1EZSA

Crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
131
structure length
125
Chain Sequence
PYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTAYYVFDKVSSPVSTRMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords ECOTIN
total genus 16
structure length 125
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ezsA00
4IW4C 1XXFC 4NIYE 1FI8C 1IFGA 1ECYA 1EZUA 1P0SE 1ID5I 1XX9C 1SLWA 1AZZC 1SLUA 1SLXA 1SLVA 1ECZA 2Y6TE 1N8OE 1EZSA 1XXDC
chains in the Genus database with same CATH superfamily
4KNSA 4KDTC 3MLTA 5AUMA 3OBAA 4MCYA 4OLYL 2DTMH 3VFPA 2YJLA 2WV3A 4Z77A 2XCMC 3LVEA 1A6TA 4FQHA 4AW4A 3O3AB 4S1SH 4PJFB 4QHUB 3DX8A 3ULUH 3F7QA 3Q2NA 4N0FA 1A4JA 1MPAH 2R8SL 1ADQL 3HG3A 4X7EC 1QO3A 4IW4C 4LDLB 5DC0A 2BSCA 1FFOA 3Q8AA 4TVPE 2IFGA 3O3DA 3EAKA 5DHYB 1WFMA 3K6FA 1GZQA 4LBEA 1RZFH 5DUBB 4LSPL 1KC5H 4BINA 4GAAA 3FDWA 4HK0B 1GMIA 4RZKA 4ZX3A 5BZWB 1DL7H 3B7TA 3BT2L 3FZUD 3FQRB 3MRIA 4WI6A 3V52H 5L2KE 1MCFA 4Z0XA 4A7UA 2YQGA 4NC1C 5D5ME 4ZFOB 1AHWB 4HF5H 4IHOA 2IDUA 4L3CB 4RMSA 5KVDE 2W1NA 3QUZC 4XCEA 3P4NA 4X9GA 4XMZA 2AXFB 3F5WA 1T80A 5JIKA 2WANA 3PL6C 1H6UA 4K7FB 1UWXK 1DEEA 3VGGA 2QFRA 3PGCB 4Z7QB 3WY2A 1YAIA 2NNCA 3PAVA 3QC6X 1EUTA 1XGUA 1GXEA 4JFHD 4P05A 4JPIA 1CGYA 2VLRB 5F3BB 5DHVA 1U33A 2NW2B 3VYPA 3T6QC 4ZFOL 5FLVA 2FJHB 4X2UA 3NJVA 5F3HB 3MRIB 5IQ9B 2R1WA 1QSED 4FQPA 4WNQA 1TXKA 5AZUA 4PGZA 4HGWB 3VFMB 5BS0B 4PJHA 1R3IH 1S5HB 4HT1L 5JQHC 1BZ9A 1H3PH 2FYYB 3V6ZB 3TYFB 4FG0A 5JW3H 3EYFA 1I3RA 3VI4E 1F3DH 3V5HA 2Q8AH 3KWWB 3WFEL 3QFGA 3KYKH 5I8OH 1DJXA 4HISA 5GGTL 3D3VD 3KEHA 1ECZA 1AH1A 1DVFB 5ECGA 1RK1A 5D5MF 1TVBB 3CPLA 2UX7A 4O2EA 4IGBC 4LSPH 5DK0A 5FR3A 5DHEA 3O6MH 2V5RA 4P23C 2YBRA 2ZUQB 3LN5A 2EYSB 3QYCA 3F5WB 3B9KD 5GS2D 4DN3L 2EILB 2CBPA 1J8HE 4ZXBC 2YAOA 3HG5A 3QIBA 1CFBA 4HJUA 4KQ4H 1E43A 1R24A 1AI1H 4OIIL 4LCIH 4UM8B 4AJ0A 3AXIA 2WUBH 5CCJA 3DBXA 4GFXA 2E27H 4PMFA 2UXVA 2VMDA 2YSSB 3TH2T 4F7TA 1UKTA 3GKWH 4OSUH 1F1GA 3QNZB 2LR4A 5I6XC 1QBLL 5CINH 5K9JL 4IMKA 4JFDE 2LE9A 3S3CB 3DGGB 3GINA 1KLUA 1QO3B 4NQCB 5KBPA 2QR0A 4P9MH 1QNZL 3LKSB 2DV6A 1I7RB 3VU1A 4NQDB 5B3NA 4KJQC 1QKZL 3ULSA 4RISH 4E5XB 4U2YA 2J8UA 4PAZA 4QTIH 2R4SL 5IJCC 3C6LC 3V95A 3FB8B 4Q52A 1QBBA 2Q8AL 3ZDXE 5C08B 4GI8A 1AR1B 3UCRA 1WIUA 4LHUA 4L4TB 2LU4A 3WJJC 3QFJD 1M7DB 3BIKA 3GMPA 3FUDA 3AITA 1OK8A 5C9KA 1DQIA 2AEOA 2E59A 5D1XB 3CK0L 5C0EB 3WIAA 4LPVA 1FNLA 1G7QB 1TFHA 2B77A 2J73A 2UXTA 3E38A 1P4LA 3GBLA 4LCWA 5EIIA 4HWZB 4MAUH 4W4NA 2C7UA 4JM4L 1JGUL 5KSVB 2IQAA 1UT2A 4HKBA 5GRUL 5GISL 2EDWA 2WWNA 3UMNA 3PHQB 1RJYB 3TA3D 5ILTH 5J8OA 1MREH 4NQXB 4LLMB 4DGYH 2DM4A 4G80A 1RCYA 3JTSB 4M93C 3UBXA 2APFA 4NYLB 4F3FB 2DLIA 1D7FA 3NCCB 5MERB 5K9KB 2JNZA 3OF6D 2XPGB 3TN0A 4Z7NF 1E50A 4HCRL 1RK0B 5D70L 1SXAA 3TIDB 5D6CA 1IM3A 1LTXA 4YXHL 3O8XA 5HBBA 1U8CB 1BZ7B 2ZX7A 1S6NA 5I6NA 2KC0A 2EXYD 1AG0A 3K81A 3RVVD 1KYFA 3ARBA 3DOIA 2P24B 1CF8L 2X4RA 3DVGB 3IXAA 3TYGL 4K8RC 4BFIA 1CO1A 3VXUD 1NCDL 5FHBL 3U25A 1G7MA 2FGWL 2VAAB 3D25A 5LQBL 3ILQC 2GBAA 2ICWJ 4UTAH 3T04D 2JFCA 4TOYH 3KZ8A 4PJ7E 4NPKA 5D93B 3GDBA 1K2DA 3MV8A 2I85A 1SDYA 3BQUA 1KGIA 4TQHA 3VRJA 2I7SA 3QEGL 1LO2L 1JPSL 4N86A 1VCBC 5KBMA 4R90L 1IC7L 3NPSB 3Q48A 4F7CB 4OV5A 3WNKA 3IDIB 2Z65C 4HKXB 2PW1A 3MNVB 3QQ4A 1KDIA 4WWKB 1YEIL 3QHFL 4K7PH 1AHMA 3KYMA 1ZVYA 2Z35B 3AY4C 4IGBA 2YA2A 1F18A 4H44C 5CLXA 5D4IA 4KJWC 3VTAA 3MDJA 3JV0A 3B43A 1QWNA 4KRLB 2LLGA 4WDIA 3WFBL 2NDGA 4TV3A 3C8KA 1PEZA 3AAZB 1WH0A 4ZW7A 1LK2B 4XZ4A 2YRLA 3CFCL 3S3SA 4NLHA 4UINL 5E7FA 4TVSa 4OD3L 1WC7A 2F15A 4N68A 1U2YA 2PYEB 3WO3B 5IB1B 2P48B 5DRXA 3LD8B 4GQPH 2LGNA 2DOCA 2IDFA 2EDYA 2MMXA 1IKNC 4NGHL 4QYOA 4JVPA 3DV6B 2Q76A 3MLWH 4J8RB 2BERA 1FLTX 5KAQF 1GSMA 1MFCL 1SYVA 1HXYA 2FL5B 3L5XH 4NJ9H 1D5BB 5ADOL 3HW7A 2ZX9A 4S2SB 1T83C 1CI5A 4CVXB 4JW3A 2VSMB 5ERWA 2BVUA 3SDXA 4ENEC 4OZHB 3T77B 2D03L 1TITA 4JS7A 5DJ2A 3T8XB 3ZRFC 3FSOA 4HUWA 3B7UX 5AW6B 4NKOA 3L5JA 5D7JC 1R17A 3BP4A 4YE0A 5BPPA 1KDJA 3PP3H 1SOQA 3VFMA 5C0AD 2COVD 3LD8C 4NHCH 1IAIL 3DX7A 4MJIA 2DLFL 2EE0A 2XC8A 1MJ7L 4QAWA 1Q0EA 1YG9A 2ZXWB 3BAKA 3DXAD 4X6BB 4KK6C 2WQVA 1IC7H 3QHTC 3CWGA 2WLLA 5AW3B 3KJ4C 1FV1B 4BZ1A 2W5PA 3IWVA 4PJ7A 1PD0A 1RU9L 4JO3L 4X4ZA 1CFVH 4LVOB 1NSNL 1HHKB 1Z0MA 3GZQA 3MLVL 4WI4A 4BFKA 6TAAA 2WXNA 5JIIA 1E40A 2AXGB 4FJ6A 4DZ8A 5CGMA 1B4TA 3AXLA 1F3RB 4JRXB 2EDDA 4BDVA 4PRPD 5FOBB 3NPSC 1QUNB 5I71C 1UB6A 3QFDB 4AENA 1BZQK 3ARUA 4UIMA 4N2IA 3ESVF 1YMMD 4ZX4A 1USZA 5C0NC 4IBYA 1H9DA 2VMCA 3LNIA 4TQPA 1PAMA 2DN7A 4OJCA 4YVUA 5AENA 5FYKE 3INUL 3SIKA 3W9DB 1VESA 4YXHH 3MR9B 1O6TA 4NDMA 4GYBA 3PGFH 4G9FE 3GUTB 2MCPH 1CTMA 4YIQB 5BOPA 5ESQA 4JPWH 3NSXA 4S1RH 3X1BA 3JUYA 3WBDA 3CLEL 1W16A 2FD6L 5DD3L 1IAMA 1NCDH 5FHBH 4MCZB 1A6AA 1MLBA 4HV8B 4F37F 4LGPB 2YD3A 5GGRY 3APNA 4RFEB 1PAZA 5E5MA 3VFTA 4NN5B 1ZLUK 3HJ0A 3PAUA 3IWUA 4OUOA 3OWRA 2C3VA 1B2YA 4MA1B 3JWDH 3QAZC 3A21A 5INDB 4LEXH 2ATPB 3O45B 1NCHA 4AI7A 5ISZB 5IM7B 5AW0B 1U8QA 3NZSA 4JY6B 1SN5A 1EBPA 4NO0A 2DMHA 4PRHE 4UQBA 1ZT1A 1I7TA 1ORSB 4MDIB 2YFOA 3NQIA 