1EZSA

Crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
131
structure length
125
Chain Sequence
PYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTAYYVFDKVSSPVSTRMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords ECOTIN
total genus 16
structure length 125
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ezsA00
1IFGA 1P0SE 1XXFC 1ECZA 1SLWA 1XXDC 1N8OE 1EZUA 1ID5I 1SLVA 1EZSA 2Y6TE 4NIYE 4IW4C 1XX9C 1SLUA 1ECYA 1SLXA 1FI8C 1AZZC
chains in the Genus database with same CATH superfamily
2VQ1A 1HHHA 1KJ2B 2FBJH 2X9WA 5FM5O 5HTSA 3QXTA 2TRYA 1VFAB 5DZPA 1E5AA 3DMMA 1NPJA 2PW1B 3V6FB 1J8HA 2C9AA 5C71A 4DP8X 1ZT7A 2OA9A 4XRCA 4PMFA 1TIUA 1JI1A 4KX7A 3NA9H 3FUKA 5IHHA 1UXMA 1PKOA 3SYOA 1K2DB 1S9VA 4X8CA 4RDBA 4XVOA 2C9VA 4GXUN 3FT9A 2HX9A 4TUJB 2NW2B 4XMUA 6FABL 4HXBL 2H6PB 5E9DA 3GSXB 3SDCA 4XAWL 4JLRB 3GSRA 4WSJA 4KTDL 4WSGA 5IVXE 5ITFA 1VGKB 5AVUB 5I75B 5I74C 1WTGT 3MJ6A 2A6IB 2J8HA 3V5KB 1RZ7H 2IWEA 2J4WL 4LCWE 4HVBA 1CK0H 3SE9H 5C0JB 1IZKA 1KXTA 5CCGE 4QT5B 1FYTA 3QRGH 4HWEL 1SHSA 2BDNH 4FTDA 4PG9A 5HHQB 1ZT4B 4IOFD 5L9DL 1DBBH 3DXAE 1DEEA 3DYOA 4GKZA 2L7UA 1WH0A 5KAQF 2SEBA 3QDMB 3S37X 2YRZA 4N0RA 1SPDA 3A4EA 1ASPA 3PWNA 3TH4T 1SJHA 1XGYL 4UAOB 1JK9A 3FFOA 3IFPA 1SDAB 1CR9H 1V7NH 4BKTC 2VDKH 5EORL 3GI9H 1NIDA 3Q2LA 4D0DB 3GSOA 2VXQA 3T4AC 5DQDH 4QAMB 5FM8A 3WKQA 3UAAA 4HOXA 5J1AB 1D5MB 4WUUD 2EDNA 4E68A 5FKAB 1BPLB 4G80A 1UENA 2BY1A 4HQQL 4OSUH 4Z5RA 2MNWA 2ZOTA 3OC5A 4NC2B 4QGYA 4WSKA 5BOPA 3BX7C 3SQBA 2PO6A 4R90H 4AENB 2IDTA 5AAWA 3PXLA 2HB0A 4NQQA 4O9HL 4CVWA 5FHAL 2KDGA 3VXUA 1Q9OB 3GKWH 4N5EC 4Y5VC 1FRGH 4L5FL 4UNVA 4EPSA 4DZ8A 5D7EA 3BWSA 1G1OA 4WEMB 2XVBA 1BQRA 4M61A 5ADPL 4JZJB 3NSCA 4PJ9B 4CKVX 1DQML 3F62A 1U36A 3V2AR 1OCCB 1KXVC 1XIWB 5KANI 3ATEA 5KJRL 4LAQH 5DHDA 3QNFA 3BC9A 4XMVA 1DFBH 1QBMH 4JFWA 4XCFL 3GHBH 1CCZA 3C5ZC 3E0GA 4Z18A 5I0XA 2VLMD 1EZVX 3QHZL 4LCYA 4ZO7A 5JZ7C 3BZ5A 1A6AA 3UTOA 3RVXD 3EFFA 1IBDA 3SD5A 3S8WA 2XQBL 1NGXA 3PABB 3TFBA 3FT1A 4FKHA 5DVNA 4BUGA 3KZ8A 4LPVA 3VWJC 2AEQH 3UYPB 4YXKH 1FLRL 4AV0A 1IX2A 1L4IA 2UY7B 2M26A 4RWHA 5DHVA 1SDDB 3ATBA 4KXZH 4NT6B 5F9OH 5IT2L 5JOPD 1E2ZA 2MQCA 2YQ3A 1JHTB 3EJPA 4NFBA 1M7XA 4I0PB 4NNYA 1AD0A 3T2LA 5GRWA 1I75A 4PJDF 3RFRA 1VADA 3OAUH 4A7GF 1Z6JT 4Y16C 3QHFL 4FS0A 1XEUA 2H5UA 3GFUA 3NJLA 4TNEA 3C2AH 1B0IA 1OW0A 2AK4B 3IRPX 3MXVH 4DUWA 2WLNA 2HVKA 3LDBC 1X44A 3B9AA 3V4VB 1DSFL 3QZBA 1CVRA 1N3NB 1QW9A 5IHUH 5LBSA 3WFDH 5AD0A 3FT2A 1XCWA 1LP9A 2A0LD 1UJ3B 2CJ3A 2AS5M 1OSPH 2Y5QA 4HKJB 2RA1A 3OXRA 2J2ZA 4OLWH 3U30B 1GS7A 1LK2B 1DJYA 2GTWB 4Y4HB 4F92B 3W37A 4QHNA 5LAXA 2APVA 3WFZA 4J3OF 1FG9C 4LU5H 1MCJA 1VPOH 1J8KA 2XPGA 4FXKC 1JGVL 3EFOA 4KKQA 4XN2A 3PV6B 1XAUA 2Y06L 1V27A 3ZZ1A 1NCGA 2X4QA 3CVHH 2H45A 4WI2A 1U2CA 4N26A 4C83B 2X0VA 2FJHA 3EAKA 1FH2A 1WAPA 2WYHA 4O9HH 1A64A 2V7NB 4NZUL 5B4MD 4AKPA 5JPNC 4PJ8C 4PJ5B 5JIQA 4PUBL 4XHJD 3MRGB 2EDRA 5CLXA 3KLLA 1E5UI 4CC1A 2GITA 1BZ9A 3WSQH 3T4YB 1NEZG 3TYGL 1ZPUA 3RKDC 3INOA 1D5IH 3VGAC 5GSVB 3MLTA 2P44B 2WIMA 1UB6A 3MZGB 1WAEA 1MQKH 1WBYA 5I8EB 4PREB 1IE4A 2OTWB 1OAYL 2YAOA 5EWIH 2P5PA 1A4KA 4KXBA 5CZRA 3ZDYE 1XF5B 4NQEB 3NZ8B 4LFHD 4A6YA 5D93C 3RJOA 2XG4A 4CJ1A 4G1EA 1INQB 3NJXA 3FO2B 3QJSB 4YVUA 2VXVL 1T0NB 2JCWA 1KGIA 3B7YA 1V3JA 2OJZH 2ZKMX 3LRGA 3SE4A 3NCFB 3V9CA 4XP5L 4DETA 4XC3H 3MTRA 5HPMB 5E8OB 1KCUH 1ROWA 5TDPA 1ORQB 4A2HA 3NT0A 1THAA 3HRZA 5IREA 4M5YL 2FT7A 2R2HA 1FQ9C 5I2IA 1KCBA 3FT4A 2V5TA 2R2BA 3IGAA 1IAKB 1O7SA 2ZQKA 4IKJA 4MA3B 4GSUA 4QD2E 3ZMRA 1JPEA 3D39D 4UQ9A 5T1LD 3WFHA 2AJUL 4YHOH 1B3IA 9PCYA 3WO4C 4YDIH 5AVVB 1KPUB 5MP6H 4IBUA 5C0BD 2W59A 2Z4TA 5GGSA 5EPMA 2QVTA 1B9ZA 3EW3B 1KC5H 4LCCA 2FAUA 3KCPA 4XP9H 4XNUH 4WWOA 3T3PB 4M4PA 3FFCD 1BVKB 4YPGB 1IO4C 2EQDA 5DF0A 1H6EA 4IBQA 4YWGL 4RA0C 4JFFA 4NQDA 2CK0L 2AGJL 4RGNB 4BA8A 2DM2A 2ZYSA 3FB8B 3ALPA 3DDGA 5BUAA 3CPUA 4PHXA 3FUDA 2JJTC 4K94H 1HX0A 4FLOA 4N5UA 3PXJA 2BJMH 2VYRE 2YPKA 2GJZA 4M03A 4CW1B 4JPVH 3G3LA 4L2YA 1UM5L 5CGYD 2AJYH 3UBXB 2W0LA 4PTTA 2JLPA 4Z8FL 1XR8B 2MCMA 5BQ7B 1L9NA 4PGEB 1G43A 1SJVA 3L5WB 3BQUB 2RFXA 2XV3A 3PJNA 1G6RA 3VXMA 4HGMA 2QSQA 3DRQB 1FN4B 1JGLH 5AVYB 4JFHE 3MUZ1 4BA0A 1JERA 1N64H 4TNWK 3QDAA 3LPPA 1F1DA 1JPFA 2ZWSA 2GK0B 5ALCL 1VGEH 1QNZH 1Y1UA 3ESNA 4BFEA 3KVPA 4HUUA 1YC7A 3D0VA 5JHMA 4JKPH 3SBWA 2ZX6A 3S48A 2CIKB 1A6TB 1E4WL 1JHKH 1FWXA 3OMAB 3GXPA 4K2UH 3GIVB 5GGUB 3RWIA 5IFJB 1PG7L 1F5WA 2EEBA 1S78D 1IAMA 2FUQA 1A1NA 2HH0L 3SGDI 4HC1L 4MMZA 4X50A 2EUVA 5BRZD 4CC4A 4PBDA 4ALAC 3DPBB 4K3DL 4KTYA 4FFZH 2R1WA 1GGCH 1RL1A 1ETZB 3TFKC 3OMNB 3HB3B 4FQXD 2K8MA 1T04B 3ETBF 3MCLL 2YBGA 2YPLE 2Y0SA 3VWKB 2MKLC 1DDHA 4NKOB 2OZ4A 2BMKB 1MW0A 3V95A 1TQSA 5ECGA 4JKNA 2DQEH 4LNRA 2F54A 1ZXQA 4NFDA 3S4SB 5I15L 5IIEB 3X1FA 3QAZC 5JXED 1KBGH 2B20A 2DQHL 3TBVB 2BSRB 3WFDL 2AJXL 2GEEA 4H8VA 1BVLA 3N0AA 4N3UA 5EOQL 4EVNA 4EQ3A 2GYSA 3U0TB 4K7FB 1A8JH 1KDJA 3EFFB 3V6OC 1I7RA 3QUZC 5A2KH 1JVKA 2X70B 5BJTA 4XP5H 2BCKA 2D2CC 2JNZA 3G5YA 3OAZK 4Y9FA 4ZTOH 4XB7A 4I1RA 1U8NB 2OXGB 4C56A 2E27L 