1EZSC

Crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords ECOTIN
total genus 53
structure length 223
sequence length 223
chains with identical sequence D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezsC01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezsC02
4JZ1A 1XM1A 2BVSH 3V0XA 1C5UA 2BQ6B 2HLCA 3FANA 2ZIQH 1GBCA 4Y0ZE 2VH0A 1FAXA 3GCTF 3AAUA 1MTUA 1GBFA 3OYPA 1AE8H 1YM0A 1JOUB 1OS8A 4B71A 4BXSA 3M5OA 3BTEE 3RDZA 1T7CA 1FI8A 1PQ7A 2VWOA 1O2ZA 1P12E 1WQVH 1TMBH 2G51A 1TNIA 1C2EA 2ZCLP 1C5WB 1J17T 2O8LA 2GZ7A 1KXBA 2H9HA 1QR3E 3HK3B 2IN2A 4KKDA 1O36A 1QL7A 3MO9A 3RC6A 1UCYK 1NTPA 1TRMA 4Q7ZA 3UQOA 3VGCC 4JYTA 2A2QH 1C4U2 1LMWB 5JBCS 1PQAA 1RXPA 3P95A 1FY8E 1P02A 2ZFRH 4VGCC 5JYIA 2HALA 2ZHFH 3LJOA 5HGGA 2G4UA 3HGNA 4GPGA 2UUFB 1V2QT 3ESTA 4FU7A 5L6NH 1DY8A 4JZDH 3UWIA 1O3DA 4O97A 3KNXA 2GMTC 1OXGA 1DLEA 2AMPA 2Y5HA 1TQ7B 2FLRH 4BAMB 1O0DH 1DXWA 1U6QA 1XUFA 3E16B 1SI5H 3MOCA 1ELVA 2R3YA 4IN1A 4CH8B 1ORFA 2Y80A 2ZGCA 3H7OA 4X6PA 4JCNA 1YCPH 2G81E 2WPLS 3EA9A 2VIDA 3M7QA 4IS5A 4BANB 1E36B 1C1WH 1FPCH 2GCTC 1NRRH 1O34A 4DIIH 2JH5D 1A3BH 1Q31A 2SGQE 1UO6A 3S9CA 1UHBB 1LKAA 2CHAB 2RA0A 1AGJA 2YOLA 4YESB 5K7RA 3ZVGA 1Q2WA 3KHVA 5E0HA 1YF4A 1Z6JH 4Q7XA 2GX4A 1P9SA 3EA7A 5HM9A 4ZHLU 5C67A 4LK4A 5E8EH 2V3HH 4NZQA 3QUMP 2M5TA 3UR9A 2ALPA 1TNKA 1W11U 1Y3UA 2QIQA 1XKAC 3PYHA 3A7XA 3LOXA 1EZUC 1C5VA 4BTIB 2VIQA 2ULLA 8GCHF 1LVYA 2P16A 2BY8X 1BRCE 2OC8A 1T32A 1W7GH 1ZZZA 3UNQA 4Y10E 4B75A 4ZUHA 2BLQA 3IWMA 3BEIB 3SUFA 3SHAH 3LGTA 4FVBA 1SSXA 4YZUA 5FPYA 2IJOB 3QDZB 1A5IA 5DGJA 3MH5A 2HVXA 3NUMA 3ELAH 1SL3A 1QL8A 3OY6U 1KXEA 1T8MA 2TBSA 5L2ZH 4NSYA 4UFDH 1NU9A 1GBKA 1SGIB 1T8LA 3O8CA 1BCUH 2FOBA 4MPVA 2BYAX 3PMBB 3DD2H 1B7XB 1UVUH 1GI8B 3K6ZA 4U30A 1C1QA 3A7YA 5FPTA 1N6YA 3D65E 4OS1A 2VGCB 1LPZB 3KQDA 3L33A 2GD4B 1TGCA 4U2WA 2AGIX 2P59A 2BXTH 2FOHA 1AMHA 2FEQH 2GZ9A 3SV7A 2W3KA 1S84A 1NS3A 1FY5A 4X1QU 2B5TB 1HRTH 1CBWC 3L6PA 4IN2A 2W26A 5I25A 1FDPA 1O3NA 3O8BA 3BG8A 3MO6A 4HGCA 1O3EA 3FZZA 3M7TA 2C4FH 1MBMA 6CHAC 1EZXC 2SGAA 3A88A 1AUJA 3NXPA 1DWBH 5F8TA 1WUNH 1KSNA 2FODA 4HZHA 3PM3A 2ZHEH 4X6NA 1GJ8B 2AH4X 3M3SA 3LH3A 1PYTC 3NPSA 3ZZCA 1VITH 4H6TA 1BMNH 4WMFA 2UUJB 3VPKA 4VGCB 4O9VA 2ZWLH 3GCHC 3RU4T 1ZPCA 1DWEH 1BITA 4ZKOU 2VINA 3A7VA 1O2KA 4GCHG 5PTPA 6LPRA 3TH3H 1GBDA 2Z9LA 3HKJB 1RTLA 5AF9H 1VCQA 1VITF 3D23A 5FPSA 4NWKA 2STAE 2J2UA 3T29A 5DP6A 1PPZA 1VJ9U 1PPBH 2CJIA 1H9HE 2LNCA 2OC1A 5LPEA 1SGNE 1FIWA 1LDTT 1QQ4A 1UVSH 2ZFSA 2FS9A 4AORA 