4JG0H 5BS0A 5IQOA 3FT4B 5CBAB 1Q9KB 3II1A 3QR2A 4NRZB 1DVFD 4QHLB 1CUOA 2UVEA 4ZTOH 5BW7A 4WEBH 4O4YH 4EXPX 2A6KA 1U9KA 2W07B 1LWRA 4PS4L 4POUB 3HAEG 1KTCA 4J3SA 4YE4H 3VXUE 3WHE1 2X2IA 4OFDA 5EUOB 3OKYA 3MO1A 5E1IA 1RZJL 3G5YA 1P4BH 3KPRB 2F53E 2XA8H 1RPKA 4RDQG 5BRZE 4H1LA 2X9YA 5IIEB 1OW0A 4FE9A 5E00A 5E2TH 3G6DH 2AAVA 5JXEC 5KBKA 3D85A 2UY6B 1K4CB 1T83A 4HULB 4NB7A 3CFQA 5I1JL 5ADPL 5D7LD 1U8IB 2XX1A 2ZXBA 3BO8B 4GINA 4YSQA 1HL8A 4M9PA 3W9EB 3HFMH 2EVGA 2JKWA 2ROYA 4G9FB 5T1LA 2BM3A 4BZ1L 3AFLA 1G4RA 1AD9A 2BNQE 1KPUB 2A9ML 4ONOA 3UTSA 1XF5B 3QULA 4J23A 1UASA 4YHKL 2J3SA 2HVJB 3U0WL 5KS9E 1FPTL 3AG4B 4NN6C 2VIRA 2ALAA 1Q9KA 1VFAB 1L9MA 2ZKYA 1QPPA 4NRZA 5ACLA 1ZJBA 4R2GD 1GZHC 5EZJA 1TKWA 1AP2A 4LDCA 1T22B 2PP9A 3RWIA 1LQSR 1QSFD 3I6LD 3TEYA 1T0MB 5CEYB 2DLGA 3QEQA 4J3BA 3WTVA 2XRAH 4FFZA 1Y6KR 3RWHA 4DO6A 3UJJH 2WZ0A 2XVKA 3O3BB 4JKLA 4M8UA 3S2AA 1KF9B 4P06A 4Q6YA 4BSWA 1E42A 1L3WA 3RNQB 1GJWA 1BSIA 1MXDA 3F12B 2BOCA 3LSOA 2NQCA 1SJXA 1KJ3H 5CSZB 4A55A 4P46B 5GHWH 3QFJB 5K1NA 2AJSH 1ASQA 2R69A 4HK3J 1IKFL 1YPZE 2CWRA 3QQDB 5JHDA 4XMXA 4ONHA 2IQ9L 4JDTH 3T1WA 1UCBH 2HYMA 4RMTA 3SKNA 2OMUB 4PU2A 2UZXB 3U30C 3HS9A 3F7RA 4LSSH 2E7CA 1CN4A 3ARWA 2F61A 2NNRA 1P7KA 8PAZA 4PJXF 2W0KA 1J9TA 3QH3A 4NQVB 4WDIB 2GIMA 4R7VA 2I07B 4DKAA 3D33A 3GBEA 4OLZL 2IFFL 5K69A 4Y5VB 4WQOA 1BIHA 1PJ9A 1IBYA 2WBKA 3VI3F 3QNXB 4OB5H 1UFGA 4GW1B 1N5YL 5AW4B 4AT6A 3PWJB 2ZKHL 4L4VE 1BLNB 5CR8A 5H4ZA 2H1XA 1MHCA 2YJQA 4G9DB 1I82A 4PREA 5CFAA 1G6RH 3JV4A 4ODXB 4WO4C 1SM3L 3LB6D 5KANG 1WFTA 3NVQA 2PNDA 4XP9H 5HI3C 1CCZA 1Z5YD 2V33A 3G08A 4KPHL 5DUJA 2EDMA 5IFJB 1URZA 2WZ5A 1EO8H 1INEH 1NICA 2BSTB 3BP4B 3QPXH 4WI5A 5FLUA 1FYTD 4RFNC 3MRBB 1DCEA 4X8XA 1CDBA 3QNFA 5E8OA 1AFVH 4P2OC 5IV2A 1PS3A 5HHVL 2CE6A 4JLRA 2G2RA 3TIDA 1FN4B 4WFGE 5D9SB 5GHWL 2QGDA 3TNMB 2EADA 1HH6A 2FTAA 1FC2D 1XGPB 2H5UA 2OSLB 3VFOB 5L2KB 5FV1L 1MFDH 3VFRB 3S88L 4XCNA 2Y3NA 3IBOA 4L37B 4PJFF 1KV3A 2YC1B 1BFVL 5SX4H 2R59A 4UBDD 1RJYA 3NRQA 2EIZA 1NCCL 3MPCA 4X4KA 4FYQA 4XVUC 4L1DA 3DRTB 2EUZA 4HFWA 4X5XB 1IGIL 1JI1A 1NIFA 4KH9A 1DBMH 4ZNEA 1FL3B 4U05A 3EOAB 1J0IA 4PBWD 1QASA 1XF1A 3X13A 4QJ3B 4LSUL 4GAJL 1BDYA 4YHIB 3KPPA 2ZWKA 5EFIA 1ZHKA 3V5DA 2DEXX 4U1SB 5CGBA 4QRRE 3VM5A 1EZLA 2CRMA 3FO0L 3KVQA 3M17A 4A2EA 2XOTA 4HK3N 4R4FL 3K6SA 1PSKH 1IFRA 1OAJA 5HTSA 3VRIA 3HAEB 1NKRA 3I6KB 1WZLA 3EFOA 4GRWH 3MV7D 1R3KA 2E9GA 1EFQA 1BEYH 3MRHA 4H8PA 4YBHA 4PGCA 3E3QC 1N67A 1VB9A 4UQAA 4P23A 2XQYG 5B1JC 1SN0A 3VRIB 32C2A 2NLJB 2WKOA 3HTLX 1VZGA 1RK7A 4OY9A 5ID0B 4KQ0A 1B0WA 4MQSB 2CJUH 1V3KA 4JZJB 4F58L 4QHPA 2ZP8A 1WYJA 1GS7A 2XBTA 1QFHA 1IKFH 2X6VA 3L3KA 3MUZ1 4XMLH 3BVTA 5SV3A 1NDTA 1UA3A 2B9BA 3C6SA 3HS8A 4HMEA 4EI5A 4S0HA 4JFEE 4MXQC 2WSDA 2MCMA 1YDPA 3NIFF 5L88L 4JFDA 3JWNG 4UOJA 4Z23A 5KVGH 1T6WA 1WG3A 1RUML 2OP4H 3WUZA 2TSAA 1RERA 2ICES 1IUZA 5HDWA 1T1ZB 4BH7A 5GSVA 3S48A 4HG4K 3VMPA 3BLKA 4ZMYA 4AMXA 2FIRT 3WNOA 2B59B 3X2QB 2UZPA 3MX0A 1LXMA 2A73B 4WU7B 3LKOB 2QVMA 1X7SA 2NTSP 4TUJB 1OP5H 4NAMA 4Y5YB 5DHDA 2E7LC 3SGKA 4MMXA 1HS6A 4L9LC 4B9GA 5D7IA 4QRTB 2W91A 1IGFL 3AS1A 3BZ5A 1DBBL 5J12C 5C0EA 1AZRA 4W9FC 4JUSA 4QJ4B 1BVZA 5C0FB 1DQKA 1UTDA 1JVKA 2LLNA 5FM8A 1I3VA 4LLAA 5A6MA 3K72A 3ES6A 5C9JB 3KHOA 3K2KA 2KZBA 4Q6KA 4R8WH 2VXVL 2KH2B 3BRGC 5KVDL 4B27A 4WEMB 1VFAA 2APVA 2WTPA 1S2EA 2H6PB 1UB5B 3ZDWA 3ZTEA 4R5XA 4X7TB 1AZVA 2R56L 1A0QL 4GIOA 3QXWA 5H8DA 3WFZA 1JXGA 1L9TA 4AYDC 4TQEH 3FW6A 3B1TA 3E2HB 1ZAGA 1NC4A 1A7QL 1U3HC 1NIBA 1PQZB 4DUVA 1RI8A 5G5DB 2YA0A 1JDAA 3P77A 4JHWH 3CHPA 1ETB1 1TEFA 4XPGH 3EHBB 5D1QD 2OX5B 5IMMA 1RZIB 3D09A 3QQ9C 4BA0A 2ZIDA 5KVMC 1HEZA 3FUEA 1CGVA 4AEEA 1UJ3B 5DGRA 1B6DA 1S9WA 4P9HC 3V0VA 2NYYD 5K59E 5ECJE 3C75A 4WHTB 3DBXB 1T04B 4NWUL 4Y1TA 3PXHA 4JPVH 1NBZB 3RWFB 4Z7WF 2OPCA 4OGAD 1DHKA 5TF0A 1T1YA 1R33A 1H6EA 1BQLL 4YGVA 4ZS6D 5IMLA 4LSRL 2VR6A 5D7LB 1AIFA 3IDNB 1JTOA 4XNUH 5DJAB 1YUKB 3KL3A 4HEMA 3PNWA 2EH8L 1HQRB 4LLWB 4N0CD 4Y2OB 2X53A 3NFPA 3UYOD 3Q7JA 1NUGA 3GIZH 4FXGB 4KJWD 1IQDB 3QJZA 2EDRA 2J5LC 5EC1A 1OAZL 3JWNE 1A6AB 5F21B 5FO9A 4JFZH 1BJ1J 4NQCE 5EIIG 1T0MA 3PNWB 2W9LA 5LGKA 1V54B 4Y19D 1KGJA 1QFPA 3AQDA 1ID5I 1T5WB 5E8PB 4ABWA 2JCCA 1EXGA 1OQOA 5DMKA 4ABQA 3D5OF 1U8KB 3SN6N 5DO8A 2EIMB 4CN6A 1U8OB 4XP4H 2XQBH 2A74C 2IWGA 4NX0A 4UQ3A 3TJHC 1A6UH 3UTSB 3HG1D 1F4XH 5E70A 3GYRA 3CFJA 1I8LA 3F7KA 3UZQB 4X7DC 1MQKL 4WO4B 15C8L 2F58L 3ARQA 1TYRA 4XN4A 3FQNA 4PJAB 1J5IA 1N3NB 2MPAH 3BKYH 3MV01 3QE5A 1JWMB 3KPSB 1RPUA 2DRUA 1MJ7H 4H0IA 2HT4C 3D69A 1QI3A 1AGFA 5LNDA 4FZEH 1EV2E 4PLJD 5HDOA 3ARGB 2VH5L 5EUOE 3GXTA 1U3ZA 4RAUA 5E6ID 4K9EH 2SODB 1A7OL 3NSYA 3I2CH 5IP4A 2DQGL 2RTTA 3B6SA 4Z3JA 4PRHD 2W92A 3OKKB 3IPBA 2OJZH 4HK0A 2HFEB 3L7EA 1UB5A 2E75C 1KPVB 2BY0A 3G6AB 3PWLB 1M7UA 2JH2A 4XNAA 5CEXA 1H3VA 2XVGA 1P6AB 3WG7B 1KB5H 2F2HA 3K5RA 3U4EB 4LCIL 3DOSA 3EO9H 3OAYK 3RDTD 4DVRL 3WFCH 1GZPB 1KBPA 2DMKA 1KCRL 2DQFB 3GHPA 2X4OA 2FX8L 5E56A 5ERWB 1PZUB 3QPQD 5I1AA 3MJ8A 3O6KH 3V0GA 4LKCA 4LBAA 4UT9L 5FK9A 3WD5H 3IJ9A 4FXTA 2BOBA 1XF3B 