5EGTA 2ZM6Q 5LMUL 1KNEA 2J7ZA 4KY7A 3T4AC 1L0YB 2R93B 2EPBA 1FGUA 2PW7A 2K01A 2LXJA 2E2DC 1F9SA 5LMNQ 3P7JA 1LT4D 1YEZA 2D5DA 3BVMA 5A2QL 1TT2A 5JVG3 1XTDA 4X65L 1OXUA 4K6LA 3HS0C 4NMZA 4GKJL 2QF7A 3F2UA 5C3WA 4MIUA 5KYIA 1CKOA 3K58A 4BY1H 1ENFA 1O7ZA 1T9HA 1ENCA 3F8TA 4DR3L 4JYAQ 1GO3E 1X55A 1SYBA 5DM63 4PG3A 1WFQA 1JB7A 2PI2E 4QGUA 5KNCA 1L0XB 1ASZA 5IIFA 1TQOA 5C4XB 2CHBD 3BVGA 2ZTDA 3U50C 1A3VA 4L5TA 4BBSH 5FJ8G 4B3TQ 3ONAB 3PV0A 1IYVA 1CM9A 1JE4A 4I7ZC 1JWMD 3E9HA 3G71A 2F0MA 2KCMA 2SNMA 3FMCA 4ULLA 5GROA 3I4MB 4BXXH 5K36G 3M4YA 1VQMA 1B8AA 1HZCA 4XQQA 3M85A 3RNUA 4A3EG 3BDCA 3DHQA 4GN5A 1XNRQ 4R4OA 5IGCA 5EAYA 4OWTB 2VB2X 4LF9Q 4R4IA 4XDXA 1BBWA 1FL0A 1FNVA 2F0WA 1G2SA 3HZXA 4GLXA 3I90A 5EJWA 3T1YQ 1WTHA 1WTXA 4B3SQ 1D1IA 2PW5A 4A3JH 3QG1A 5IYCH 5DLQE 3G6JB 2MPMA 2KEDA 1EIGA 2ZXPA 4ZKCB 2JA9A 2EXDA 1TWCH 1JWSD 4LUVA 5I2XA 2NVQH 5FO7B 1WD1A 2PNRC 1N34Q 4BY7H 4A3CG 1Q12A 5HURA 4HEDA 2OQKA 1ICFB 1U4LA 4JV5Q 3E6ZX 2F0FA 1RDPD 5C0XJ 4XQNA 3CAMA 4UPAA 1CK1A 4DK0A 3FP9A 1SYDA 3HKZB 4RGNA 1VQPA 4NXML 1V1PA 4YHHL 2HHHQ 2ES2A 1PH7A 2RSNA 1XTCD 1S5ED 3SGIA 5FKAC 2KENA 1YNJC 1KRSA 2RF4A 3I4NH 3Q0AA 2UXBL 3KF6A 3GTPH 1G291 2UXCL 4A3DG 1H9MA 3R8BA 2D0OA 4M1UB 3NUCA 4L63B 1HZAA 1PH3A 4P74A 1FR3A 1BOSA 1LTTD 3I55A 3KLWA 4JI4Q 3FRPB 5C0XI 4C3HG 4A3KB 1RCVD 1K0SA 2JYOA 5JEAG 1OXXK 1EWHA 4XIGS 2B63B 5CBEE 4OWXB 1BR9A 2M9VA 3E0JA 5KRUA 2R92G 1JOOA 3VYTA 1KRTA 3AFQA 4DR7L 1J8IA 1LM0A 4PMCA 2LKVA 3J80i 1JT8A 1HNWL 2AQ1B 2L4NA 1HUNA 4R4TA 5FO8B 4RGOS 4PZ6A 5ELCA 2E2JH 4DV1Q 4A3IH 4YY3L 1FD7D 4A3GB 3NBHA 5JOBA 3VDYA 1X3PA 3E5SA 1VQGA 2K04A 2F0EA 2B2VC 2NTTA 1SYFA 3TS0A 4DR6L 3S2HH 1PTOC 1Q90A 1CHQD 1VQJA 5FLMG 1MGSA 3H0GB 1HZ9A 1RTOA 5T1GA 1DYQA 1V43A 1WTQA 3BZCA 1VQ6A 4FP5D 2EDGA 3EJIA 1Z6HA 2EY5A 1A62A 3OHXC 1Y1VH 3LWUA 1I3QH 3UDGA 2QEJC 3CP0A 1LO5D 3F2BA 1PZJD 5FK9C 5IT9E 1GOZA 4YWLA 4B9XA 1H9RA 3MHBA 4ZLTF 1UUPA 4A93H 3BDOA 2JA8B 3NTHA 1EY0A 1V1OA 3NELA 4RGMA 4CGYB 2K75A 1GD7A 4LUZA 5HGQA 3CC2A 2F3WA 1BDOA 3K7AB 1ML0D 2B2UA 3S17H 1PRTB 1I4QA 4N8FA 5C3EB 3IAYA 2EJFC 5HGTA 1NSNS 3SE0A 4AQYL 1G6PA 1HH2P 3D6CA 2VY3A 4Y7NH 2PQAB 1L1OB 1IKLA 2ALYB 3NE5B 5M5WB 3J81j 4FXKC 4K5XA 2XTIA 1LV9A 4RCOA 3HOXH 1IZ6A 5M3FH 3KDFA 4C1NK 5LHY1 1EOTA 3V96A 2AUKA 4A3MG 3M4OB 2VUMG 4RMFA 3LNNA 4HJAA 3ER0A 2YU9B 1I4HA 1VQFA 4IZ8A 1TXYA 1B9MA 1B3QA 4MTKA 4PZ8A 5LMUQ 1BF4A 3C2PA 5K5PA 3L7ZC 4HIDA 2WACA 4L8JA 2RQXA 1XYIA 2NVXH 1WTPA 3U9OA 1ET9A 1EU3A 3GTJH 4JBJA 4AYBG 4RG1A 4YIJA 5E1FA 2I0QA 3LGJA 3OOCA 2VNUD 2ZJRA 1EQQA 1ENAA 3SK5A 4S3SA 2CH4W 3BZKA 4GKJQ 5I6WA 3NEMA 1Y1WG 3T16A 5ELOA 4RKLA 4C3IH 4DR3Q 4R9WA 3R2IA 4NPSA 4B3RQ 3K80C 1HR0L 3M7NA 1VQBA 1U4MA 4G57A 3F1ZA 3AMUA 4DAMA 1NMFA 2JA5B 3S1QB 2MO1A 4LUOA 5G3LD 1GUWA 2RHSB 2B3GA 3URYA 1I5FA 2KUMA 5M3MG 1BNZA 1SFOB 4X64L 4HAEA 5DM73 1YJ9A 3CD6A 2EYHA 4KHVA 2JA6H 2YTVA 3I4LA 1X54A 2J4XA 3S24A 1PH5A 4ILWA 3RLOA 3GTOB 1TKWB 2KHJA 3KBGA 4RCNA 3PO2H 1UNSA 3PCOB 2ZJQA 5IGDA 3KLSX 4IFDG 4A3IG 2JP1A 1Z7TA 1G8ZD 5C44G 5CBAE 2DUDA 2F0SA 4DR4L 2JA7B 4N8X1 3P1HA 1YNJD 3CHBD 3NSWA 2QGQA 2RDFA 2F0DA 3T51B 4YWMA 3CMEA 1SE8A 4O42A 1CKNA 1TS2A 1PH2A 1RTNA 5IWAL 3VR5A 2F0JA 1EYCA 2A19A 5E4WC 5IGGA 3RN5A 4HJ7A 1IBMQ 1EY8A 1OXSC 3TP6A 3HKZE 2KOLA 1KNAA 2VZAA 3ULPA 3H91A 3GP7A 2CQOA 2YTYA 4H02A 3HOVG 5D3IB 3NXWA 4BS9A 3J80E 4FF2A 5IP9H 1H9KA 3HG9A 4B3ML 1KDBA 4O2DA 4A93G 1X3QA 5EPKA 1CSQA 4KN4C 4OL7A 3DMUA 4YHHQ 2UUAL 1O78A 2WINB 1NR4A 1D8LA 4I65A 1UEBA 4XT3B 4KKUA 1YBYA 2K5NA 1PTOD 1MI2A 1VQ9A 4CJ1B 5IOCA 1SE2A 2BH8A 1SBBB 5ELDA 1EQRA 3S1RB 1DJRD 4BWGB 2RBMA 2WB1G 1GXDC 3D4WA 3G48A 2F3IA 4NKLA 3TREA 1N33Q 1RHPA 4GKKQ 2JK8A 3Q22A 3PO3H 3TQYA 1L0WA 1KTKA 1VF7A 3W5OA 1E1TA 2XWJB 1Q3LA 4N9PA 1VQ4A 2XIWA 3L0OA 1LT3D 3CPFA 1O7LA 3S1NB 2HQLA 4OX9L 1NCVA 2ZJPA 2NVTH 3GTKH 1HNZL 4DR7Q 5CGKA 4P72A 2TSSA 2H5XA 1J5EQ 2XWBB 3UDIA 2JE6I 1HNWQ 1FNUA 2OF1A 5C0XH 2E2IH 3NQTA 3PUWA 2Z4HA 3EA6A 5EKLA 4JI0L 1EUJA 4X66L 1KIXA 1HRJA 4DAYA 4JBWA 1Y69U 3TS2A 2NZHA 2WAQB 3RUZA 4KY5A 1A3TA 3BG3A 4CKBA 1I4XA 4DR6Q 1SR3A 4IALA 4K5VA 1A15A 1STGA 2WP8J 3DEPA 5A2QE 4OONA 1VQLA 4C3IG 4A3FB 4EQNA 1TWGB 1EQVA 1YITA 1PZID 4O1NA 1PHJA 4C56C 3GTMH 2B2TA 2G9DA 1Q8KA 4B9WA 3HOUG 3GDEA 1ZKOA 1DXMA 4ZQ3A 3KLSA 3QIAA 4C3JB 3CC4A 3J80c 1OXTA 4A75A 3WOFA 2IL8A 4H44C 2K7VA 2PI2A 2ZTCA 2DJFC 2JA6G 3QWNA 3BYTB 4MZ9A 2K1BA 1HZBA 1AP0A 2OTLA 1PRTF 4IUTA 4X3KA 4AQYQ 1EY9A 1X6OA 4K2KA 2B2UC 1HNXL 4J8QA 4MNOA 1O7IA 4K5WA 5M5XH 3CCEA 2R7DA 2MNAA 4HCEA 4PMWA 3TRZA 1U0LA 1I6HH 2MGSA 2UU9L 4XXEA 2N49A 3CF5A 2K4KA 4L5SA 1FJGQ 2MQHA 4JI3L 5I6YA 1AEXA 2DNEA 3HOZG 2L5TA 1FGBD 3I70A 1QVFA 1D5XC 1W6JA 1KDCA 5CV7A 2C5CA 4JG2A 4KHZA 2A69C 3PUYA 3MWYW 4GOPC 4CDFC 4LF4Q 3HGBA 4RA8A 3C3LA 4HR7B 1TWHH 2ZXRA 4MHEA 3UDXA 1LTRD 4FVMA 4BBRH 2Q2TA 4JW0A 3OTOL 1VQIA 3EFXD 2LXKA 1PV4A 4A3EB 1PLFA 2D0PA 1I4RA 5JPNC 4DK3C 1HR0Q 4F7XA 4K0KQ 4K14A 1K28A 4IOCA 3HOWH 4J1MA 1YHBA 3OPOA 4EX5A 1TIID 2OQ0A 4O0AA 3VYSA 3J7YW 4DV7Q 1SSOA 1SNMA 3VYUA 5EKIA 1W6KA 4X64Q 1XMQL 3A5UA 2EYPA 3ZJYC 1I94L 3S14H 4A3LH 2X6GA 4EQOA 1O7YA 3N52A 1VMPA 1K83H 5C0XG 1Q46A 1F2LA 4GS3A 4POFA 1E7ZA 5I9OA 3UE1A 2R93H 4OELB 1DOKA 4DR4Q 2AKWB 2O4XA 3D8GA 1N36L 2VQEL 4ZCKA 4H13C 4R8IA 3EN2A 2L9HA 4CHTB 1SNCA 5IY0A 5TSSA 3GD7A 3J7AF 2EE1A 1C0AA 2F0KA 2RSOA 5CMDA 5KYLA 4WJ3M 1XPOA 4HJ9A 2L0CA 3I3CA 4JI6L 3MXNB 4A3DB 4K8JA 1WI5A 3KBXA 4R4CA 2AQ2B 4GN3B 3MXGA 2E2HB 3H3VI 4B3MQ 1O80A 5C4XH 4XTCS 2ASBA 2YTXA 4JCVE 3M4PA 4C3HB 1OTCA 1S4ZA 2UUAQ 3KFUA 4QUFA 2D62A 1C7YA 2KHIA 4UP7A 5G3LF 2EZVA 3R93A 4IURA 3IFTA 5CV4A 3T1HQ 2M00A 3I4MH 4K6DA 4FXDA 5KGUA 2QILA 1KAAA 3AFPA 1EWIA 1GM5A 4HTHA 1H95A 5A35A 3M7GA 1J6QA 3HOYH 4GZYC 1QVCA 5JJLA 3Q8DA 2Z0SA 4A76A 4LW1A 1BCPB 1EFID 1QB5D 1QVGA 1X65A 2D9UA 3SVMA 2L55A 1B2TA 2R7FA 4IUQA 5J3BA 1RF2D 3NHHA 5KNDA 4J6HA 4OX9Q 1ZYRC 5ELNA 2B2YA 3HOYB 1HNZQ 2EYOA 5IGFA 1MIUA 5CV6A 1Q82C 3JC66 4EVOA 4DK1A 1K3RA 3A0JA 3GTQB 1WCMG 1H9JA 4DR1L 1LYLA 2CWPA 4JI0Q 4CDEC 4X66Q 2QCPX 1DM0B 1CZWA 1M90C 1L2FA 1H9SB 1N8RC 2Y0SB 1SMYC 1U4RA 4OIJA 5D65A 1EIYB 4BBRG 4YCWA 4DV2L 3K8AA 2J0TD 1LUZA 2C35B 3RZOB 1AE2A 4KMUC 1V1QA 2F0NA 4KY6A 3SHLA 1VS0A 2KEEA 4QF4A 3AB9A 1AZPA 3NBHB 2HQEA 4TSSA 2Z4IA 4ALPA 3G4SA 3TEHB 3PF5A 4U673 4JI8L 3CPWA 3TP5A 2QDBA 2IW3A 3CQZB 4WRDA 4ZAIA 1PH9A 2B2TC 1R9TB 4XQJA 1VCIA 3EQLC 4A3KH 2A69D 3E0EA 4IUVA 4IPCA 2VXWA 4QJFA 1GUGA 2B63H 1V8QA 1PMRA 4A3MB 2VUMB 1CA5A 1PYBA 1EOVA 1XX8A 2IHFA 3PMFA 2O5IC 3SDZA 1CFMA 4HSPA 2A6HC 2FMMA 2P5ZX 4WFN3 1X9NA 1Q1EA 2R93G 2QW7A 3G7LA 4A3GH 2F0VA 1I4PA 1TWFB 4K8IA 4AYBB 1CHPD 2CVRA 2NB0A 3WWVA 5IYBG 2YV5A 4R4QA 2XN9C 2UU9Q 4LFBQ 2PO4A 3H0GH 3QB3A 2SNSA 1JJ2A 5GAGC 5KIXA 4MTNA 5IODA 4JI3Q 2K50A 2PZWA 4C1NI 1F9QA 1F9PA 1X3GA 2EYJA 4AIMA 2A5HA 3HRZC 1K73C 2DN8A 4DXFA 4LFAL 1QUQA 2E5LL 1TWAB 5D3DA 1B4OA 3S16B 4JC0A 5JJZA 4DV6L 2B29A 4BY1G 1R4PB 4IO9A 3HEJA 2JA8H 2DGYA 3TZUA 3S2DB 4NDXA 2DY8A 3SK8A 1ILPA 1PXUA 1F2ZA 1S5FD 2OT2A 1XMOL 1D5ZC 1A0IA 3NWSA 2NN6H 3NK9A 4DA2A 5M3MB 3OTOQ 2WKDA 4A3BH 5BN3A 2DNCA 1NJIC 1G2TA 2FFKB 3K7AH 4FDBA 1P16A 1HUMA 5L37A 1AN8A 5C3EH 3ICEA 3U4VA 5IP7H 4OXPA 2AHOB 4DV3L 3K5OA 3PGZA 4BBSG 3K0YA 1QZGA 2UUBL 1A2TA 2H4OA 3I8ZA 2F0UA 1IBLL 1NMGA 4A3BB 1D2BA 4CJ2C 1VDZA 1MHWC 2KCTA 3FVQA 5M5WH 5BR8L 4GNXC 4BXXG 4DPGA 4JI5L 5I4DA 5IYDH 1HA6A 3J7ZC 2VQFL 4QIWB 4I7AA 1UE7A 5M5YB 3TP7A 1IXRA 1STEA 2B8FA 3M4OH 1S5CD 4CJ0B 2YU9H 