1SOTA 4K5ZA 1ELBA 3ZYEA 2C8WB 1RIWC 1A46H 2ANKH 3QTVH 1C1VH 2NU3E 1Y5UT 2ASUB 3Q00A 1F5KU 1P2IA 2PGQB 2O8TA 2CN0H 3RXMA 1GGDB 1KXDA 2QF0A 4AGKA 4ABFA 3LC3A 2SNVA 1P03A 1BDAA 1LHGH 2BDCA 4MG3A 1JMOH 2TGAA 1P2MA 2PR3A 2XBWA 1SGEE 1P2KA 2F91A 2OUAA 3TLOA 1C5QA 1B0FA 1GJ6A 2VVVA 1IHTH 3EDXB 1G3BA 5DP5A 2JETB 1LVMA 3PMJA 1MZAA 2HOBA 1HUTH 1EASA 3ZYDA 2G5NA 5H4IB 3FP7E 3LGWA 2V6NA 2BLOA 2EEKA 2ZDNA 3MO3A 2FLBH 2JH6D 3LT3A 5FCRA 3URCA 1FY1A 2R2MB 1QIXB 4Q2KA 3P70B 1PYTD 3BIUH 4XDEA 3RMNH 3RXRA 3RU4D 1XKBC 1ANCA 1ACBE 1C5ZB 1LPKB 4TY7A 1MKWK 1QL9A 4XSKU 1G3CA 3V12A 1P3EA 1O2OA 1A61H 2OCVB 3S9BA 3QZQA 2FOGA 5EW1H 1O2RA 4ESTE 1TFXA 3UPEA 4DCDA 1E34B 3RMMH 1MMJN 2C8ZB 1O5CB 3CP7A 5GPIB 1HCGA 2CF9H 4FUCA 2BB4A 5DP8A 3SNAA 3UREA 3EYDA 3SJ9A 5BRRE 1OP0A 2ZC9H 3O8DA 1MU6B 1O2GH 1GBEA 4X8SH 1OWHA 1VITG 2PV9B 2FYRA 2PKAB 1KDQA 1CGHA 1PJPA 1AB9B 3LONA 1NRNH 4INKA 4K1EA 3NZIA 2WPIS 5EGMA 5TCAA 1S82A 1EP5A 3SQHE 4KGAA 3K2UA 1CHOF 1HXFH 1S83A 4UFEH 3S7KB 1W14U 1FV9A 1O2HA 1Z8RA 1HBTH 1TRYA 3M37A 1C5MD 3HKIB 1UCYE 5DPAA 1K22H 1NY22 1O5GH 3SN8A 2ZFFH 1GMHF 3P8GA 2GP9B 2XC0A 7GCHF 1KTTB 1DY9A 2A7CA 2XC5A 1EB2A 1GMCF 2OINA 3TIUA 4NZLA 1WOFA 3ATMA 1XUGA 2ZGBH 3T62A 1MD7A 5EW2H 4YTAA 1ZGIA 4Y71A 3TNSA 1GHBF 3ODDA 1W3CA 5EXLA 2RG3A 2BM2A 5EU8A 3SNCA 1ETRH 3HATH 3LGIA 2DE9A 5EPNA 1AWHB 1MAXA 2ODPA 1P11E 1ZRBA 4ZH8A 5A8ZA 2AGEX 4ASHA 2LPRA 3GDUA 4E06H 2QXIA 1FMGA 3ZVBA 2BY9X 5E2PA 1DVAH 1AY6H 1DSUA 1EZSC 1HAOH 2Q6DA 3PMHB 3SUDA 4JK6A 3NK8A 2FTLE 1NRPH 1RJXB 1C1OA 2VWNA 1RIWB 1TBZH 2ZFPH 1IQFA 1C1UH 1CT4E 1WV7H 1LHEH 3F9EA 4D8NA 3E8LA 4FUIA 3MU1A 2P3TB 3RXIA 1P2JA 2YNBA 1EKBB 2Z7FE 3MNSA 3V3MA 1W7XH 3RLWH 1BTZA 3IITA 1SVPA 1TPPA 3B9FH 4GLYA 2WUBA 3UFAA 5F03A 3SHCH 1AKSB 1V2PT 1IQKA 4OGXA 3LKWA 1ZRKA 2F3CE 2BMGB 1SPJA 3FAOA 1PPHE 1QJ7B 2FM2A 1D3PB 2P8OC 2A5AA 2R2WU 1TWXB 2VIVA 5FXLA 2A4GA 3SNEA 4MTBA 4MQAA 2A0QB 7LPRA 1GHXH 2FDAA 1C5SA 1HAZB 1PQ5A 1WBGB 2ILNA 4UFFH 1YPHE 1NFWA 1O3GA 4I7YH 2W7SA 4A7IB 2ZCKP 3PV4A 1P05A 3D62A 4X1PU 5ESTE 2ANYA 3PTNA 1K1PA 3TNTA 1T4UH 1GBLA 2WV5A 1C1NA 3QN7A 2J92A 8ESTE 2C8XB 2ZU2A 3OY5U 2H2ZA 1ETSH 5T6GA 3GYMA 2Z3CA 1O2JA 3OX7U 1D3QB 2PHBA 2V3OH 2Y82A 2HNTF 2CF8H 1C2MA 1HV7A 1HNEE 3P17H 4K8BA 1G2MA 1IQGA 1LCYA 4GHTA 1EPTC 1HXEH 4LZ1H 4AB9A 1ABJH 1C5XB 1V2TT 2Z9GA 1ELCA 2H9TH 1K2I1 4MPWA 3HK6B 1O2IA 1VCPA 2XTTB 5A0AE 2ZHDA 1DFPA 3PMAB 1IOEA 1AVWA 1L1JA 1QRXA 4X1NU 3SU6A 1SHHB 1G37A 5C1UA 1OWKA 2F9PA 1VR1H 1ARBA 3LGYA 3U1JB 4K1TA 1Z8IB 1FNIA 1S85A 1ZHRA 