2FQEA 5DUML 3FU8A 4YHZH 3P11L 4DO4A 5CJXA 4HS8L 2EIBA 3MC0A 3U0WH 5CWSB 3QDMB 5FYJU 3IE9A 2ZYHA 5BUGA 5MHSD 2EDLA 5KTEL 1YYML 4KKBC 1E2WA 1F4XL 4I18C 4XMKL 4CN1A 4XHJC 2OMYA 3ZU8A 1AMYA 4X6DF 3V0IA 7PAZA 4RQQB 2O5ZL 3P3TA 4EQ2A 3L3KB 1YNTB 4GXUM 4RSVA 3ESNA 3ME0B 1LO0H 3P0VL 4LPUA 3NIGF 1A47A 3IJYA 1UZGA 4Y19E 2QTEA 4ALAL 1IBDA 1P6FA 1YNLL 4GG8B 4BDVB 3DX6A 3KBHE 3N1MC 3BZFB 3UZVB 3CFDA 2IAMA 3FJTA 4LCYB 1DVZA 5H2BB 5IVNA 5TTRA 1X9LA 2GHWB 3RTQB 3UABA 1CURA 4ZTOL 4HD9A 1KIUB 1AO7A 4EUPG 4DKDC 1KJ3L 2VM3A 1PX8A 3QG6A 3GIZL 5AKRA 1RZKC 1U92A 4L8CA 4IBWA 3FCGA 4Z95L 4JQVA 1VGEH 1V3JA 4K3EL 1FA4A 2F19H 1VPOH 4WI2A 2X4RB 4JL2A 2ZCHH 3DX7B 4MMXB 1NCIA 1ZK9A 4MX7A 3LQZB 1G5GA 4ZFGH 5ICUA 3KPPB 2VUKA 2DIEA 5T3XH 5EPMA 2FHCA 1OP3H 1IKOP 3VXOB 4GY4A 3VM7A 4NI6A 1F4AA 3FN3A 3MLWL 2WMPB 4RGND 4UUJB 4IOSD 2FHBA 2NY5C 2TRYA 4G42B 4RESB 5DK2A 1H3WM 3BGAA 4HOZA 5GQBA 3NGBC 1ZHBB 4CSZA 1HQ4B 5BRZB 1UD4A 3TCLB 1U21A 3FRPA 2R2BB 3S6CA 1ZJAA 2CZNA 1DQLL 4X99A 3D87B 2HH0H 3PV6B 4UILH 1TJHL 5EEYA 4LL4A 1FQ9C 2GCYB 4IEFA 4F8OA 1NL0H 1BIIB 2BIPA 1ECYA 1WBXA 3QB7C 5B7FA 2QHRH 4L8SB 2K6YA 4RH4A 1FCCA 3SGJC 1E4WL 3QA3A 4QXTA 5CCKH 2P80A 4FQCH 4ONGL 3EH3B 3FU0A 3PDDA 1LE5A 3V4UL 1CFTB 2WVTA 4N26A 2XVBA 1G1OA 1LO4H 1OPGL 2QV4A 1UYWH 4ZQTA 2I9TB 4B96A 4AMWA 1R0AH 1JYVA 2GFBB 4NKMB 3FKUS 2YK1L 3BT0A 2EH7L 5D2NA 1QWUA 2BSTA 4V11A 4Y4HB 4AUYA 4PB0L 1R9FA 3IMVA 3ZE1F 5KW9H 4NKQB 5DWUL 2GTQA 4OCSL 4Q89A 3DARA 4EBQH 1DSWA 3KVDD 1B4JL 3IDGA 2JKJA 3OKDA 2WN3A 1B0IA 2Y07L 3LEYH 4ODUB 4L8DA 3BYTA 4CBZA 5K39A 5H4YA 3MV8B 4PLKC 4PG9A 5C2BL 2YD8A 2YEZA 3O6KL 4M5TA 1OM9A 4MFHA 3R19A 3SE6A 3IYLW 5HHQA 4HHAA 5IJVA 4LGRB 2O6DA 3LNHA 1M6OB 4YZFE 2LAGB 1ZKAA 2CHXA 4UAHA 4XHJD 2JIXD 4I4WA 3ULUD 4MVBD 1MHEB 3OG6B 3ZQWA 4FHKA 1NPNA 2HFEA 3L7EB 1Q0XH 5CZVH 2GCYA 4IEFB 2WLJA 4WKZB 3P9WB 3V7AG 3WNPA 4QWWC 5EZLA 5I6XB 1N64L 3BPLC 1MJUL 3DYOA 3D9AH 1SDDA 2VM9A 3WIFB 5IMOA 4X5XA 3EZJB 1NAMA 3FU3A 1GCFA 4A2MA 4QHKI 1EVTC 1MRFH 1AGEB 5CFHA 3QFJA 4XP5H 1LE9B 1BOGA 4UMGA 2V2TA 2YGVA 4HUUB 2I60H 5DRZA 1I3GL 1M53A 4I3GA 3FQNB 5F1NA 4P2QA 2Z4QB 4Y1AB 4P5KB 1DLHB 5KSAD 3UTTD 4RAHA 1HOCA 4W9IC 1TF4A 3BIBX 2EVHA 3HRZA 4LP8A 4A1RA 1BMZA 3UXFA 3S98A 1KPRB 4ZUVB 1FO0H 4GKSA 2CO7A 4UTAA 3ESUF 4OM1H 4Q4IA 4I3RH 3FB6A 2CDEA 3H3KA 4A2GA 3SDYH 2WTRA 1SGKA 4MD5B 1XIWB 4KKZA 4EZJA 2NQDA 1H3XA 3DIFB 4Q9QH 1PY9A 2KQNA 4ZPTB 2XA8L 1UXSA 5DHVH 5HI4C 3IAGC 3NZ8B 1QZ1A 4FQ2H 4LCWE 2BJMH 3PWJA 1KBKA 3FYEB 3G6AA 3L13A 3NCEB 4MNGA 5E6IC 2IMMA 2YGQA 4IJTA 3TH3T 3LKQB 2IAMB 4LCYA 5SWQA 2DZEA 2EACA 1NGXA 2OXHA 2V2XA 1OB0A 3MBWB 4KRPD 4DQOH 1TQVA 4ODXA 2JK5A 3EDEA 2P28B 3ASOB 4NQDE 1RH8A 2OJEB 1OSYA 4HKJB 1A64A 4P5MA 2A6DB 2A74A 3IJHA 2VT0A 3QIBD 5E6UB 4PUBL 4WNSA 3SDDB 1MDTA 5IW3A 3QXVA 5JOPE 3U79A 3P30L 4KO6A 3FCTB 5CGTA 4BQ6A 1N64H 4ZX5A 1RY7B 4LOUC 4ONHB 2IH8A 4B41A 3WNLA 3ZL4L 1E4XL 5F9JA 1J5OH 2A6KB 2ZUWA 2A83B 2XJLA 1GYVA 4ZUTB 1SEBB 3ZT6A 5L9DH 4WEUD 1YY8B 4Z7UE 3BZEA 3RYMA 4JM0A 4JFQA 1WPCA 3PXLA 5I1LB 3KXFD 3VFOA 4WI8A 1RURH 1NAKH 2GKIA 4JO5A 1I7TB 4CNIA 2D31A 3CG8A 5L0QC 1BPLB 1ZHBA 1RMFH 1MCEA 1GAFH 5GGVL 3GRBA 4UZUA 3M86A 4PB0H 4ZFZB 1AZNA 5J1TC 1UXWA 4HAGA 4FQQA 4FTDA 2DQEL 3SY0B 5LHDA 4Y9EA 4GAYA 4QTHB 3H2WA 4P4RB 4XO5A 4GLRH 3HE6D 3VWKD 3LN9A 3VX0A 3HBZA 1GS6X 4ILDA 4OF0A 5H94B 3T0EB 3ET9F 3HE6A 3CZUB 3PGDA 3CMOH 4EN3A 5D7IE 3GMQA 2IWFA 4LOEA 4P59H 1PCSA 1XXFC 2NXYC 4PJ9B 5LBSH 2XYCA 4QO1B 3FN9A 5C0RH 4PRDA 1F8TL 1L4IA 3HVNA 2X3AA 2BWDA 2P5EB 1J87A 2R1WB 3EJCA 5E8NB 4JY4B 1AGFB 1D6VH 1JTTA 5KANI 1BQLH 3D1MC 4HPOH 5E9DD 3RVWD 2AJXH 1K9TA 2D4DA 2QMJA 2YAEA 2DM3A 1PZBA 4YDVA 2WXGA 2ZUSA 4L4VB 4FLHA 5LAPA 3LKOA 3L3IA 5EUOA 3D9AL 4MYWB 5DJ8A 2Y7SA 3FMGL 1B3JA 4Y4FA 5EO1B 5I76B 3Q05A 2ERJC 4QRQB 4OZFG 5E1HB 3UIZA 1SBSL 3EH5B 4R7DA 3BGMB 1EAJA 5F1SA 3U36A 3UO8B 4EUPB 3SPIA 4TTDC 5CU5A 1U3HB 3QDJE 1E30A 4YNYB 3SGDH 3CBJB 1D7CA 1XGYL 3E2HC 4JFFD 1OE2A 3QPXL 4KUZL 1BECA 5DVLA 3VE0B 5GS0H 2HJFA 1O0VA 1QLFB 2PYFA 2QVTA 4CGUB 4LAQL 5F9AC 5TE6L 2ODHA 2H0PA 3O81A 5INDA 1HC1A 5EG6C 1RUPL 3SGKC 2E7LA 2D7NA 2L3BA 4XO3A 2ICCA 3ECBB 4OQTH 1F6LL 4KX8A 3QFJE 2R27A 5TE4L 3HCVB 4X4XB 4XXDB 1ORSA 1X9UA 4JKPL 4MDIA 5HGBA 3U0PA 2ZKMX 3VGBA 3SYOA 4DOHB 3VFUB 3BXNA 3STZA 1JCKA 4HIHA 4HUWB 4OI7A 5DYOA 4PV9A 1S3KL 1TYJA 4OGXH 2KDYA 4Y4HC 1C8PA 4CC4C 2O5XH 5D1XD 4CMHC 3S96B 4X6CB 4U1IA 1FE8L 4OZHF 1IGIH 4ZOCA 4P59L 3FQTA 1T3FA 3HNSH 3RL1B 1MEXH 4N6RB 4JM2B 1IT9L 3M1BB 2CGYA 2VJ8A 4U6YB 4WHTA 1AQMA 3DX4A 2ATAA 3LEVH 3VFNB 3GSNB 4ZMQA 4MJIE 3O9WC 2EEBA 1MN4A 1J05B 1XF5A 3KPMA 4AMKH 5DJAA 4IRJB 4K8RD 4YGVB 3B3BA 2JKIS 4JN1L 5TE7L 4UQEA 3OWEA 2R0WL 4LGSB 1MIMH 1N10A 2WYZA 4HEPG 1H5BA 1MFAL 4LVNB 5IEKB 3PPEA 3VCLA 3IKCB 3IEAA 4PLOB 4MRBA 5KN5B 1CR9H 4LZKA 5FUZL 3IFOB 3UG4A 3WO4B 4R5VA 1CLZL 1S7VB 2YUZA 1VFBB 5LLIC 2Z91A 5FM5O 3BP6A 1NCAH 3GSOB 1IVLA 5IWLA 3VXUB 4CRPA 4O9HH 4JFPB 3WKPA 3V6OA 1G5AA 1R6VA 3FFDA 4M7ZB 1PKQE 4U2ZA 4YWGL 4ZMZA 3QUZB 5EU6D 43CAB 2VR7A 1LWJA 1MVFA 1V7MH 5ALBH 4M6AA 1U8NA 2GT9A 4OFYD 3I3BA 