1HTPA 4KV6A 3HP3A 1Z9FA 3NWTA 2XVSA 4A3JG 5IYCG 3HOVB 2EY2A 2L1BA 2UUCQ 5FLXE 4JPBW 3BJUA 5J22A 3HKZG 4CDCC 4BY7G 5IGEA 3IFDA 2PZTA 3C46A 1PFNA 3U58A 4GOPA 4X62L 5J1ZA 1VQAA 4KTAA 1XNQL 2F0GA 3X3NA 4KHPL 1CQVA 1LTSD 1UAPA 4JI6Q 1EL0A 1ZYRD 1SE3A 3H6MA 2WB1B 4RWSC 4X65Q 3BZDB 1G91A 4X3UA 5H1SE 2JA5H 3S1QH 4OEMB 3MAQA 1Q8IA 2EYFA 1PZKD 3I4NG 2VW9A 1KL9A 1QILA 2PMZB 3A74A 4HMJA 3C1FA 2Z6KC 1GUSA 5ISRA 2IY5B 1B7YB 1SFOH 1SMYD 1JORA 3CKIB 4FF3A 1C48A 3H3VH 5ELEA 2MO0A 3FKIH 1KABA 3GTOH 3S1MB 3A7AB 3PF4A 2BCOA 3SR1A 5DAUA 1UEAB 1SJED 2G9HD 2V1CC 3K57A 2KHSA 5C4JB 4A3GG 3QJYA 2JA7H 2RDGA 2ENBA 2PQAA 1GVPA 4RHSA 1BCPF 1BQQT 4K2LA 3JAMc 3E9IA 3FKIB 3OSOA 3FEWX 3H0GG 1K8GA 1DD2A 1QWYA 1LTGD 4C2MB 3WOEA 4Z9CB 1A3UA 1SNOA 1RODA 2JQOA 2Y0SE 1BBXC 4HN7A 2B2YC 4IUUA 4QMGA 4LK1C 4DR1Q 4Q0FA 1TY2A 1PVOA 3HOUB 1EY4A 5KEEA 2A1AA 2F4VL 2JA8G 2A6HD 3CMAA 2I46A 1Y1VG 2HDMA 1JICA 3GTLB 1VQKA 4DV2Q 1CI3M 1NE3A 2R61A 3NP8A 3D4DA 5FLXc 4ZUIA 3T13A 1SYGA 1ZEQX 3EIVA 5M9OA 3CW2C 2K03A 5IP7G 4XT1B 4DAYB 4NXMQ 4UHVA 3S1RH 1K0RA 4OO1H 4DGZA 2F0TA 2ZT9C 3KJOA 3M3YB 3A56A 4JI8Q 2D2CC 2K5VA 5C4HA 4IPGA 2DY7A 1X3EA 3JAML 4PV1C 5EBDA 3Q6SA 4LWCA 2R7ZB 3S1NH 1WTVA 1VMCA 2UXBQ 2UXCQ 3MA2B 3RLFA 4FF4A 3K5LA 1JMCA 2KCNA 1CTMA 1EYGA 3CCQA 3GV3A 3DLLA 3HOZB 1YNNC 3CU7A 3A5ZB 1II3A 2BDOA 2PYKA 3DUZA 3A8KE 2FINB 3MZ5A 4X3TA 3BU2A 3HOXG 2Q8RE 3QOJA 5M3FG 4F8MA 3PUZA 2DJGC 1IYJB 2GA4B 2F3VA 3MXPA 3J81c 5FLXL 4H0LC 2NVYB 4FYDA 1JJGA 1PH6A 5C6AA 4PMBA 1BKBA 3OW2A 4YY3Q 5AFWA 4A3FH 1XNRL 2QDLA 1TWGH 2NWGA 4UP9A 4LFAQ 1ZXTA 3IRBA 2E5LQ 2OWOA 3BVZA 3W1GA 3PIP3 2K6AA 3RMHA 2JA5G 4KJOA 3D31A 5CC4A 2Q8TA 1MD2D 2K14A 4TKOB 5GADC 4C3JH 5FO9B 5EPLA 4DNRB 2NYZD 1MSGA 1PTOB 1XMOQ 1KXLA 1U4PA 3AQQA 3MFGA 1NAPA 1KAWA 1M4VA 1MJEA 1BO0A 2XNAC 4HCSA 3FPPA 1K8MA 1BXTA 3K7UC 3OWFA 1KQSA 5EKKA 2UUBQ 1UE5A 4QIWE 1IBLQ 3AEVA 4KJNA 3CC7A 1E22A 3J81L 4DNTB 4JI5Q 3TBIB 5LL6S 4G4KA 3UE0A 2EOTA 5CYUA 2EXZA 3K0XA 3PO2G 1HCZA 2VQFQ 4LF8L 3M9BA 4NP5A 1VQCA 4DAVA 3RZDB 3I2ZA 1EEID 1QNKA 5GAHC 3S15B 1EQTA
chains in the Genus database with same CATH topology
4ZRZA 2ID0A 5ELBA 1LT5D 1B1ZA 2IX0A 1TS3A 1SDFA 3MEHA 2FMCA 1J9OA 2NN6I 2NTSA 4FF1A 3MC0B 5K36H 5CV8A 5CORA 3IL8A 2IWHA 4RGTA 2PQEA 2I07B 1B44D 2E76C 1SNPA 1GUOA 1PYWD 5T1IA 3CRKC 5E3FA 1I50B 4N9TA 3KUPA 3QOLA 4ZYSA 1TU2B 3D4RA 2CW0C 3RD4A 3TP8A 2IX1A 3MTSA 3IKJA 3T53B 1EIHA 3K59A 1HHVA 1WTWA 1KDAA 1WCMB 4FNFA 1Z47A 3ZYYX 4RH6A 1PRTC 2IX3A 2K05A 2E75C 1HTLD 2HDLA 2BDNA 3X3MA 4CKEA 1CZGA 5CV9A 5JPMC 1JWUD 1SNDA 1F77A 4G7HC 1Y8OB 3VR4A 4ZUJA 1YNND 2LFNA 4PNYA 1LACA 1AW7A 3GO5A 3KF8A 1LABA 2RVLA 5JEAH 4U68A 2BA1A 2BA0A 2A74C 4UAIA 5BN5A 2OEOA 2QKIC 4P2CB 4XYOA 1EU4A 1JR0D 1SYEA 3LX0A 1CQFA 5COYA 1DONA 4UDUC 2Q8IB 4F87A 4X3SA 1B9NA 5EQ0A 2R92B 3PUXA 2X69A 4IUNA 1JB3A 2BE5C 1V1PB 1HQRD 1X32A 3SK6A 4QCLA 2F0QA 4DU9A 5BN4A 3DWQA 3H3VC 1TS5A 4BY1B 3O13A 3VR2A 2NUCA 2B2WA 2O2LD 3TSSA 4KKSA 1C4QA 2A6EC 5C5LA 1KLGD 1FYCA 2L11A 3BS1A 3W3AA 2CQAA 5I2YA 3GQBA 1QCBD 4BBSB 4LJZC 3P20A 2F0LA 1ONLA 4OO1I 3MXNA 1S5DD 2EY1A 1Y8PB 4OHJA 1ILQA 4ME5A 3GV6A 2K32A 1HPCA 2LY7A 3KK7A 1QJOA 4TRDA 1LTAD 1SYCA 5DEHA 2KA7A 1PTOF 2OXPA 1E2ZA 1STBA 1A2UA 3V05A 3W2DA 4A3JB 2XRQD 1TWCB 1RD9D 2NVQB 5J39A 4BY7B 3I91A 4L6TB 1LTID 4G7OC 4KN7C 2E74C 2SDFA 4BA2I 1KLUD 3DWAA 2CW0D 4DF7A 4OGQC 1GUTA 5E4XA 1SAPA 2V4DA 3TN2A 1Y1WB 4ID6A 2ICIA 1H9SA 3I4NB 4IN3A 3GTPB 4NW2A 1PFMA 1AZQA 3MFYA 4WORA 1HXYD 1PRTD 1STYA 4F88A 2F0IA 4IQZA 3K5MA 3Q23A 4MN3A 2N88A 4R8NA 3A7LA 2IPKD 3J7AV 3ERQA 4IFDH 4KI0A 1I4GA 1MBYA 2L12A 4LMQD 2K5DA 1QG7A 4CBVA 4KKTA 4DFAA 1SJHD 4DXGA 2Z1CA 3JAME 2E2JB 4A3IB 1PFBA 2B39A 3TMEA 5C44B 1E2WA 4KK7A 1OO9B 2PCFB 3S2HB 3R2TA 4ZKBB 2EJMA 1QOHA 2XSCA 5NUCA 3TDQA 2N55A 4ODGA 1Y1VB 5CV5A 1I3QB 3T56B 4E6IA 1GJXA 4HMIA 4WJWA 1SNQA 1WVLA 1D5MC 3OIQA 4KD4A 3DWPA 4A93B 2WIIB 3A8IE 4QUCA 2H1EA 1Q1BA 2BE5D 2LMCB 2R3ZA 1VF5C 3KLRA 2F1MA 1SEBD 5CR3A 1EZ6A 3S17B 2FJ2A 3MXUA 1OXVA 2WKCA 1EWCA 1TVXA 1ET6A 4Y7NB 2MP1A 2PPBC 2JSOA 1WTOA 3OWEB 1STHA 2F4IA 2A6ED 2KCCA 1FNWA 3SEBA 3HOXB 5M3FB 2SOBA 3NTIA 2F03A 2EJGC 5JEAJ 3VYRA 1BUVT 3V2TA 4BA1I 3J81E 1G6ZA 1EYDA 4RAUC 2TMPA 1IW7C 1IYUA 1STAA 2NVXB 1B3AA 2A68C 3GTJB 2EYLA 1NUCA 3OMGA 2F0OA 4HSVA 1AFPA 1GUNA 3LWEA 4RKBA 3VR6A 3FDTA 3VA5A 4EGVA 4C3IB 2ZXOA 3EVQA 2M2LA 4Q5VA 1DOMA 2MHVA 1QE6A 2B2WC 2JXMB 1JOQA 2YYZA 1PDQA 3VR3A 2AQ3B 3VA7A 3A8JE 3GTGB 4G7ZC 3DEOA 1E0BA 1JC7A 1I6VC 1XXGA 3K6OA 4M8AA 2NN6G 1EY7A 3N6RA 1SE4A 3R3OA 2C9OA 2JA6B 4QB4A 2K28A 5C3XA 3OW7A 1DOLA 3PO2B 2NZ1D 2HCIA 4JK1C 1ESRA 1STNA 3Q24A 3MVVA 1DZ1A 3AU7A 1EEFD 2BOSA 3D6WA 5C4ZA 2PZUA 2EVBA 1T5EA 1RKNA 1B53A 3D3RA 3PIO3 2XRSD 1NR2A 1F2YA 1IHZA 2AUJD 3L9AX 3NBIA 3L3OC 5DNFA 3NQIA 5IT9L 1SXTA 3OIPA 1B50A 1MSHA 2HUGA 3SK4A 3SXHA 2KECA 1BCPC 3ITPA 2B8GA 1IKMA 5JAVA 5EBCA 1JOKA 1TR5A 3U9SA 3H94A 2MUYA 2EYMA 3C1EA 2RKSA 4KD3A 3DM1A 5LL6X 5C5MA 1A6XA 1PTOH 3QO2A 3PUVA 3ND8A 1RJTA 3PO3B 4V190 2IJ0A 2AWNA 4ZK9B 2WV6D 3I73A 2K5WA 2NVTB 5ELFA 4B08A 3GTKB 5KNBA 4DAPA 1LLRD 2IT1A 4DN4M 3A55A 2Z8LA 3EROA 2E2IB 1DCZA 3BYYB 1IL8A 2AWOA 2JEAI 3P75A 5D14A 2MJ8A 3NPPA 4FO2A 4IFDJ 1QNUA 3K5NA 4RHRA 2F0HA 1CT1D 2ICEC 4XYQA 1TY0A 1EYAA 2JEBI 1CA6A 2X6LA 3BDLA 5IGBA 1EY6A 1EZ8A 1GHJA 3GTMB 1HQMC 1LTBD 3WDNA 1R4QB 1IW7D 2KJXA 1F2MA 4IFDI 2A68D 4LAAA 5EPJA 3UI2A 3A54A 2LS01 1D6EC 2KVMA 1TS4A 3NTKA 1EY5A 1Y8NB 2B2VA 4OO1G 1F9RA 3I72A 5M5XB 1E2VA 2VB3X 4FXGC 1D1KA 1I6HB 1LT6D 1GHKA 2NBFA 1C8CA 2A73B 1K8OA 3DXJC 3J80L 4PQXA 1U9RA 2K33A 1WD0A 1JCKB 4V0BA 1T5XD 2SEBD 1S5BD 5FOBB 5F2DA 3S9WA 2R6GA 2EY6A 1TWHB 1HFNA 4BBRB 1WTRA 1HA5A 4RFBA 2F0PA 3CRLC 2K5QA 2RDHA 4TQUS 4CKCA 5JVH3 2HCCA 1ICWA 3FPUB 4H7BA 3OMCA 3ND9A 2FHTA 3H09A 3HOWB 1JQYD 1HFGA 2RA4A 4EQPA 4OIKA 4C3JG 5I9PA 3TZDA 1ESFA 4ABNA 1BCPD 2KQ3A 1M8AA 2O5JC 1XWEA 3S14B 4IUPA 1K83B 5EGTA 1KNEA 2J7ZA 4KY7A 3T4AC 1L0YB 2R93B 2EPBA 2PW7A 2K01A 2E2DC 1F9SA 3P7JA 1LT4D 2D5DA 3BVMA 5A2QL 1TT2A 5JVG3 1OXUA 4K6LA 3HS0C 4NMZA 2QF7A 3F2UA 5C3WA 4MIUA 5KYIA 3K58A 1ENFA 1O7ZA 1ENCA 1SYBA 5DM63 5KNCA 1L0XB 5IIFA 1TQOA 5C4XB 2CHBD 3BVGA 1A3VA 3ONAB 3PV0A 1IYVA 1CM9A 1JE4A 4I7ZC 1JWMD 2F0MA 2SNMA 3FMCA 4ULLA 3I4MB 5K36G 3M4YA 4XQQA 3M85A 3BDCA 3DHQA 5IGCA 2VB2X 4XDXA 1FNVA 2F0WA 1G2SA 3HZXA 3I90A 5EJWA 1WTXA 1D1IA 2PW5A 3QG1A 3G6JB 2MPMA 2KEDA 1EIGA 2ZXPA 4ZKCB 1JWSD 5I2XA 5FO7B 1WD1A 2PNRC 1Q12A 5HURA 4HEDA 1U4LA 3E6ZX 2F0FA 1RDPD 5C0XJ 4XQNA 1CK1A 4DK0A 1SYDA 3HKZB 4RGNA 1V1PA 2RSNA 1XTCD 1S5ED 5FKAC 1YNJC 3Q0AA 1G291 1H9MA 3R8BA 4M1UB 3NUCA 4L63B 1FR3A 1BOSA 1LTTD 3FRPB 5C0XI 4C3HG 4A3KB 1RCVD 2JYOA 5JEAG 1OXXK 1EWHA 4XIGS 2B63B 5CBEE 1BR9A 2M9VA 3E0JA 5KRUA 1JOOA 3VYTA 1J8IA 4PMCA 2LKVA 2AQ1B 2L4NA 1HUNA 5FO8B 4RGOS 5ELCA 1FD7D 4A3GB 3NBHA 5JOBA 1X3PA 3E5SA 2K04A 2F0EA 2B2VC 2NTTA 1SYFA 1PTOC 1Q90A 1CHQD 1MGSA 3H0GB 1RTOA 5T1GA 1DYQA 1V43A 1WTQA 4FP5D 2EDGA 3EJIA 1Z6HA 2EY5A 3OHXC 3LWUA 2QEJC 1LO5D 1PZJD 5FK9C 5IT9E 1GOZA 4B9XA 1H9RA 3MHBA 4ZLTF 1UUPA 3BDOA 2JA8B 3NTHA 1EY0A 1V1OA 4RGMA 4CGYB 2F3WA 1BDOA 3K7AB 1ML0D 2B2UA 1PRTB 1I4QA 5C3EB 3IAYA 2EJFC 5HGTA 1NSNS 3SE0A 3D6CA 1IKLA 3NE5B 5M5WB 4FXKC 4K5XA 1LV9A 4RCOA 4C1NK 5LHY1 1EOTA 3V96A 2AUKA 3M4OB 3LNNA 2YU9B 1I4HA 4IZ8A 1B9MA 1BF4A 3C2PA 5K5PA 3L7ZC 2WACA 4L8JA 2RQXA 1XYIA 1WTPA 3U9OA 1ET9A 1EU3A 4YIJA 5E1FA 3OOCA 2VNUD 1ENAA 3SK5A 4S3SA 5I6WA 3T16A 4RKLA 4R9WA 3R2IA 3M7NA 