5C20A 3N7OA 2ZI2H 5EOKA 1UTMA 3Q3XA 1MZDA 2BX4A 1GJ7B 1KXFA 1BTWA 4B2CA 4YOJA 5A09A 1EP6A 1UTKA 1C2DA 1OX1A 3W95A 4NIXA 3UTUH 4KTUA 1C5LH 4Q7YA 1HIAB 1SLUB 2G5VA 1BBRE 1FAKH 4WJG2 2FP7B 2P8OB 1BOQA 2GDEH 3ZZ7A 3PROA 1THRH 3SJIA 1EPTA 3LDXH 2GMTB 4TY6A 5C1YA 3BTKE 1CHGA 3E0PB 2QC2A 3GY2A 1ZSLA 3TJVA 3GY4A 4FUHA 2XYAA 1GI0A 1A1RA 2F9UA 3A80A 4NIVA 1KTSB 2BLWA 2AIPA 1ESAA 1TA2A 1AFQB 1C1RA 1F0RA 2H5DA 1EAIA 3H7TA 2A1DB 1K1MA 1SGFA 3MH4A 1C1MA 3T25A 3V13A 4B1TA 4I31A 2C90B 1IQLA 1NFUA 2A32A 2G55A 2QA9E 2VH6A 4I8HA 1EJNA 4BAQB 2VWLA 5HMAA 4DOQA 1ZHMA 2BD8A 2A31A 1GJDB 2A45B 4D9QA 1W10U 4D9RA 1BHXB 1GHWH 1SC8U 1Y3WA 2Q6GA 5LPFA 3SV6A 2OXSA 3KQEA 1FPHH 3GY7A 2J34A 4B74A 3KCGH 3BTWE 1O3BA 3CENA 1UVTH 3ZVAA 4D7GA 1NC6A 1ZYOA 3UQVA 2QCYA 5C2ZA 2QF3A 2ZG0H 2GV6A 1RGQA 2ZCHP 1GI3A 4WXIA 2P94A 5A8YA 2A4RA 4IW4E 1OWDA 1YYY1 3RXQA 2XBXA 2VIOA 1C2KA 4NFEA 2EI7A 1ZPZA 2G8TA 2ZDMA 3RP2A 2FWWA 1DUEA 1FY3A 3RMLH 2A4OA 3VEQB 1Y3VA 5DP4A 4BNRA 1OSSA 1RTFB 4BTUB 4Y0YE 2A2XH 3SO3A 3M7UA 2OBOA 3TGIE 2ZQ1A 1O2YA 1SFQB 1P0SH 5FCKA 1JIMA 3KEEA 2RDLA 3LGUA 4JK5A 4B2BA 1MQ6A 1ZTLA 1XUIA 1ZJKA 4AX9H 4Y76A 1G30B 4UDWH 4RSPA 2GV7A 3TK5A 2VIPA 3MTYA 1CQQA 1C2GA 3RXDA 3FFGA 2AFQB 3SU3A 3VFEA 4INHA 4NWLA 1DS2E 1O3CA 1HAHH 2VVUA 1ELFA 1EQ9A 2J38A 1O2MA 3G01A 1AQ7A 2XCNA 1FXYA 1ZLRA 2OC7A 3AAVA 1ELTA 1TNJA 4DVAU 3SJ8A 1BIOA 1TOCB 1TX7A 3MYWA 1QB9A 1D4PB 4Y7AA 4J2YB 2XC4A 2ZDVH 2ZNKH 3SV2H 4TWYA 3S69A 1BA8B 2TIOA 3T26A 1LO6A 1SQAA 3ZZDA 1ANEA 1DXPA 4F4OC 2Z9KA 2BDBA 2GZ8A 3A7ZA 4ZKRU 4XE4A 3MH7A 1AI8H 2A5KA 4D7FA 4ZKNU 5C3NA 3SNBA 4JZFH 1P2NA 2G52A 1C9PA 1GHYH 2H1UA 1VGCC 2AS9A 1P04A 2I6QA 2VNTA 4OS6A 3EE0B 3E1XB 2J95A 3UIRA 1Z1IA 1O3FA 3GDSA 4CHAB 1TALA 4GVUA 1DWCH 1P3CA 1TA6A 2BD4A 2FO9A 3BTGE 4R8TB 3DFLA 3PLPA 1UK2A 1V3XA 3VB5A 5F6MA 3VXEH 1P09A 2GKVE 2QXJA 3SNDA 1GI2A 1JRSA 3RLYH 1NT1A 1N1LA 1MTWA 2BDAA 3MU8A 2BTCE 4CRBA 5DP9A 2OTVA 3SW2B 3SV9A 1GMDG 2OD3B 3A8AA 1UCYH 1FIZA 3M5LA 4WH8A 2BHGA 1SOZA 2BZAA 2FIRH 3QWCH 2ZU3A 1UJ1A 2SGPE 1HAVB 3LPRA 2F9OA 3QTOH 1F0UA 5IYTA 4AOQA 1GVKB 4MLFB 3E6PH 2C93B 2ZTYA 2AEIH 8GCHG 2HRVA 3A7TA 2C3SA 3BIVH 1F2SE 1HAPH 4ABJA 1L4DA 4BXWA 3MI4A 3RXSA 3RM2H 4ZHAA 1SR5C 1TABE 1QGFA 1HAGE 3PWBA 1FUJA 4YT6H 1A2CH 2ZGHA 1DSTA 1C5NH 3WY8A 2BQ7B 2FOFA 1HYLA 4J1YA 4XBDA 2WINI 2YNAA 4RN6A 4DIHH 1L2EA 1JWTA 1ZSJA 1MD8A 1Z7KA 1MUEB 1O35A 1AZZA 1V2RT 4AB8A 1XXDA 5DK1A 1P57B 1Z71A 4E7RG 3U1IB 2PW8H 2BOHB 1DOJA 3MMGA 2UUKB 1O2VA 1QRWA 3BTFE 1CE5A 1ZGVA 4NA9H 5JB9S 1EAWA 