4X6BA 1F2XK 4R7NB 4UI2A 4XN5A 4XMVA 3D07A 1EDYA 3N06B 1KPRA 4ZUVA 2CK0L 1U30A 3ZHKA 1JFHA 1ZRUA 3GBNL 4MJ2A 4K5MA 1WD8A 1FRGL 2YPLA 3BE1L 2K7PA 2I27N 3GMNB 1IBGH 1AANA 3QXUA 5E1AB 2PTUA 1LJMA 4PJIB 4Y16D 3FH8A 4F33A 1EFXB 4KI5D 4APXB 5L8LB 4RGNE 3EH1A 3DRQA 1GVIA 1IGFH 1CWVA 4Y2DB 3PJLA 3NFSL 1AKPA 3UX9B 5KSBB 3AU1B 3AAZA 4XXCA 3LZOA 2FECI 5KSAC 1KGWA 4B9CA 3GI8L 1KJMB 5F44A 5BRPA 1PZ5A 4BUQA 5IR1B 3UPRA 4B9KC 4D0CA 3RIAK 3GXFA 4WTZA 5KUMA 3ZIMA 2G60L 3TH4T 4ANKA 1MVUB 1PDKA 3TIEB 5DUMH 1C1EL 4RFNB 2CDGB 2I9LB 5C0AE 1JVOA 1NJ9B 1PYWB 3MTXA 4I77L 3UAJA 5T5FL 4WK4B 5IHUL 1BF8A 3LRSA 1C7SA 5L7XL 1A2YA 2ZAIA 1DUYB 1NMAH 2FB4L 4P46A 4OI8A 5KSAB 5HYSG 2PW2A 2BNQB 4Y2LA 4LQFH 1LILA 1P7QA 4Y9FA 3S5LA 3U9UB 2HMID 3HB3B 3L6FA 1H3GA 3DETC 5J6GB 4C8XA 3BZ4B 1IFHL 3OG4B 4WK0B 1EHLL 3DSNB 4B6ZA 4MWFA 4LEXL 4MASA 3LY6A 4PJ7F 1RV6X 1YMHB 3K0WA 4PGDB 1F5WA 2ZYRA 4QRRD 2HAZA 1ZVHA 4FAAB 2XU9A 1BA9A 4OZHA 3CV5A 1FFNA 1JNHA 2NSQA 1TO4A 1IGJA 1XGRA 4NWTL 4BSJA 4LXFA 4YL4A 4KDVA 3KLHD 2D7QA 5GISH 1JNJA 5ANMA 4KMTL 1MHHB 1LEKB 3E9UA 3HZ3A 3IDMB 1ET7A 4L48A 3QIBB 1ASOA 4PR5B 5SV4A 3G7TA 1CICA 4C56E 3GSRB 3NIDF 4Y5XC 3W0WA 5A2FA 5ISZE 5IB5A 1XF4A 1VFOA 3FCSB 3NSCA 2FAUA 3C5SA 1I8AA 3R1GH 1KTDA 2R56H 2E47A 4ENZA 5HGDB 2OTWB 3WNNA 5IFHL 4LESA 4K3JH 4P2RB 1RZQA 4CAGA 1WE5A 2X9ZA 4J3UA 3FB5A 5CINL 1FFTB 3D18A 4YHPA 4OIAA 2YOAA 3MRBA 4N9GA 5EOQL 1ZLVK 3EYQC 2CRIA 1EDHA 2CNZA 2UXFA 3BP7A 4CC0A 4ABVA 4TVPH 4HFUH 2HKFH 2WQUA 1HH6B 1N4XL 5EPMB 4V2CB 2XWTB 1MJJB 2RIKA 3KBEA 4FG4A 2WO2B 4M5YH 5D9SA 2JJTC 2VGLM 1QZNA 3MOAH 3HUJE 3MRGA 5EULV 1I1YA 3V5HB 1KG0A 5ID0A 2GSIA 3QUKA 4HUVA 2C5DC 3PAYA 2GK0A 4RRPA 3EOBB 3OZKA 4UT7L 4IRJC 2EECA 3GBDA 1JZ8A 4G9DA 2NR6C 1HKLL 3QUYC 3HZVA 5T3XD 1FZOA 1NOAA 4XAWL 1BEXA 4B9FA 3MSPA 4G83A 5FO7B 3MV9E 3G08B 2Q86A 2DMGA 3T0ED 1R3HA 3LRKA 4JPIB 3X17A 1BM3H 3EJUA 1KEMH 1A1NB 3KR3L 4J3VA 1A1MA 3EJYC 4GMTH 4E41A 1HAUA 3FT2A 3WXWH 2BRRL 5E24E 4K7PX 4MAUL 4A6YL 5JXED 4QF1B 3LS5L 5IQLA 5BW7C 4XCFH 3LRGA 2H8PB 5BMFL 2VZOA 1KXQE 4Z18A 1GIGL 1CXKA 1MI5D 3MLYL 2P8LB 1X5AA 4IU2B 1NCWL 4FMFA 4JBSA 2V6HA 3FT1A 2ROXA 4I3RL 4OD1L 3AW5A 3BQVA 1S7RA 4Y4KA 2JMRA 4Y5VA 4JM2F 4OD3H 3HHRB 1A4CA 5E8EA 2JJSA 3BPCB 4NQVA 3FB7B 1DCLA 1TNMA 5HDLA 2UYLB 5I1JH 4OZIB 2YC1A 3GNML 5IBLD 5IQ7H 1NGZB 4C56B 1TVBA 2D3VA 4ZUWB 4IOIA 5AAMA 2VDMB 4MS6A 3TGXA 1KBWA 4AVHA 1WZ1H 1OAYH 1JHKH 1JXKA 4R6UA 1JGIA 4M02A 4MMYB 1UVQA 5SWZD 1ZHLA 3NBNA 2P42B 2VDOB 3GSVB 1KIRB 5IJDC 1CXFA 1E6JH 3N3EA 1GGYA 4MA3B 2Y6SC 5D55A 2XN9A 4P9HH 3P73A 4L4TE 2GBUA 5EBLA 2Y25A 5C0DA 5C6TL 2NW2A 1P5UA 2ZOLA 3KPQB 5CP7A 1MCHA 3ECUA 1NMCC 1R46A 3B2VH 5HGHA 1WJ3A 2B0SL 4E42B 1Z6JT 3A47A 4PJHE 4PJHB 2I25N 3CFKB 3HKFA 3UROR 1T2QH 1U3HA 4Y1SA 4X4YA 3LKSA 2CBOA 4EZKA 4J12A 2XNAA 5C0GA 1RUAL 3QRGH 2HKHL 2VUYA 1XGTB 1YEFL 4OLEA 1KIPB 1QAWA 4Z8FH 5FO8A 5CMAB 2Z0BA 4P4KB 1A7NH 1TZGH 3EH2A 3BP7B 5F96H 5I0YA 5HYSA 2WCPA 2OS7A 1YZZA 1K4DA 5AOMA 4X4MA 3UPCA 4I88A 5I26A 4OF8A 2A6IB 5B38B 5IREA 4PVMA 1VPOL 1XAKA 2FJGA 4KK6D 2Y2YA 4WFED 4GAGH 2XQYA 3D2UD 2MQGA 2ZYSA 3QUMB 4W9HC 4U3SB 4XMUA 2GY5A 3IU4H 4J27A 4MLIA 1G1CA 2FWOB 4L3EE 5D7JA 5HI3D 3S8FB 2WVVA 3PGFL 2NZIA 2DIAA 1AHWA 4YS4A 4QT5B 1B4LA 3M46A 3RNKA 2EABA 1XGQA 1LP9E 4HMCA 5MENE 4LRNL 3CSBA 4AUUA 4M5YL 3E8UL 5EOTA 3QXDB 1E5UI 3K6IA 1U91B 4WEEA 2MNUA 1I1CA 5D1QC 4E41B 2HVKB 2VDKH 4M7KH 1HWWA 5FYLH 1T6VN 2V7NA 2VABB 3N04A 1E6JL 2Q86B 2MNWA 2IOOA 2QT6A 4BCYA 2APXA 4XCYA 4WWOA 2JSFA 1AJ7H 1IBHA 3VGDA 1A5FH 1L7TL 1U4FA 3QGVA 4EI5C 4XB7A 5SWZA 5IBLC 1E4WH 4MJ6B 2VABA 5M7QA 4PJEA 2ZX6A 4N1CA 3J8F7 4JG0L 4GMSL 1SMDA 4JHAL 25C8H 4OZIA 2GQHA 2XWTA 1YYLH 3FT9A 4BYHA 4IKKA 1NM9A 2JTYA 4AZUA 4QT5A 3RNKB 3V0WH 4N0CC 4F7PA 5LDUA 1HDMA 5B1JA 3PIQB 3X3FH 2KYIA 2J6WA 2LABA 2OMWB 1HFUA 4YBLC 4ELKA 4OJDH 1D5IL 1EFXD 3DA0A 5INCB 2NTFA 3K2UL 5HP5A 5CGYD 2XZQH 2XG4B 4ZAKB 2ZAHA 3BUPA 3HUJB 3WL9B 1P9MA 4M1DH 4D7BA 1M2VB 4Z7QE 1XSKA 1ZIBA 4P5MB 3RHWF 1P7HL 5D6DC 3OPZL 2XKUA 5TQ2L 4QRRA 2QHLA 3RURA 1E9OA 2E7MA 3UDWC 3SOBH 4PI2A 5JHDE 2BIHA 5IB2B 1AZUA 3FAWA 2BNRE 1SUJA 3TEXA 1H9VA 5DQDH 5C8JB 1SLUA 4K0OA 2A9MH 1EAQA 3RZCD 1M3IA 1UT9A 4JANA 1K5NB 5HY9A 4KNQA 4MJIB 4JY4A 4BUHA 5ESVB 5LG1A 3VH8G 2CHDA 5JPMB 2C7UB 2CH8A 1G6RB 4NUJB 1IC1A 3VD5A 3CFKA 1QPXA 3LXUX 3Q8EA 2WTRB 1T5XB 4MB5A 3L7FA 5IROC 3O3DB 3ETTA 4LP4A 5C9JA 3I3EA 4XR8C 1KV7A 1NEPA 3LMJH 4GKSB 2R0WH 4G70B 2ATPA 2YKLH 4HIXL 4XNXH 1E2VA 2QPUA 1P4UA 5D1ZA 4M43H 1MJJA 2C3VB 1A5FL 5JPMA 1A8ZA 1NOFA 5PAZA 3PUUA 1CS6A 3GSQA 2BFVH 5TDNA 2CRZA 3DTXA 3GXMA 2ITCA 2N59A 3K6NA 3HC0A 1R0AL 3RFRA 4GBXC 2J8UB 2WNWA 2XKNB 5DD1H 3CFIC 1Y18A 3GZOA 3ZDYE 4OIFA 3GMMB 2AJSL 4H0HB 4QI3A 1A21A 3I02B 2L4OA 2VERN 4JG5A 2KLRA 2WQ8A 5KVGL 3WJJA 4U1LB 2ID5A 1YDPB 2ESVD 4KX9A 5GGUA 3CE1A 1EMTL 1D9KB 2X9WA 3Q9PA 3KAAA 4ZQKA 5SWSE 1IL1A 3CAFA 4MZ2A 1RZKH 3FSAA 3GLZA 5GGVY 1DVQA 4HWBA 1IGJB 3OZLA 1DQMH 4ORGB 5EZPA 5GZOC 4F57H 4QOKB 1KYOJ 2VOTA 1G9HA 1CFQB 1P4LB 2F7QA 3C5ZA 5A2CA 1QRND 3WTWA 3ERXA 2O61B 4JHVA 3BD4A 4FQLL 4PJ5D 1S46A 