1YMHA 1I8LC 4K07A 4MX7B 4ZG1A 1MJUH 2OXHB 4UAHA 3O2DL 5AVQB 3VB9A 2ZX8A 2QPSA 3LV3A 3QIUD 2J43A 2JH2A 2WOYA 2QR0B 3DI2B 2HT3C 2L4OA 2DM3A 4XOAA 3SDXB 3OX8A 1MKFA 1PY4A 4PTUA 1MWAL 2ZUQB 3SO3C 4TTDD 5IOPA 4Y88A 5DHMC 4I3RL 3X3GL 2LTQB 3WNPA 3K72A 2DWEA 5DLMH 4IGBB 3ZRFC 4Y2DC 4XXDA 3WSQL 1ICTA 4GXVL 1N3NA 3JVGC 1S5IL 1E40A 1XV8A 2YC1B 1ACYH 3WCYA 5JHDA 2KZ1B 5C9JA 1IRAY 5F97E 2C8NA 1MFUA 4PJEE 4LSVH 4M8RA 4UANA 1R19A 3MV8D 2J2ZB 2YPLA 4BH7B 3I6LD 3U4EB 3RAJH 4PJDB 4NRYA 4YWGH 3NDYE 3EH4B 1EVUA 4OFPA 3BAEL 3O8XD 5EBLB 5B8CC 1AJ7H 1KV3A 1AP2B 1WFJA 1IFRA 5DRWB 3DJSA 2XY1A 1G0YR 3IJ9A 4JZOA 3DVNB 2NY1C 3G6AA 2H0EA 3D33A 3HUJB 4HKZB 2QDVA 1KY6A 3H7BA 3SIKA 3I02A 2FGWH 3ARDD 3NP3A 1PLGL 2BSSB 4B5ZA 4XPTL 3Q1SL 4CN6A 4HIJA 3ZSSA 2ZSVB 1N70A 2A77L 3E8UL 4NQSA 1E67A 4M62L 5HI4C 1ND0B 1BYOA 3S7GA 5GQBA 3K80A 1WBYB 3JUZA 5I8EA 5CJBA 2XTLA 2Z93A 2J21A 4WO4D 4F7MA 2B3RA 4F57H 1A6UL 4RFEB 3WD5L 5I9QB 5AVXB 5J0BA 1C5DA 2WP3O 3VRJB 4UTAH 3O4LE 4WEEA 3KGSA 5C0FB 1Z3GL 2P80D 4ZO6A 5DC2A 3ZDZE 1J8SA 1M7UA 4ZOCA 5JA8B 2G5BB 2DTML 1IBBA 3P4MB 4KK6D 4Z0BH 5EN2A 3L5XH 4ONFL 2C3WA 1CN4A 4NO0D 4ZUWB 2X3CA 4BSVB 1MRDL 4PRHE 3KWWA 4E5XB 3U25A 1CO1A 3FO9B 1BJ1J 1M9SA 3CQPA 2J7LA 3L5IA 4H2CA 1I1AC 5C09D 4N28A 2IGFL 2EE6A 4HWBL 4MXVF 4E0RA 3PQYA 2JIXB 1M05B 2IMMA 5ABAA 1UWXH 3LS4H 3QBTB 4JE4B 4RMRA 2YD5A 3TCLA 2ORBL 2EO9A 5T1DL 5MERA 1UKQA 3BGMB 4H8HA 4YSAA 2FX8L 1L6PA 1YEEL 2R56L 3IJYB 5EC1A 1LNUA 4AGPA 1N8OE 4BSJA 1QMUA 3CGTA 3SODB 4A7UA 4PJFE 2F7OA 5DHYB 5KBMA 3NCEB 3I9GH 2N56A 3SYPA 1KBKA 2ZAGA 1CICA 1T83A 4FNUA 3P1VA 3IJEB 4N24A 1UT9A 3VGHA 5D1QB 1QKZL 2JB6A 2LE9A 5GZND 4JANB 3FQRB 2NY0D 2Z31D 4NQXA 3O41A 3FB8A 4AL8H 1DVFB 2PP8A 1XCTB 2V2WA 4XCYA 1YSOA 1VFBA 3AY4C 3V4UL 1YNKL 1S3KH 3VFTB 2FGWL 4MRCA 4BFIB 1JRHL 4JPKH 4P5SA 3BQUA 1JXGA 43CAA 3BZFA 4HWUA 4JHBA 2EVIA 1S9YA 4Z78A 2VLJD 3BT2L 3M86A 4JB9H 3QCUL 1Z5YD 3L9RB 4FNSA 3I9AA 3TBWA 1F90H 1ZHNB 1L9QA 4QRSB 5EV7A 1JP5A 2AXGA 3NGBB 3I9PA 3OLGA 4ESKA 3GMQA 5T3XD 2WCGA 1EZUA 2Y22A 3WE1A 1RPKA 2ZXEB 1DVXA 1KFAL 3WD5H 4PJIA 2BS71 3L5HA 4PJBA 2EIKB 4XE0A 5KG9B 2VR5A 1IVLA 2HVBA 1I4FB 3W0WA 4GRLC 4PJ9C 3PGCA 4JFED 1CDHA 3HNTH 5BO1L 4LPTA 3BUQA 4Y2DD 1VA9A 5TE7H 1DQDH 4Y4KD 4Z7AA 4QHUB 1IZJA 4OF5A 1ADQA 1HE8A 2W95A 2UXVA 2BP5M 1BQHG 4P2RA 3WNOA 3KLHD 2NY6C 4QHLA 4FQQA 1JTTA 4GP8B 4FQPA 1F2QA 5DEGA 3E9TA 1AY1H 5DD1H 1T04A 2UY6B 4PV9B 2IC2A 1RZFL 5H94A 4IBTA 5KYNA 1EH9A 3VWJD 5LGYA 3GRBA 5B22A 2PPCA 1KCLA 3CZEA 1NFDB 5HDRA 2ADGB 2VDQH 3M1OA 2GCYB 3NFPB 2O93L 4O5LL 1OE2A 1X6NA 2X4UB 3BVNB 4R26H 3RHWF 4HJJH 4K5LA 4YHPA 3P0YH 1S5IH 2BSRA 1RJZB 2APFA 3NTCH 3TBVA 3WLWC 4HUVA 5I1GL 2ICEB 2WWOA 1TZAA 5F1NA 5HYJE 2A74C 2WZAA 4I8DA 4IRJC 4DVRL 4B0MM 3ARZA 4OCLC 1I7RB 3UFIA 3BQVA 5EC2A 4AT6B 3QB7C 2WVUA 4U6VH 3S5LA 2FWOA 1BOGB 2Q8BL 4ZAKA 4EZKA 3H56A 4GAAA 4DF9A 1A7OH 4JN1L 1YLBB 1LWHA 5KSUA 3FPYA 3JTSA 1TQWA 3V0EA 2FBJL 2P42B 5CXPA 5I30L 1KEGL 4KRPD 2X42A 5CLYA 4JQVA 4I48A 1WA2X 1CFSB 3BWAB 3U4BH 3CFQA 4FEIA 3OPZH 3BP4A 5E9DE 1OGTB 4XO5A 2EVHA 3ARED 3N50A 1G9NH 4G8GD 2YD0A 3F7QA 4DZBA 2EYRA 5JXAH 3QJRB 5K9OA 3AQYA 4KUZH 3BN9D 1ZXKA 4OGAD 1C5BL 4CSPA 4FL4C 4F9PC 4PP2B 4FQ2L 3DBSA 3KPOA 4QJ4B 1GJIA 3O4OB 4AQ8C 4L4JA 5AAMA 1T3FA 4TNWF 2I07A 2DW5A 4HIIA 3GS7A 3JWOH 4B9GA 1J5OL 1QHPA 3FN3A 1KBVA 3GTNA 2XN9B 5IB1A 1D5ZA 3MJGX 4JO3L 2I9LB 1KB5B 4R7NA 2J88L 1Y6NR 5AVTB 2WCPA 4PBWD 2RIKA 5DHXB 1C12A 1NICA 5A6LA 2DI8A 5D93B 4Z6AT 3BIKB 5FF6B 4MS8C 5FO9B 2DKMA 3FAXA 5JXEC 1ZJAA 4FULA 4UINL 4V33A 4BE5A 5EU5A 2JFCA 4DPAX 4KKZA 4X6DF 3QIWC 4P5KA 3FFDB 5DFWH 1CE6A 5JW5B 5J1SC 3ABGA 3MRDA 1U3YA 3DROA 5EMYA 3Q9QA 4J3WA 1V8HA 2ADJA 2YK1L 4BZYA 4NO3B 4X0KA 1Z9NA 2Z93B 3IN0A 5EIVA 3C6SB 2R9HC 1P53A 4HWBA 1FPTL 4XR8C 1UA7A 4FQJH 3NAAH 5CZKA 3DBXA 2P48B 1YY8A 1BMGA 5F7NC 3CN4A 3LMJH 4BH8B 4X8XA 4NENA 3FH5A 3FUNA 4RIRA 2DQGH 5IMMB 5JQ6L 3RUGF 1HHIA 3GBML 3QG6B 1FNAA 3O3EA 1QSEA 3BSZH 4N2EA 1IC0A 1UM4H 2F6AA 2N4IA 4WAFA 2JKRM 4J5VA 3H9SB 3ALXA 3PHOA 5DQ9A 1TJIH 4DO4A 5D71H 1BJ1H 4ZNEE 5CCHE 4BFOA 1PD6A 4WUUE 3MFFA 2GSGA 3OQRA 5C0GB 5J9PA 2XBTA 1JXFA 2RTTA 4I18A 4PGCA 3BDYH 5KANG 4LLAA 1DVFD 4KJQD 4JFSA 2YZ1A 2IAND 3ETTA 4FZEL 1F3DJ 3O3DB 1F56A 2VW7A 5BXFB 3TESA 4NM4L 2BSCA 5DHYA 2LV4A 3KS0H 2FQFA 4DT2A 3KYMB 5ANMB 3S36H 2CPUA 1K85A 3ZMNA 3WFBL 3V7MA 3W0WD 1FZOB 4EXPX 3UJTL 4P06A 4W1TA 3IJSA 4JZJA 4BZ2L 4HK3N 1UOWA 2J6EH 1YDPB 2UWEB 5B3SB 1I8IA 4UQBA 1URIA 2V0AA 3VFUB 2X2YA 4NQXB 4HQQH 1SY6L 3G5XA 5MENB 1VCBC 3ESMA 4G8IA 5C0IB 3EHBC 2R59A 4MDIA 3EH2A 4MFHA 2WQXA 3QXAA 1DEDA 2H1PL 15C8H 2CZNA 1BQUA 3FQYA 1E3XA 1Z2KA 3OPZL 3OZ9H 1BIIB 4D9RE 2NRDA 3BZFB 1ETJA 1M9WA 3LQAH 3MV7B 4HCIA 3IFNH 1FL6A 3EJJX 2Z35B 3C2SA 1OP5H 3RTQC 1SDDA 4EI5D 4M6AA 2GTZB 4PAZA 1XF1A 5KN5B 5FO7A 1FBIH 1J1PL 3P54A 4P0DA 1A14L 1A9BA 3LHPL 3SCMD 1DVUA 3QNXA 2FR4B 2BSBA 1NWOA 2WAHA 1UZ8B 4JDVB 2Q3ZA 3QPQD 4GMSL 3MYZA 1BWWA 2Z0BA 4PJIB 5K9KA 1AHWA 3TBTA 5D70L 3FULA 5AG9A 3WXVH 1A47A 1JCKA 1WFTA 1S7SA 4OD3H 1NCIA 4U1KA 5GRUL 3QXDB 5D7JC 3RDTB 3S5LG 3VW3L 