1GVLA 1GG6B 2BVXH 1V2NT 3GICB 1XVOA 3SI3H 1BQYA 2I6SA 3BTHE 1GDUA 4NCYA 2F83A 2PKAA 4Z0KA 5GCHG 2OQUA 1GCTB 3SU0A 4WXVA 2ZGXH 2P3FH 2PKSB 4RKJB 3GY6A 1DLKB 1B0EA 1YC0A 1LTOA 1DX5M 1UVOA 3F9FA 4MNYA 4KTCA 2ZU5A 2A5IA 3BTQE 1A3EH 2ZTZA 5A2MH 2SGFE 3U98H 1RRKA 5A8XA 1BB0B 1TNHA 2V35A 4UONA 1EJMA 1WAYB 4GAWA 1S0QA 1DPOA 1GWAA 3GISB 1KLIH 4GCHF 5DO4H 2HWLB 3HGPA 3TJOA 2STBE 1UVPA 1YP9A 2D26C 2XNIA 2UUYA 1HAIH 1NU7B 1P9UA 3U9AH 5CHAC 4FUEA 2VVCA 1EZQA 5A0BA 2OLGA 1KYNA 2GTBA 3RXKA 3QO6A 2HGTH 4AG1A 1UTQA 5E0GA 3RC5A 3SBKA 1JRTA 2BX3A 4ABHA 1ELEE 2B9LA 1MTNC 1XMNB 3E3TA 3F68H 1FLEE 3T2NA 3MNBA 3P92A 4CHAC 1D6WA 1W13U 3I29A 1QHRB 1KDQB 1QCPA 4X0WU 2CHAC 3ATIA 1A0JA 3Q76A 3PO1C 1WU1A 1ANBA 1HGTH 2ZDKA 5J4QA 3QGJA 1BJUA 4ISHH 3KIDU 2GVFA 3R3GB 3TK9A 3B23B 3AASA 1PPFE 1QJ6B 1ZTJA 1S6HA 2GDDA 3NCLA 2FZZA 1QA7A 1H9LB 1IQNA 4JZIA 3PLKA 1MBQA 4D76A 1W2KH 2ZA5A 1MAYA 1ZMNA 3RXTA 1ETTH 3RXJA 1HDTH 3TH2H 1WTHD 2OQ5A 1XVMA 3RXBA 3LH1A 1UTPA 1HFDA 3T5FH 2TGDA 2O8WA 5SGAE 4X6OA 4OS4A 1PPGE 3ZVEA 1O3OA 2ZKSA 3HPTB 1LHFH 2WPHS 5L2YH 3C1KA 4THNH 5BPEA 2Z3EA 1S6FA 2Y5GA 4IGDA 4DW2U 4GUXA 2ODYB 2WYGA 1N6XA 2AYWA 3U8RH 1NO9H 3ATKA 1K1LA 1BMAA 2WV4A 4I8LA 2AERH 6ESTA 2KAIA 5CE1A 1OPHB 1CBWB 2FESH 6GCHF 2VJ1A 2HPPH 4KP0A 1IAUA 3P8OA 2PFEA 4Y7BA 4AYYB 4SGBE 1AE5A 1KLJH 2BVRH 1OKXA 2XCFA 2FTMA 4CRCA 3BN9A 4NIYA 4B73A 2TRMA 3BV9B 1SHYA 1SQOA 1XUHA 3DUXH 3VB7A 3BF6H 3GY8A 1YPMH 1SGFG 4BOHA 2FI3E 4IC6A 4YM9A 4OS7A 5CMXH 1T4VH 2XRCA 1BRBE 1FQ3A 3KGPA 1SGCA 1H4WA 1G3DA 2Y7XA 5AFZH 3RC4A 4X2XA 1QBOA 1T8OA 4ABAA 3CS0A 1GHAG 3K6YA 2DE8A 3I78A 1YKTA 1A0LA 2GCTB 4YO9A 1DICA 3ZZ8A 5EODA 4UD9H 1EAXA 4Y6DA 1MKXK 1TOMH 3Q3KA 1TIOA 1T8NA 4LXBH 3LU9B 2P95A 1S5SA 1HJ9A 3P8NA 3MNXA 2GGVB 3RM0H 4YLUA 4YOGA 1O2SA 4Y8XA 3NKKA 1YPLH 2BXUH 1SB1H 4UFGH 1GMHG 1TONA 4ISLA 2D1JA 5T6FA 4X8TH 2RA3A 2P3UB 1K1NA 1GMCG 3QZRA 3KQCA 2Z3DA 4X1RU 1SLXB 4DG4A 3U8OH 1L1GA 4F49A 2UWOA 2TGPZ 2Q6FA 2HPQH 1PQ8A 1KXAA 3SUEA 3SJKA 2A4QA 2BD9A 4NA7A 2AMQA 3BTTE 3TU7H 4TPYA 3A85A 1YPKH 5ABWA 3H5CB 3LC5A 1G9IE 1QY6A 4Y8ZA 3A89A 1GI9B 1O5EH 1QQUA 1O2QA 1FONA 3A86A 5EQSA 5FBEA 1AUTC 5DP7A 1J16A 4JMYA 3UY9A 1YGCH 5AFYH 2ZF0H 1HJ8A 1DWDH 5JBBS 1TLDA 1O31A 3LGVA 1JXPA 1FJSA 2Y5FA 1LQDB 2A7HA 2VGCC 1GG6C 2BD7A 4NGAH 2FOMB 3VB6A 3FP8E 1TPAE 3ATWA 3ZZ3A 1THSH 1TMUH 3UR6A 3BTME 2Z94A 5LGOA 1GJAB 1BTXA 4M7GA 3VB4A 5EXMA 1A4WH 3SU2A 4Y79A 1LKBA 3MFJA 4H42U 3RXAA 3U8TH 1V2MT 1EXFA 1ZSKA 1GHAF 4WVPE 3E0NB 2UWPA 1AKSA 4XBBA 1C5TA 1CA0C 1LHCH 