1U4MA 4G57A 3AMUA 2JA5B 3S1QB 5G3LD 1GUWA 3URYA 2KUMA 1BNZA 1SFOB 4HAEA 5DM73 2EYHA 4KHVA 3I4LA 2J4XA 4ILWA 3GTOB 1TKWB 3KBGA 4RCNA 1UNSA 5IGDA 3KLSX 4IFDG 2JP1A 1Z7TA 1G8ZD 5CBAE 2F0SA 2JA7B 3P1HA 1YNJD 3CHBD 3NSWA 2RDFA 2F0DA 3T51B 4O42A 1TS2A 1RTNA 3VR5A 2F0JA 1EYCA 5IGGA 5E4WC 1EY8A 1OXSC 3TP6A 2KOLA 1KNAA 3H91A 3GP7A 5D3IB 3NXWA 4BS9A 3J80E 4FF2A 1H9KA 3HG9A 1KDBA 1X3QA 5EPKA 4KN4C 4OL7A 3DMUA 1O78A 2WINB 1NR4A 4I65A 4XT3B 4KKUA 1PTOD 1MI2A 4CJ1B 5IOCA 1SE2A 1SBBB 5ELDA 3S1RB 1DJRD 4BWGB 2RBMA 1GXDC 3D4WA 4NKLA 1RHPA 3Q22A 1KTKA 1VF7A 2XWJB 1Q3LA 4N9PA 2XIWA 1LT3D 1O7LA 3S1NB 1NCVA 5CGKA 2TSSA 2XWBB 2JE6I 1FNUA 2OF1A 5C0XH 3NQTA 3PUWA 2Z4HA 3EA6A 5EKLA 1HRJA 4DAYA 4JBWA 1Y69U 2WAQB 3RUZA 4KY5A 1A3TA 3BG3A 4CKBA 1I4XA 4IALA 4K5VA 1A15A 1STGA 2WP8J 3DEPA 5A2QE 4C3IG 4A3FB 4EQNA 1TWGB 1EQVA 1PZID 4O1NA 4C56C 2B2TA 2G9DA 4B9WA 1ZKOA 1DXMA 4ZQ3A 3KLSA 3QIAA 4C3JB 1OXTA 3WOFA 2IL8A 4H44C 2K7VA 3QWNA 3BYTB 2K1BA 1AP0A 1PRTF 4IUTA 4X3KA 1EY9A 4K2KA 2B2UC 4J8QA 4K5WA 4HCEA 4PMWA 2MGSA 4XXEA 5I6YA 1AEXA 2DNEA 2L5TA 1FGBD 3I70A 1D5XC 1W6JA 1KDCA 5CV7A 2C5CA 4KHZA 2A69C 3PUYA 3MWYW 3HGBA 4RA8A 3C3LA 4HR7B 2ZXRA 4MHEA 1LTRD 4FVMA 3EFXD 4A3EB 1PLFA 1I4RA 5JPNC 4F7XA 4K14A 4J1MA 3OPOA 1TIID 3VYSA 3J7YW 1SSOA 1SNMA 3VYUA 5EKIA 1W6KA 2EYPA 2X6GA 4EQOA 1O7YA 3N52A 1VMPA 5C0XG 1F2LA 5I9OA 1DOKA 2O4XA 3D8GA 4H13C 4R8IA 2L9HA 4CHTB 1SNCA 5TSSA 3GD7A 3J7AF 2EE1A 2F0KA 2RSOA 5CMDA 5KYLA 2L0CA 3I3CA 4A3DB 4K8JA 3KBXA 2AQ2B 2E2HB 3MXGA 1O80A 4XTCS 4C3HB 1S4ZA 4QUFA 2D62A 5G3LF 2EZVA 3R93A 4IURA 3IFTA 5CV4A 2M00A 4K6DA 4FXDA 5KGUA 2QILA 1KAAA 4HTHA 5A35A 3M7GA 4GZYC 1BCPB 1EFID 1QB5D 3SVMA 2D9UA 2L55A 1B2TA 4IUQA 1RF2D 3NHHA 5KNDA 4J6HA 1ZYRC 2B2YA 3HOYB 2EYOA 5IGFA 5CV6A 4EVOA 4DK1A 3GTQB 1H9JA 2QCPX 1DM0B 1CZWA 1H9SB 2Y0SB 1SMYC 1U4RA 4OIJA 5D65A 2J0TD 3RZOB 4KMUC 2F0NA 4KY6A 3SHLA 2KEEA 4QF4A 3AB9A 1AZPA 2HQEA 4TSSA 2Z4IA 4U673 3TP5A 2QDBA 2IW3A 3CQZB 4WRDA 4ZAIA 2B2TC 1R9TB 4XQJA 1VCIA 3EQLC 2A69D 4IUVA 2VXWA 1GUGA 1V8QA 1PMRA 4A3MB 2VUMB 1CA5A 1XX8A 3PMFA 2O5IC 3SDZA 1CFMA 4HSPA 2A6HC 2FMMA 4WFN3 1Q1EA 3G7LA 2F0VA 1I4PA 1TWFB 4K8IA 4AYBB 1CHPD 2CVRA 2NB0A 2XN9C 2PO4A 3QB3A 2SNSA 5KIXA 5IODA 2PZWA 4C1NI 1F9QA 1F9PA 2EYJA 2A5HA 3HRZC 2DN8A 4DXFA 1TWAB 5D3DA 1B4OA 3S16B 5JJZA 1R4PB 3HEJA 3TZUA 3S2DB 4NDXA 2DY8A 3SK8A 1ILPA 1PXUA 1F2ZA 1S5FD 2OT2A 1D5ZC 3NWSA 5M3MB 2NN6H 3NK9A 4DA2A 2WKDA 5BN3A 2DNCA 1G2TA 2FFKB 1HUMA 1AN8A 3K5OA 3K0YA 1A2TA 2H4OA 3I8ZA 2F0UA 4A3BB 1D2BA 4CJ2C 1VDZA 3FVQA 5I4DA 1HA6A 4QIWB 5M5YB 3TP7A 1STEA 2B8FA 1S5CD 4CJ0B 1HTPA 4KV6A 3HP3A 3NWTA 2XVSA 3HOVB 2EY2A 2L1BA 5FLXE 5J22A 5IGEA 3IFDA 2PZTA 3C46A 1PFNA 5J1ZA 4KTAA 2F0GA 3X3NA 1CQVA 1LTSD 1UAPA 1EL0A 1ZYRD 1SE3A 3H6MA 2WB1B 4RWSC 3BZDB 1G91A 4X3UA 3MAQA 1Q8IA 2EYFA 1PZKD 1QILA 2PMZB 4HMJA 3C1FA 1GUSA 5ISRA 1SMYD 1JORA 3CKIB 4FF3A 1C48A 5ELEA 1KABA 3S1MB 3A7AB 2BCOA 3SR1A 5DAUA 1UEAB 1SJED 2G9HD 3K57A 2KHSA 5C4JB 3QJYA 2RDGA 2ENBA 4RHSA 1BCPF 1BQQT 4K2LA 3FKIB 3OSOA 3FEWX 1DD2A 1QWYA 1LTGD 4C2MB 3WOEA 4Z9CB 1A3UA 1SNOA 1RODA 1BBXC 4HN7A 2B2YC 4IUUA 4QMGA 4LK1C 4Q0FA 1TY2A 3HOUB 1EY4A 5KEEA 2A6HD 2I46A 2HDMA 1JICA 3GTLB 1CI3M 2R61A 3NP8A 3D4DA 4ZUIA 3T13A 1SYGA 1ZEQX 5M9OA 2K03A 4XT1B 4OO1H 4DGZA 2F0TA 2ZT9C 3M3YB 3A56A 2D2CC 5C4HA 2DY7A 3JAML 4PV1C 5EBDA 3Q6SA 2R7ZB 1WTVA 1VMCA 3MA2B 3RLFA 4FF4A 3K5LA 2KCNA 1CTMA 3HOZB 3GV3A 1YNNC 3CU7A 1II3A 2BDOA 2PYKA 3DUZA 3A8KE 2FINB 3MZ5A 4X3TA 2Q8RE 3QOJA 4F8MA 3PUZA 2GA4B 2F3VA 3MXPA 5FLXL 4H0LC 2NVYB 4FYDA 5C6AA 4PMBA 5AFWA 2NWGA 1ZXTA 3BVZA 3PIP3 2K6AA 3RMHA 4KJOA 3D31A 5CC4A 2Q8TA 1MD2D 4TKOB 5FO9B 5EPLA 4DNRB 2NYZD 1MSGA 1PTOB 1U4PA 3MFGA 1NAPA 1M4VA 1BO0A 2XNAC 4HCSA 3FPPA 1K8MA 1BXTA 3OWFA 5EKKA 4KJNA 3J81L 4DNTB 3TBIB 5LL6S 4G4KA 2EOTA 5CYUA 2EXZA 1HCZA 4NP5A 4DAVA 3RZDB 1EEID 1QNKA 3S15B 1EQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNQ A;  2EY5 A;  2F0W A;  3P75 A;  1EY7 A;  3HZX A;  3R3O A;  3H6M A;  4HTH A;  4KD4 A;  4QB4 A;  2OF1 A;  3QB3 A;  2SNS A;  2OEO A;  4H7B A;  3NQT A;  2PW5 A;  5C3X A;  5J39 A;  5KIX A;  5EKL A;  5IOD A;  3OMC A;  1SYE A;  1II3 A;  2PZW A;  2PYK A;  2F0H A;  4B9X A;  3MHB A;  2EYH A;  3LX0 A;  2EYJ A;  2EYF A;  4KHV A;  1STN A;  3MZ5 A;  3RUZ A;  4KY5 A;  3MEH A;  1A3T A;  3QOJ A;  4HMJ A;  3C1F A;  5CR3 A;  1EY0 A;  1EYA A;  3MVV A;  1EZ6 A;  4IAL A;  4K5V A;  3NHH A;  4EQP A;  1STG A;  4J6H A;  4F8M A;  3V2T A;  4K14 A;  3BDL A;  5IGD A;  5I9P A;  5IGB A;  1JOR A;  5CV8 A;  4DF7 A;  5C4Z A;  1EY6 A;  2F3V A;  2PZU A;  2EYO A;  1EZ8 A;  3MXP A;  5HUR A;  2F0S A;  5IGF A;  1RKN A;  4J1M A;  5CV6 A;  3P1H A;  1KAB A;  3HEJ A;  4EVO A;  2KQ3 A;  2F0F A;  2F3W A;  4EQN A;  2RDF A;  4IUN A;  4NDX A;  2F0D A;  3SR1 A;  5DAU A;  3SK8 A;  4F7X A;  1EQV A;  1F2Z A;  1F2Y A;  1SYD A;  1IHZ A;  2KHS A;  2PQE A;  1SNM A;  5C6A A;  4PMB A;  5HGT A;  1NSN S;  1SNP A;  3NK9 A;  5EGT A;  4ID6 A;  3SK6 A;  1STH A;  5E3F A;  3D6C A;  4KY7 A;  4N9T A;  2ENB A;  1F2M A;  3QOL A;  4B9W A;  5ISR A;  2EYP A;  4K2L A;  2F0Q A;  2PW7 A;  4WOR A;  2F0J A;  2SOB A;  4DU9 A;  1EYC A;  4EQO A;  5IGG A;  3OSO A;  4LAA A;  4ZQ3 A;  3TP8 A;  1EY8 A;  1STY A;  3SK4 A;  3TP6 A;  3SXH A;  2F0I A;  3ITP A;  1A2T A;  4K5X A;  2F0U A;  5I9O A;  1TT2 A;  2F0N A;  5JAV A;  3NXW A;  1A3U A;  1KDA A;  2NUC A;  3NUC A;  4KJO A;  4KY6 A;  1JOK A;  1TR5 A;  1SNO A;  2O4X A;  1EY5 A;  3D8G A;  4NMZ A;  1KDB A;  3SHL A;  1EYD A;  5C3W A;  3ERQ A;  4MIU A;  5KYI A;  4QF4 A;  4QMG A;  2EYM A;  3C1E A;  1STA A;  1ENC A;  5C5L A;  2RKS A;  4KD3 A;  4OL7 A;  2HQE A;  3DMU A;  4IZ8 A;  5C5M A;  3TP7 A;  1EY9 A;  5CC4 A;  1SYB A;  2EYL A;  4K2K A;  5K5P A;  1NUC A;  1SNC A;  1EY4 A;  3OMG A;  3TP5 A;  5KEE A;  2F0O A;  2QDB A;  2WAC A;  4I65 A;  4K5W A;  4DFA A;  2F0K A;  4R8N A;  4WRD A;  3OWF A;  5KRU A;  1JOO A;  4KV6 A;  5IIF A;  3U9O A;  1TQO A;  5EKK A;  5KYL A;  2F0L A;  4PMC A;  3NP8 A;  3D4D A;  4RKB A;  2LKV A;  4YIJ A;  5E1F A;  3TME A;  5IOC A;  4K8J A;  2EY1 A;  2EY2 A;  3VA5 A;  1A3V A;  4KJN A;  1ENA A;  4ME5 A;  4ZUI A;  3SK5 A;  3T13 A;  4S3S A;  1SYG A;  1U9R A;  2RBM A;  5I6W A;  5J22 A;  5M9O A;  5CV9 A;  3D4W A;  1AEX A;  3EVQ A;  5I6Y A;  1SND A;  3PMF A;  3T16 A;  4TRD A;  1SYC A;  4NKL A;  2F0M A;  5DEH A;  2SNM A;  2EXZ A;  5IGE A;  4ZUJ A;  5JOB A;  4RKL A;  2OXP A;  3E5S A;  1JOQ A;  2PZT A;  4N9P A;  2F0E A;  5CV7 A;  1KDC A;  5F2D A;  4NP5 A;  1SYF A;  3BDC A;  2F0T A;  1STB A;  2EY6 A;  5NUC A;  4PNY A;  4DGZ A;  3DHQ A;  3S9W A;  5IGC A;  4ODG A;  1A2U A;  5CV5 A;  2F0V A;  3ERO A;  5CV4 A;  5C4H A;  5J1Z A;  2M00 A;  2F0P A;  4G57 A;  4K8I A;  4KTA A;  4E6I A;  4K6D A;  5CGK A;  5KGU A;  1KAA A;  2F0G A;  4HMI A;  3EJI A; 
#chains in the Genus database with same CATH topology