1NANI 5B1JC 4R90L 1WT5C 4AMXA 3GSNB 3KM1A 4HIEB 1Y6MR 4MS6A 1MIEH 2Z1KA 1AO7E 1XHHA 2NYKA 4OIIL 4NBYB 1ZKAA 2XZCL 4PVBA 1LK2A 4PGJA 5DD3L 2LLGA 1RZKC 2Y36H 1QI5A 3O6LL 3HA0A 1E9OA 1NKRA 1KN2H 3CQFA 3HNSL 3PV6A 2I5YL 4APXA 3RA7L 1TETH 3GTVA 3DV4B 5E8DH 3TPUA 3Q3GB 1OOWA 2H26A 2VDNH 2GCYA 2WYZA 1UZGA 3NYKA 2XQ0A 1LO4L 4GG8B 5A16B 1LJMA 5ESVA 1F00I 2NUPA 3MMEB 4DN3H 3PREA 4NP4L 2XQBH 3GSWA 1IKNC 2CLRB 3EF7A 3EYUL 5C07A 1LGVA 3FU7B 3T9WA 2F53E 4YR6B 4QCIA 4G7QB 1WO2A 4JMXA 4LK4A 3G5ZB 1URZA 3NJMA 5FAAA 2CLVA 3K6NA 1E2VA 4ILDA 1IM9B 4WTQA 1OCZB 2ZUYA 4JPSA 2NT0A 2WBKA 3REVB 1KXHA 4NQVB 4CBPA 1UWGH 1ZLSL 3L4XA 1G7LB 4DK6A 4DQOH 3Q2WA 3ARDA 5J7CC 3RWGB 3PWPA 4MMXB 4MJ5A 3VD3A 3GUTB 4LDOB 5BV7H 5E4EC 5EEWA 2FHCA 1W8NA 1IL1B 3SDAD 2ZSWB 4M62H 2NXZB 1OCRB 3QCVH 2K78A 3O8XA 4PRAA 3DVGB 4R0LB 2R2HB 3S36L 3W57A 4X4YA 2VOTA 3ORJA 2OMWA 3LEXB 1KJMA 3RGVB 4R96B 1I9JL 3TIEB 1U8CB 3OHXB 2XWTB 3NEEA 2P80A 1UOLA 2DDQL 4V1DE 1L6ZA 4NX0A 3NZSA 5DSCB 3Q2NA 3O2DA 5ERWA 2XTJC 4OLVL 5GGSB 4BK5A 3WS6C 4QRQA 2I9LA 4K9EH 5GRZA 3GBMH 4XBGA 1FFOA 1S7RB 1AZBA 4DVBB 1C12B 4C55A 5HPOA 5K9JL 2A9MH 4PRHA 1SOQA 5FO9A 2VLRB 3EJZC 5IQLA 4BKLA 3KL3A 3SHSA 1B3JA 5EU5B 2OSYA 1RIVL 5K69A 1C16B 3IFNL 2DL9A 3MRQA 1UEYA 3NACH 3QC5X 4XOEA 4MD5B 4EI6B 2WKOA 1EAPA 3DROB 3K71B 5FYJL 1J87A 3BUYA 3CZJA 2JELL 4FXGB 5CJ8A 2DWYA 4N87A 1EFQA 1UXLA 4EN3A 3PJLA 3MRFA 1SLXA 2YPKB 3L3GA 3C6SA 2LAAA 3TONA 3MUHL 4U2ZA 3BVTA 5I6XC 2VQUA 4XP6H 1I1AB 1MZZA 4MMYB 3TV8A 4UQAA 4ADJA 2X2HA 3FB5A 2WLYA 4X5RA 3ULVF 2OX5A 3MLRL 4BH8A 1K4DB 3K5RA 5IK3B 4Z7NE 1QUPA 3WTXA 4H8UA 1E4HA 2ATKA 1U8OB 1HC1A 4FG0A 4QHKI 4XVTH 3QG6A 4GO8A 3UTQA 4XTRD 1AKJA 2G9HB 4J2XA 1FH5L 3MJ7A 3W11D 4Q0XH 3H9ZA 2OR9H 4A37A 1VB9A 5E1HB 4PJXA 4XO4A 2PNDA 1YNLL 2IAMA 4HKBB 5KVEL 5LO7A 3A67H 5K1VA 1WWWX 1HXYA 2VDLL 1A0QH 4JRXB 3SPIA 3ZHLA 1JPTH 3VJ6B 1QA9B 5B38G 2PYEE 2CR6A 3HKFA 2WGNB 4WFFD 1RVFH 1H3PL 2D0HA 3NIGE 4X6FA 4KDTA 2OCCB 4AJ0A 1CXHA 3U4AA 2I7OA 4HJGA 5C7XL 1OWWA 1A6VL 4QLWA 5ICYB 1FFPA 2YZ8A 3KLAB 4MNQB 4WWKA 3KYMA 5ANMA 5GJTL 2YEZA 4S1RH 3OGCA 3F5WB 3O6FA 5HGAA 1E3FA 3CBRA 1RZ7L 3BAYA 4ZNEA 2IPUK 5EO9B 1NCWL 4KX8A 5HDQH 4NBXB 1IEBA 4PLNC 2FIRT 3VXSA 1ZHKA 4B7IA 4KI5D 3PFUA 4JFDD 3H9HB 1V3LA 3IDGA 5GIRA 5I8KL 3SDAB 2IXQA 4K7FA 5SWQA 2AJSH 3ZBMA 4GRLB 5DU7A 2CBPA 2EYSA 5TGBB 4X6BB 1PZ2A 1XGPB 1X9LA 4U1LA 4P23A 3G5YB 3ZQWA 3AQXA 1A65A 3GJEA 3VO0A 5E8NB 5TDOB 4J27A 3FKUS 2OL3B 3QRBA 5L88L 1EAQA 3E1ZA 1GSKA 1QPKA 1GYWA 1PPIA 3CC5A 3DI3B 4XMPH 1AS7A 1MCQA 4CN4A 3S37H 1TVHB 3M46A 1WS8A 2LAGB 2EZ0D 3EGXB 4L2LA 4NEHB 1X9UA 4NJAL 5AZEL 2O61B 2FL5B 4P2CG 4W6WB 2XSKA 4LASH 3ZE2E 5IOPB 2JCCA 3FCBA 4LO9A 2DWEB 3UIYA 2NDGA 3A6OA 4S1SH 1IC4H 2P1YA 3NABL 2CDFB 4Q6IC 3FO0L 1M42A 3IDIA 3QDME 1YAIA 3WOVA 3WLWD 5I0YA 2V3FA 5DUJA 4NXSA 3DO7A 4TNVK 4OVVA 3KLDA 4X9BA 5T33L 3DGGA 2Y72A 3PWPD 3O0LA 3NCWA 1LWRA 3QZPA 4PJDA 4GKNA 2J71A 2PPDA 1PZUB 3DSFH 3RKPA 3DTXB 4PJAE 5CJQL 1JPGA 2VDLH 4XN9A 1KXQA 3FFCB 5D72L 3AQDA 1P4UA 3O6KL 1MCOH 1A5FL 1UURA 3BFWA 2BNRD 4PJIF 5CZVL 3N91A 4D7BA 3I02B 3CE1A 5B1CA 2EDMA 2E46A 4NCC1 3RVVC 2YLKA 3WEOA 4IMKA 2WOBA 3D85A 2BZDA 2WWMD 3HPJA 1BZ7A 1KELL 4JJ5B 2HJKB 3VXTA 1ND0A 1FVCB 1JGUH 1MCCA 3ZL1A 3FRUA 1E65A 1MLCA 3HCVB 3TWCL 4PJEF 3FZUD 2AQNA 4RFNC 3MRIB 4YXHH 3OAUL 4MA7L 1Y7VA 1OAKH 3IPFA 4KDVA 1I8MA 2GHZA 4LOVA 5LGHL 3BUIA 1JCVA 4M1CC 4NRXB 1C5DB 3X1NA 1QUNB 5EO1B 2JB5H 2KPNA 4N1HB 4QXGH 3AW5A 5LWYL 1AGFB 3GMLA 2QQLL 3BP7A 2X4SB 4JHUA 2ZAHA 3W56A 4PRAB 4DGWC 5CMAA 4NJ9H 1K3ZA 2DTSA 4TRPL 2DIEA 2W07A 1JF1A 2WWKT 3RGVA 2UZPA 1GC1C 2GTQA 4OCWH 4IU3B 1QATA 1G1CA 3HZYB 1U33A 2DLTA 1I8UA 2ESVE 3E3QC 4ZUVB 1F4YL 4AOFA 3MLYH 4HOZA 3C5JA 3B2UC 3NPZB 4NFCA 3UERA 3MUGA 4P2RE 3IDJA 3L5XL 1NH6A 2VE6B 4HISA 4ONFH 3V0FA 4LGRB 4NRZA 4BK8A 1MFBL 3QQ9C 4CA4A 2OTUA 1LHZA 2CGRH 4J3OG 3UADA 2MHAA 2VMEA 5J13C 4HHAA 5I82A 3VRIA 2AXFB 1F58L 5G4NA 1CI5A 1J05B 3HG1B 4IRSC 3ROOB 4JRYB 3GBLA 3VFRA 1UH4A 4NGHH 4O02B 2XA8H 2B16A 4ZNCD 4L1TA 5EFIA 3ARFC 1JPTL 3ZYJA 3NJIA 1CZ8H 4FXGA 3JYBA 4JFDE 4JM2B 1CDUA 5D72H 2FO4A 2VL5A 2PTVA 3NCYP 3HE6B 1XCTA 4KXAA 5C0DA 3L3GB 2X2JA 5B38B 2W8CA 5BZZA 4X5XA 4WWKD 3S3CB 2D31A 2E4FA 4FFWD 2IMNA 4TPRL 1YY9D 2IPKB 3BJ91 4LP8A 3UPCA 1SVZA 2R51A 4KY2A 4MSWA 4PLJC 3RURA 4AYGA 4U0RC 3KW7A 4RAHA 2AW2A 1NCCH 5D9SA 1KELH 1MZYA 4PGBA 4NKDB 4G9FB 4JO4L 2ZYHA 3ILPB 4X9GA 2FQDA 3EO0B 4FXTA 2XKNA 1YQ2A 3RKDD 4QOKE 3ARWA 5A40E 2IGFH 1S7XA 4IBVA 1ROCA 4Y5VA 4WI4A 4G6FD 4OFIA 3GXNA 5IB4B 3Q1EA 3BP6B 3OC8A 5CILL 1K5NB 1AIZA 2WTRA 5DA0B 2X09A 6TAAA 4QHUA 3TEYA 4M9OA 2ZWZA 3WN5B 2NYYD 3II2A 5EEVA 5CSGA 2J1KA 5ANME 4GIPD 2V2TB 4XAWH 1H6TA 1QR4A 2B4CC 3R19A 4OCRL 5AVRB 3WMSA 2CAKA 1ADQL 1RZ8B 3CXDL 1R5IA 3UTTA 2XTSA 1AGDA 3NBNA 4J12A 4L9DA 4CRPA 1MJ8H 1NGPL 5I24A 1RY7B 2XZAH 2HN7A 5JHLH 1QEWB 1FNGA 5I18H 1D6EA 3ULSA 3MHZA 5LGHH 3GRWA 3QDJD 5C0BE 2HG5A 2OMZB 1BDYA 2J1WA 4JDEA 5FIEA 4TTGA 3HHSB 3C5ZD 1Q0XH 4JG5A 4Y16A 1OAQH 4HDIB 1GZHC 1HTYA 4U49A 4CVZB 4BHUA 4JPWL 5AKTA 3US9A 4RMSA 2PCPB 1B2WL 2A1WH 