1YPEH 3GCNA 3KF2A 3SU5A 2ZDLA 4FUFA 6CHAB 4XOJA 3QLPH 1QURH 4Y8YA 5E2OA 3ODFA 1SFIA 2AGGX 1WTGH 4I33A 1NRQH 4AFQA 1F0TA 2P93A 3KN2A 3TJUA 1O2TA 2R0KA 1C2FA 1E35B 1GI4A 1QBNA 1H1BA 1UTNA 1C4Y2 1O5AB 2J9NA 2ZPRA 2A7JA 1GDNA 2FOAA 2PSXA 1V2JT 1GJ4H 3U69H 3ZZ4A 4X8UH 1TRNA 2R9PA 3VGCB 4RKOB 4X2WA 4K69A 1ZTKA 3RXCA 1O3JA 1A7SA 1Y3XA 1DT2A 1J9CH 2WPJS 1W8BH 2BLVA 2JKHA 1ARCA 1EX3A 1MTVA 2XWAA 4WH6A 1KY9A 2BQWB 1HB0B 2ZQ2A 2Z9IA 1QJ1B 5FX6A 4MNVA 2FMJA 1C5PA 3Q3YA 1O2XA 4I32A 8LPRA 4NG9H 3B8JA 4KELA 3PB1E 2J94A 4Q80A 1DDJA 1HLTH 2ZU1A 1QRZA 4OGYA 1BT7A 1EJAA 4AFUA 1EOJA 2ZHWH 3M3TA 1BMMH 2NU2E 1XUKA 1GBMA 5ESBA 5LPRA 4ABBA 2NU0E 4WMEA 4CRDA 1EB1H 3SUGA 1MKXH 3EGKH 5AHGH 4X2YA 3QX5H 3SU4A 3ZV8A 3D49H 1LHDH 2ZU4A 4O3UA 1TAWA 2AIQA 1GGDC 3ZZ6A 4U01A 2XW9A 1IQIA 1O2WA 1UK4A 1GMDF 4ZXYH 1GI6A 2O8MA 1NROH 3PTBA 5EQQA 3TJNA 3GY5A 4DJZB 1SLVB 2ESTE 3E90B 4K3JA 3RXHA 4FU9A 1O2LA 4TPIZ 4CRGA 3MWIU 1N8OC 2WUCA 3I77A 3SGBE 2TGTA 1O39A 4A1TA 4A1XA 2XBVA 1CA8B 4ZMAH 1OWIA 3QK1A 2DUCA 2FOCA 1ZOMA 1C2IA 2HNTC 5B6OA 1GVZA 1O2NA 1V2KT 3BEUA 1BMLA 1BJVA 1G36A 2FYQA 1E0FD 4IBLH 1HJAB 1AU8A 1K1OA 1BTPA 2QXGA 1C2HA 1HJAC 1IQHA 1LQEA 1BHXF 1TX8A 1ESBA 1AN1E 1C2LA 4WY3A 4LOYH 3BSQA 4A6LA 4U32A 3RXUA 2OP9A 3DT0H 1CGIE 4A92A 1D3TB 1SGYE 2Y7ZA 3GY3A 1NESE 2KAIB 3F6UH 3K9XB 2BDHA 4IMZA 1P2OA 5DKMA 1V2VT 1UMAH 3M5MA 4ABEA 3SORA 1TGNA 1O3PB 1YBWA 3A8BA 1TMTH 1TGSZ 2Q1JA 1EAUA 3PLBA 2XBYA 3SJOA 1Y5BT 7KMEH 1VJAU 2BY7X 1TBRH 3RXGA 5K0HA 1GL1A 2EI6A 2WPKS 1THPB 1IQJA 2JETC 1FN8A 2PTNA 2ZFTA 3UOUA 1SMFE 4JYVH 1ESTA 1W0YH 3FZDA 4K2YA 3STIA 5GCHF 4LZ4B 1O2UA 3GDVA 1O38A 4ABDA 4ISIH 5FBIA 3FP6E 2K1QA 1AB9C 1GHZA 4NA8A 1NN6A 3LJJA 3A82A 1UTOA 4BTTB 2PUQH 1HIAA 1UTJA 1SGPE 3RXEA 2F9VA 3JZ1B 4AYVB 3AVZA 3ZVDA 1MH0A 1ZMLA 4AFSA 1HAXB 4B76A 1MTSA 4DT7B 1NFXA 1YCPM 1A0HB 4UE7H 2CV3A 3A7WA 1QTFA 1O33A 1Y5AT 5F8ZA 4E7NA 1JBUH 1QA0A 1QNJA 1EPTB 1ZR0A 1F0SA 1UHBA 2GT8A 4CRFA 1YLCA 4Z6AH 2SGEE 4WWYA 1BBRH 3A81A 3RXLA 1XUJA 1DUAA 1FN6A 4MVNA 2ZO3H 3UOPA 1C5YB 1Z6EA 1LPGB 2PLXA 1O37A 1FY4A 3UNSA 5GIBA 3DHKH 1GBIA 1T31A 1E38B 4XFQA 2R0LA 1O3IA 1CGJE 1O3AA 1MKWH 2Z9JA 3VB3A 1WSSH 5E0JA 1MCTA 2O8UA 5T6DA 3M61U 1XX9A 3M5NA 2SGDE 2BD5A 1GI7B 3ZZ5A 2EC9H 2GCHF 4O3TA 3ZV9A 5CHAB 1AZ8A 4ABIA 1K1IA 1CA0B 5JPMH 5AVDA 2XXLA 3RXVA 4CR5A 1GBJA 2SFAA 1NPMA 3UUZA 5IDKA 1C5RA 4BAHB 1C5OH 2ZPQA 5FHTA 1UTLM 3MH6A 3S0NA 4MPXA 1QB6A 1V2WT 2ANWA 1ID5H 1YCPK 3S9AA 5JB8S 1AO5A 2CGAA 4UEHH 1C1PA 1CT2E 1XXFA 2ZPSA 1LVBA 1AFQC 4IMQA 