 2ATW A;  1BVS A;  5JJI A;  2E8G A;  4ZRZ A;  2ID0 A;  1D7Q A;  5ELB A;  2N78 A;  1LT5 D;  1AH9 A;  4JI4 L;  1B1Z A;  2IX0 A;  5FJ8 H;  1TS3 A;  1SDF A;  4JVZ A;  1S40 A;  3MEH A;  4LF7 L;  2FMC A;  1J9O A;  2NN6 I;  2NTS A;  4X62 Q;  5IP9 G;  4FF1 A;  3MEF A;  3MC0 B;  5K36 H;  2GN5 A;  1DGS A;  5CV8 A;  4A3E H;  2L15 A;  1YZ6 A;  4KHP Q;  5COR A;  3IL8 A;  2IWH A;  2PMZ E;  4RGT A;  2PQE A;  4TVA B;  2I07 B;  1B44 D;  2E76 C;  1SNP A;  1GUO A;  1PYW D;  5T1I A;  1HJP A;  3CRK C;  5E3F A;  1I50 B;  4N9T A;  3KUP A;  3QOL A;  4IJL A;  4ZYS A;  1CKM A;  1TU2 B;  3D4R A;  2CW0 C;  3RD4 A;  3TP8 A;  2IX1 A;  3MTS A;  4GNX A;  3IKJ A;  3T53 B;  1EIH A;  2G5D A;  3K59 A;  1HHV A;  1WTW A;  4JBM A;  4HIO A;  1EIF A;  1KDA A;  3PO3 G;  3F2D A;  1WCM B;  4FNF A;  1Z47 A;  1AE3 A;  1WJJ A;  3ZYY X;  1KHI A;  2CKZ B;  4RH6 A;  1PRT C;  4P75 A;  2IX3 A;  1Q81 C;  1PH1 A;  2K05 A;  2E75 C;  1HTL D;  1U5K A;  2HDL A;  2BDN A;  3X3M A;  4KLK A;  4LF6 L;  4X6A H;  4CKE A;  1CZG A;  1VQH A;  5CV9 A;  5JPM C;  1JWU D;  1SND A;  1SMX A;  1F77 A;  2Z9H A;  4G7H C;  4A3D H;  1Y8O B;  3VR4 A;  4ZUJ A;  4JI7 L;  2E2H H;  1YNN D;  2LFN A;  3FHW A;  4PNY A;  5IWA Q;  3STB C;  3L2P A;  1LAC A;  2RHQ B;  3JAM i;  1AW7 A;  3GO5 A;  4L5R C;  3KF8 A;  4AH6 A;  4C3H H;  1LAB A;  2RVL A;  5JEA H;  4U68 A;  2BA1 A;  2BA0 A;  2A74 C;  1GKH A;  4UAI A;  5BN5 A;  2R92 H;  2OEO A;  1E24 A;  1W3S A;  2QKI C;  4P2C B;  4XYO A;  4DR5 L;  1EU4 A;  1JR0 D;  1SYE A;  2Z6K A;  3LX0 A;  1CQF A;  5COY A;  1DON A;  4UDU C;  2Q8I B;  4F87 A;  1JJC B;  4X3S A;  1B9N A;  1K9M C;  5EQ0 A;  3F2C A;  2R92 B;  3UDF A;  3PUX A;  1K8A C;  2CFM A;  2RCN A;  1YVC A;  2IHE A;  3RLN A;  1FVI A;  2Z6B A;  5FLM H;  2X69 A;  4IUN A;  1NTG A;  3PQI A;  1JB3 A;  2BE5 C;  3AYH B;  1V1P B;  1HQR D;  2AMC B;  1X32 A;  3SK6 A;  4B3R L;  3GTQ H;  4QCL A;  2F0Q A;  4JBK A;  4JOI A;  4DU9 A;  5BN4 A;  3DWQ A;  3H3V C;  4WJ4 A;  1TS5 A;  4BY1 B;  1VQD A;  3KF6 B;  3O13 A;  3VR2 A;  1Q86 C;  2NUC A;  2B2W A;  2WAQ E;  2O2L D;  3TSS A;  4KKS A;  1C4Q A;  4JI1 L;  2A6E C;  3RZO H;  5C5L A;  1KLG D;  1FYC A;  2L11 A;  3BS1 A;  3W3A A;  2CQA A;  5I2Y A;  3GQB A;  1QCB D;  4LFC L;  4BBS B;  4LJZ C;  3P20 A;  5AJ3 L;  2F0L A;  1ONL A;  4OO1 I;  3MXN A;  3CCR A;  1S5D D;  2EY1 A;  1Y8P B;  4OHJ A;  1ILQ A;  3CQZ H;  3J81 i;  4ME5 A;  3GV6 A;  3OYY A;  2F52 A;  1R9T H;  2K32 A;  1HPC A;  2LY7 A;  3KK7 A;  4DUY L;  1XJV A;  1QJO A;  4TRD A;  1LTA D;  1SYC A;  5DEH A;  2KA7 A;  1PTO F;  2OXP A;  1SN8 A;  1X3F A;  4A3M H;  2VUM H;  1E2Z A;  1STB A;  2HIV A;  1IBM L;  1QUQ B;  3HOW G;  1NBW A;  1A2U A;  5E7N A;  3V05 A;  4L5Q A;  3W2D A;  4A3J B;  4DV5 L;  2XRQ D;  1YHA A;  1TWC B;  1RD9 D;  2NVQ B;  1TWF H;  5J39 A;  4BY7 B;  4A3L G;  3I91 A;  2GVA A;  4L6T B;  4DKA C;  1LTI D;  2Q2H A;  4G7O C;  4KN7 C;  4LF8 Q;  4HJ8 A;  2N3S A;  1Y1W H;  2E74 C;  1HNX Q;  2SDF A;  1VQ5 A;  4BA2 I;  1KLU D;  1IL2 A;  3DWA A;  2VS1 A;  1CSP A;  2CW0 D;  4DF7 A;  4YWK A;  4OGQ C;  4HJ5 A;  1GUT A;  1E1O A;  1TWA H;  3S16 H;  4APV A;  5E4X A;  4GLV B;  1SAP A;  2V4D A;  3TN2 A;  1N33 L;  4GKK L;  2EIF A;  1Y1W B;  2K5H A;  1SRO A;  4ID6 A;  2ICI A;  1SRU A;  1H9S A;  3S2D H;  3I4N B;  4IN3 A;  3GTP B;  4NW2 A;  1PFM A;  1AZQ A;  3MFY A;  4WOR A;  4DR2 L;  4LF7 Q;  5M3M H;  1HXY D;  1PRT D;  1K3B C;  1STY A;  4F88 A;  2F0I A;  3KYH C;  4IQZ A;  3H15 A;  3K5M A;  3Q23 A;  5C4X G;  4MN3 A;  1J5E L;  2N88 A;  1B70 B;  3KDF B;  3A7L A;  4R8N A;  2IPK D;  3J7A V;  2OCE A;  3ERQ A;  4IFD H;  4KI0 A;  1I4G A;  5C44 H;  2UXD L;  1MBY A;  4DV0 L;  1QZH A;  2L12 A;  4NB3 A;  4LMQ D;  2K5D A;  4QY7 A;  3I4M G;  4QL5 A;  4GOP B;  1QG7 A;  4CBV A;  4KKT A;  5GQO A;  4DFA A;  1SJH D;  4DXG A;  2Z1C A;  3JAM E;  1ASY A;  2E2J B;  5M5Y H;  3HOY G;  4A3I B;  1PFB A;  2B39 A;  3STB D;  3TME A;  5C44 B;  1E2W A;  4KK7 A;  1N32 L;  1WYD A;  1OO9 B;  2PCF B;  3S2H B;  3CCV A;  3R2T A;  3HOV H;  4ZKB B;  2EJM A;  2HD3 A;  1QOH A;  4OWW B;  2XSC A;  2Y0S G;  5NUC A;  2I5M X;  1XMQ Q;  3TDQ A;  2N55 A;  4ODG A;  1IBK L;  1Y1V B;  5CV5 A;  1I3Q B;  3T56 B;  1I94 Q;  1BBU A;  4DUZ L;  4E6I A;  1GJX A;  1VQO A;  3CCJ A;  4HMI A;  4WJW A;  1SNQ A;  5JJK A;  1WVL A;  2KBN A;  1D5M C;  3OIQ A;  4KD4 A;  4LF6 Q;  1UE6 A;  3DWP A;  1X56 A;  4A93 B;  2WII B;  2OTJ A;  3RR5 A;  1N36 Q;  2GVB A;  4A4I A;  3A8I E;  4QUC A;  2LSS A;  2VQE Q;  4JI2 L;  2H1E A;  1Q1B A;  2BE5 D;  2LMC B;  4JI7 Q;  2R3Z A;  1VF5 C;  4GLA C;  1MKH A;  1YJW A;  3KLR A;  2F1M A;  1SEB D;  5CR3 A;  1EZ6 A;  3S17 B;  2FJ2 A;  1SLJ A;  3MXU A;  3I56 A;  1XPR A;  1OXV A;  2WKC A;  1EWC A;  1TVX A;  4PZ7 A;  1ET6 A;  1FJG L;  4LF5 L;  4Y7N B;  3G6E A;  2WFW A;  4IPH A;  2MP1 A;  2PPB C;  2JSO A;  1WTO A;  3OWE B;  1STH A;  2F4I A;  4DR5 Q;  2JJQ A;  1CKN B;  2A6E D;  2HIX A;  3S1M H;  2KCC A;  1FNW A;  3SEB A;  4A3K G;  5C4J H;  3HOX B;  5M3F B;  2SOB A;  3NTI A;  2F03 A;  2B63 G;  2EJG C;  4LF4 L;  1XPU A;  5JEA J;  3VYR A;  1BUV T;  3KOJ A;  3V2T A;  4BA1 I;  3J81 E;  1G6Z A;  4YCU A;  1EYD A;  4RAU C;  2TMP A;  1S72 A;  4C2M H;  4DV4 L;  1IW7 C;  1PH8 A;  1IYU A;  1STA A;  3CCS A;  2NVX B;  1B3A A;  2A68 C;  3GTJ B;  2EYL A;  1NUC A;  3OMG A;  1HR0 W;  1L1O A;  2F0O A;  4K0K L;  1KD1 C;  2K52 A;  4HSV A;  1AFP A;  3CCL A;  1GUN A;  2ZTE A;  4IOA A;  3LWE A;  3HOU H;  4RKB A;  3VR6 A;  3GTG H;  3FDT A;  4JOI C;  3VA5 A;  4DV7 L;  4EGV A;  4C3I B;  2ZXO A;  5IT9 c;  1VQN A;  3GTL H;  2QA4 A;  3EVQ A;  2M2L A;  2RCF A;  4Q5V A;  4JI1 Q;  2QEX A;  1DOM A;  2MHV A;  1QE6 A;  2B2W C;  2JXM B;  4NXN L;  1PA6 A;  1JOQ A;  2YYZ A;  1PDQ A;  3VR3 A;  2AQ3 B;  4LNQ A;  1W2B A;  3VA7 A;  3A8J E;  1CUK A;  3GTG B;  2HT1 A;  4G7Z C;  3DEO A;  1E0B A;  1JC7 A;  1I6V C;  1VQE A;  4LFC Q;  2VL6 A;  1XXG A;  3EBE A;  3K6O A;  4M8A A;  5AJ3 Q;  1RL2 A;  3M3Y H;  2NN6 G;  4A3B G;  4J15 A;  1EY7 A;  3N6R A;  1SE4 A;  3R3O A;  2C9O A;  2JA6 B;  4QB4 A;  2K28 A;  5C3X A;  3OW7 A;  1DOL A;  1PH4 A;  5C3E G;  2ZM6 L;  3PO2 B;  2NZ1 D;  4DUY Q;  2HCI A;  3W1B A;  4JK1 C;  2R7Z H;  1ESR A;  1STN A;  1A8V A;  1RIP A;  3Q24 A;  1LTL A;  3I7F A;  5LMN W;  5LMN L;  3HOZ H;  5IE8 A;  3MVV A;  3CCU A;  1YHQ A;  1DZ1 A;  3AU7 A;  1EEF D;  2BOS A;  3D6W A;  5C4Z A;  2PZU A;  2EVB A;  4R1J A;  1T5E A;  5IYD G;  4DV5 Q;  1RKN A;  1B53 A;  3D3R A;  3PIO 3;  2XRS D;  1NR2 A;  1F2Y A;  1IHZ A;  2Q2I A;  2AUJ D;  1A63 A;  2BH2 A;  3L9A X;  3NBI A;  3L3O C;  5DNF A;  3NQI A;  1PYS B;  5IT9 L;  4POG A;  3CCM A;  4JYA L;  1SXT A;  4AYB E;  3OIP A;  1B50 A;  2NVY H;  1MSH A;  3T1H L;  2HUG A;  3SK4 A;  3SXH A;  2KEC A;  3U4Z A;  1BCP C;  3ITP A;  2B8G A;  1JE5 A;  1IKM A;  5JAV A;  4B3T L;  5EBC A;  1JOK A;  1TR5 A;  3U9S A;  3H94 A;  2MUY A;  1MJC A;  3KJP A;  2EYM A;  3C1E A;  4P71 A;  2RKS A;  4KD3 A;  3DM1 A;  5LL6 X;  5C5M A;  3QR8 A;  1A6X A;  4LF9 L;  2EQS A;  1PTO H;  1V9P A;  4DR2 Q;  2A8V A;  3QO2 A;  3PUV A;  3ND8 A;  1RJT A;  4DV6 Q;  3T1Y L;  3PO3 B;  4V19 0;  4B3S L;  2IJ0 A;  2AWN A;  2Q2U A;  4ZK9 B;  2WV6 D;  3M4Q A;  2UXD Q;  1M1K C;  3I73 A;  2K5W A;  2NVT B;  2PNH A;  5ELF A;  3HKS A;  4B08 A;  4DV0 Q;  5KNB A;  4UY8 C;  3GTK B;  3D0F A;  4DAP A;  1LLR D;  4QQB X;  2IT1 A;  1NNX A;  4DN4 M;  1N34 L;  3HFZ B;  3A55 A;  3PSI A;  3FKI G;  2Z8L A;  3ERO A;  2E2I B;  3K81 C;  1DCZ A;  4DV3 Q;  3BYY B;  1IL8 A;  2AWO A;  4JV5 L;  1VQ8 A;  2JEA I;  1YIJ A;  2JA7 G;  3P75 A;  5D14 A;  3RZD H;  4UP8 A;  2MJ8 A;  4Y52 H;  2FXQ A;  3NPP A;  4FO2 A;  4IFD J;  1N32 Q;  1QNU A;  5BR8 Q;  1WOC A;  3K5N A;  2HHH L;  4RHR A;  3S15 H;  2F0H A;  1CT1 D;  2ICE C;  4ME3 A;  4XYQ A;  1TY0 A;  1EYA A;  2JEB I;  4GNX B;  1IBK Q;  1CA6 A;  2X6L A;  4P73 A;  4DUZ Q;  3BDL A;  5HY6 A;  3PIO A;  5IGB