4LSQL 4W9CC 5DFVD 3O6ML 4GW4B 1HHKA 1BVNP 3VGFA 3O41A 3OR6B 3PCYA 4BFRA 1CFNB 1SPDA 4XC1L 2VLRE 3C9NB 4X80H 4X6FB 1Y6NR 2Y7NA 5KAQG 4LMQI 2F5AH 2BMKB 4PY7B 2X4SB 2UWEB 3FBQA 4ETQA 4OH2A 4EN2A 2YPLB 3KWTA 1UXLA 3GSWA 1PIGA 3EO0B 1J9SA 3UJTL 4HIIB 1HI6B 1CD8A 1MAKA 3BSGA 3ULSB 4F15C 3OAYH 4H20H 1GMEA 3BKCH 3TBWB 5DD5H 5F0PB 4WV1C 1ICTA 2JI3A 1FZMA 5KYNA 3ZKMC 1HJBC 1XIWA 2KLSA 4YSRA 4NN7C 1G6VK 2GB2A 2LW3A 3OZ9L 4XN2A 4DJMA 2R39A 3EGDB 4CBPA 2VDQB 5H35A 4X5PA 2YQ2A 4NJAL 1HZLA 5LWYL 4WWKD 5C0CD 1DJIA 4PP2B 3AREC 4DQAA 2MTPA 4ZQKB 2XWZA 2PO6D 4K3HA 1A6UL 4L05A 1IGTB 1MKFA 3RZCC 3GXPA 1JK8A 3I6LE 5F7EL 4PJ5A 5LAXB 5DLML 4BE6A 5BV7L 4QHNA 2IOMA 1RP9A 1QRNA 5DMIH 3QJUB 1D7BA 3LKPB 2JQZA 3MODL 1EHLH 4XMWA 3DROA 3MUGA 3UTZA 4JO8A 3L95B 2G5BA 4IHBA 3QCUL 3C8HA 1M4KA 5C97A 3ZE2F 3FU9A 3PIQA 2Z1KA 2WNGA 2CLRA 3ZKNC 1VHPA 2AV7B 2XG5B 3RWGB 5EU4B 1CBVH 4I4WB 4CJ0A 5AD0B 5DJDB 3EO0A 2VNCA 3EJPA 4HCFA 1SLVA 2NUTA 3RY5A 5DXWA 1U3YA 3J07A 3KE0A 1WIOA 2G5RA 1TQSA 2XTJE 1OW0C 4JDVB 4U6HA 5G2NA 1CE6A 2O6EA 5IOKA 4DO5A 3UG3A 3AVEA 2YD5A 4HS6A 4YLQT 4HLEA 4FCHA 4OCRL 1DSYA 1G84A 3BX7C 5E95B 1I85A 4HIHB 2BY2A 4Z7OF 1GYWA 2FX7L 4FQHB 1ZXQA 2VDNB 3LZNA 1MFVA 1J8RA 4MAYD 2XXCB 4IBVA 1AGDB 3LOWA 1FVCA 2XWBB 3O2DH 3X14A 2DQHL 3LXBA 5ICYB 5LWYH 2EYRA 1N4XH 3C8DA 3PJSA 4ZS7L 1UZ6E 5FKAB 4FNUA 5D2LE 1VERA 2CO6A 5LXGL 2FZ3B 2CIIB 2H1PH 2CHWA 2OMXB 5D6CB 4HLZH 5E9DE 3ZR6A 4HT1H 5DSCB 3CUPA 1UZ8A 4MVBC 2J1KA 3TN0B 4IU2A 2EUWA 4Z7VE 4HBCH 4IHOB 2IVFC 3SPVA 2P5WE 3CMOL 4F7PB 3F84A 3BZEB 4LLVA 1OGAB 4WFFD 1JUFA 3H4FA 4HUNB 4Y9GA 3WAJA 1NH6A 1I7UA 1B0RA 3LAFA 4IIQB 3NH7L 4MGXA 4NZRH 3W56A 3HHMA 2WW8A 4BFGA 4MS8C 1NFDF 4FXGC 4U49A 2Q87A 2XXMB 2YMTA 4H4NA 2BX5A 1J9CT 1DJSA 4IS6A 3KR3H 2BVTA 1UH3A 1RZGB 2ATKA 4CMHB 2YQ3A 3MACH 4L0ZA 4JO3H 2DYPD 4M1CC 3BWZA 1LP9B 3RKDD 3FRPG 4HKJA 2F5AL 4F9PA 2PO6C 4Q0XH 4XWGH 5GIRB 1B4RA 3ZOAA 1WSST 3RJQB 5I5MA 2FCBA 4C83A 5B7EA 3U7YH 3Q5TA 3KDMA 5BJTB 4OCWH 4WY7H 2QSQA 5DMGD 1C5CH 1Z32X 5E8DL 1Z7JA 1F45A 3FU7A 1C5DA 3P0YL 2DB8A 2ZUXA 3OXRB 3WV0A 4KTEH 1BYPA 5DRNA 1BQSA 3EYFB 2FK9A 4ANXA 5MEOB 5MI0C 3QZMA 3G04B 2Z7UA 4YXKH 4Z5RA 5IOPA 4K71C 5C6WH 1JI2A 1G7PB 5ACMA 2Q7YB 3SQBB 3QUMA 1DFXA 4ECNA 4O9HL 2BOLA 2C4FU 1OCRB 3O6LL 3MUJA 1TTBA 1N18A 5AYTA 2CPUA 3P3SA 2VN3A 1M6UA 1PGRB 2BZ7A 1SEQH 3IMTA 2ZT9C 2E6QA 2Z7ZA 5F7EH 2OL3H 3JWOH 5T3ZL 4P4KA 5CJBA 2G75A 5GGTH 1FGVH 4MJ4A 4NNPH 1L5GB 1KYOK 1UD5A 3HHSB 4GEIA 5EIVA 4XNDA 5T3ZE 4KKLC 5I1KL 1YECH 3FQRA 5TPWL 2WIIB 4G7VL 5FA3A 2CKBH 1F90H 4YO0A 2Q2LA 2B1HL 4WKXA 3EGDA 3ULVH 2OMVB 3F00A 3QWNA 2PXYB 1JAEA 2EYSA 5JQ6L 4HWNA 4G9FD 3BH4A 1W72B 2AITA 1L9OA 1EHNA 3PGDB 4XB8A 2ZOLB 1IAOB 5DD6B 5FW7A 1XR8B 1KENH 5HHME 4MNGE 1OALA 1JZ4A 2J57A 3ZZ1A 1KB5B 4IRSD 2C26A 2E5EA 3P73B 3Q3GB 3FT2B 5A2IH 1C16A 2E46A 4KI5C 1D9KC 1FVCB 2QZQA 3MNMA 3WEMA 1JS4A 3NJFA 5CM1A 4FJYA 4MJID 4OZ4B 5F96L 1ZEAH 3HS0C 5AG9A 1BXXA 3LH2L 3WI9A 1MW0A 4HHAB 5H37G 5IJVB 3N40P 1U8MA 1W0VB 4IMLA 1OP3K 5JR1H 2QQKL 2VZTA 4G8GE 2DQUL 4TRPL 5EUOF 4JCLA 3R8BB 3PWPD 2K3TA 3POCA 2VISB 4Z3EA 2IGLA 1W6WA 3N85L 1NGPH 4YHYC 3KNBB 3MI6A 4B9YA 2RQEA 2GSIB 2CO1A 2GJ6D 3QIUD 3DHUA 3HUJF 1XBDA 4N1EA 5I8KH 3SBRA 1OF0A 1R3JA 2IG2H 1Q94B 3MCKB 4ZTPH 3CVCA 2FSEB 5F7DB 1J88A 4XCCH 1CK0L 5L7XH 5AD0A 2LQRA 4ZO6A 1CE1L 3OSVA 1AS6A 3IN2A 4FS0A 4LB8A 5AVUB 4MMZA 5B1KA 2P7TA 1P1ZA 3ARDA 3S3PA 1RZIA 3FU5A 4DCQB 4XGZA 1E7VA 5J12B 3QDAA 1II4E 4U1LA 1CDUA 4HBCL 3ZZSA 4Y5YC 2IV8A 5ICZA 1IEBA 4NKDB 4AQEA 2QSCH 3FCSA 4GXUN 5CCKL 1XF4B 2PCYA 5TPWH 1FGNH 1I4FA 1FFPB 4PS8A 3KJ6H 1N70A 4HD5A 5I2IB 3VXTA 4EOWL 1L7IH 3QXAB 1RIHH 4PVLA 3UP1A 1HQ4A 5BRZA 1I1AB 4O4YL 2BNRD 2CCWA 3MUY1 1RJLB 1AR1C 3OAUL 1CGSH 3KPOB 1HYSD 5FB8A 2V9TA 2QVKA 2ADIA 2E9IA 1NGYA 2KMWA 2Y7MA 3TN0C 4W9GC 3ARGC 3BQUD 5DHYA 3WFDH 1T0OA 3MRMB 1BMGA 1WWCA 3E6HB 4FULA 3T6ZA 1T5XA 3C09C 3NIGE 2OK0L 1AS7A 3T0EA 1OWWA 4POZC 2ITFA 1WRFA 4P2YA 3T3PF 2B5IB 3RGVA 4OJEH 5J0BA 1KLGB 1X9QA 2BS71 3U7WH 1NFIA 2ADYA 2F18A 1HE8A 2IH9A 3QWOA 1KB9J 5KVFE 1S7VA 4JQIA 4GRMA 1KTLA 5GZNA 3CTTA 1Q0XL 2GSGB 2G9KA 3LS4L 5CNHA 4X0NA 4H8WC 1S3RA 5IB1A 4Q97A 3Q1EA 3RTQA 3WS3A 3PP4L 5IZ7A 4XTRD 4BK8A 1MJUH 3H42H 4K5LA 3T3MF 4L18A 2Y5TA 4JPQA 3TT3L 2R1YB 2W60B 4NN7B 1BQ5A 3TFKC 3UBGA 4H88L 5I66A 4WV1B 3EYVB 4KFMA 4AQOA 4Y1AD 2B7DT 3L4VA 1Q0YH 3QUML 3KYMB 2H32H 1IBBA 3PRZA 4HBQA 2DJSA 3QUXA 4JHAH 4LCWD 1N5AB 4PJEB 3VGAB 3CZLA 1P84K 5JW5A 3K1DA 3CX5K 1ZA3A 5K9QI 1AGBA 5GRYA 2A6JB 3MROA 4ZOAA 4AQ1A 3GJFA 3RUGE 4U1KA 1ZEAL 4JHBA 2GIXA 2CLVB 1OXYA 3OQ3B 4J2XA 4MJJA 4G6JH 2IAMD 5JMRA 2BJML 5EU3B 2YRZA 3U6XA 1GW6A 3AREB 1WTGT 4KX7A 3X13B 4DP4X 1FLRH 1DR9A 2P3YA 1NA8A 3U30B 4OJYA 3GNMH 2DQJH 4FXKB 5ES4B 1FIGH 5IQ7L 4XC3H 4NFDA 2VC2H 3P11H 1N5YH 3MJ7A 8CGTA 1HX0A 5E08L 2C1PB 4XWOC 3ZQXA 4TSBL 2WQWA 1RJCA 4Z0BL 3UYRL 2VERA 2CJTA 1G0YR 2IWKA 2OI9C 3I6SA 1Z66A 4JEGB 1S9XB 4YUEH 3IDMA 4QY8B 3JTSA 1CL7H 3L4ZA 2YSTA 3WGUB 4CMMB 3HZMB 1DBKH 4NHCL 3B5TA 1WIPA 1M7IA 1WCBA 5E5RB 2VB5A 3O8XD 1XCTA 3KXFB 1R5VA 2BVPA 2GJ6A 1SBSH 