4QT8C 1SGRE 1P01A 1UK3A 3Q77A 9ESTA 1F92A 4FU8A 2GT7A 5A0CA 2G4TA 1ELDE 3T28A 1GL0E 2O9QA 2ZECA 4O03A 2BDYA 2TPIZ 5TCCA 4OS5A 2W3IA 2BD3A 2ZFQH 1O3KA 4H6SB 3A8CA 4PROA 2QGRA 3ZZBA 4AGJA 1E37B 4YLQH 5L30H 1RD3B 3TPIZ 4OS2A 1ABIH 3V7TA 2PUXB 2ZHQH 3EA8A 4FXGH 5HYOA 4I8GA 1BZXE 5EXNA 3ZVFA 1L1NA 1OYQA 1G3EA 2BZ6H 3AW0A 1KLTA 3AW1A 1DM4B 4YOIA 1WCZA 3KL6A 1GHVH 4YT7H 3TGJE 1P06A 2QN5T 4JZEH 1Y59T 1GJ9B 2PGBB 4CR9A 4CH2B 2QV1A 2OC0A 1EATA 1CHOG 1BTHH 3GCHB 1G32B 1V2ST 2UWLA 1DANH 2BY6X 1GJBB 1GBAA 5J4SA 5EPYA 2EA3A 5TJXA 1PPEE 3OSYA 4X1SU 1OWEA 1JIRA 4FUJA 1LVOA 1CT0E 2THFB 1TGBA 4I8KA 1BRUP 3A83A 1Z8GA 3MU5A 3VXFH 2ALVA 2GCHG 3W94A 1AVXA 7GCHG 3CS7A 4NIWA 3SU1A 3DA9B 3UNRA 1SGDE 1ANDA 1TE0A 1GI1A 5DP3A 2ANMH 1H8IH 1AIXH 1TGTA 1C2JA 1F5RA 1B5GH 2ZGJA 3R0FA 2XWBI 1C1TA 1X7AC 3SOSA 3TGKE 1ZPBA 1WYKA 1P10A 1AWFH 4CBOA 1WQSA 2PWXA 1HPGA 5GJ4B 3F9GA 1BBRK 1INCA 4ISOA 2BY5X 2Y6TA 4INLA 3M3VA 1V2UT 2NU1E 1PFXC 5F8XA 3P8FA 4CBNA 3OU0A 1O5DH 2CXVA 4GSOA 4I8JA 3RXOA 2FS8A 4SGAE 3F1SB 3EQ0H 2FOEA 1H8DH 1OYTH 1Z1JA 2WYJA 1O5BB 3MHWU 3JZ2B 3PWCA 3RU4E 2EI8A 3STJA 1GBBA 2IPHA 3NWUA 5FX5A 7ESTE 1AHTH 1BTYA 1C4V2 5I46H 3RXFA 4FUGA 1K21H 3ITIA 1M9UA 1CO7E 1D3DB 3LIWA 3TVJB 2FX4A 1TBQH 3SI4H 1GBTA 3ZZ9A 4ABGA 4BAOB 2ZEBA 4K60A 2HNTE 1C9TA 1J8AA 2ZDAH 2J4IA 1GPZA 1FZZA 4FVDA 3ZZAA 3BG4C 3SV8A 1NRSH 3GOVB 1BTUA 1SQTA 3MU0A 1OP8A 4R0IA 1HAVA 5GWZA 3UWJH 1CSOE 1GCDA 1P8VC 2FI4E 1YPJH 5T3HA 1K9OE 1MU8B 3DFJA 3TITA 1BUIA 3L3TA 2Y81A 5EQRA 2BOKA 1HAYB 2VB0A 1PPCE 1O3HA 1ZJDA 3PO1B 2ZTXA 4DURA 2FPZA 5C1XA 2JH0D 2FXRA 1J15A 4DGJA 4HTCH 1KXCA 2OBQA 4X8VH 4MPUA 5JDUB 1VCWA 1GDQA 1V6DA 1GCTC 1NFYA 1SGQE 2QXHA 2F9BH 1YPGH 1GI5A 1IHSH 1K28D 1TX6A 4ZXXH 2BDIA 5HM2A 4JYUH 1TQ0B 1S81A 2B0FA 2ZP0H 3IG6B 4MNWA 1TNLA 5JBAS 4ZROA 3TK6A 5GDSH 4IC5A 3MNCA 2PTCE 1O2PA 4WF8A 3SGQE 3E91A 4A1VA 1K1JA 3ATLA 1DE7H 3MU4A 5DJ7A 4ZKSU 1Q3XA 2CMYA 1Z8JB 1GBHA 1IQEA 3C27B 4K8YA 1QBVH 4TWWA 3RXPA 3BTDE 3TH4H 1Y8TA 1TPSA 4A5TS 3EAJA 1O3MA 4HFPB 4KTSA 4NSVA 1GJ5H 1O30A 2V0BA 2RCEA 3QGNB 1N8OB 3OTJE 1CU1A 1A5GH 2FI5E 5LH8A 4MDSA 4ZHMU 1NM6A 2BDGA 1AVGH 2F9NA 1G2LA 5HXFA 2D2DA 1MQ5A 3URDA 3M35A 1VZQH 3A84A 2NWNA 2H9EH 2Z6BD 4CREA 1SLWB 1TNGA 1SG8B 3GCTG 3S7HB 1QB1A 4AFZA 3KQBA 2W7UA 3K65B 1ZMJA 1ELGA 2FX6A 1MTNB 4TYDA 4B2AA 1D9IA 1O32A 5DG6A 4WMDA 3T27A 2QYIA 1S0RA 1ELAA 1F5LA 1BRAA 2G00A 3FVFB 3O8RA 4FUDA 2D8WA 1O3LA 3F9HA 1OP2A 1L4ZA 4NFFA 4CRAA 3SQEE 2VIWA 1P2QA 3ENSB 1OWJA 4X6MA 1CVWH 1L0ZA 1Y3YA 5C5OA 