A;  1EY6 A;  1EZ8 A;  1GHJ A;  2JN4 A;  3GTM B;  1YJN A;  1HQM C;  1LTB D;  3RN2 A;  2I5L X;  3WDN A;  1R4Q B;  1YNX A;  4JI2 Q;  1IW7 D;  4IJH A;  2KJX A;  1F2M A;  4IFD I;  3E3X A;  4YCV A;  2A68 D;  4LAA A;  2WB1 E;  5EPJ A;  3UI2 A;  3A54 A;  1I50 H;  2LS0 1;  1KC8 C;  4LFB L;  1D6E C;  2KVM A;  1XNQ Q;  2R7Z G;  1TS4 A;  3ULL A;  3NTK A;  1EY5 A;  1Y8N B;  4LF5 Q;  4DV1 L;  2B2V A;  4OO1 G;  4HIM A;  1F9R A;  4DK6 C;  3I4O A;  3I72 A;  5M5X B;  1EFW A;  1E2V A;  1C9O A;  2VB3 X;  4FXG C;  1D1K A;  3ULJ A;  1N9W A;  1WCM H;  2CH4 A;  3ERS X;  1I6H B;  1G51 A;  1NY4 A;  1LT6 D;  3PIP A;  3J7A 5;  1UE1 A;  1GHK A;  1YI2 A;  2NBF A;  3KF8 B;  1C8C A;  2A73 B;  1K8O A;  1Y14 B;  1PFS A;  2XGT A;  3DXJ C;  3DM3 A;  3J80 L;  5GAE C;  4CDD C;  4A3C H;  4PQX A;  1U9R A;  2K33 A;  1WD0 A;  1JCK B;  4V0B A;  4DV4 Q;  1T5X D;  4IPD A;  2SEB D;  1S5B D;  5FOB B;  2WAQ G;  5F2D A;  2I5H A;  3S9W A;  2R6G A;  2EY6 A;  1TWH B;  4DNI A;  1HFN A;  4BBR B;  1WTR A;  1HA5 A;  2CCZ A;  4RFB A;  2F0P A;  1UWV A;  3CRL C;  3CXC A;  1L1O C;  2K5Q A;  2RDH A;  4TQU S;  4CKC A;  5JVH 3;  1S3O A;  2HCC A;  1ICW A;  4A3F G;  3FPU B;  4H7B A;  4HIK A;  1VQ7 A;  3B6Y A;  3OMC A;  2NZO A;  3ND9 A;  4EQ5 A;  4NXN Q;  2FHT A;  3H09 A;  2CWA A;  2N8N A;  3HOW B;  1P8L A;  1JQY D;  4GN4 B;  1HFG A;  2RA4 A;  2MFI A;  4EQP A;  2F4V Q;  4OIK A;  4C3J G;  5I9P A;  3TZD A;  2UUC L;  1ESF A;  4ABN A;  1BCP D;  2KQ3 A;  1Q7Y C;  1M8A A;  1E3P A;  3NEN A;  2O5J C;  1XWE A;  3S14 B;  5IYB H;  4IUP A;  1K83 B;  5EGT A;  2ZM6 Q;  5LMU L;  1KNE A;  2J7Z A;  4KY7 A;  3T4A C;  1L0Y B;  2R93 B;  2EPB A;  1FGU A;  2PW7 A;  2K01 A;  2LXJ A;  2E2D C;  1F9S A;  5LMN Q;  3P7J A;  1LT4 D;  1YEZ A;  2D5D A;  3BVM A;  5A2Q L;  1TT2 A;  5JVG 3;  1XTD A;  4X65 L;  1OXU A;  4K6L A;  3HS0 C;  4NMZ A;  4GKJ L;  2QF7 A;  3F2U A;  5C3W A;  4MIU A;  5KYI A;  1CKO A;  3K58 A;  4BY1 H;  1ENF A;  1O7Z A;  1T9H A;  1ENC A;  3F8T A;  4DR3 L;  4JYA Q;  1GO3 E;  1X55 A;  1SYB A;  5DM6 3;  4PG3 A;  1WFQ A;  1JB7 A;  2PI2 E;  4QGU A;  5KNC A;  1L0X B;  1ASZ A;  5IIF A;  1TQO A;  5C4X B;  2CHB D;  3BVG A;  2ZTD A;  3U50 C;  1A3V A;  4L5T A;  4BBS H;  5FJ8 G;  4B3T Q;  3ONA B;  3PV0 A;  1IYV A;  1CM9 A;  1JE4 A;  4I7Z C;  1JWM D;  3E9H A;  3G71 A;  2F0M A;  2KCM A;  2SNM A;  3FMC A;  4ULL A;  5GRO A;  3I4M B;  4BXX H;  5K36 G;  3M4Y A;  1VQM A;  1B8A A;  1HZC A;  4XQQ A;  3M85 A;  3RNU A;  4A3E G;  3BDC A;  3DHQ A;  4GN5 A;  1XNR Q;  4R4O A;  5IGC A;  5EAY A;  4OWT B;  2VB2 X;  4LF9 Q;  4R4I A;  4XDX A;  1BBW A;  1FL0 A;  1FNV A;  2F0W A;  1G2S A;  3HZX A;  4GLX A;  3I90 A;  5EJW A;  3T1Y Q;  1WTH A;  1WTX A;  4B3S Q;  1D1I A;  2PW5 A;  4A3J H;  3QG1 A;  5IYC H;  5DLQ E;  3G6J B;  2MPM A;  2KED A;  1EIG A;  2ZXP A;  4ZKC B;  2JA9 A;  2EXD A;  1TWC H;  1JWS D;  4LUV A;  5I2X A;  2NVQ H;  5FO7 B;  1WD1 A;  2PNR C;  1N34 Q;  4BY7 H;  4A3C G;  1Q12 A;  5HUR A;  4HED A;  2OQK A;  1ICF B;  1U4L A;  4JV5 Q;  3E6Z X;  2F0F A;  1RDP D;  5C0X J;  4XQN A;  3CAM A;  4UPA A;  1CK1 A;  4DK0 A;  3FP9 A;  1SYD A;  3HKZ B;  4RGN A;  1VQP A;  4NXM L;  1V1P A;  4YHH L;  2HHH Q;  2ES2 A;  1PH7 A;  2RSN A;  1XTC D;  1S5E D;  3SGI A;  5FKA C;  2KEN A;  1YNJ C;  1KRS A;  2RF4 A;  3I4N H;  3Q0A A;  2UXB L;  3KF6 A;  3GTP H;  1G29 1;  2UXC L;  4A3D G;  1H9M A;  3R8B A;  2D0O A;  4M1U B;  3NUC A;  4L63 B;  1HZA A;  1PH3 A;  4P74 A;  1FR3 A;  1BOS A;  1LTT D;  3I55 A;  3KLW A;  4JI4 Q;  3FRP B;  5C0X I;  4C3H G;  4A3K B;  1RCV D;  1K0S A;  2JYO A;  5JEA G;  1OXX K;  1EWH A;  4XIG S;  2B63 B;  5CBE E;  4OWX B;  1BR9 A;  2M9V A;  3E0J A;  5KRU A;  2R92 G;  1JOO A;  3VYT A;  1KRT A;  3AFQ A;  4DR7 L;  1J8I A;  1LM0 A;  4PMC A;  2LKV A;  3J80 i;  1JT8 A;  1HNW L;  2AQ1 B;  2L4N A;  1HUN A;  4R4T A;  5FO8 B;  4RGO S;  4PZ6 A;  5ELC A;  2E2J H;  4DV1 Q;  4A3I H;  4YY3 L;  1FD7 D;  4A3G B;  3NBH A;  5JOB A;  3VDY A;  1X3P A;  3E5S A;  1VQG A;  2K04 A;  2F0E A;  2B2V C;  2NTT A;  1SYF A;  3TS0 A;  4DR6 L;  3S2H H;  1PTO C;  1Q90 A;  1CHQ D;  1VQJ A;  5FLM G;  1MGS A;  3H0G B;  1HZ9 A;  1RTO A;  5T1G A;  1DYQ A;  1V43 A;  1WTQ A;  3BZC A;  1VQ6 A;  4FP5 D;  2EDG A;  3EJI A;  1Z6H A;  2EY5 A;  1A62 A;  3OHX C;  1Y1V H;  3LWU A;  1I3Q H;  3UDG A;  2QEJ C;  3CP0 A;  1LO5 D;  3F2B A;  1PZJ D;  5FK9 C;  5IT9 E;  1GOZ A;  4YWL A;  4B9X A;  1H9R A;  3MHB A;  4ZLT F;  1UUP A;  4A93 H;  3BDO A;  2JA8 B;  3NTH A;  1EY0 A;  1V1O A;  3NEL A;  4RGM A;  4CGY B;  2K75 A;  1GD7 A;  4LUZ A;  5HGQ A;  3CC2 A;  2F3W A;  1BDO A;  3K7A B;  1ML0 D;  2B2U A;  3S17 H;  1PRT B;  1I4Q A;  4N8F A;  5C3E B;  3IAY A;  2EJF C;  5HGT A;  1NSN S;  3SE0 A;  4AQY L;  1G6P A;  1HH2 P;  3D6C A;  2VY3 A;  4Y7N H;  2PQA B;  1L1O B;  1IKL A;  2ALY B;  3NE5 B;  5M5W B;  3J81 j;  4FXK C;  4K5X A;  2XTI A;  1LV9 A;  4RCO A;  3HOX H;  1IZ6 A;  5M3F H;  3KDF A;  4C1N K;  5LHY 1;  1EOT A;  3V96 A;  2AUK A;  4A3M G;  3M4O B;  2VUM G;  4RMF A;  3LNN A;  4HJA A;  3ER0 A;  2YU9 B;  1I4H A;  1VQF A;  4IZ8 A;  1TXY A;  1B9M A;  1B3Q A;  4MTK A;  4PZ8 A;  5LMU Q;  1BF4 A;  3C2P A;  5K5P A;  3L7Z C;  4HID A;  2WAC A;  4L8J A;  2RQX A;  1XYI A;  2NVX H;  1WTP A;  3U9O A;  1ET9 A;  1EU3 A;  3GTJ H;  4JBJ A;  4AYB G;  4RG1 A;  4YIJ A;  5E1F A;  2I0Q A;  3LGJ A;  3OOC A;  2VNU D;  2ZJR A;  1EQQ A;  1ENA A;  3SK5 A;  4S3S A;  2CH4 W;  3BZK A;  4GKJ Q;  5I6W A;  3NEM A;  1Y1W G;  3T16 A;  5ELO A;  4RKL A;  4C3I H;  4DR3 Q;  4R9W A;  3R2I A;  4NPS A;  4B3R Q;  3K80 C;  1HR0 L;  3M7N A;  1VQB A;  1U4M A;  4G57 A;  3F1Z A;  3AMU A;  4DAM A;  1NMF A;  2JA5 B;  3S1Q B;  2MO1 A;  4LUO A;  5G3L D;  1GUW A;  2RHS B;  2B3G A;  3URY A;  1I5F A;  2KUM A;  5M3M G;  1BNZ A;  1SFO B;  4X64 L;  4HAE A;  5DM7 3;  1YJ9 A;  3CD6 A;  2EYH A;  4KHV A;  2JA6 H;  2YTV A;  3I4L A;  1X54 A;  2J4X A;  3S24 A;  1PH5 A;  4ILW A;  3RLO A;  3GTO B;  1TKW B;  2KHJ A;  3KBG A;  4RCN A;  3PO2 H;  1UNS A;  3PCO B;  2ZJQ A;  5IGD A;  3KLS X;  4IFD G;  4A3I G;  2JP1 A;  1Z7T A;  1G8Z D;  5C44 G;  5CBA E;  2DUD A;  2F0S A;  4DR4 L;  2JA7 B;  4N8X 1;  3P1H A;  1YNJ D;  3CHB D;  3NSW A;  2QGQ A;  2RDF A;  2F0D A;  3T51 B;  4YWM A;  3CME A;  1SE8 A;  4O42 A;  1CKN A;  1TS2 A;  1PH2 A;  1RTN A;  5IWA L;  3VR5 A;  2F0J A;  1EYC A;  2A19 A;  5E4W C;  5IGG A;  3RN5 A;  4HJ7 A;  1IBM Q;  1EY8 A;  1OXS C;  3TP6 A;  3HKZ E;  2KOL A;  1KNA A;  2VZA A;  3ULP A;  3H91 A;  3GP7 A;  2CQO A;  2YTY A;  4H02 A;  3HOV G;  5D3I B;  3NXW A;  4BS9 A;  3J80 E;  4FF2 A;  5IP9 H;  1H9K A;  3HG9 A;  4B3M L;  1KDB A;  4O2D A;  4A93 G;  1X3Q A;  5EPK A;  1CSQ A;  4KN4 C;  4OL7 A;  3DMU A;  4YHH Q;  2UUA L;  1O78 A;  2WIN B;  1NR4 A;  1D8L A;  4I65 A;  1UEB A;  4XT3 B;  4KKU A;  1YBY A;  2K5N A;  1PTO D;  1MI2 A;  1VQ9 A;  4CJ1 B;  5IOC A;  1SE2 A;  2BH8 A;  1SBB B;  5ELD A;  1EQR A;  3S1R B;  1DJR D;  4BWG B;  2RBM A;  2WB1 G;  1GXD C;  3D4W A;  3G48 A;  2F3I A;  4NKL A;  3TRE A;  1N33 Q;  1RHP A;  4GKK Q;  2JK8 A;  3Q22 A;  3PO3 H;  3TQY A;  1L0W A;  1KTK A;  1VF7 A;  3W5O A;  1E1T A;  2XWJ B;  1Q3L A;  4N9P A;  1VQ4 A;  2XIW A;  3L0O A;  1LT3 D;  3CPF A;  1O7L A;  3S1N B;  2HQL A;  4OX9 L;  1NCV A;  2ZJP A;  2NVT H;  3GTK H;  1HNZ L;  4DR7 Q;  5CGK A;  4P72 A;  2TSS A;  2H5X A;  1J5E Q;  2XWB B;  3UDI A;  2JE6 I;  