3QIUA 4YLBA 4DGWC 3IS0X 3KLAB 4HPYH 1H6TA 1E9PB 1WAEA 1WVZA 2BIQA 3NACL 4NS0A 4U3CA 5TFSL 2W0FB 4CVZB 5D2LA 5I17B 3ZLQC 1BLIA 3WEXA 1WAPA 1OAQL 5TDOB 3OKNA 4AQAA 5PCYA 2BRRH 3GS4A 5JW4N 4G8EB 4XNQB 2QVFB 4RWHA 1S78C 4NT6B 4U6VL 4HEPA 1JPFA 4UV4H 3V4PL 2VL5B 1MHEA 2VSKB 4Y5XB 2X5PA 1JRHI 3QRGL 3VWKB 4A04A 1M3JA 4QCIB 3U9PL 1J5HA 3TZVC 1BXUA 2W65A 3LNFA 3GRGA 3JTBA 1U8LB 2IADB 4LKCB 3S96A 5BVJB 4KVNH 4Y16A 3H8NA 2YLKA 3QZPA 1RJZA 4A6YB 3QUZA 1X4ZA 3CSPA 2WSPA 3TWCL 1F97A 2ESVE 2WJ5A 4GKNA 5K9OB 3GB7B 1VJSA 3JVGA 5D5MA 4DGUA 3RTQC 5E4OA 4ZAKC 1XF2A 4L4JA 2PCFA 1KTKE 4D0BA 1PZ3A 3TZVB 1Z9MA 1T7XA 1EDQA 3LZPA 2DQIL 1GY2A 3WE6B 3FO0H 2R7EB 4IU3A 1OCOB 4DKEH 4G43B 1AXSA 1GKEA 4I3SL 4JRXE 4NSKB 3TT3H 1KEGH 2D2OA 3A4DA 4OUUA 3NCBB 3AM8A 4K4KA 3L9BA 1KBGL 1XL6A 2HUHA 1QQDA 4L8SA 3ILPB 3QAZB 2V7HB 4JO4L 1E8YA 1BVKB 5DD5L 4DAGL 4FKKA 4KI5F 4HOWA 3F12A 2HT3C 4TVUA 1FNSH 2B0SH 2QKIB 3FQUA 4KDTA 2ED7A 2OKMA 4A66A 1AQHA 2FR4A 5FYJE 3ZTNH 4GSDH 4EIBA 1M05A 3LEXA 3BP5B 2UZYB 2FNBA 2XICA 1X5ZA 4BFJA 1R3HB 1S7TB 4LO9A 3CX5J 3IAQA 3MRCB 5C09A 2X3BA 4N3TA 3ROLB 1SXCA 1EUUA 3KPSE 4I8DA 5JLZA 5I18L 3B9KC 1FNEB 2APBA 4YWGH 2MQ0A 2HXAA 1H3PL 2DYPA 4B3EA 3AMKA 5HGBB 4OZHE 3OKLB 3V0EA 5HVHB 4Z9KB 4H8UA 1Z5LB 3ROLA 5I8OL 3TO2B 4QR7A 4XH2B 2K8MA 4S1SL 3ARDC 3I9GL 3VWJD 5BQ7B 4IRSA 4Z7WA 3TFBA 2Y36H 2VC2L 5JHBA 2K7QA 1DJYA 3GUFA 1BGXH 2QKIA 3EJRA 5FCUL 4IRJD 3T71A 3RBSA 2WSKA 2FLBT 5DURB 3S5LG 3TV3H 4WFHD 1GTNA 4GO6B 4N2CA 1UA6H 3MACL 3HMXA 1BYOA 4N8CH 1K8DA 1R5VB 2GJ6B 3QIUB 5E6SB 3TVMA 4LL1A 3T3PB 1TZIA 2ZF8A 3WTUA 3ULUF 4KI1A 2XLLA 2OR7A 4M29A 1KY7A 1SYSA 4K5PA 3HG1B 1HN1A 1I7UB 4NP4H 1KXVC 1IM9D 3RWJB 3S35H 3VXSD 1S5IH 4L3CA 1T20B 4PG2C 2NY5H 3P4OB 4JO2H 4EKJA 5KS9A 4M5ZH 5BZXA 3TBYA 5D8JL 5GGSY 3SKNB 4MYPA 4BK5A 3H85A 3RJDA 1HEZB 3BMVA 1W80A 1BCIA 2C1PA 4ABUA 4HJ0C 1L6XA 3IFNH 1TJIH 4KI5E 4Q56A 1ZTXE 2K45A 3MXWH 3PFUA 4G71B 4PJAF 5HHVH 3AS3A 2KZKA 3RVTD 3T6VA 2OV0A 4Z7UA 1GW0A 3NAAL 1S7QB 3CFNA 4JAMA 3CN3A 3U9PH 4QHUA 4PQXA 4XOCA 3TU6A 1T21A 1L9RA 3ULVD 3MNDA 3HI1B 2R0ZH 3BD5A 4Y0GA 1J5CA 3VFSB 4P4KC 1HQRA 4AW7A 3EFDL 4ELMB 4Z7UB 4CU7A 3Q9QA 3VD0A 1AGBB 4DERA 3ULUL 1IJNA 3RIAF 3SGEH 1FZOB 3QJQB 4GSUA 4G8EA 2F9BT 1QTYT 4XOAA 2H9GA 4OLUH 1SXNA 2NMSA 3WKML 1IZJA 2QTVA 1ZV5A 4LP5A 2FT8A 2NYKA 3VWKA 1SLWA 1IZKA 1WCQA 4FNSA 5E2UH 2V9QA 4QXGH 2R69L 4JFOA 2WQAA 2ZPKL 5IMKA 1PLCA 4WW2B 4RWYL 1KN2H 1O7DC 1UJ3A 5FA4A 3T2LA 1ILUA 4AH2A 4OKVA 1HH9A 3S37L 2AGJL 3FQUB 2AERT 5B21A 1U36A 1IMHC 3AU1A 3SE9L 2ZUUA 5DD0H 4FFWD 3BLPX 1SXZA 3MLXH 1YA5A 4KXAA 4BQ8A 1NBYA 2HG0A 1NAML 3WMSA 5BVPL 3LPOA 4YSTA 1OCCB 1NGQL 1RZ8A 3L3HB 1MFBL 3EGSB 2CBMA 4H40A 1JZ3A 3BKJH 1XMEB 2XIIA 2BNQD 1KCUL 3DMMA 1OF2B 4RGMC 4JFXA 4YPJA 3EF7A 2DQEH 1ZGLA 4K71B 2A9DA 4L8BB 1IAKB 3QJSB 4TUOB 5GSRB 1JZEA 2DH3A 4TYUA 4GAYB 1F1AA 1IFGA 2JCCB 3RG1C 1ORQB 1BFVH 4PGEB 4E9LA 1MCOH 4JFEB 5FF6B 1JK9B 3P2BA 5DJXB 2QQLH 1ADQH 3ALWA 4BGLA 2F68X 3E9TA 4FLOA 4FNQA 4GG6E 4JFXB 1L6PA 5HDBF 2NY4B 4TUJA 1I1AC 1DN0A 4AOFA 3JT0A 1GJUA 1I7ZB 4X6DE 1S8DB 2VLJD 4P8QA 4N0YL 4JRWA 3V5KA 4UDTA 2CALA 2PW2B 2ESVA 1SEBA 3UCQA 4GKOA 1E67A 1W9XA 3CHQA 1S7UB 3MLZL 1FH2A 3Q6GL 1CVSC 3A3YB 3QUYB 3U4AA 4DN3H 5IB4A 4H13C 2DKSA 1QEXA 3P9LB 4ZRGA 3NDZE 4HZLA 5EOCH 1NKOA 4KAQH 4UNVA 4QRUA 5T3XE 3UTTA 2VCOA 4D0DB 3KM2A 3SE9H 4DGYL 1QFWH 1E5ZA 2K0RA 2WKGA 3TEUA 4EUPH 1M7IB 1WCBB 2G5UA 2CO3A 4KY2A 3MV9D 3LJ3A 4EI5D 1ITCA 3IGLA 4K3JL 1WHPA 4E5XG 1FNHA 4B0MM 4RETB 4HHWA 3AUWB 5DZLA 1MCPH 2HZHA 3KNBA 1I7ZA 5EU5B 4HUKB 3B2XA 4NP9A 2G4GA 2D3LA 4TNEA 1MVYA 3GK8L 4LCUB 2HJLB 1NFDB 1CVRA 1RIVL 3BDBA 1RD6A 3OMZA 4DKFH 5KYWA 2QVIA 2PKDA 4JDEA 2OCFD 2X3CA 4X9HA 5E4EB 1GTFA 3TYGH 3QI9D 4FYSA 5DVKA 4BFIB 3CD4A 2D7PA 4GRLD 5LCVH 1U93A 3VGHA 3RZCA 4FNRA 3RLSA 1EH9A 3C2AL 1ZA6B 2Y69B 5KG9A 3GBNH 3K72B 4NKMA 5BOZG 5DQJA 2BK8A 4PW9A 4FA6A 5AVSB 5EBMA 1FFPA 1NWPA 1AY1L 4N2DA 5E0QA 4LLQA 3RVUD 1FZKA 1T89C 3HAEH 5A1AA 2BHZA 5C71A 4KVCH 4QUOA 5DR5H 1RUAH 3MRPB 2J55A 4GQZA 3C6LB 3QS2A 1DJZA 1XIWC 4Z95H 3BH9A 5JORA 2AQQA 2AKRA 2CSPA 3HB3C 1DVFC 4BGDA 4TUUA 4G6ML 1BAWA 4IRZL 4PJBE 1YPZF 3PQYA 4OCWL 4WUUE 4WY7L 3N55A 5M94B 2FSEA 3GO1L 2NY1C 3WEOA 5FUZH 3ZE0E 1JV2A 4MA1C 3O4OB 5EEZA 3RHWK 5INCA 3U7WL 3JUZA 2VDLL 5GRWA 5EEXA 4URKA 1LO3H 1FYHB 2P5EA 5E8NA 2SEBB 4N1HB 4UTCA 2MKLC 4BKLA 5C07E 2YRPA 4XBPA 3B5HA 3AB0C 4OGQC 2J88H 2XFXB 3KYAA 1QATA 2B9AA 3BVDB 4HS3B 5GGSB 4ZS7H 1M1XA 1A3RL 4Q9BA 3RWEA 3S7GA 5IT2L 1KYAA 3HC4L 3AQXA 2AJYH 4HSQA 4XO9A 3QWOB 3C5ZC 1U8PB 4HSAC 4Q14A 4NENB 3V5KB 3L3GA 4AKPA 4HWEH 1DQLH 4NUQA 4OZ4A 2P5PA 1I31A 4N6RA 3F7PC 4MLSA 4ZFQA 3WKYA 4E2OA 1B90A 2R0LL 5E2WH 5HGGS 4K94C 3MRHB 4HJJL 1OT2A 1IGYA 1MCNA 1QACA 2E4TA 3VD2A 4M7JH 2RQ8A 4LVNC 3CQPA 2NY2B 2HN7A 3E0GA 4X83A 3JTTB 3GM0A 2EQDA 1JD7A 4QMEA 4GBXA 5CLZA 4DW2L 1N8ZB 3GS7A 4M00A 2E7DA 3ME0A 1BIIA 4R7LA 1R3LA 1BZ7A 1JXDA 1SDAB 2AK4E 3EOAA 4KZ0A 5ILTL 1KPUA 2EVJA 5DURD 3U2JA 4OZGE 2CM6A 2KPNA 2IMNA 1DVUA 3QQNA 1EO5A 5C0JB 1VCAA 3ARGA 1ERNA 5D1ZC 4PJXA 4NPJA 4YNYA 