1RS0A 2PSYA 1EUFA 1RTKA 1C1SA 2B7DH 3BEFB 2PKSC 3RMOH 1J14A 2WPMS 1TPOA 2B8OH 1IQMA 1SBWA 1ZHPA 2W5EA 4GHQA 2IOTA 3A8DA 5GXPA 2VWMA 1YLDA 4DY7B 9LPRA 2QAAA 5C5NA 2ODQA 8KME2 4K1SA 3GCOA 4X2VA 1NZQH 1GHBG 1GJCB 2SNWA 2H6MA 2C8YB 1V2OT 1VGCB 3RUOA 4AN7A 1TB6H 1OOKB 4AZ2B 3A87A 5EG4A 1A5HA 2VU8E 3SGAE 4Y11E 1EOLA 2H5CA 2AMDA 4FUBA 4XBCA 1AFEH 4ISNA 3ZVCA 3P6ZB 5ETXA 3BG4B 4H4FA 1DITH 3GYLB 1TYNA 2BD2A 3M36A 6GCHG 1O5FH 1AD8H 2NU4E 1YPHC 4AG2A 1D6RA 2ZZUH 1SGTA 1V2LT 4HI3A 4E05H 1F7ZA 4ZAEA 1W12U 1KIGH 3SZNA 4MNXA 4BAKB 5FAHA 1W0ZU 5G4BA 1H9IE 1MCVA 2R3UA 5JBTA 2QY0B 1QFKH 1RFNA
chains in the Genus database with same CATH superfamily
4JZ1A 1XM1A 4RT0A 2BVSH 3V0XA 1C5UA 2BQ6B 2HLCA 3FANA 4YXWD 2ZIQH 1GBCA 4Y0ZE 2VH0A 1FAXA 3GCTF 3AAUA 5EIYA 1MTUA 1GBFA 3OYPA 1AE8H 1YM0A 1JOUB 1OS8A 4B71A 4BXSA 3M5OA 3BTEE 3RDZA 1T7CA 1FI8A 1PQ7A 2VWOA 1O2ZA 1P12E 1WQVH 1TMBH 2G51A 4XD7D 1TNIA 1C2EA 2ZCLP 1C5WB 1J17T 2O8LA 2GZ7A 1KXBA 2H9HA 1QR3E 3HK3B 2IN2A 4KKDA 1O36A 1QL7A 3MO9A 3RC6A 1UCYK 1NTPA 1TRMA 4Q7ZA 3UQOA 4RT1A 3VGCC 4JYTA 2A2QH 1C4U2 1LMWB 5JBCS 1PQAA 1RXPA 3P95A 1FY8E 1P02A 2ZFRH 4VGCC 5JYIA 2HALA 2ZHFH 3LJOA 5HGGA 2G4UA 3HGNA 2J97A 4GPGA 2UUFB 1H8HD 1V2QT 3ESTA 4FU7A 5L6NH 1DY8A 4JZDH 3UWIA 1O3DA 4O97A 3KNXA 2GMTC 1OXGA 1DLEA 2AMPA 2Y5HA 1TQ7B 2FLRH 4BAMB 1O0DH 1DXWA 1U6QA 1XUFA 3E16B 4AC9A 1SI5H 3MOCA 1ELVA 2R3YA 4IN1A 4CH8B 1ORFA 2Y80A 2ZGCA 3H7OA 4X6PA 4JCNA 1YCPH 2G81E 2WPLS 3EA9A 2VIDA 3M7QA 4IS5A 4BANB 1E36B 1C1WH 2KCAA 1FPCH 2GCTC 1NRRH 1O34A 4DIIH 2JH5D 1A3BH 1Q31A 2SGQE 1UO6A 3S9CA 1UHBB 1LKAA 2CHAB 2RA0A 1AGJA 2YOLA 4YESB 5K7RA 3ZVGA 1Q2WA 3KHVA 5E0HA 1YF4A 1Z6JH 4Q7XA 2GX4A 1P9SA 3EA7A 5HM9A 4ZHLU 5C67A 4LK4A 5E8EH 2V3HH 4NZQA 3QUMP 2M5TA 3UR9A 2ALPA 1TNKA 1W11U 1Y3UA 2QIQA 1XKAC 2F4LA 3PYHA 3A7XA 3LOXA 1EZUC 1C5VA 4BTIB 2VIQA 2ULLA 8GCHF 1LVYA 2P16A 2BY8X 1BRCE 2OC8A 1T32A 1W7GH 1ZZZA 3UNQA 4Y10E 4B75A 4ZUHA 2BLQA 3IWMA 3BEIB 3SUFA 3SHAH 3LGTA 4FVBA 1SSXA 4YZUA 5FPYA 2IJOB 2KR7A 3QDZB 1A5IA 5DGJA 3MH5A 3UAIC 2HVXA 3NUMA 3ELAH 1SL3A 1QL8A 3DSPA 3OY6U 1KXEA 1T8MA 2TBSA 5L2ZH 4NSYA 4UFDH 4F55A 1NU9A 1GBKA 4OM9A 1SGIB 1T8LA 3O8CA 1BCUH 2FOBA 5EJ1A 4MPVA 2QE7D 2BYAX 3PMBB 3DD2H 3U28C 1B7XB 1UVUH 1GI8B 3K6ZA 2LELA 4U30A 1C1QA 3A7YA 5FPTA 1N6YA 3D65E 4OS1A 2VGCB 1LPZB 3KQDA 3L33A 2GD4B 1TGCA 4U2WA 2AGIX 2P59A 1S6LA 2BXTH 2FOHA 1AMHA 2FEQH 2GZ9A 3SV7A 2W3KA 5HIZA 1S84A 1NS3A 3MQKC 1FY5A 4X1QU 2B5TB 1HRTH 1CBWC 3L6PA 4IN2A 2W26A 5I25A 1FDPA 1O3NA 3O8BA 3BG8A 