4PSPA 1CXLA 2DQ6A 5IVZA 1N0LA 1G7HA 4WW1B 4QTHB 1WFMA 1KB9J 3BE1H 4LVNC 5M95B 2AJVH 1HIML 2G2PA 1A1MB 4L8BA 4FTVE 4ANWA 1C5BH 4LPUA 2VXUH 4UZGA 2MQ3A 4GOSA 1F0LA 3QO1A 1JJUA 2O6PA 3LD8C 3RZCD 1MVUB 3OKOA 4OVUA 4TVPE 1W91A 3NJVA 5DJXB 3D2UA 3QZWG 3RWCA 2W88A 3T77A 5L8JB 1VKXA 4U1NA 3QUZD 4FXKA 2VDMH 2JCCB 4JO3H 3FSOA 2XNAB 1BMWA 5HGDA 4MAUL 4GAJH 1NM9A 1NAML 1U8HB 1XR9B 2DL2A 4A55A 3UPRA 3IDIB 5T1JA 4L3EA 3MUJA 2BIHA 1U95B 2BOBA 1SXZA 3DGGB 5HGHA 4PJ8A 4FFTA 4HIHB 1M71A 4QXVA 2ZF8A 3OVUB 1QNIA 3KPOB 4PW4A 1G4RA 3VFPA 4XN1A 1BQSA 1NFIB 3SKOB 2F53D 4U1JB 4L4TB 5E6RB 2MFNA 3B6SA 3HG3A 1DVTA 2OMYA 5C07D 1EPFA 4HXAH 1K5WA 2ROYA 4FG2A 3Q6FA 2VLKE 1GYUA 5HSFA 3PHQB 1OTTD 1TQTA 4P3DB 4YHZH 4C8XA 1X5KA 3BIKA 4TSCL 1T2XA 4MMXC 3EGDA 4DN4H 4M8QB 4MAZA 5I0ZA 2WBJD 4IM8A 4MYPA 1MAMH 2Q20A 3FQTA 5CJXC 4PJCA 5BOJA 3S3DB 4I77L 3L4CA 2WKGA 5D2LF 2Q8BH 1OY3B 5HDOA 1J88A 5HHPB 2I25N 2B1AL 1PG7H 4GIOA 5CBAB 2BK8A 2ADIA 5FGSA 3HRZC 2H1XA 1OQXA 2HFEB 3HS9A 5GS3A 2BIIA 4Z0XA 3TYFB 1KYOJ 2QELA 2LT9A 3UJIH 4G8GB 1H9VA 4OZFG 1GOFA 5LGKA 3RX8A 3O45A 3DTDA 5FKPA 3ROLB 3TU6A 4U1MA 1TZHA 3DURB 4JFZL 5CEYB 3TNNB 2ILLA 3L7EB 3GM0A 4FLQA 2O5YL 4XVJH 1G9NL 3BH9B 3RY5A 4ZW5A 3H85A 5FFGA 3KPMA 4QO1B 1M1SA 3ARRA 3AJ7A 4WGWB 4Z77A 2WSPA 2OMUA 5CMAB 2OP4H 1B0GB 2DYPB 4YXLH 4OFQA 1Q4NX 1U58A 3SB3A 4PS7A 4OF8A 1J0HA 2AEIT 3EYQD 3PS6A 4QNPE 2XXFA 2GSGB 1PZDA 2VLJB 3FUJA 3QPQC 4GSDH 4KITB 4OJFL 2HFFB 3I6KB 4R7DA 3RJQB 5A3IC 2FJGB 2Z31A 2J8UE 3O2VH 2B2XH 3KXFB 4LARH 1EEUA 2P7TA 1M7IB 3EKCA 5LDUA 4MAUH 5JIIA 5AWNH 1D2PA 1OVZA 3HNVH 5H35B 4JX0A 2AJZB 1A4AA 1N2RA 2R0WL 2WQVA 4IK6A 4QIRA 1LDSA 1G6RL 3BLBA 4WHTA 4P2QA 1H5BB 5F1IB 1NAMA 4UDTB 1MWAA 3O2WH 2ED8A 3BEVB 3F12A 5IHUL 3APNA 1TO5A 1VSCA 2H0PA 1OARL 3KNBB 4MNGA 5CN1A 2FO4B 2VL5B 2XU9A 2AABH 2HJFA 4X42A 1QLRB 4K5NA 3VH8A 4YSTA 3SBWC 2BVPB 2FSEA 2Z65C 3FB7B 1MCPL 4N1CA 5EA0L 2D31B 5T3XH 5IB3A 5H8DA 5GGRY 3SY0B 1MCWM 2IH8A 4FGMA 4KVNL 3KPQB 5FS5A 5ALBL 5F1KC 4PGBB 3MV7A 4ZMPA 3D39B 1OANA 1SN2A 3FQXA 1FL6B 4RLDA 1XF4A 5T1LB 2K6ZA 3UGEA 3ILPA 3D8MA 3H9SE 1OGAA 2R1YB 4L8SA 3F7RA 3HPLB 5IW3A 3MLWL 1D7CA 1KCSL 5E1IA 3GZKA 4OM0H 1A4JB 1O6SA 2IV8A 5KSAC 2DMGA 3MRMA 4ZFZB 3ZTJG 2DN7A 5CR1A 5E99H 3ZL2A 1IGYA 3VI4F 4JFTA 3I3BA 2B1HH 2DS4A 4PW3A 3AWGA 1Q1JL 4QRUB 3T8XB 2PP9A 4EMZA 2V9UA 1DBKH 1OALA 4L3EE 1FV1B 3O4LD 1WD9A 3QXDA 3O3BB 3VNYA 1Z1WA 2PKDA 4J2QA 2N7SA 1JZ4A 3S9DB 1X7QA 2OZ4L 1XIWC 2UWEF 4NOFA 4OKDA 4ZPVB 2X4RA 5FA4A 2BVUA 5I71B 1N6QL 1ZVHA 1MFCH 4HF5H 4G7SB 4IHBA 1YYMH 1FIGH 2X9ZA 1MIMH 2WCSA 5EO0B 3VXSD 4GRWE 3OKLB 5D4JA 1DBMH 2FUTA 3LB6D 4QDGA 2RHEA 3QUZA 1RZ8A 4KMTH 3FQUA 4FE9A 4UB0L 2HLFD 2C1PB 4MQTB 4W93A 2YAMA 5EEXA 3IXTB 2DQTH 3DK2A 3VWJB 4APXB 3ZXAC 4G6ML 3QISA 1WZKA 2NXYD 1R3JB 3TC9A 1I8LA 4IYKA 4CADA 1UQSA 1IC1A 2EDWA 1D6EB 1WPCA 3ULSB 3AM8A 4GG8A 1HHKA 2Y1VA 3JWNH 3MXWH 5ELIA 4ENED 3AG4B 2VMFA 3N9GL 3VSTA 1AZVA 5FV1L 4BYHA 2KDYA 1CGSH 1EERB 2ICWJ 2Y7LA 1IGMH 2VO5A 3TWYA 3I6LE 2RBLA 5SWSA 4Y2DA 1WBZA 1GGTA 3DMMB 3V6FA 3HZVA 3JVGA 2B77A 4XNYL 1S8DB 3BGFC 2ORBH 4XMLH 3GIZL 2YGOA 4XRCB 5T1DH 4C4KT 1F18A 2HKAA 2R39A 4IDLA 4W68A 5I0WA 4KI5C 4N8PA 1X9RA 2Z7WA 5DEZA 2R29H 4WO0A 3U30C 1FNSH 1MW2A 3LZPA 4GKSB 8PAZA 1U8KA 4OFYD 2VR6A 3LKOB 5F7EL 3OKEB 1Z9SA 2IGTA 3LXCA 4K0OA 4A7SA 3F64A 3U9PL 3GUTA 4KHXH 3FUEA 2YGNA 3UO1H 3C75A 5B8CA 1FFQA 3P0VH 1SYSA 1JGIA 4K71C 4N9OB 2A6IA 1CGTA 3AROA 4DK5A 4XNAA 4YEFA 1WFIA 2QQQA 4QT5A 4N2LA 4PJAF 2DKSA 4N8CL 5DCCA 4PP1D 2VXTL 1UD4A 2XZZA 4JKWA 3ISWA 3HAEA 4AIXA 2VQ4A 1TTRA 3U36B 3PWLA 4WEBH 2ED6A 4HIHA 2F08A 3WUZA 3CWGA 5A6IA 4LLQB 1RUPH 3L1EA 5E00A 3NVQA 2PCYA 3WMPA 2WYIA 1QFWM 1YEHL 4UBDD 1AC6A 4PRBB 3T5WA 4JFZH 3W1ZA 1QQDA 2NYZA 4KY1H 1R0AL 4YLCA 4M00A 1KYOK 3LXUX 2QQLH 3FSAA 4CNIB 1A7NH 4DVBA 1N6QH 3ZR6A 4ZD3H 4QRPD 2J57A 5EULV 2BWQA 1SFDA 1T2QH 5C0CB 1XGUB 4OGXH 4OAWA 3IE9A 3RVTC 4C57C 4KMTL 3MBEA 4UB0H 4E41B 1IM3B 5IJBC 1H0DB 1U91B 2PWGA 5AZ2H 3V4LA 4YBLC 2J44A 2PO6B 3QRGL 1AE6L 4XVSH 5DEFA 3DX3A 2F8IA 2QQNL 5KUMA 3UBXI 5IEKB 5IFHL 4AENA 4KZDL 1I9IH 5F7LB 1KBWA 3ES6B 3ZZLA 3EUUA 3D08A 4CSSA 1I7TA 3BW9A 3GXMA 1NFDE 1Q1PA 4IK7A 3TYFA 4HH9B 2NY5C 1I1AA 4YDKH 4KQ4L 3DX7B 4BFJA 1TXKA 5INCB 4XPHL 4G71B 2M2DA 1TZHB 4N0CD 5EOCH 2FIKB 4Z95H 2DWSA 3OKMA 4X4MA 3RP1A 1U8OA 2X38A 2WUBL 3VD2A 1FYTD 1E4XH 1HHGA 2BW4A 2PMZA 4JZNB 4ZXBC 2A9NL 3ZN6A 5TQ0H 3RG1C 1OARH 3F7VB 3SDXF 1DEEB 2DYPA 4HU2A 2SEBB 2AZUA 3V5DB 2X88A 4MJHA 2VZSA 5GGVL 5K39A 1IQDA 1NJ9B 1SBBA 3IGFA 4PRIB 4PVMA 3BAXA 1PY0A 3CZSA 3FTZA 4KTDH 4I87A 3V0IA 2VLRD 1HI6B 1N5AB 1TZGL 2VLME 4A7TA 3BDBA 1JHTA 3BH8B 3SDYH 1SDYA 1P4LA 5F7DA 5J6SA 3KEDA 2NY2D 2F1AA 4H40A 4WZ9A 2I26N 2WJ7A 4WKXA 3ILEA 2CO7B 5KYUA 3O4LA 3FQNA 3K91A 1ACXA 3BQUC 1TMCB 1XVSA 1E4KA 2IWKA 2YQBA 3F5WA 4JO5A 4PIBA 4C59B 2FEJA 4Y9EA 4LSPL 2OJEA 3A0OA 4K3EL 3ZDYB 1NFAA 2E6PA 1BPVA 3SDDD 1UD2A 5DWUH 3ARBD 3DTUB 1QFWI 5KVMC 1G7IA 2Q7NA 5IB2A 4KKPA 2BOCB 2GI0A 4ODTH 1RFDH 5FYJU 4AQEA 1MVYA 2E9BA 3FB7A 4KKCD 2GC4C 5EUOB 3RTLA 1DDTA 2QTVA 4HSAC 4PJ9A 