4JRXD 5FECB 4LARL 1CDCA 1X5GA 5KS9B 3BWUC 4NO0D 5LNGA 4C59B 1FYTE 2X4TB 5IUCA 2DQTH 2VW4A 1NMCB 1G7JA 3VH8B 2ZJSL 5EOQH 5DZPA 4KZCA 4UQ3B 4HWZA 2XN9D 1LNUB 3L81A 3T3ME 5BQ7A 3LQZA 3O11A 3RFZC 2ZOKA 1JGDA 1GC1H 4H1LG 4DP7X 3KYOA 2OYKA 2NNFA 1IJ9A 4WFFE 3ES6B 5AVYB 3FQWB 1SM3H 5E6ZA 1FNEA 5IQ9A 2BP8B 1BD2B 3MOBH 1XWVA 3DSFH 4NO2A 4TPRH 5CEXB 2X2YA 3DHJA 3FU7B 2CO7B 2HX8A 3TX4A 2FLRT 2WBJD 3CZGA 4IBZA 4KKAC 1OCWH 1A6VL 1ZT4A 3QEGH 3T0XA 4AV5A 4G7VH 4ACPA 4UWQB 3ML8A 3NT0A 3O6FA 4M8QA 3KEDA 4N0UA 4EE2A 1PZCA 1G4MA 6PAZA 1T21B 5I0WA 4LDOB 4Y7OC 4IIQA 4OVVA 4ZFFA 4F5CE 2VLLA 5CEZH 5D2LB 5CD5D 2B15A 5I1GH 4JFYA 3VW3H 4RQQA 2XY2A 3KPRD 2VR3A 3NCYP 1T1ZA 1KYDA 5BMFH 2ATKB 1QQDB 2WLMA 1KGYE 2NNXA 3NIGB 4IIZA 3RX9A 3V0JA 3RY6C 1D5BA 3NSJA 2C3WA 3D85D 1U2HA 3S5ZA 2GSMB 1M05B 4ADJA 4PRHA 3DTDA 3ZO0A 1HYSC 1OV8A 4ADGA 1ZHNA 1JZHA 1R5WA 3DPBB 1WFOA 4AE1A 4D9RE 4BEIA 3RUGF 2GJZA 1OT4A 3GO1H 3UZEA 1I8KB 2QGEA 1OK0A 1RZKL 3EJYD 3OJDA 1UD6A 5F7YC 3RWDA 3VFGL 1W8OA 5C2UB 5M95B 2J2ZB 4IDJL 5D1QA 4ZO9A 4N2LA 1H19A 1BFSA 2P8LA 3MRLA 5AOJA 4XPTH 3AQYA 2BSRB 4KHXL 1PTZA 1A4JB 5FKAA 2VXQH 1HHGB 1E3XA 5TQ0H 3MRJA 2VDKB 3NJMA 5ICYA 2KUTA 3LDBB 2NDFA 1NCJA 3S8WA 1HI6A 2WLLB 2VMEA 2J6EH 4JY5H 3BEWA 5EC1B 3LKNA 3QQ4B 1WFUA 2CLVA 2D7TL 3EDDA 2WAHA 4P2OD 1IQDA 3T2NH 3BUYB 1XHHA 2D7MA 4OGZA 3LKQA 4XAWH 1XX9C 5SWQB 4EDWL 3CFEB 4E9TA 4RGNC 3TYFA 1H8LA 4NNYB 3RWIB 5ETUA 3DX3A 4M6MH 5BO1H 5C07B 3T08A 3U46B 2ZCLH 3MR9A 1MFUA 1HSBB 5IVXE 3FHQA 1YJDL 5I1DB 4L9LB 3QCVH 2XWJB 1N0XH 1M9SA 4NJAH 2IAND 2IBBA 4YPGB 4GEJA 5C09B 2JI2A 3V4LA 1I3UA 3HRZB 3LEXB 3L5IA 4BWUA 2YAFA 4FLSA 4FNLH 3V0FA 4FL4B 3ZR5A 5FYLE 4RCAA 4BJLA 3K2MC 1R1CA 4R83A 4XNYL 4W9ZA 1Z3RA 3BH9B 4IGBD 3UTQB 2BNUB 5F8QC 1AXTH 3QDME 3TCLA 5AVRB 1QRNB 5E2TL 2V3EA 3MRPA 3KLAA 4XBMA 2XVLA 4GAGL 4TKWA 5D4JA 3WOVA 5KJ7E 2WB1A 5A16B 5DSCA 3BH8B 4X7SH 3T1FB 4NYLA 4F3FA 3VQLA 2AEPL 2BIOA 4GXVH 1BGXL 2VDMH 4GP4B 2I24N 2FEJA 5F1KC 4ZW5A 1TR7A 2NY2C 4NRXA 4KJPD 3CXHK 3S4SA 3R0NA 5C7XH 3S34L 5E2UL 2EAEA 3V4VH 3BAWA 3D6GA 2DQDH 1WGVA 4PV8B 1OAUH 3R18A 4HWBL 3UP6A 5CZVL 1SVCP 2ZSWB 2B16A 4I9WD 2IH1A 3KBPA 3HLKA 1CIUA 5CZXC 4I5BB 3SGEI 3OAZH 2A6JA 2X6UA 2X7LA 3MV7A 5F7AA 5D7IB 5B39G 1NPJA 1L7TH 4AC2A 4F1ZA 3X1GA 4PCSA 3L9RB 5EWIH 2NT0A 1MCKA 1GGCL 2F8OA 4JGJA 5AKSA 3FO2B 4JRFA 2V4LA 1P7QB 2WVUA 5C8JA 4AWJC 3GMOA 5JZ7C 5IB2A 3C9NA 4HIPA 1N0XL 2IDQA 3HZYB 1I85C 3ZDZB 2NY1B 4N2OA 4KH2A 4AIEA 2N01B 4PRPE 3KMDA 1QKZH 1NC2D 1JRHL 2ILLA 3RPIB 3O2WL 2CIIA 4B60A 1OAXH 4A2LA 3GXIA 4U4BA 5CAYB 2R2EA 4XNYH 3VU2A 3P9LA 4ERSH 3L8QA 5G5DA 1JWSA 3U82B 5LAXA 4BH8B 4FG6C 1HHIA 1MIEH 2OQJB 2WQSA 4PJGA 2ITCB 1JWUB 4KITB 4OFPA 2GEQA 2K70A 1SZNA 1IU1A 2NYYC 5B7MA 4N0YH 3TA4D 4I2XE 3FRPB 4NBZB 2WWMD 1LLAA 1MWAH 4GQ9H 4LLUA 1ID2A 4UT9A 5D7KD 3N40F 3SYCA 1NFKA 1A25A 1FYTA 1KTLB 4Z7VB 4H8HA 4DUWA 4L29B 4NM8H 3GWJA 3VSQA 4Q0XL 4XWGL 5ID1B 4J39A 3EF4A 1P0SE 4HU8A 2D0FA 3RI5K 1G9EA 1DBKL 5ITFA 1H15B 1DQJB 2VLKB 1KULA 1XH3A 3D4ZA 2A4EA 1JZGA 3AREA 3FHAA 3VI3B 2GC4C 3LKRA 2FO4A 2QPEB 5L9DL 5KSBF 2MQ3A 2BSED 1U93B 3W3BA 3EJTA 4LLYA 3SYQA 2GT9B 1PLGL 1XSOA 4PB9L 3EJZD 2IBGA 4OAWB 1IGML 4GSDL 2Y22A 5CILL 2B1AH 1EAPB 3LPGA 5GGTA 4AEIH 5A16A 1YYLL 3SDAA 2ZG1A 5FB8B 2XPGA 3LB6C 4F58H 1HZHL 2UY6A 2P43B 2FX9H 1QTSA 2AJUH 3GTTA 2FJGB 2DKUA 3TN0D 4XMLL 3DMMD 2YN3A 1KWGA 1OP4A 3Q44A 4PRBA 2N1KA 3DX6B 4TSCL 4Z7UF 3MGAA 4KJPC 1C9SA 4RMVA 5LCVL 4XXWA 4FDWA 4JX0A 4YMPA 3FTUA 2WXFA 4P07A 2IV9A 4NKDA 4HX1A 1QEWA 2AI0H 2GABA 2JELH 4JM2C 3LHAA 1HSBA 2Y06H 3KS0J 4MCMA 5HYJD 3HS0B 3IN0A 5JHDD 2HLEB 1ZTXL 2XWJA 4XPHL 3K3QA 3ZYJA 1ZT1B 1PW3A 3H53A 3UAJC 3CC5B 3CLFL 3K71B 4FZ8H 2DD8L 2FNWA 4NWTH 3WYRA 1BBDL 1XTMA 2XJKA 1OARH 1U8MB 3D51A 4UB0L 5LB1A 3IM1A 1PZ2A 1T3FB 2XN9B 3B2MA 3JWNH 3RL1A 4ADIA 4AM0Q 4BSWB 3WHXA 4AEHL 2H6OA 1HEHC 2KLTA 2X05A 3DX1A 3QJOA 4YHNB 2FYVA 4MCZA 2GITA 2H0EA 2KT6A 3LIZA 4HCRH 3VXQB 1KGCE 1NMBH 4U1JA 5EWIL 2E27L 4RNRB 3UJIH 3LHPL 1PPIA 2FWLB 4J4PC 5IMLB 3SY6A 2VJXA 2WZAA 3ML9A 5MEND 2A38A 2P24A 4LVHC 5B8CC 4Y4FD 3BVWA 4HXAL 5JPMC 3QH3B 5G4OA 1CK0H 1AQDB 2DTML 1YY9C 2MFNA 2OULB 1R24B 3CDGB 2J72A 4XNMA 4PY8I 5IROA 5BS0E 4DUXA 4FLQA 3HN3A 2F54E 1G1YA 4AQEB 4DF9A 1PMYA 3F6IA 1DUZA 3QYMA 3GHBH 4IK6A 3MODH 3TS8A 3MLPA 3G5YB 5HDRA 3RUGA 2HLFD 3ZMEA 4AGPA 4NHUA 5KYUB 1YEIH 1A1MB 5HGHB 3MJ6A 4DGIL 2R29A 3GSXB 2AJZB 4YBLB 3OHMB 1HL4A 5IWLC 3H9HA 5LN4A 4K94H 1O9ZA 4N8CL 1H3UA 1HHHA 1T4WA 5D6DA 2I26N 1XH0A 1DZ0A 4TLKA 5D1XA 1W2KT 3D3VA 5F89A 4APQC 3MRRB 4R5TA 5F0MB 1JSYA 4PREB 5CLWA 4I18B 2XZCL 3KYOB 5F3FA 2H6UA 1OAZH 2VWEC 4N0FB 4XPBL 1W0VA 1LHZA 2Z64C 2Q6WA 4KKRA 5EU4A 5FO9B 3NRFA 3FTWA 1XGZA 2J8UE 3N41B 3VFSA 1HCYA 1HOEA 4J1UA 1QBLH 4IOFD 3B9AA 1WA0X 4ZTPL 4BD4A 3RUGB 1KB5A 4BFEA 2ZJSH 4PTUA 3OKEA 1DQQB 1A9BB 2HFGL 3QORD 1INQB 5J56B 1XGQB 4JB9L 3UTOA 5T1JA 2V8MA 2AZUA 1TU2A 5IQNA 3THMH 3LS4H 1SOKA 4YFDB 5KSUA 2OMTA 2R29H 4M7LL 1JK8B 4MXVE 5FUOH 1WICA 4RX4A 4E9VA 1CG9A 3H42L 3H2QA 5C09D 2VDQL 4KTYA 2YBGA 4R0LC 5DLMH 3IK2A 3UTSD 1J0ZA 4N2FA 