1HNW Q;  1FNU A;  2OF1 A;  5C0X H;  2E2I H;  3NQT A;  3PUW A;  2Z4H A;  3EA6 A;  5EKL A;  4JI0 L;  1EUJ A;  4X66 L;  1KIX A;  1HRJ A;  4DAY A;  4JBW A;  1Y69 U;  3TS2 A;  2NZH A;  2WAQ B;  3RUZ A;  4KY5 A;  1A3T A;  3BG3 A;  4CKB A;  1I4X A;  4DR6 Q;  1SR3 A;  4IAL A;  4K5V A;  1A15 A;  1STG A;  2WP8 J;  3DEP A;  5A2Q E;  4OON A;  1VQL A;  4C3I G;  4A3F B;  4EQN A;  1TWG B;  1EQV A;  1YIT A;  1PZI D;  4O1N A;  1PHJ A;  4C56 C;  3GTM H;  2B2T A;  2G9D A;  1Q8K A;  4B9W A;  3HOU G;  3GDE A;  1ZKO A;  1DXM A;  4ZQ3 A;  3KLS A;  3QIA A;  4C3J B;  3CC4 A;  3J80 c;  1OXT A;  4A75 A;  3WOF A;  2IL8 A;  4H44 C;  2K7V A;  2PI2 A;  2ZTC A;  2DJF C;  2JA6 G;  3QWN A;  3BYT B;  4MZ9 A;  2K1B A;  1HZB A;  1AP0 A;  2OTL A;  1PRT F;  4IUT A;  4X3K A;  4AQY Q;  1EY9 A;  1X6O A;  4K2K A;  2B2U C;  1HNX L;  4J8Q A;  4MNO A;  1O7I A;  4K5W A;  5M5X H;  3CCE A;  2R7D A;  2MNA A;  4HCE A;  4PMW A;  3TRZ A;  1U0L A;  1I6H H;  2MGS A;  2UU9 L;  4XXE A;  2N49 A;  3CF5 A;  2K4K A;  4L5S A;  1FJG Q;  2MQH A;  4JI3 L;  5I6Y A;  1AEX A;  2DNE A;  3HOZ G;  2L5T A;  1FGB D;  3I70 A;  1QVF A;  1D5X C;  1W6J A;  1KDC A;  5CV7 A;  2C5C A;  4JG2 A;  4KHZ A;  2A69 C;  3PUY A;  3MWY W;  4GOP C;  4CDF C;  4LF4 Q;  3HGB A;  4RA8 A;  3C3L A;  4HR7 B;  1TWH H;  2ZXR A;  4MHE A;  3UDX A;  1LTR D;  4FVM A;  4BBR H;  2Q2T A;  4JW0 A;  3OTO L;  1VQI A;  3EFX D;  2LXK A;  1PV4 A;  4A3E B;  1PLF A;  2D0P A;  1I4R A;  5JPN C;  4DK3 C;  1HR0 Q;  4F7X A;  4K0K Q;  4K14 A;  1K28 A;  4IOC A;  3HOW H;  4J1M A;  1YHB A;  3OPO A;  4EX5 A;  1TII D;  2OQ0 A;  4O0A A;  3VYS A;  3J7Y W;  4DV7 Q;  1SSO A;  1SNM A;  3VYU A;  5EKI A;  1W6K A;  4X64 Q;  1XMQ L;  3A5U A;  2EYP A;  3ZJY C;  1I94 L;  3S14 H;  4A3L H;  2X6G A;  4EQO A;  1O7Y A;  3N52 A;  1VMP A;  1K83 H;  5C0X G;  1Q46 A;  1F2L A;  4GS3 A;  4POF A;  1E7Z A;  5I9O A;  3UE1 A;  2R93 H;  4OEL B;  1DOK A;  4DR4 Q;  2AKW B;  2O4X A;  3D8G A;  1N36 L;  2VQE L;  4ZCK A;  4H13 C;  4R8I A;  3EN2 A;  2L9H A;  4CHT B;  1SNC A;  5IY0 A;  5TSS A;  3GD7 A;  3J7A F;  2EE1 A;  1C0A A;  2F0K A;  2RSO A;  5CMD A;  5KYL A;  4WJ3 M;  1XPO A;  4HJ9 A;  2L0C A;  3I3C A;  4JI6 L;  3MXN B;  4A3D B;  4K8J A;  1WI5 A;  3KBX A;  4R4C A;  2AQ2 B;  4GN3 B;  3MXG A;  2E2H B;  3H3V I;  4B3M Q;  1O80 A;  5C4X H;  4XTC S;  2ASB A;  2YTX A;  4JCV E;  3M4P A;  4C3H B;  1OTC A;  1S4Z A;  2UUA Q;  3KFU A;  4QUF A;  2D62 A;  1C7Y A;  2KHI A;  4UP7 A;  5G3L F;  2EZV A;  3R93 A;  4IUR A;  3IFT A;  5CV4 A;  3T1H Q;  2M00 A;  3I4M H;  4K6D A;  4FXD A;  5KGU A;  2QIL A;  1KAA A;  3AFP A;  1EWI A;  1GM5 A;  4HTH A;  1H95 A;  5A35 A;  3M7G A;  1J6Q A;  3HOY H;  4GZY C;  1QVC A;  5JJL A;  3Q8D A;  2Z0S A;  4A76 A;  4LW1 A;  1BCP B;  1EFI D;  1QB5 D;  1QVG A;  1X65 A;  2D9U A;  3SVM A;  2L55 A;  1B2T A;  2R7F A;  4IUQ A;  5J3B A;  1RF2 D;  3NHH A;  5KND A;  4J6H A;  4OX9 Q;  1ZYR C;  5ELN A;  2B2Y A;  3HOY B;  1HNZ Q;  2EYO A;  5IGF A;  1MIU A;  5CV6 A;  1Q82 C;  3JC6 6;  4EVO A;  4DK1 A;  1K3R A;  3A0J A;  3GTQ B;  1WCM G;  1H9J A;  4DR1 L;  1LYL A;  2CWP A;  4JI0 Q;  4CDE C;  4X66 Q;  2QCP X;  1DM0 B;  1CZW A;  1M90 C;  1L2F A;  1H9S B;  1N8R C;  2Y0S B;  1SMY C;  1U4R A;  4OIJ A;  5D65 A;  1EIY B;  4BBR G;  4YCW A;  4DV2 L;  3K8A A;  2J0T D;  1LUZ A;  2C35 B;  3RZO B;  1AE2 A;  4KMU C;  1V1Q A;  2F0N A;  4KY6 A;  3SHL A;  1VS0 A;  2KEE A;  4QF4 A;  3AB9 A;  1AZP A;  3NBH B;  2HQE A;  4TSS A;  2Z4I A;  4ALP A;  3G4S A;  3TEH B;  3PF5 A;  4U67 3;  4JI8 L;  3CPW A;  3TP5 A;  2QDB A;  2IW3 A;  3CQZ B;  4WRD A;  4ZAI A;  1PH9 A;  2B2T C;  1R9T B;  4XQJ A;  1VCI A;  3EQL C;  4A3K H;  2A69 D;  3E0E A;  4IUV A;  4IPC A;  2VXW A;  4QJF A;  1GUG A;  2B63 H;  1V8Q A;  1PMR A;  4A3M B;  2VUM B;  1CA5 A;  1PYB A;  1EOV A;  1XX8 A;  2IHF A;  3PMF A;  2O5I C;  3SDZ A;  1CFM A;  4HSP A;  2A6H C;  2FMM A;  2P5Z X;  4WFN 3;  1X9N A;  1Q1E A;  2R93 G;  2QW7 A;  3G7L A;  4A3G H;  2F0V A;  1I4P A;  1TWF B;  4K8I A;  4AYB B;  1CHP D;  2CVR A;  2NB0 A;  3WWV A;  5IYB G;  2YV5 A;  4R4Q A;  2XN9 C;  2UU9 Q;  4LFB Q;  2PO4 A;  3H0G H;  3QB3 A;  2SNS A;  1JJ2 A;  5GAG C;  5KIX A;  4MTN A;  5IOD A;  4JI3 Q;  2K50 A;  2PZW A;  4C1N I;  1F9Q A;  1F9P A;  1X3G A;  2EYJ A;  4AIM A;  2A5H A;  3HRZ C;  1K73 C;  2DN8 A;  4DXF A;  4LFA L;  1QUQ A;  2E5L L;  1TWA B;  5D3D A;  1B4O A;  3S16 B;  4JC0 A;  5JJZ A;  4DV6 L;  2B29 A;  4BY1 G;  1R4P B;  4IO9 A;  3HEJ A;  2JA8 H;  2DGY A;  3TZU A;  3S2D B;  4NDX A;  2DY8 A;  3SK8 A;  1ILP A;  1PXU A;  1F2Z A;  1S5F D;  2OT2 A;  1XMO L;  1D5Z C;  1A0I A;  3NWS A;  2NN6 H;  3NK9 A;  4DA2 A;  5M3M B;  3OTO Q;  2WKD A;  4A3B H;  5BN3 A;  2DNC A;  1NJI C;  1G2T A;  2FFK B;  3K7A H;  4FDB A;  1P16 A;  1HUM A;  5L37 A;  1AN8 A;  5C3E H;  3ICE A;  3U4V A;  5IP7 H;  4OXP A;  2AHO B;  4DV3 L;  3K5O A;  3PGZ A;  4BBS G;  3K0Y A;  1QZG A;  2UUB L;  1A2T A;  2H4O A;  3I8Z A;  2F0U A;  1IBL L;  1NMG A;  4A3B B;  1D2B A;  4CJ2 C;  1VDZ A;  1MHW C;  2KCT A;  3FVQ A;  5M5W H;  5BR8 L;  4GNX C;  4BXX G;  4DPG A;  4JI5 L;  5I4D A;  5IYD H;  1HA6 A;  3J7Z C;  2VQF L;  4QIW B;  4I7A A;  1UE7 A;  5M5Y B;  3TP7 A;  1IXR A;  1STE A;  2B8F A;  3M4O H;  1S5C D;  4CJ0 B;  2YU9 H;  1HTP A;  4KV6 A;  3HP3 A;  1Z9F A;  3NWT A;  2XVS A;  4A3J G;  5IYC G;  3HOV B;  2EY2 A;  2L1B A;  2UUC Q;  5FLX E;  4JPB W;  3BJU A;  5J22 A;  3HKZ G;  4CDC C;  4BY7 G;  5IGE A;  3IFD A;  2PZT A;  3C46 A;  1PFN A;  3U58 A;  4GOP A;  4X62 L;  5J1Z A;  1VQA A;  4KTA A;  1XNQ L;  2F0G A;  3X3N A;  4KHP L;  1CQV A;  1LTS D;  1UAP A;  4JI6 Q;  1EL0 A;  1ZYR D;  1SE3 A;  3H6M A;  2WB1 B;  4RWS C;  4X65 Q;  3BZD B;  1G91 A;  4X3U A;  5H1S E;  2JA5 H;  3S1Q H;  4OEM B;  3MAQ A;  1Q8I A;  2EYF A;  1PZK D;  3I4N G;  2VW9 A;  1KL9 A;  1QIL A;  2PMZ B;  3A74 A;  4HMJ A;  3C1F A;  2Z6K C;  1GUS A;  5ISR A;  2IY5 B;  1B7Y B;  1SFO H;  1SMY D;  1JOR A;  3CKI B;  4FF3 A;  1C48 A;  3H3V H;  5ELE A;  2MO0 A;  3FKI H;  1KAB A;  3GTO H;  3S1M B;  3A7A B;  3PF4 A;  2BCO A;  3SR1 A;  5DAU A;  1UEA B;  1SJE D;  2G9H D;  2V1C C;  3K57 A;  2KHS A;  5C4J B;  4A3G G;  3QJY A;  2JA7 H;  2RDG A;  2ENB A;  2PQA A;  1GVP A;  4RHS A;  1BCP F;  1BQQ T;  4K2L A;  3JAM c;  3E9I A;  3FKI B;  3OSO A;  3FEW X;  3H0G G;  1K8G A;  1DD2 A;  1QWY A;  1LTG D;  4C2M B;  3WOE A;  4Z9C B;  1A3U A;  1SNO A;  1ROD A;  2JQO A;  2Y0S E;  1BBX C;  4HN7 A;  2B2Y C;  4IUU A;  4QMG A;  4LK1 C;  4DR1 Q;  4Q0F A;  1TY2 A;  1PVO A;  3HOU B;  1EY4 A;  5KEE A;  2A1A A;  2F4V L;  2JA8 G;  2A6H D;  3CMA A;  2I46 A;  1Y1V G;  2HDM A;  1JIC A;  3GTL B;  1VQK A;  4DV2 Q;  1CI3 M;  1NE3 A;  2R61 A;  3NP8 A;  3D4D A;  5FLX c;  4ZUI A;  3T13 A;  1SYG A;  1ZEQ X;  3EIV A;  5M9O A;  3CW2 C;  2K03 A;  5IP7 G;  4XT1 B;  4DAY B;  4NXM Q;  4UHV A;  3S1R H;  1K0R A;  4OO1 H;  4DGZ A;  2F0T A;  2ZT9 C;  3KJO A;  3M3Y B;  3A56 A;  4JI8 Q;  2D2C C;  2K5V A;  5C4H A;  4IPG A;  2DY7 A;  1X3E A;  3JAM L;  4PV1 C;  5EBD A;  3Q6S A;  4LWC A;  2R7Z B;  3S1N H;  1WTV A;  1VMC A;  2UXB Q;  2UXC Q;  3MA2 B;  3RLF A;  4FF4 A;  3K5L A;  1JMC A;  2KCN A;  1CTM A;  1EYG A;  3CCQ A;  3GV3 A;  3DLL A;  3HOZ B;  1YNN C;  3CU7 A;  3A5Z B;  1II3 A;  2BDO A;  2PYK A;  3DUZ A;  3A8K E;  2FIN B;  3MZ5 A;  4X3T A;  3BU2 A;  3HOX G;  2Q8R E;  3QOJ A;  5M3F G;  4F8M A;  3PUZ A;  2DJG C;  1IYJ B;  2GA4 B;  2F3V A;  3MXP A;  3J81 c;  5FLX L;  4H0L C;  2NVY B;  4FYD A;  1JJG A;  1PH6 A;  5C6A A;  4PMB A;  1BKB A;  3OW2 A;  4YY3 Q;  5AFW A;  4A3F H;  1XNR L;  2QDL A;  1TWG H;  2NWG A;  4UP9 A;  4LFA Q;  1ZXT A;  3IRB A;  2E5L Q;  2OWO A;  3BVZ A;  3W1G A;  3PIP 3;  2K6A A;  3RMH A;  2JA5 G;  4KJO A;  3D31 A;  5CC4 A;  2Q8T A;  1MD2 D;  2K14 A;  4TKO B;  5GAD C;  4C3J H;  5FO9 B;  5EPL A;  4DNR B;  2NYZ D;  1MSG A;  1PTO B;  1XMO Q;  1KXL A;  1U4P A;  3AQQ A;  3MFG A;  1NAP A;  1KAW A;  1M4V A;  1MJE A;  1BO0 A;  2XNA C;  4HCS A;  3FPP A;  1K8M A;  1BXT A;  3K7U C;  3OWF A;  1KQS A;  5EKK A;  2UUB Q;  1UE5 A;  4QIW E;  1IBL Q;  3AEV A;  4KJN A;  3CC7 A;  1E22 A;  3J81 L;  4DNT B;  4JI5 Q;  3TBI B;  5LL6 S;  4G4K A;  3UE0 A;  2EOT A;  5CYU A;  2EXZ A;  3K0X A;  3PO2 G;  1HCZ A;  2VQF Q;  4LF8 L;  3M9B A;  4NP5 A;  1VQC A;  4DAV A;  3RZD B;  3I2Z A;  1EEI D;  1QNK A;  5GAH C;  3S15 B;  1EQT A; 