1QSFD 1TLMA 4LPYA 2J1ZA 3DYMA 1CLVA 1XGPA 1LILA 4L5FE 1HQ4A 3ZLQC 1Q9KA 3C5XA 4J6RH 4KNSA 1RERA 3ARPA 2UV3A 3B9KD 2ZKYA 3ZYOA 1XF2B 3LPFA 1A4JA 3G7TA 4WTZA 3VTAA 2L3BA 3MRBB 3BWUC 1TU2B 4KK9C 4ZUSA 3CFIC 4K5PA 1I7ZA 3NPSB 4PY7A 3P69A 2GJJA 5SX5K 3VDAA 4G8EB 1AMXA 3QH3A 1AR1C 4KO7A 3LSOB 4M56A 3STLA 4A7QA 2A77H 5GSVA 4PJCF 4AVIA 3STZA 3QAZB 4AEEA 1T22A 1O9VA 1TJMA 2KLSA 7FABH 1YEDB 4Z3GA 4TYUA 1WG3A 3K5SA 1YEJH 4IRJA 3ZY7A 5DFTA 3QDGD 1CLCA 1LD9A 3CZLA 3PWPE 3D2UD 4NJAH 3U2JA 2Y4SA 4HYTB 4MJ4A 3S35H 1MDTA 3HMWH 4G7YH 5EU7C 1ZIBA 3I75A 1ZT7B 1K3IA 1CQYA 4XO9A 4CADB 5EEYA 2X10A 5BZDB 3DX9B 5AFAA 4GKOA 4F2ME 2ATPB 5KZCD 2V37A 4J8RA 4AY0A 3D9AH 4N90D 3RZCC 5D5MA 1CLOH 1B4RA 4MA3A 4MB3A 2D4DA 1H15A 4XMKL 1GW6A 5E56A 2IFFH 4G11A 4S2SB 5HDLA 2LTQC 1EJOH 3MR9A 4J4PD 5ES4B 2X89A 2X4QB 3QO0A 3VSVA 1DO6A 1E4XL 1OAXH 5MP6L 4R2GB 1S8DA 3V0AC 3VQ1C 4EBQH 4LCCB 3QWRD 5GGQL 1MUJB 1PZSA 1ZT4A 5GRVK 3UC0L 2EDQA 4F9PA 3TBCA 4OD1L 3FT0A 5ILTL 2DQUH 3QQ4B 1BZ9B 5A7EA 4AQ8A 4OJDH 3MLYL 1SJHB 5AAMC 2RACA 1T7XA 2A4CA 4PV8A 4KC3B 2F58H 1OOAA 1GGBH 1GMEA 4HGWA 3WDIA 1MFBH 3ARGD 3KD4A 4OT1H 5E1QA 1PL3A 4ICWA 2ZKXA 4DP2X 5E6ID 3N43B 3QI9D 4ONHA 4XO8A 4LL9A 4N6QA 3UP6A 4A7GA 3APFA 2CM5A 1JF1B 5F3HA 3IYLW 2UX7A 5DUBA 4NKMA 4ZFFB 1EJ6A 3AREA 2ZXQA 3TN0B 4O2CA 1RZJL 3QIWA 4JL2A 2X05A 5CM1A 5E5LA 5DWPA 3WTWA 1N10A 5TPWL 1TQCC 3ECUA 5IJDC 3ZW3A 4ZUVA 1J1XL 1RJCA 1ORQA 2WXOA 3DX6B 3STBA 3M1CA 4EKXA 1ZK9A 1TKWA 1TLKA 3KPPB 5C6TH 4FZ8H 4NRZB 2GK0A 3VXUB 2D2OA 3THML 4CNIA 3TIDB 1W72L 3FT4B 2YPVA 4G6AC 1JXKA 1UT1A 2H3KA 3PV7A 1WICA 1MEXH 3ZRCC 2X4OB 1H6FA 2YMTA 3U1SL 3GB7A 4GW1A 4KO6A 2VAJA 5FLUA 2AGJH 4R3SB 4FYQA 1JGUL 1QLEH 3L3IB 4P5MA 3X2QB 5DJAB 4AIOA 5EFIB 1E27A 5AW4B 4V11A 4DWHA 4FFWC 1NANH 4ECNA 5DEFB 4WJG3 3DX0A 1U8PA 2JK5A 3O3UN 3QUYB 1BGXL 4PJHA 5ESAB 3QQDB 4P5TA 3RX9A 2V9TA 1ETZA 4EUPA 3C6LD 3TFKD 1FO0H 2E74C 2CKBA 4HH9A 3MOBL 2LU3A 4Z3TA 1F1AA 4YDNA 3ECBB 3TEUA 2OMNA 4NQCD 4MJ6A 2XX1A 3I85A 1BECA 5T3ZL 1HEZA 3NRFA 1NBZA 2DJUA 1KGUA 4I18C 5DHVB 3CUPB 2EO1A 4PJFA 4D0BA 4GRMB 2HUEA 5E8DL 4WIQA 4LVEA 2Q10A 2LQRA 2OZNA 3Q06A 2NOYA 3OKKA 3ZKMC 5FUOH 3NA9L 3HI6H 3LPGA 1DBML 3ZE1E 2NY2B 2ARJQ 5CBEA 1KLFB 4PGEA 4LEXL 5LNDA 4F5CE 3IU4H 4PYGA 4GSQA 4G6MH 2AK4A 3SQOH 4Z3IA 2QMJA 1LEGB 4YSQA 1WIOA 2MKWA 4UMSA 4EQ2A 2CWRA 1FN4A 4ELME 5AD0B 2OXGA 4C56B 5KYWA 3L1OL 2DKUA 2H0FA 5HHMB 1ACZA 4JPWH 4NWTH 4BQ6A 2BNQE 4H8WL 4Y4HA 3RIFK 2X4NA 4FHBD 3GSNL 4LRNH 5IFAH 1GYAA 3T65B 2VJ0A 1NGWA 3D4CA 2Y2WA 4NGHL 3ARQA 3EFOB 4OJAA 1QP1A 2BNRB 4HMDA 3SPHA 4TQPA 1AGCA 5H2BB 1EMTH 1SBSL 1JYXA 5A3ID 2V2XB 1ZGLP 3PF2A 4JR9H 1BG1A 3LIZH 4LVOB 3UJJL 3DVIA 1SJEB 4S0SD 5J6GA 3MYJA 2CDGA 1HS6A 1XH3A 1G7IB 3BKML 5DK3A 4B60A 2OK0H 1EQWA 1YQVL 4LHQB 2B4CL 4QF1A 3FZUC 2NCMA 1AHWC 2NSMA 1AI1L 2WXPA 4DGUA 2X2UA 2AEQL 1FIGL 1W0YT 2A73B 1U93B 4MNGE 1OSZA 4XX1G 2MQ0A 5ESQB 4PJ7B 5IM7A 1FGNH 1PIGA 1ZT1B 4K2UL 4QTHA 5D6DC 4AI7A 5LDSA 3ML9A 2O6DA 3T6XA 4LMQE 3DO3A 5DVPA 2E9JA 1JYVA 2H1LM 2W65B 1LO2L 1W8EA 2JI1A 2PXYB 4WCYH 4OZHF 5D71L 4L1LA 2NY6B 1VFMA 2O30A 4LOUC 5GSRB 1L0PA 5C08A 5B7MA 1AQMA 5BVJA 1GA2A 2EDLA 2WC7A 1PLAA 3EZ8A 3RWCB 1T0NA 4JM4H 4BDVB 3P9WB 4UINH 3PWVA 1A22B 2I85A 4WHYG 5IESL 3C6EA 3TT3H 1A6WH 2AQQA 3OWEA 1FFRA 4J1UA 3WUWB 3IK2A 4IOFC 3U6RB 4KJPC 4OZGF 2IG2L 2GIYA 1X7SA 5EBWA 3CLFL 2E7MA 3DJRA 1F4WH 2V17L 1KDIA 2E6QA 4N3TA 3KXFE 2R2BB 3IGAB 1IKNA 2WLZA 4RRPA 3VRJA 3C5SA 4IRJB 1Q94B 3ELQA 2KZKA 5B39B 1M71B 1U3ZA 3RB5A 4QHMB 5GHWL 5A2CA 3MKGA 1QRNA 4YSPA 3ILDA 4OF3A 3D51A 5BO0D 4GW4A 3RU8H 2GY5A 5J8OA 2DY2A 1U3JA 1EZLA 3EGSA 3TZVB 1BLIA 1WK0A 3VFOA 5I8KH 1YEFL 3DX9A 3ME0B 4QXUH 3TJHD 5IW6A 4WJ5B 3MOBH 2GFBA 4OZ4B 1KWGA 4HA1A 5IHLB 1AQHA 4WLCA 2VRQA 4Y1AD 1H15B 1ZVNA 3ULVD 1V3KA 5EB9A 5D7KD 2IALB 2SODB 2AEPL 4AWJC 3BFQG 2FJFA 3VM7A 1AXSB 4MA1B 2QSCH 5MERB 3WHE1 2XN2A 2J12B 2Q3XA 3VXQA 3O8XC 1IQWL 1T1ZB 1C8QA 1A02N 3H7BB 4MJJA 1GC1L 2FH8A 2C3XA 3KWUA 3MJ8B 4XN8A 2KYIA 1KENH 4Y5YA 5JR1L 3CMOL 3IPEA 3BKMH 4U7KA 2OK0L 2P4AB 4YE4H 4RAUB 4TSCH 4G8FA 1U8MB 2G60H 2IV9A 3QIBB 3ZZQA 4XC3L 4PMEA 1NIBA 3H1ZA 4LHUA 2WXGA 4I13B 4U3HA 4XPBL 2PYFB 4M5YH 2EIEA 1SJMA 1HDMA 3E9UA 3WS6A 3BPLC 4JY4A 5GGSY 3SQOL 2AK4D 1KB3A 3SGDH 4RFEA 3CXHJ 4FI8A 3MV7E 1P6AB 1R4XA 4M1DH 3LRSA 5C0FA 3VD0A 1E6OH 1OM9A 1U58B 3FNKA 4K15A 2GBTA 5E8EA 4LCIH 3CFBB 3AG1B 4Z76A 4R5VA 4Z78B 2OCFD 4GXUM 2EXWD 4YBLB 1HWHB 2FEEI 2K9UA 2Z31B 3MRJA 4Z95L 2G0LA 5C70A 3R4DA 3QDJE 4HIXH 2EADA 3KWWB 5B1AB 2AXGB 3HAEG 5FW7A 1RFDL 2ZP9A 1AI1H 3UG4A 2E9IA 1N59A 3CFDA 4XMPL 3FTSA 1BAGA 1PYWB 5L2KB 3K1DA 3HLKA 2Y69B 3FCTA 4XWOC 1E4JA 2APXA 3GSQB 1RK0A 1G87A 3NH7H 5BS0B 4NN7B 2F54B 5HJDA 4PEEA 2P5WB 3T0BA 5DJDA 4XNBA 1GJWA 2ZUSA 2D7PA 4BZ2A 3WAKA 1XL4A 4OJYA 4P2RB 1R33A 2QADD 1JWSB 1E42A 4F3FA 4JO8A 3V4PA 2AV1B 3VQLA 4JM4L 5I66A 1RHHB 4N5ED 3EJUA 5CEXB 2UVFA 2YA1A 2VDPL 2BNUB 3ZRSA 3I84A 3FONB 4AW7A 1RSYA 2HUHA 4GI9A 4JCWA 2OFQA 1D5XB 5F89B 5CZXC 4UTBA 5KSAD 1EXGA 1S78C 4NERA 2W0PA 3FTYA 2Z4QB 7FABL 1XF4B 2J6EA 2OS7A 1I85A 2VDQL 