1QRKA 2MPAL 12E8L 1SQMA 3UYPB 1ACYL 1K6QL 1ZHNB 5GS3A 1NGWA 2CKBB 1IO4C 3L2LA 3HVDA 2H26B 1GZQB 4JE4B 1QVOB 4LBEB 3GBML 2DLHA 1S9YB 1XGTA 5F7LB 1OPGH 2IPUK 4LVOC 5I73B 4XT1C 3C2SA 4AMKL 3FTXA 1FZMB 4OM0L 4KTGA 2NY7H 1G7PA 2Q7YA 2YPLE 3KJ4B 1S7WA 5EC2B 4AIOA 3CDCA 4N0UB 1CE6B 4H8WH 3OR7A 2BVOA 5F7WC 2X4UA 4OCSH 5TD4A 4I2XA 2R4RL 5KVDH 2WUCH 4QRPB 5LNEA 4P2RE 3P4MA 4ZSOB 3CIAA 4OGAC 35C8L 2PCPB 3L48A 2ZOWA 2AK1L 4GIAA 3H0TB 4YHOH 1O6SB 1USQA 1IAIM 1KB3A 1MCBA 5AVZB 4O58L 5DTFB 4NDMB 2G2NA 3ATDA 2AK4B 4DTGH 2TAAA 3H2PA 2G3ZA 4S10A 1MSPA 2YMXL 1G9NH 4GSXA 3SGDI 4UQDA 1ACCA 5T33H 3SYPA 3NJKA 4NM4H 1P53A 2J1XA 1LMKA 1G7JB 5HHXL 4XPAH 2MJWA 3EZ8A 1ZLUH 3VTMA 2BDNL 2HCZX 3G5XA 1QSEE 2VR5A 3BCDA 3GIVB 4W9JC 3WDIA 1NGZA 3MREA 4RAVB 5JDJA 3IF1B 3RPBA 1ZT7B 3WHE0 5I15L 2Y1ZA 2V2TB 1BOYA 2AKRB 2X6CA 5LN8A 2UV3A 3T4AC 3SPVB 1VADA 1Z5HA 5CHNB 3CX2A 3ILDA 3O2DA 3VXPA 1VENA 5IW1B 1PIFA 2QPFA 3OAZK 4WU5B 4TVPD 1A3LL 1HTYA 3COOA 5AAMC 2YXWA 3QARA 3SDAD 1A4KA 2R1XB 3GZPA 1U42A 3FTSA 4UOW1 4NQDD 4W9EC 4ZFOA 4PLKD 1J0YA 1KLFA 3WFHB 1UENA 1S9VB 5EBLB 5C0DB 2OJZL 3L5WA 4NQEA 4WWKC 5C0IB 3MRKB 3Q0HA 4ZPVB 1N6VA 3QHZH 3ARED 1T03L 1AR1D 2ED8A 5C08D 3ATEA 3JV4B 5C09E 4BFOA 5AZ2H 2HPOA 4J3OC 3VXME 5FYLD 4FQ2L 3TP4A 1JZFA 2XUWA 2YPVA 3G5WA 3MCLL 3VXUA 5HY9B 1ET5A 3JWOC 1K5NA 3WHXB 2IFFH 4ODWA 3IFPB 2EEFA 5KBLA 3MRGB 4CU6A 1PCXA 2VAJA 3FQXA 4YHZL 1QG3A 2CNYA 5JHLL 3EDFA 3FB7A 4P2QD 4TULL 5HHMB 5CSGA 1AC6A 1OGSA 4UV7H 3GEFA 1P84J 1CGWA 3O41B 1ZVNA 4RGNB 2AFNA 5CJOH 5L0QB 3HC4H 2NR6A 4PJ8A 5KS9F 3X3GL 1O7DE 2X4PA 2WINB 4HZLB 1ND0B 1EXUB 4PJIE 1BG1A 1MAJA 4F92B 3T2NL 2X6AA 5A2AA 4RDQF 5IHZB 3LKPA 1D3CA 1IFHH 4MDJB 1FGVL 4NNPL 3SJVB 5IBUG 4QRSB 4JG9A 1TNNA 4OCXH 3GM8A 2JB5L 3DTUB 1HZKA 5HHOD 1ZD6A 3WGVB 1BM7A 3HC0B 2K4WA 4L23A 5DCCA 4XMTA 1N2RB 1A7OH 3DVFA 1DN0B 2WLZA 2VN7A 1BVNT 4UANA 1E28A 3D0LB 3MRDB 3WXWL 3WMPA 2XN9E 2ENYA 1XH1A 4FTVB 1M42A 4JK0D 2IQAB 2EE6A 5DS2A 3W39B 4U3XA 1EAPA 1DQVA 3POHA 4W68A 9PCYA 3A24A 1JD9A 1MLCA 5JW4M 1MWAB 2VXUL 3BFOA 4R4ND 1AO7D 3BN9D 1IX2A 1OB1B 3IDXH 3T77A 3V4PB 2EZ0D 1J5DA 1UQSB 2AXHA 2YPKB 2VLKA 3LRLA 3ULAB 3QNYA 3EJSA 5CIPH 3MV8D 3HMWL 3MVSA 1OOAA 3ULVF 1DN2A 1F86A 1KTRL 1SBBA 3JWNC 1G9NL 4JMNA 4PJDF 4XVTL 5EC2A 1D6VL 5MEPB 3HI5L 5IEKA 3QEUB 5EU5A 5DUPL 3WCYA 1VADB 1BLNA 5CHNA 5IHZA 1OSPL 1AE6H 1NCGA 2QSVA 1FL5A 3ARBD 3HE7C 1YEDB 3CSFA 4M61B 2XWRA 3BUBA 3VMNA 4AH2B 1QFUL 1Y1DA 4L3EA 3T4YB 3ZDXF 3AMLA 4X9YA 1IAIH 3UPRB 3H6JA 5C08E 3T3MB 3HJEA 3OM3B 3BKCL 1DE4A 3IXTA 3OPUA 1SOSA 4NERA 1F11B 5ANME 4EOWH 5IHBA 1KYUA 5CJ5A 3IDIA 1PX4A 2EE9A 1CG9B 2KS0A 3UJJL 1A1OB 4FC3E 4MSWA 4CKVX 4YHMH 4ZUSB 3PL6D 1IGMH 5L4FA 3ARFD 1LDSA 2NXYB 4FMVA 2VKWA 2EXTA 4MJ6A 4PJ9C 5F7FA 3UGUA 1PY0A 3ROOA 3DJSA 3RIKA 3CNKA 4ZD3H 4G3YL 4ZMVA 4J5VA 3TA3A 2VDOL 4U33A 1F3DJ 3P02A 1YEFH 4IMLB 3O0LA 3FQXB 5TE4H 3VQMA 4BRJA 1A02N 1A6TB 2BSDA 3GMNA 3FOMA 4XI5D 3H9SA 2WXKA 4XXCC 2MCAA 3IAPA 3V2AR 1SY6H 1PX3A 3GXDA 4ODSL 5AKTA 1QLEB 4JO1L 2R8SH 5TH2B 5C2BH 4KC3B 3D12B 2DQFA 2YD0A 1BFOA 1KXQA 3SDCB 1ROCA 1MG3C 4L1LA 4FQLH 1AD0B 1L0YA 2HT4D 2OMVA 3TCTA 1COBA 4QRBA 1JOIA 4D0CB 4ZMOA 5EUKA 1M1SA 1PFCA 2Q7AA 3FCBA 4N2EA 4J6RH 4ZUUB 1PZ5B 2WPGA 2A9AA 3CDZB 4PRPB 2EIKB 4FZ8L 5KJRH 4N8VA 2OYPA 1NOLA 4K07A 1N2RA 3A23A 4EIUA 3QORB 4NZTH 1UOLA 3L3OC 1VFUA 1JYXA 4JRYD 5LKNA 4UILL 5L4IA 2B2XL 2N56A 1UACL 1NDGB 1F56A 1S5IL 1MIML 3L1OH 1KIPA 1DEEB 5JQIB 2Z8SA 2C3XA 2VZ3A 1YEJH 4XZUB 4F8NA 4DP8X 1TTUA 3IDUA 4FGMA 4K55A 4M48L 3UTQA 3E1F1 1HWGB 1V27A 3MQIA 3P40A 1E4KA 3P2DA 4PJAA 2R83A 3N9GH 3KPRA 1M7DA 3BIKB 5CD3A 1J8HA 3UZQA 2RALA 4TQEL 3AU0A 5CILH 3MFGB 3S3BB 1MH5B 4HC1A 4X8GA 4AQ8A 1Z9NA 4EI6A 2IAMC 3H55A 1A9EB 1KACB 1PL3A 1YNKL 2DQHH 3BZDA 4AGNA 1RAMA 4N8UA 4HXAH 2X88A 5I0ZA 1HNYA 3SSGA 2BCMA 1UOVA 1Q9LA 3FQWA 3OR7B 4N0UE 5EB9A 2WNKA 2BVEA 1FBIH 2OP4L 3MNWB 3EH4B 1G7LA 3RDTA 2VISA 1I9JL 1TEYA 3FFDB 4PSRA 1P7BA 1DBJH 3CSGA 4AGLA 3SDXB 5HPMB 1BFTA 4PCTA 4FQXD 4WHYH 4MA3A 3QCUH 3V7AE 5D7IF 2BVOB 3N2JA 1S7QA 2X4TA 1A6WL 1KSRA 4DEPB 3B83A 4XN1A 4P2RA 2HRGA 2K9UA 3S34H 4FLRA 5CO1A 5DJ0A 5D93C 2XV0A 1YN6A 2C9PA 3WDJA 3ZIYA 1HSAA 5E9DB 1QFWM 2HUEA 1UADC 5L6YL 5BNXD 1JPST 3EIFA 1A1OA 4MSWB 4XP9L 3WTTA 1D2PA 1S78D 3D39B 3GI8H 2Y3AA 3DIVA 1R5IA 1MCLA 4OCYH 3IJSB 2UYLA 2DTSA 1JF6A 3X1FA 4JPKH 3F83A 4XO8A 1EEUA 1RIUH 3O3UN 3KWUA 5DJ8B 4NN5C 2AXWA 4F2MA 1EA9C 3OJVC 4MTMA 3A6OA 3WUWG 1K8IB 2K1MA 2VR9A 2UZIH 4JG1L 1Y7VA 1JGLH 4A2DA 1GAFL 4JFFB 3P54A 2EC8A 4DGVH 5JNYA 2YEZB 2D9CA 2KZ1B 1DANU 2A6DA 3HZVB 3IMWA 3N43B 3TT1L 2L7UA 1K2DB 3BZ4A 3G5ZA 2KDGA 3O2WH 1RJZB 4ZXBB 4A7QA 4J3XA 3GMQB 1EK3A 2UUDK 3S0PA 2NY4D 5DFVC 4PSPA 5AALA 4OGYH 1EO7A 4OI9A 7FABL 3BE1H 2VLRA 4U1MB 1I8LC 3I9GH 4PI0A 4OGXL 2ZCKH 3NJJA 5F1NB 1NKGA 2JKLA 2GAZA 5LGYA 4BELD 3OD3A 3N5AA 3K0YA 3WELA 6FABL 3ARXA 2G5BB 4Y8DC 4IIQC 4WHCA 2BVPB 3V4VL 4U1GC 2KBGA 2ZOTA 3BAJA 4P3DB 4JFDD 5J9PA 3HE6C 1TVHA 3TOPA 2ORBL 4KTDH 2Z93A 4JQXA 3FCUB 4QNPE 5JUEH 3SCMC 2E8YA 3GSXA 3ISWA 1QVOA 1D2OA 2JCCE 5IVZA 5FHAL 4P2QB