#chains in the Genus database with same CATH homology
 4ZRZ A;  2ID0 A;  5ELB A;  1LT5 D;  1B1Z A;  2IX0 A;  1TS3 A;  1SDF A;  3MEH A;  2FMC A;  1J9O A;  2NN6 I;  2NTS A;  4FF1 A;  3MC0 B;  5K36 H;  5CV8 A;  5COR A;  3IL8 A;  2IWH A;  4RGT A;  2PQE A;  2I07 B;  1B44 D;  2E76 C;  1SNP A;  1GUO A;  1PYW D;  5T1I A;  3CRK C;  5E3F A;  1I50 B;  4N9T A;  3KUP A;  3QOL A;  4ZYS A;  1TU2 B;  3D4R A;  2CW0 C;  3RD4 A;  3TP8 A;  2IX1 A;  3MTS A;  3IKJ A;  3T53 B;  1EIH A;  3K59 A;  1HHV A;  1WTW A;  1KDA A;  1WCM B;  4FNF A;  1Z47 A;  3ZYY X;  4RH6 A;  1PRT C;  2IX3 A;  2K05 A;  2E75 C;  1HTL D;  2HDL A;  2BDN A;  3X3M A;  4CKE A;  1CZG A;  5CV9 A;  5JPM C;  1JWU D;  1SND A;  1F77 A;  4G7H C;  1Y8O B;  3VR4 A;  4ZUJ A;  1YNN D;  2LFN A;  4PNY A;  1LAC A;  1AW7 A;  3GO5 A;  3KF8 A;  1LAB A;  2RVL A;  5JEA H;  4U68 A;  2BA1 A;  2BA0 A;  2A74 C;  4UAI A;  5BN5 A;  2OEO A;  2QKI C;  4P2C B;  4XYO A;  1EU4 A;  1JR0 D;  1SYE A;  3LX0 A;  1CQF A;  5COY A;  1DON A;  4UDU C;  2Q8I B;  4F87 A;  4X3S A;  1B9N A;  5EQ0 A;  2R92 B;  3PUX A;  2X69 A;  4IUN A;  1JB3 A;  2BE5 C;  1V1P B;  1HQR D;  1X32 A;  3SK6 A;  4QCL A;  2F0Q A;  4DU9 A;  5BN4 A;  3DWQ A;  3H3V C;  1TS5 A;  4BY1 B;  3O13 A;  3VR2 A;  2NUC A;  2B2W A;  2O2L D;  3TSS A;  4KKS A;  1C4Q A;  2A6E C;  5C5L A;  1KLG D;  1FYC A;  2L11 A;  3BS1 A;  3W3A A;  2CQA A;  5I2Y A;  3GQB A;  1QCB D;  4BBS B;  4LJZ C;  3P20 A;  2F0L A;  1ONL A;  4OO1 I;  3MXN A;  1S5D D;  2EY1 A;  1Y8P B;  4OHJ A;  1ILQ A;  4ME5 A;  3GV6 A;  2K32 A;  1HPC A;  2LY7 A;  3KK7 A;  1QJO A;  4TRD A;  1LTA D;  1SYC A;  5DEH A;  2KA7 A;  1PTO F;  2OXP A;  1E2Z A;  1STB A;  1A2U A;  3V05 A;  3W2D A;  4A3J B;  2XRQ D;  1TWC B;  1RD9 D;  2NVQ B;  5J39 A;  4BY7 B;  3I91 A;  4L6T B;  1LTI D;  4G7O C;  4KN7 C;  2E74 C;  2SDF A;  4BA2 I;  1KLU D;  3DWA A;  2CW0 D;  4DF7 A;  4OGQ C;  1GUT A;  5E4X A;  1SAP A;  2V4D A;  3TN2 A;  1Y1W B;  4ID6 A;  2ICI A;  1H9S A;  3I4N B;  4IN3 A;  3GTP B;  4NW2 A;  1PFM A;  1AZQ A;  3MFY A;  4WOR A;  1HXY D;  1PRT D;  1STY A;  4F88 A;  2F0I A;  4IQZ A;  3K5M A;  3Q23 A;  4MN3 A;  2N88 A;  4R8N A;  3A7L A;  2IPK D;  3J7A V;  3ERQ A;  4IFD H;  4KI0 A;  1I4G A;  1MBY A;  2L12 A;  4LMQ D;  2K5D A;  1QG7 A;  4CBV A;  4KKT A;  4DFA A;  1SJH D;  4DXG A;  2Z1C A;  3JAM E;  2E2J B;  4A3I B;  1PFB A;  2B39 A;  3TME A;  5C44 B;  1E2W A;  4KK7 A;  1OO9 B;  2PCF B;  3S2H B;  3R2T A;  4ZKB B;  2EJM A;  1QOH A;  2XSC A;  5NUC A;  3TDQ A;  2N55 A;  4ODG A;  1Y1V B;  5CV5 A;  1I3Q B;  3T56 B;  4E6I A;  1GJX A;  4HMI A;  4WJW A;  1SNQ A;  1WVL A;  1D5M C;  3OIQ A;  4KD4 A;  3DWP A;  4A93 B;  2WII B;  3A8I E;  4QUC A;  2H1E A;  1Q1B A;  2BE5 D;  2LMC B;  2R3Z A;  1VF5 C;  3KLR A;  2F1M A;  1SEB D;  5CR3 A;  1EZ6 A;  3S17 B;  2FJ2 A;  3MXU A;  1OXV A;  2WKC A;  1EWC A;  1TVX A;  1ET6 A;  4Y7N B;  2MP1 A;  2PPB C;  2JSO A;  1WTO A;  3OWE B;  1STH A;  2F4I A;  2A6E D;  2KCC A;  1FNW A;  3SEB A;  3HOX B;  5M3F B;  2SOB A;  3NTI A;  2F03 A;  2EJG C;  5JEA J;  3VYR A;  1BUV T;  3V2T A;  4BA1 I;  3J81 E;  1G6Z A;  1EYD A;  4RAU C;  2TMP A;  1IW7 C;  1IYU A;  1STA A;  2NVX B;  1B3A A;  2A68 C;  3GTJ B;  2EYL A;  1NUC A;  3OMG A;  2F0O A;  4HSV A;  1AFP A;  1GUN A;  3LWE A;  4RKB A;  3VR6 A;  3FDT A;  3VA5 A;  4EGV A;  4C3I B;  2ZXO A;  3EVQ A;  2M2L A;  4Q5V A;  1DOM A;  2MHV A;  1QE6 A;  2B2W C;  2JXM B;  1JOQ A;  2YYZ A;  1PDQ A;  3VR3 A;  2AQ3 B;  3VA7 A;  3A8J E;  3GTG B;  4G7Z C;  3DEO A;  1E0B A;  1JC7 A;  1I6V C;  1XXG A;  3K6O A;  4M8A A;  2NN6 G;  1EY7 A;  3N6R A;  1SE4 A;  3R3O A;  2C9O A;  2JA6 B;  4QB4 A;  2K28 A;  5C3X A;  3OW7 A;  1DOL A;  3PO2 B;  2NZ1 D;  2HCI A;  4JK1 C;  1ESR A;  1STN A;  3Q24 A;  3MVV A;  1DZ1 A;  3AU7 A;  1EEF D;  2BOS A;  3D6W A;  5C4Z A;  2PZU A;  2EVB A;  1T5E A;  1RKN A;  1B53 A;  3D3R A;  3PIO 3;  2XRS D;  1NR2 A;  1F2Y A;  1IHZ A;  2AUJ D;  3L9A X;  3NBI A;  3L3O C;  5DNF A;  3NQI A;  5IT9 L;  1SXT A;  3OIP A;  1B50 A;  1MSH A;  2HUG A;  3SK4 A;  3SXH A;  2KEC A;  1BCP C;  3ITP A;  2B8G A;  1IKM A;  5JAV A;  5EBC A;  1JOK A;  1TR5 A;  3U9S A;  3H94 A;  2MUY A;  2EYM A;  3C1E A;  2RKS A;  4KD3 A;  3DM1 A;  5LL6 X;  5C5M A;  1A6X A;  1PTO H;  3QO2 A;  3PUV A;  3ND8 A;  1RJT A;  3PO3 B;  4V19 0;  2IJ0 A;  2AWN A;  4ZK9 B;  2WV6 D;  3I73 A;  2K5W A;  2NVT B;  5ELF A;  4B08 A;  3GTK B;  5KNB A;  4DAP A;  1LLR D;  2IT1 A;  4DN4 M;  3A55 A;  2Z8L A;  3ERO A;  2E2I B;  1DCZ A;  3BYY B;  1IL8 A;  2AWO A;  2JEA I;  3P75 A;  5D14 A;  2MJ8 A;  3NPP A;  4FO2 A;  4IFD J;  1QNU A;  3K5N A;  4RHR A;  2F0H A;  1CT1 D;  2ICE C;  4XYQ A;  1TY0 A;  1EYA A;  2JEB I;  1CA6 A;  2X6L A;  3BDL A;  5IGB A;  1EY6 A;  1EZ8 A;  1GHJ A;  3GTM B;  1HQM C;  1LTB D;  3WDN A;  1R4Q B;  1IW7 D;  2KJX A;  1F2M A;  4IFD I;  2A68 D;  4LAA A;  5EPJ A;  3UI2 A;  3A54 A;  2LS0 1;  1D6E C;  2KVM A;  1TS4 A;  3NTK A;  1EY5 A;  1Y8N B;  2B2V A;  4OO1 G;  1F9R A;  3I72 A;  5M5X B;  1E2V A;  2VB3 X;  4FXG C;  1D1K A;  1I6H B;  1LT6 D;  1GHK A;  2NBF A;  1C8C A;  2A73 B;  1K8O A;  3DXJ C;  3J80 L;  4PQX A;  1U9R A;  2K33 A;  1WD0 A;  1JCK B;  4V0B A;  1T5X D;  2SEB D;  1S5B D;  5FOB B;  5F2D A;  3S9W A;  2R6G A;  2EY6 A;  1TWH B;  1HFN A;  4BBR B;  1WTR A;  1HA5 A;  4RFB A;  2F0P A;  3CRL C;  2K5Q A;  2RDH A;  4TQU S;  4CKC A;  5JVH 3;  2HCC A;  1ICW A;  3FPU B;  4H7B A;  3OMC A;  3ND9 A;  2FHT A;  3H09 A;  3HOW B;  1JQY D;  1HFG A;  2RA4 A;  4EQP A;  4OIK A;  4C3J G;  5I9P A;  3TZD A;  1ESF A;  4ABN A;  1BCP D;  2KQ3 A;  1M8A A;  2O5J C;  1XWE A;  3S14 B;  4IUP A;  1K83 B;  5EGT A;  1KNE A;  2J7Z A;  4KY7 A;  3T4A C;  1L0Y B;  2R93 B;  2EPB A;  2PW7 A;  2K01 A;  2E2D C;  1F9S A;  3P7J A;  1LT4 D;  2D5D A;  3BVM A;  5A2Q L;  1TT2 A;  5JVG 3;  1OXU A;  4K6L A;  3HS0 C;  4NMZ A;  2QF7 A;  3F2U A;  5C3W A;  4MIU A;  5KYI A;  3K58 A;  1ENF A;  1O7Z A;  1ENC A;  1SYB A;  5DM6 3;  5KNC A;  1L0X B;  5IIF A;  1TQO A;  5C4X B;  2CHB D;  3BVG A;  1A3V A;  3ONA B;  3PV0 A;  1IYV A;  1CM9 A;  1JE4 A;  4I7Z C;  1JWM D;  2F0M A;  2SNM A;  3FMC A;  4ULL A;  3I4M B;  5K36 G;  3M4Y A;  4XQQ A;  3M85 A;  3BDC A;  3DHQ A;  5IGC A;  2VB2 X;  4XDX A;  1FNV A;  2F0W A;  1G2S A;  3HZX A;  3I90 A;  5EJW A;  1WTX A;  1D1I A;  2PW5 A;  3QG1 A;  3G6J B;  2MPM A;  2KED A;  1EIG A;  2ZXP A;  4ZKC B;  1JWS D;  