3N1GC 3NIGF 4YFLF 1F13A 1ZEAH 1RJZA 4HUVB 3QORD 5B1BB 1F02I 3SDXA 3FHEA 2XXMB 1YNTA 3FBKA 3A6CH 4BXSV 1B4TA 5FPIA 4QXWA 2P3YA 1ZLWH 5TDNA 5BVPH 1D9KD 4HOWA 3S98A 2XETA 3ASOB 2BOLA 4IGBA 4PCKA 1UD5A 1UB5B 2ZG3A 3BCDA 3L95A 1FNEA 1XXFC 4ZMVA 4GAFB 5HYFA 3TNMB 4K7PL 5KYWB 3IJ7A 4PGZA 3WI9A 1JZJA 4Z7UF 3V4PL 3IT8D 4IRSD 2A9ML 2WN3A 1BM3H 1L3NA 2YAFA 2BHFA 4JAMB 5KSUB 5C08D 1LO2H 4WCYL 1NLBH 4NRYB 2P52A 4JJHA 4NO2A 2Y7SA 1NGWB 2XTJD 3NACL 3SE6A 3FQ1A 3WKMH 3NCMA 4HPOL 3WIFB 1TO4A 4UOJA 4DGVL 1DANU 3UBHA 4DEPB 3GIZH 2TSBA 4RDQF 2VITA 5FYJD 2W0KA 4GP4B 4XCFH 4UTBH 2WJ5A 1D5RA 4RMTA 1DQQB 3DLQR 5CLTA 3T0AA 4MWFB 1W80A 2ITCB 5ILTH 5DA4A 5ITBH 4AKQA 1W2KT 2PABA 4TPRH 3AT0A 3IDUA 5DEGB 5I6LA 1CI3M 3G6JB 1CD0A 1HCYA 4OD2A 4W9KC 3QZOA 1I9JH 1DANT 5GS0L 2FX9L 3GGWA 5JIHA 1QRND 5EEZA 2BWIA 1IAOB 2AAAA 2ADGA 4Q6IA 2JQMA 3ZL4H 3KYOB 1H3UA 4Z7WB 4FNQA 4CILA 3K6SB 4YQXL 5E5UB 3TJEL 2YKKA 3V10A 4RISL 1G1KA 3AB0B 3ZTNH 3JV6A 4BD4A 1IJ9A 2P8PA 3OXSB 1S7QB 2EDJA 4MXQC 1DLHA 4PFEA 4AT6A 3HLAB 2B8OT 5KS9A 2HFGL 1U2YA 3SPGA 1SOSA 2C9RA 4HHWA 1YN6A 1XZ0A 3ZDYF 1WV7T 4FQXA 4KJPD 3HC4L 4KI5E 3D50A 1DVSA 2XJLA 3E3QE 5TH2B 2OJ1A 1KMGA 4G1MB 2EUWA 3JTTA 3K74B 1ZHBB 3DYPA 3JTSB 4N4YB 3ZKXC 2E47A 4A2FA 3HAEB 2Q2LA 4J6IA 3B1TA 5EZIL 1GS6X 3V6ZB 4X7EC 3R0NA 4YBHA 3UC0H 1Z0NA 2O6CA 1DN0A 4AXWB 4M4RB 3WEXB 2BNQB 3ESOA 5K1JA 3L3JB 2NLJA 2WZPA 2ENJA 1BX2A 5KSBA 5SV4A 2K7PA 2YD2A 1E8WA 2XWXA 2HT2D 3VXMD 4F9LA 3F8UB 4X7DC 1CXIA 2PYEB 3UAJD 1C1EL 1B90A 3CZGA 1QABA 5JW4Q 2YSSB 5GGVY 3N44B 3ARXA 4GMTL 4QRRB 4UT7H 1KJVA 4DQAA 5AVWB 2JJWA 2GJ6D 5FFOA 1SQMA 2HRPL 5DT1H 4JFUA 5EBGA 3FRPA 3O41B 5KS9E 1D5ZB 3QUXC 3BJLA 1WQVT 3KJ4B 3VCLB 1Z5LB 2DQFA 1HXKA 4O4YH 2ITEA 2NUTB 3RZWA 3KWTA 5I1LB 1H8LA 3ES6A 2H47C 5I17B 1Q72L 1OB1B 2KERA 3N1QC 3SKJL 4WDIA 4A63A 4Y5XC 3LKRA 2HG0A 2W60B 3RGVC 3TX4A 4W70A 2CBMA 3MJWA 1CE6B 1MEXL 4DP9X 3EHBD 3UABA 5MI0C 2YPLD 5CP3A 2JJSC 2A2QT 1RZIB 5IT2H 1JWMA 3EOYG 3LEYL 3OKMB 4AQAB 3DIVA 5DLLA 5HYJB 1HDMB 4N8CH 4UQ2B 3QIWD 3US0A 4L18A 3RGBA 5HHNB 1PSKH 5TF1L 4GP5B 2WO4A 4PS4H 5BRQA 3IVKB 4WEBL 1OXYA 1SFHA 1LO3L 2YGVA 1JGEB 4LLUA 4DO6A 4BFKA 5LB1A 1WEJL 3RE0A 5K39B 3B2DC 4IRSA 3GSUB 1T66D 4GI8A 4NQCA 1CL7I 2QDWA 2FWUA 2F19L 2YD6A 3AGWA 3BVWA 3E2HB 4WNJA 1C08B 1HHIB 3ARFA 3D3VA 1KTLA 4XWGL 5CZVH 5FGCE 3Q0HA 4K23H 4FXGC 3ARGC 5MEND 3M88A 2ZG1A 4UIKL 3GXDA 5KN5A 2HRGA 3DUSA 1F86A 3R06B 4LCWD 3TP4A 4L1HA 4FQQB 4YC2B 2ZXCA 3C6LC 3LHPH 1LMIA 1TVBA 2PR9A 1T1WA 1FLTX 2XYCA 5L2KA 4LT7A 5EZIH 3NIDF 2CO7A 3PP4H 5AVSB 3FQNB 1WCBA 4DAGH 4ODXA 4AITA 5T1KB 4FA8A 2H9GA 3DETD 5DO2D 5GXBB 5D7JD 1V54B 2MRYA 5GRJL 1O7DC 1JWUB 2X4UA 1KLUB 3AAZB 1AHKA 1OCWL 1VCAA 4YHIA 5GGTA 3IAGC 1NPUA 4D0CA 4PJHF 2DD8L 5E2TL 3BSZL 4P2YA 5KYYA 2EUXA 2VQTA 3LH8A 3EADA 3G6DL 5L6YH 1WYJA 3A6BH 3LN9A 1IARB 3SYQA 3WIIL 3PWUB 5HI5C 2W9DH 4N2MA 3O3AB 3MODL 5JUEH 3LVEA 1T5WA 3UCQA 4DKFL 3BPNB 3LS4L 3CDGB 5AOZA 2WQAA 3HG2A 1UVQA 2WPGA 1ZV5A 4X4XA 4NHCH 1SEQH 1PG7W 3PWJA 1UH2A 3OKDB 3PGFH 4W9GC 4HLZG 1ZE3C 1GYVA 4KXDA 1XX9C 2XV6B 3EOTH 4UI2A 2MCAA 2OYLA 1BQHB 5TDNB 4QCIB 5JIPA 1DQDL 4UUJB 5JIKA 2PCFB 1MAML 2FCBA 2E7DA 3UXFA 1FNEB 3B7RL 3IAQA 1R1CA 2NPLX 4G42B 2VR7A 5DUML 1MREH 5DD5H 5IQNA 5I16B 1IMHC 2B1AH 1UYWH 2IANA 3CXFA 3L3HA 3MKKA 5L0QC 3HRPA 1R3HB 1CTOA 1SVBA 3FQ2A 3IMBA 1UZ8A 4JDVA 1JV2A 1WZ1H 1NCNA 4NKQB 4XO3A 1GZHA 4MNQD 1UM5H 4PJXE 4OUUA 5C3TA 3G9AB 4E42A 1HU8A 1W0VA 2VISB 3MROB 2BP3A 4QGTA 5KBPA 4QRBA 3MGOA 4F37F 2XWCA 4F7TB 2NQCA 5HJGA 4P59L 2WTPA 3IMVA 4B9FA 1IILE 2AABL 5ACLA 1WAAF 2FT6A 3UTTD 1S7WB 4RMVA 2F7PA 4YE4L 1OP5K 5C97A 1KXQE 2QTEA 2VSKB 3L3OB 2KZBA 4U1SA 2DMCA 4UIMA 3G6JA 1R24A 1NCAH 3ARBC 3FFDA 5C0EA 4JL1A 2HPOA 5D7HA 4IBZA 2YFOA 5C0ND 5EF3A 3Q3GA 4K94L 5ID0A 2KPWA 2OSLB 2BJML 2E3VA 4ZFGL 5CWSB 4KGLA 3W2DH 5HHOB 3U2SB 2ICES 2V5RA 4GT7A 3K6SA 5ESVB 4PRDA 4OJCA 2YS4A 4RETB 1S7RA 3IMUA 4GBXC 5HYSB 2WZ5A 2YPVH 2Y9RT 5DS1A 4WU5B 3U4BL 1YY8B 4O58L 5I5RA 3IFOA 4Y9BA 3UBFA 4AIZA 2N7BA 1RIHH 3GRWL 4OFKA 3ARVA 2UYLB 4M3JA 5A43C 3MRHB 4XX5A 4DFHA 1C7SA 4PV8B 5D7IF 1KBBA 5EH1A 4A04A 2JWYA 5D2NC 3ZU8A 4TNVF 1JG9A 1PD0A 3K71A 4YUEL 2JELH 1N4XL 3SY6A 1CLZL 1I31A 3R1GH 4KJYB 1FORH 5IF0B 4PCSA 1XCXA 4PR5B 1J0JA 3BXNA 3X1BA 3PWPB 4L1BA 4MMXA 5DJ8B 4NKMB 4LSUH 4ZFFA 5J6HB 4KKNA 4G7YL 5CJXA 4I0CC 4HUWA 4PWFA 4LSQH 4JY6B 1YO4A 3RNKA 1DL7L 5F72S 3CFEA 1D3CA 3GYRA 3GS0A 4WFED 3AACA 5C0BA 4K9EL 4NZRH 3D34A 3UL4A 3WHXA 4PWEA 4ZFQA 1YN7B 1O75A 2G9HA 3KPPA 3AMKA 4B3EA 5FECA 1XGZA 4QJ3B 1IGFH 1IGJA 3FDWA 3BVDB 3CFNA 2YSSA 3TIEA 4KKAD 2XWDA 2A9DA 1FZOA 1OHQA 4Y0GA 4BCZA 1QSFE 3QIBC 1E43A 5E7BA 5KVEH 3BE1L 3FRPG 1HESA 1LO0L 1BFOA 2XA3A 1LO3H 5K5YA 3NK3A 5FW6A 1VFAA 5ERWB 3U46B 5I15H 2H2SD 2VIRA 4F57L 1J1XH 2CHZA 5D1QE 12E8L 1Z5LA 2DQFB 2YAHA 4JG0L 4P59H 3VCLA 3KS0J 3PAUA 3QXUA 4HK0A 2FLBT 4HJGB 3AGVA 2Q6WA 4JFEE 4R6UA 5ESAA 1U92B 4NAQA 4P5TB 3U9PH 4HJ0C 3BZEA 4YSUA 3QYCA 4QYOB 1HNYA 2KL6A 4HAFA 5JMOC 1KACB 2X6CA 3DUUB 1ADQH 2Q3AA 4J39A 3SE8L 3VFGL 4F20A 4MD5A 1RZIA 4EI6A 5J4MA 3H3PL 1NCBH 3WIHH 2Z31C 1UYWL 5BZWA 2XZAL 5JHLL 1TFPA 5KJ7E 3COOA 5PCYA 3O0RH 3L2NA 5J13B 5K9KB 3EYVB 3VXNB 3CXHK 3BVVA 2HXAA 3P9MB 5EOCJ 3WFCL 1CUOA 1B9KA 5AALA 3FFCE 2J1YA 1P9MA 2AQPA 3SPVB 2GEQA 3RDTA 3HE7B 3JV4B 4N6RA 2WSDA 1HCZA 1WGVA 3IFPB 2BIOA 2NY0B 4OI9A 5E8NA 5TDOA 4JFQB 5J06A 1GYCA 2ED9A 2NSXA 4H0IA 1ZLWK 3D25B 1JZHA 1MCLA 1KPRB 3CC5B 4WHYH 1F8TL 5ICZA 3QCTH 5GS0H 2XUWA 4N2NA 5J1AA 4YDVB 3N85H 4ZMOA 4TUKH 4A2MA 2CBQA 2K45A 4XNMB 1QA9A 2J72A 2JTDA 1HILB 1WCBB 2WZ0A 3Q13A 1OPOA 5J12C 2W9EH 2GBUA 3EZJB 1E28A 3QUMA 4OV5A 2VABB 2CCVA 2CDFA 3HI1B 3TL5A 4UYPA 3JBG7 1AIFA 4L8SC 4NZRL 1QR1A 4NQDD 5HJ3A 3L1OH 1RULH 4QPEA 4XN7A 3QDHA 4L4TE 3UJIL 3SCMC 3Q43A 5KSAA 3QYNA 5ABDE 3KLAA 4MNQA 1G5AA 4NUGH 4MJ2A 3NZHH 1OWRM 2X40A 3GXIA 3DJZA 3T3MF 1Q0EA 2A73A 5FFLA 4MHHI 4LBEA 4NPKA 3R8BB 4H13C 5JLZB 5ESQA 1MCIA 4TNFA 4PHZA 5I1CH 1XIWA 4KHTH 3T2PA 4ZMQA 5F21B 4IHOA 3ZT5A 3J07A 1UVQB 4G6JH 4N9GB 1ZLVH 3ZE1B 4IS6A 2XQYA 2N1TE 3VXPA 4B9JA 1P7QA 3CFUA 3MRNB 3NCYS 3MV9D 3I2CL 4N0YL 2DBJA 4PWJA 5AKRA 3WXVL 3APCA 4G5ZL 1LO5A 4HJIA 1MCSA 4M93C 1NGXB 4OLZL 4WW2F 4P48A 1U8QB 4KMQA 2E9GA 1D7FA 1GCYA 1PQZA 4BDVA 3K2UL 2JXMB 3GUFA 2F8OA 3EOBA 4KH9A 3WNIA 4FJ6A 4DEPC 4ELMB 1IL1A 2IDCA 1ECZA 3UTTE 4JQIL 1WFOA 4HJ1A 5DD6A 4GEIA 2FRGP 1ZGLM 3AM8C 1J9RA 1AD0B 2D7QA 3IDNB 1R5VA 4HWNA 5DMKB 1VADB 1FVDA 2XPYA 1KJMB 3AXIA 3ZDXF 3TBBA 4P2OB 4JG1H 2G4GA 3ZTNL 5DJ2B 2EACA 3BSZA 2H1PH 4YL9A 3U7WH 4YIQA 2XV0A 1J7VR 4QHMA 4M6OH 1KWKA 4LKXB 2VDNL 2ZOKA 4HKXA 3IAPA 2K8QA 4F7TA 1D5IL 4IBSA 4QRQB 1G9MH 4CDGC 1LP9B 1R3LA 2Z3FA 4S1QH 1NCTA 2R7EA 4OLUL 4P9ML 4HXBH 2AXWA 4MXWH 5AL8A 1I8AA 3OSKA 2OV0A 3GZPA 3GMOA 1OD9A 1S5HA 3FCUB 4AQOA 5E9DD 3S0PA 3SDCD 4HS6B 5AENA 3DTXA 4XNQB 5KSBF 2XPGB 1S6NA 3HZ3A 2K9FB 1KOAA 4GS7B 2B1OA 1B0WA 1BF8A 2DYRB 5DC9B 1GTNA 4BFNA 5LXGH 2F7IA 3QG7H 5ID0B 1YUHB 1DHKA 1CBJA 5C0CE 3QWNA 4OTXL 2H3NA 5E99L 2DLGA 3E6HA 4XCNA 2YSTA 3LNEA 2RQ8A 3IF1A 2EEDA 2ICCA 1ZRUA 4KBPA 5E5RB 3V8OA 5I73C 4MMYA 4PJ5A 3P11H 4UT6H 1QWHA 2DAVA 1M6OB 3FUMA 3MRGA 3QK0A 1JZ2A 1BZ7B 1TITA 2D7MA 3VFRB 1DVQA 4Y19B 1P2CB 1YPZF 3UTQB 4N2GA 2BVOA 3P4OB 2Y3AA 2OW6A 1AKJB 4ADGA 4JM2A 2I9TA 1I82A 1MRFH 5F7AA 1I8MB 4R8WH 3T4AB 2YO3A 5T5NG 2BFVH 5F7BA 2YRBA 2YWZA 2Y5TA 1J18A 5EO1A 3FO2A 2DQTL 4C58B 1YY9C 4BIKA 5HBBA 2X0WA 1DJIA 2XG5A 3MBEC 3K6OA 1X4ZA 1MFMA 4A2DA 5KW9L 3RNKB 4DW2H 5IW1A 2KS0A 5HPMA 5KYXB 4CBZA 2WLKA 3T6ZA 3KJ4C 4MCZB 3D06A 4IKIA 3RWEB 4G7VL 1SUJA 5ICYA 4L0YA 1SGKA 1TJHH 4YZFF 1ECYA 2JQAA 4NAMA 4ODBD 2D7TH 5I1HL 3BUBA 5DUPL 1SZNA 1UA3A 1W8OA 3GEWB 4Y4FB 1DBKL 2L8AA 5LBVA 4DP4X 1RUQH 2WINA 2EYTB 3WXWL 3O11A 3BAJA 5L4MA 4QY8A 3D3VD 3OMZA 1ZHKB 2ZXGA 4Z9KB 2OZ4H 3CFJB 4AGNA 1ZDQA 2X9YA 3M7OA 4ZXBA 5DC0A 2FLMA 2ESVD 2MMXA 3V4PB 5FHBH 4JPIA 3B34A 4H44C 2QSTA 1EAJA 2WVVB 1NGQH 5SV3A 3VB8A 3WYRA 3N43F 3HG1A 3A24A 3GDCA 2UZYB 4X6BA 1RUKL 4U1LB 1W16A 4JFFB 3RUGA 4U7SA 4CUCA 1IEAB 2DV6A 1AGEB 5BMFL 2DLIA 1K9TA 1WBXA 2BVQB 2WBWB 4AJYV 4NDMB 1KJ2H 1WWCA 3J7HA 1O7VA 3ECVA 2B08A 3F01A 4HFUH 3X13A 5IUSA 2HLAA 4M1DL 4X5XB 3EGXA 3GEFA 1IBGL 2QKIA 4K3DH 3UBXA 4NO0A 2NXZD 2FL5A 5LCVL 3KYKH 1SN5A 3F6JA 5CILH 1DBJL 1E4KC 5BS0D 2P47B 3RDTD 4YEEA 2VLKB 4Z1PA 3IKCB 1M1XB 2W9DL 4JFQA 3N41F 3Q8BA 1EAOA 3B9DA 1WAAE 4Y1AA 1PX4A 2FLRT 3NMEA 3CDZA 5E1GA 3CTTA 4HK3J 5CGBA 2GKIA 4JHWL 4MQ7B 1GKEA 5JOEA 2CPCA 1MCNA 3CK0L 1OHZA 4HV8A 4CU7A 2JF1A 4A2LA 3RWIB 1K8IA 1MJ8L 3ZUNC 3QJHA 1K5NA 1O5DT 1XGRA 4K8RL 3VXME 2ZXWB 1JBJA 4XBEL 3FFCA 3RPIB 3QHTC 3DX2A 2H32B 3L6FA 1GGIL 4FQIL 5JQ6H 4D2NA 1BD2B 2ZOLA 3UPRB 2AQSA 4HLZH 4LSSL 1AIFB 2AK4E 1QR1B 5I76B 1PLGH 4Z7VE 4OI8A 2ITCA 3FYEB 2R1WB 3VQ2C 1MHHA 4A2EA 5KSAB 3NIFE 2YN3A 1P84J 4PJ8B 5D1ZD 3WS3B 3NCCB 2L7QA 3WU1A 5IBUG 35C8H 3BVUA 1XMWA 2J8OA 4A38A 4FNLL 4X4ME 4N0FB 4ALAL 2YD7A 4DUXA 1NUDA 1BXUA 2EDEA 4WKZB 2DQDL 1X5XA 2NXYB 2BNRE 2X3AA 3LYRA 2HSIA 1MLCB 5IHZB 5FV2A 5IMLA 4R4FH 4P4RA 3D52A 1BVNT 4FFYA 4KY1L 1EDYA 3OLIA 2Q87A 3HMXL 3BKCH 3IN2A 3C8KB 2MNJB 1TTCA 1A7NL 1J8HE 1PBYA 1S7QA 1LO5B 1YMMB 2FX7H 3EGDB 4OZIE 4MXWL 1A6ZB 2PCPA 3ZO9A 1ILUA 1YC8A 5IVZB 3LJ3A 3UP1A 3JWOC 5IGXH 4IEFB 1E6JH 2EZ0C 4W9FC 4PWKA 4ZW6A 3EYOB 1RZKL 3L3KB 2OXHA 2BC4A 1QHQA 4KMLB 5DJYB 5EF2A 3J8F7 2FK9A 5JO5A 5KBLA 3CFMA 3L4ZA 1TPXB 4YMPA 3TV3L 4IOSA 1UACL 4HWBH 3RZCA 4F1ZA 3Q5TA 4KRLB 3SDDB 5F93C 5ADOL 1BAFH 1XD1A 4U1NB 3VNZA 3BKYL 3HZYA 5KVFE 3W3BA 1T6WA 3WO4B 3FUFA 1EVTC 1WHPA 2VM3A 1U8HA 1XR9A 4G9DB 4XP9L 3SKNB 4ZYKA 3JWNG 1Q72H 2ZCLH 4AUJA 3NIFF 4AVJA 1BA9A 4WY7H 4B41A 2XWJB 4EEEA 3D0AA 2CJTA 2Y1YA 1OGPA 1E9QB 5CJOL 3FS9A 1VAHA 3S37L 5GGRB 3CVBA 3GHPA 1T20B 3V55A 5D4IA 2BSEA 1GJUA 3P3YA 4U33A 4UAOC 5TQ2H 1HYRC 1MFDH 2BINA 2D3VA 2LFEA 4L4TA 4OLYL 5L4IA 2C3GA 5HYQA 2XPZA 3R0MA 1LE5A 2FO8A 2LABA 2P7TB 5E9NA 4NUJA 3GBDA 3ASNB 2NUTA 4NNXA 1D9KA 3TA4D 5I1LA 1BVOA 1DUZA 4PJ5E 1OB1A 3AUWB 2N0KA 2B0SH 1HEHC 3AREC 3TA3B 2IPKA 1A3ZA 4D7PA 1R9FA 2V8LA 3BCFA 4GRWH 1YEIL 5HHMD 3MLXL 1M56B 4MQSB 1EUTA 5HHPA 3F7KA 3SYAA 4PY8I 1H5BA 4DCQB 5LLIC 2IH1B 4HJEA 2DQJL 4G2AA 