5I2X A;  5FO7 B;  1WD1 A;  2PNR C;  1Q12 A;  5HUR A;  4HED A;  1U4L A;  3E6Z X;  2F0F A;  1RDP D;  5C0X J;  4XQN A;  1CK1 A;  4DK0 A;  1SYD A;  3HKZ B;  4RGN A;  1V1P A;  2RSN A;  1XTC D;  1S5E D;  5FKA C;  1YNJ C;  3Q0A A;  1G29 1;  1H9M A;  3R8B A;  4M1U B;  3NUC A;  4L63 B;  1FR3 A;  1BOS A;  1LTT D;  3FRP B;  5C0X I;  4C3H G;  4A3K B;  1RCV D;  2JYO A;  5JEA G;  1OXX K;  1EWH A;  4XIG S;  2B63 B;  5CBE E;  1BR9 A;  2M9V A;  3E0J A;  5KRU A;  1JOO A;  3VYT A;  1J8I A;  4PMC A;  2LKV A;  2AQ1 B;  2L4N A;  1HUN A;  5FO8 B;  4RGO S;  5ELC A;  1FD7 D;  4A3G B;  3NBH A;  5JOB A;  1X3P A;  3E5S A;  2K04 A;  2F0E A;  2B2V C;  2NTT A;  1SYF A;  1PTO C;  1Q90 A;  1CHQ D;  1MGS A;  3H0G B;  1RTO A;  5T1G A;  1DYQ A;  1V43 A;  1WTQ A;  4FP5 D;  2EDG A;  3EJI A;  1Z6H A;  2EY5 A;  3OHX C;  3LWU A;  2QEJ C;  1LO5 D;  1PZJ D;  5FK9 C;  5IT9 E;  1GOZ A;  4B9X A;  1H9R A;  3MHB A;  4ZLT F;  1UUP A;  3BDO A;  2JA8 B;  3NTH A;  1EY0 A;  1V1O A;  4RGM A;  4CGY B;  2F3W A;  1BDO A;  3K7A B;  1ML0 D;  2B2U A;  1PRT B;  1I4Q A;  5C3E B;  3IAY A;  2EJF C;  5HGT A;  1NSN S;  3SE0 A;  3D6C A;  1IKL A;  3NE5 B;  5M5W B;  4FXK C;  4K5X A;  1LV9 A;  4RCO A;  4C1N K;  5LHY 1;  1EOT A;  3V96 A;  2AUK A;  3M4O B;  3LNN A;  2YU9 B;  1I4H A;  4IZ8 A;  1B9M A;  1BF4 A;  3C2P A;  5K5P A;  3L7Z C;  2WAC A;  4L8J A;  2RQX A;  1XYI A;  1WTP A;  3U9O A;  1ET9 A;  1EU3 A;  4YIJ A;  5E1F A;  3OOC A;  2VNU D;  1ENA A;  3SK5 A;  4S3S A;  5I6W A;  3T16 A;  4RKL A;  4R9W A;  3R2I A;  3M7N A;  1U4M A;  4G57 A;  3AMU A;  2JA5 B;  3S1Q B;  5G3L D;  1GUW A;  3URY A;  2KUM A;  1BNZ A;  1SFO B;  4HAE A;  5DM7 3;  2EYH A;  4KHV A;  3I4L A;  2J4X A;  4ILW A;  3GTO B;  1TKW B;  3KBG A;  4RCN A;  1UNS A;  5IGD A;  3KLS X;  4IFD G;  2JP1 A;  1Z7T A;  1G8Z D;  5CBA E;  2F0S A;  2JA7 B;  3P1H A;  1YNJ D;  3CHB D;  3NSW A;  2RDF A;  2F0D A;  3T51 B;  4O42 A;  1TS2 A;  1RTN A;  3VR5 A;  2F0J A;  1EYC A;  5IGG A;  5E4W C;  1EY8 A;  1OXS C;  3TP6 A;  2KOL A;  1KNA A;  3H91 A;  3GP7 A;  5D3I B;  3NXW A;  4BS9 A;  3J80 E;  4FF2 A;  1H9K A;  3HG9 A;  1KDB A;  1X3Q A;  5EPK A;  4KN4 C;  4OL7 A;  3DMU A;  1O78 A;  2WIN B;  1NR4 A;  4I65 A;  4XT3 B;  4KKU A;  1PTO D;  1MI2 A;  4CJ1 B;  5IOC A;  1SE2 A;  1SBB B;  5ELD A;  3S1R B;  1DJR D;  4BWG B;  2RBM A;  1GXD C;  3D4W A;  4NKL A;  1RHP A;  3Q22 A;  1KTK A;  1VF7 A;  2XWJ B;  1Q3L A;  4N9P A;  2XIW A;  1LT3 D;  1O7L A;  3S1N B;  1NCV A;  5CGK A;  2TSS A;  2XWB B;  2JE6 I;  1FNU A;  2OF1 A;  5C0X H;  3NQT A;  3PUW A;  2Z4H A;  3EA6 A;  5EKL A;  1HRJ A;  4DAY A;  4JBW A;  1Y69 U;  2WAQ B;  3RUZ A;  4KY5 A;  1A3T A;  3BG3 A;  4CKB A;  1I4X A;  4IAL A;  4K5V A;  1A15 A;  1STG A;  2WP8 J;  3DEP A;  5A2Q E;  4C3I G;  4A3F B;  4EQN A;  1TWG B;  1EQV A;  1PZI D;  4O1N A;  4C56 C;  2B2T A;  2G9D A;  4B9W A;  1ZKO A;  1DXM A;  4ZQ3 A;  3KLS A;  3QIA A;  4C3J B;  1OXT A;  3WOF A;  2IL8 A;  4H44 C;  2K7V A;  3QWN A;  3BYT B;  2K1B A;  1AP0 A;  1PRT F;  4IUT A;  4X3K A;  1EY9 A;  4K2K A;  2B2U C;  4J8Q A;  4K5W A;  4HCE A;  4PMW A;  2MGS A;  4XXE A;  5I6Y A;  1AEX A;  2DNE A;  2L5T A;  1FGB D;  3I70 A;  1D5X C;  1W6J A;  1KDC A;  5CV7 A;  2C5C A;  4KHZ A;  2A69 C;  3PUY A;  3MWY W;  3HGB A;  4RA8 A;  3C3L A;  4HR7 B;  2ZXR A;  4MHE A;  1LTR D;  4FVM A;  3EFX D;  4A3E B;  1PLF A;  1I4R A;  5JPN C;  4F7X A;  4K14 A;  4J1M A;  3OPO A;  1TII D;  3VYS A;  3J7Y W;  1SSO A;  1SNM A;  3VYU A;  5EKI A;  1W6K A;  2EYP A;  2X6G A;  4EQO A;  1O7Y A;  3N52 A;  1VMP A;  5C0X G;  1F2L A;  5I9O A;  1DOK A;  2O4X A;  3D8G A;  4H13 C;  4R8I A;  2L9H A;  4CHT B;  1SNC A;  5TSS A;  3GD7 A;  3J7A F;  2EE1 A;  2F0K A;  2RSO A;  5CMD A;  5KYL A;  2L0C A;  3I3C A;  4A3D B;  4K8J A;  3KBX A;  2AQ2 B;  2E2H B;  3MXG A;  1O80 A;  4XTC S;  4C3H B;  1S4Z A;  4QUF A;  2D62 A;  5G3L F;  2EZV A;  3R93 A;  4IUR A;  3IFT A;  5CV4 A;  2M00 A;  4K6D A;  4FXD A;  5KGU A;  2QIL A;  1KAA A;  4HTH A;  5A35 A;  3M7G A;  4GZY C;  1BCP B;  1EFI D;  1QB5 D;  3SVM A;  2D9U A;  2L55 A;  1B2T A;  4IUQ A;  1RF2 D;  3NHH A;  5KND A;  4J6H A;  1ZYR C;  2B2Y A;  3HOY B;  2EYO A;  5IGF A;  5CV6 A;  4EVO A;  4DK1 A;  3GTQ B;  1H9J A;  2QCP X;  1DM0 B;  1CZW A;  1H9S B;  2Y0S B;  1SMY C;  1U4R A;  4OIJ A;  5D65 A;  2J0T D;  3RZO B;  4KMU C;  2F0N A;  4KY6 A;  3SHL A;  2KEE A;  4QF4 A;  3AB9 A;  1AZP A;  2HQE A;  4TSS A;  2Z4I A;  4U67 3;  3TP5 A;  2QDB A;  2IW3 A;  3CQZ B;  4WRD A;  4ZAI A;  2B2T C;  1R9T B;  4XQJ A;  1VCI A;  3EQL C;  2A69 D;  4IUV A;  2VXW A;  1GUG A;  1V8Q A;  1PMR A;  4A3M B;  2VUM B;  1CA5 A;  1XX8 A;  3PMF A;  2O5I C;  3SDZ A;  1CFM A;  4HSP A;  2A6H C;  2FMM A;  4WFN 3;  1Q1E A;  3G7L A;  2F0V A;  1I4P A;  1TWF B;  4K8I A;  4AYB B;  1CHP D;  2CVR A;  2NB0 A;  2XN9 C;  2PO4 A;  3QB3 A;  2SNS A;  5KIX A;  5IOD A;  2PZW A;  4C1N I;  1F9Q A;  1F9P A;  2EYJ A;  2A5H A;  3HRZ C;  2DN8 A;  4DXF A;  1TWA B;  5D3D A;  1B4O A;  3S16 B;  5JJZ A;  1R4P B;  3HEJ A;  3TZU A;  3S2D B;  4NDX A;  2DY8 A;  3SK8 A;  1ILP A;  1PXU A;  1F2Z A;  1S5F D;  2OT2 A;  1D5Z C;  3NWS A;  5M3M B;  2NN6 H;  3NK9 A;  4DA2 A;  2WKD A;  5BN3 A;  2DNC A;  1G2T A;  2FFK B;  1HUM A;  1AN8 A;  3K5O A;  3K0Y A;  1A2T A;  2H4O A;  3I8Z A;  2F0U A;  4A3B B;  1D2B A;  4CJ2 C;  1VDZ A;  3FVQ A;  5I4D A;  1HA6 A;  4QIW B;  5M5Y B;  3TP7 A;  1STE A;  2B8F A;  1S5C D;  4CJ0 B;  1HTP A;  4KV6 A;  3HP3 A;  3NWT A;  2XVS A;  3HOV B;  2EY2 A;  2L1B A;  5FLX E;  5J22 A;  5IGE A;  3IFD A;  2PZT A;  3C46 A;  1PFN A;  5J1Z A;  4KTA A;  2F0G A;  3X3N A;  1CQV A;  1LTS D;  1UAP A;  1EL0 A;  1ZYR D;  1SE3 A;  3H6M A;  2WB1 B;  4RWS C;  3BZD B;  1G91 A;  4X3U A;  3MAQ A;  1Q8I A;  2EYF A;  1PZK D;  1QIL A;  2PMZ B;  4HMJ A;  3C1F A;  1GUS A;  5ISR A;  1SMY D;  1JOR A;  3CKI B;  4FF3 A;  1C48 A;  5ELE A;  1KAB A;  3S1M B;  3A7A B;  2BCO A;  3SR1 A;  5DAU A;  1UEA B;  1SJE D;  2G9H D;  3K57 A;  2KHS A;  5C4J B;  3QJY A;  2RDG A;  2ENB A;  4RHS A;  1BCP F;  1BQQ T;  4K2L A;  3FKI B;  3OSO A;  3FEW X;  1DD2 A;  1QWY A;  1LTG D;  4C2M B;  3WOE A;  4Z9C B;  1A3U A;  1SNO A;  1ROD A;  1BBX C;  4HN7 A;  2B2Y C;  4IUU A;  4QMG A;  4LK1 C;  4Q0F A;  1TY2 A;  3HOU B;  1EY4 A;  5KEE A;  2A6H D;  2I46 A;  2HDM A;  1JIC A;  3GTL B;  1CI3 M;  2R61 A;  3NP8 A;  3D4D A;  4ZUI A;  3T13 A;  1SYG A;  1ZEQ X;  5M9O A;  2K03 A;  4XT1 B;  4OO1 H;  4DGZ A;  2F0T A;  2ZT9 C;  3M3Y B;  3A56 A;  2D2C C;  5C4H A;  2DY7 A;  3JAM L;  4PV1 C;  5EBD A;  3Q6S A;  2R7Z B;  1WTV A;  1VMC A;  3MA2 B;  3RLF A;  4FF4 A;  3K5L A;  2KCN A;  1CTM A;  3HOZ B;  3GV3 A;  1YNN C;  3CU7 A;  1II3 A;  2BDO A;  2PYK A;  3DUZ A;  3A8K E;  2FIN B;  3MZ5 A;  4X3T A;  2Q8R E;  3QOJ A;  4F8M A;  3PUZ A;  2GA4 B;  2F3V A;  3MXP A;  5FLX L;  4H0L C;  2NVY B;  4FYD A;  5C6A A;  4PMB A;  5AFW A;  2NWG A;  1ZXT A;  3BVZ A;  3PIP 3;  2K6A A;  3RMH A;  4KJO A;  3D31 A;  5CC4 A;  2Q8T A;  1MD2 D;  4TKO B;  5FO9 B;  5EPL A;  4DNR B;  2NYZ D;  1MSG A;  1PTO B;  1U4P A;  3MFG A;  1NAP A;  1M4V A;  1BO0 A;  2XNA C;  4HCS A;  3FPP A;  1K8M A;  1BXT A;  3OWF A;  5EKK A;  4KJN A;  3J81 L;  4DNT B;  3TBI B;  5LL6 S;  4G4K A;  2EOT A;  5CYU A;  2EXZ A;  1HCZ A;  4NP5 A;  4DAV A;  3RZD B;  1EEI D;  1QNK A;  3S15 B;  1EQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...