1JGDB 5B7EA 2I9TB 1OLLA 3BVXA 4OCXL 5JW3H 4DP0X 5LQBL 4N20A 3N85L 2HKHL 5I1KH 3FOLA 1FCCA 4DN3L 3CSYB 3EDKA 5F96L 2F5BH 1ZD6A 3ISYA 5FKPB 4ETYA 1T4KB 3GSUA 3FN0H 3A47A 1KJ3L 3BP6A 5I5MA 2ZCKL 3BH9A 5F8RC 2XIIA 3D3VB 4OGYH 3H55A 5EN2B 1RZKH 2GJPA 5HD8C 3T3MB 4XZ4A 3V79C 4M5TA 3H3PH 2BPBA 3WIHL 1T03H 5E2VH 3ZMEA 2WVSA 1Z5HA 5MENE 2IQ9H 5ECJE 2O72A 2ZXBA 1B0GA 5AKVA 1OAKL 1QLFB 2R0KL 3HFMH 1PSKL 4NPYA 4P5TC 35C8L 1KCRH 5TF1H 4L1DA 3ERXA 3S34L 3GO1H 3B8YA 4PJEB 2DLHA 1OK8A 2W0FB 5ADOH 4BCXA 1MHCA 2QMKA 2XOTA 5I1CL 2NQDA 1BYPA 1W9XA 1OAXL 3C60D 5T1KA 3E1F1 2EDTA 1L5GB 1CZ8L 4Y2OA 1XGTA 1X7QB 1JIBA 3W81A 2LVCA 3CIAA 1M7IA 1CR9L 2APTA 4XP1H 4YL4A 4CSTA 2LU7A 3CHPA 4OB5H 2Y25A 5BRZE 5IEHB 1AYOA 3QEQA 1HNFA 5L4FA 5HVGB 1UASA 3EYUH 1QPPA 5CHNB 3ML8A 4H2AA 4CVZA 4LDEB 1YYML 2DZEA 5F3BB 1N2RB 3GZQA 3FQUB 3WN6A 3PQYE 3UZVA 4K55A 4PJHE 1J0KA 1UD6A 4D9LH 4JN2A 5JPMA 2NNRA 4X2UA 1Q9LA 1QSEE 3BYYA 1DFXA 1R3JA 1NTDA 2ZX9A 4XX1E 3BEVA 3NJNA 5C07E 4Q4EA 1IAII 4TVUA 1HZHL 2IEPA 5AW0B 1CS6A 1NZRA 4LDLB 4KX9A 1PCXA 2YD1A 1FFTB 4RQQA 1CD1A 4Y4HC 3C09C 5D1ZA 1YZZA 2FSEB 4YJZL 3D2UB 4EN2A 1MCWW 1HH9A 2DOCA 3MACH 5TPWH 2H6UA 4FXKB 2I7SA 4GXVH 4XMKH 2BP8B 1F58H 2PCFA 1GY1A 4A7VA 4Y2DB 5CZXD 4FABH 2GI7A 1PY9A 3GI9L 3K46A 2ERJB 4A39A 2EO7A 8FABA 1OGAB 4Y1AB 5C0RL 4AEIH 3GMQB 2YXVA 3T1FB 2Q7AA 5BNXD 4EXKA 2FEEL 4QRUA 3PP4L 5TE6H 1AXIB 1XT5A 5FO8B 4J3OD 4D8PA 1DR9A 1IIKA 2DIAA 2RH0A 3CVHA 3NH7L 4GSXA 1W0VB 3H9YA 2PN5A 1NFIA 3MROA 5GPRA 4DGIL 4E42B 3UTSB 2QPDB 5C7ZA 5D6DA 2A6JA 1RI8A 3QGVA 1FZKB 2NY1B 2TRHA 1BSIA 5K9QG 4GT0A 2ZOLB 4YN3A 1X5AA 2O5ZL 1N5YH 1HN1A 3II3A 4ANUA 2VCOA 5IQ9B 2MPAH 4TL5A 1XIWD 2EE2A 2X6BA 1QVOB 2VDPH 4F15C 3WS3A 4M93B 3A4AA 3PWLB 4Y7MA 3FQWA 2I69A 3FQTB 3LXBA 4MAYD 4MD0B 4WHCA 5H94B 5CUSH 2NTSP 3SBPA 3V4VL 5IBUB 3MGTB 4YSCA 1JN6A 3ZQ9A 4PRBA 1J5DA 2K1MA 3F7YA 2Z1PA 3JWNE 4PB9L 4JFFE 4XB8A 4YHPB 3VE0B 5AZEH 2BXZA 4NSKA 5FYLL 3NSXA 3LZRA 2DBLH 5C3IA 5I9QC 4AYMC 3OAWA 5JOFA 1I1RA 4DJMA 3FBQA 4FG4A 4K7PX 2EDXA 4WNSA 3KLSA 3ZIMA 2OLDA 3JV5A 2UYLA 4FQ2H 1YEGH 3L7EA 2FWOB 4DIXA 3CLEL 3JUYA 5DD5L 3MV11 4ZX4A 1R3KA 1NC2D 4U2YA 4YSRA 3HE6D 1NGPH 4KROC 5IEKA 4Z77B 4JFXB 4DFIA 4P4KB 1OAJA 4KJYA 5HHVH 1XCQB 5K59F 3CSPA 3BW9B 5KVFH 2XCMC 1A0QL 1Z9SB 2BVYA 2DMBA 5KVGH 3D18A 3HHMA 1Q0YL 4CU6A 1Q9WB 4GG6F 3CCHA 5T5FL 4GS7C 1V5JA 2FBRA 2VLJA 1RVFL 2BNQD 3MOQA 1NIEA 4G9FD 5E24E 1OGTA 1RURH 3F58L 3QUXD 5AOKA 1Z66A 5E6IB 4YHZL 5D96C 3SKNA 1KUMA 5CN3A 5J56B 3QDGB 2BRRH 3TJPA 1UA6L 1HIMH 4LAJH 4YHNB 2VZOA 4TQEL 3BSHA 4HCRH 4Y5YC 4NQEE 1N6UA 2H6OA 2OMXB 5C2BH 3PAYA 1BD2E 5SWZB 3CG8A 4KOCA 4L4VA 1FPTH 4TF4A 5ETUB 2ADYA 2X1XR 1W72A 2P46B 3PPSA 1DQLL 1ZTXH 1R46A 2YN5A 3QDJB 1T3FB 4Y2LA 3PIQB 1NL0L 3X14B 2F5BL 3T71A 1OF2B 5EF0A 2DLFH 4EZJA 1XQ4A 1B6UA 3RL1B 4A2GA 1M3JA 4E2OA 4UDTA 3WNKA 4X83A 1WUZA 4N1EA 1TF4A 1IC4L 1PFCA 1DVFC 4W4OC 3MREB 3PE9A 4NNXB 3KCWA 3HW7A 1UWXK 2EKSA 1P4LB 3NFSH 1UG9A 2Q6WB 1CBVH 4FJYA 2H8PB 4TQIA 4JY5L 5E6YA 5JW4R 3L45A 4NWTL 3RWDA 3LH2L 1BD2D 3TA3A 5C6WH 3FN9A 4OAWB 5I0DA 3R18A 1FDLH 4QMEA 2VRKA 5I1HH 5B1KA 5T1KD 2BY3A 2AI0H 2HT3D 4JRLA 2OJEB 4KH2A 3D4ZA 1YEHH 4WK4B 3R7QA 2ADJB 4X6CF 4YPJA 2H4EA 3D30A 4HH8A 3NGBC 1KFAH 4FQHB 2Z7YA 5IZ7A 2AC0A 5D70H 4LSRH 3HB3C 3BRFA 2YA2A 4KVPA 3X3FH 3KPNA 1NMBH 3PL6C 4I2XE 4KQ3L 4Z7WE 5EUOA 3BH4A 3VMNA 4I89A 4ETQA 1AZCA 1Y07A 2FIKA 3IJHA 4PRNA 3UG3A 3KPRE 3QS2A 1VPOL 1HT6A 3RVUC 1BFSA 4HC1A 3GBEA 1YMMD 2VR9A 5DMGD 4PU2A 4N2AA 4J6RL 1RSFA 1QSEB 1S46A 2R0ZL 3CVHL 5JDSA 3QUYC 3F7VA 2RALA 3TH2T 2Y36L 3HG1E 3O6LH 2IOIA 5EZJB 1M7DA 2AJUH 4YDVA 2WZ6A 5F6IB 3RX7A 4O51B 1IQDB 2K3HA 4LSPH 2C34A 1Y18B 1JRHH 1HILA 4M7JL 3TBYA 2JJVA 3QJFB 5C0GA 3C60A 3P77A 1QI3A 1PDKB 3TO4D 3U6XS 1ZLVK 4U6YB 1CXEA 4I18B 2MCPL 1R6VA 4ZQTA 3TT3L 3STZB 2X1PA 1I85C 2H2PC 5BRZA 5C0AE 2WBXA 5KBKA 1CPUA 4J3XA 5DMJB 3EJYC 3Q48A 3QEQB 1SVCP 2QADC 1BLNA 2CO1A 3VH8G 5MHSD 5CU5A 5CEZD 4AE0A 4CVXA 4I3SL 4U1GB 1LWJA 5IGXL 2X6AA 4KRMB 1PX3A 1GSMA 4JVUA 1FJ1B 4IGBC 1J5CA 2ZYRA 4AYID 5GGVH 3ZE0B 2G75A 4AH2B 2D4FA 3UEQA 2W9EL 5MENA 3BDXA 5GRVL 5KOVC 5BZDA 5E23A 5E2JA 4JVWA 4HLEA 3U0PB 3Q5YA 4IS6B 2WLJA 4QRAA 2Q86B 3V9FA 4GKSA 2FYYB 2E4TA 4QTIH 5D6CB 4HFWB 5D5MB 3U7YH 1M2VA 2PP7A 1C1EH 4Q89A 1II4E 1ITCA 1U8QA 5D7KE 5IUCA 1VZIA 1BIIA 1QAWA 4RZCA 3CNKA 4ODHL 1BEYL 3MCKB 3MN8A 5FA3A 4N8UA 3EYFA 3HN8A 3QO0B 3B2VH 3TA3D 1PLBA 4YDIL 8FABB 1FUNA 4KHTL 1JSYA 4I5BB 1IIIA 2CXKA 4ZMTA 3EBIA 2HVJA 5FM5M 2CG9X 4AQZA 4RESB 3SKMB 5KZCB 3WJMA 1FG2B 1A1OA 4Q14A 4OI7A 2FBOJ 4G8EA 1GW0A 3X3FL 5BUGA 1MCKA 2QVFB 1MCPH 4YIQB 1ET5A 1WCQA 4ADIA 2HAZA 1JZ8A 3BP5A 3CN1A 2BHYA 2HLEB 3FMGH 4LKXA 5IKCB 1PEWA 5ALBH 3NEOA 2EILB 4GQQA 1T22B 3TT1H 1CYGA 4MQXD 5TK2A 1R3LB 4FQLL 5IVNA 3N6YA 3BPOB 4XBPB 5I5IA 1CLOL 5EU6D 2PW2B 2JSFA 5DMYA 2YJQA 3CH8A 1FZJA 5EIIB 1WA0X 1XGUA 3IGUA 4KZEL 2Y1AA 3FQWB 3SJVD 5DI8A 3R7RA 5IJVB 3QIWB 1Q1JH 5CEZH 3U6XA 2LLLA 5E08H 1L0QA 1H0DA 4FQXC 4X99B 4U3SB 1U9KA 3TBSA 4NIKB 2ICWA 1JN6B 3LS5H 1CL7H 5ICXA 4CMMA 3N42F 1WE5A 1UCTA 3DX6A