3MO6A 4HGCA 3KQ5A 1O3EA 3FZZA 3M7TA 2C4FH 1MBMA 6CHAC 1EZXC 2SGAA 3A88A 1AUJA 3NXPA 1DWBH 3PV5A 5F8TA 1WUNH 1KSNA 2FODA 5T1VA 4HZHA 2J5UA 3PM3A 2XOKD 2ZHEH 4X6NA 1GJ8B 2AH4X 3M3SA 3LH3A 1PYTC 3NPSA 3ZZCA 1VITH 4H6TA 1BMNH 4WMFA 2UUJB 3VPKA 4VGCB 4O9VA 2ZWLH 3GCHC 3RU4T 1ZPCA 1DWEH 1BITA 3SZEA 4ZKOU 2VINA 3A7VA 1O2KA 4GCHG 5PTPA 6LPRA 3TH3H 1GBDA 2Z9LA 3HKJB 1RTLA 3N7EA 5AF9H 1VCQA 1VITF 3D23A 5FPSA 4NWKA 2STAE 2J2UA 3T29A 5DP6A 1PPZA 1VJ9U 1PPBH 2CJIA 1H9HE 2LNCA 2OC1A 5LPEA 1SGNE 1FIWA 1LDTT 1QQ4A 1UVSH 2ZFSA 2FS9A 4AORA 1SOTA 4K5ZA 1ELBA 3ZYEA 2C8WB 1RIWC 1A46H 5KECA 2ANKH 3QTVH 1C1VH 1FX0B 2NU3E 1Y5UT 2ASUB 3Q00A 2PGQB 1F5KU 1P2IA 1QZ8A 2O8TA 2CN0H 4DT4A 3RXMA 1GGDB 2QF0A 1KXDA 4AGKA 4ABFA 3LC3A 2SNVA 1P03A 1BDAA 1LHGH 2BDCA 4MG3A 1JMOH 2TGAA 1P2MA 2KCPA 2PR3A 1SGEE 2XBWA 1P2KA 2F91A 2OUAA 3TLOA 1C5QA 1B0FA 1GJ6A 2VVVA 1IHTH 3EDXB 1G3BA 5DP5A 2WZQA 2JETB 1LVMA 3PMJA 3N7DA 1MZAA 2HOBA 1HUTH 1EASA 3ZYDA 2G5NA 5H4IB 3FP7E 3LGWA 2V6NA 2BLOA 2EEKA 2ZDNA 3MO3A 2FLBH 2JH6D 3LT3A 5FCRA 3URCA 1FY1A 2R2MB 1QIXB 4Q2KA 3P70B 1PYTD 3BIUH 4XDEA 5B6LA 3RMNH 3RXRA 3RU4D 1XKBC 1ANCA 1ACBE 1W0KD 1C5ZB 1LPKB 4TY7A 1MKWK 1QL9A 4XSKU 1G3CA 3V12A 1P3EA 1O2OA 1A61H 2OCVB 3S9BA 3QZQA 2FOGA 5EW1H 1O2RA 4ESTE 1TFXA 3UPEA 4DCDA 1E34B 3PV2A 2KCOA 3RMMH 3SYJA 1MMJN 2C8ZB 1O5CB 3CP7A 5GPIB 1HCGA 2CF9H 4FUCA 2BB4A 5DP8A 3SNAA 3UREA 3WW7A 3EYDA 3SJ9A 5BRRE 1OP0A 2ZC9H 3O8DA 1MU6B 1O2GH 1GBEA 4X8SH 1OWHA 1VITG 2FYRA 2PV9B 2PKAB 1KDQA 1CGHA 1PJPA 1AB9B 3LONA 1NRNH 4INKA 4K1EA 3NZIA 2WPIS 5EGMA 5TCAA 1S82A 1EP5A 3SQHE 4KGAA 3K2UA 1CHOF 1HXFH 1S83A 4UFEH 3S7KB 4P00A 1W14U 1FV9A 1O2HA 1Z8RA 1HBTH 1TRYA 3M37A 1C5MD 3HKIB 1UCYE 5DPAA 1K22H 1NY22 1O5GH 3SN8A 2ZFFH 1GMHF 3P8GA 2GP9B 2XC0A 7GCHF 1KTTB 1DY9A 2A7CA 2XC5A 1EB2A 1GMCF 2OINA 3TIUA 4NZLA 1WOFA 3ATMA 3KYGA 1XUGA 2ZGBH 3T62A 1MD7A 5EW2H 4YTAA 1ZGIA 4Y71A 3TNSA 1GHBF 3ODDA 1W3CA 5EXLA 2RG3A 2BM2A 5EU8A 3SNCA 1ETRH 3HATH 3LGIA 2DE9A 5EPNA 5GNDA 1AWHB 4TSFD 1MAXA 2ODPA 1P11E 1ZRBA 4ZH8A 5A8ZA 2AGEX 4ASHA 2LPRA 3GDUA 4E06H 2QXIA 1FMGA 3ZVBA 2BY9X 5E2PA 1DVAH 1AY6H 1DSUA 1EZSC 1HAOH 2Q6DA 3PMHB 3SUDA 4JK6A 5IK2D 3NK8A 2FTLE 1NRPH 1RJXB 1C1OA 2VWNA 1RIWB 1TBZH 2ZFPH 1IQFA 1C1UH 1CT4E 1WV7H 1LHEH 3F9EA 4D8NA 3E8LA 4FUIA 3MU1A 2P3TB 3RXIA 1P2JA 2YNBA 1EKBB 2Z7FE 3MNSA 3V3MA 1W7XH 3RLWH 1BTZA 3IITA 1SVPA 1TPPA 2GJGA 3B9FH 4GLYA 2WUBA 3UFAA 5F03A 3SHCH 1AKSB 1V2PT 1IQKA 4OGXA 3LKWA 1ZRKA 2F3CE 2BMGB 1SPJA 3FAOA 1PPHE 1QJ7B 2FM2A 1D3PB 2P8OC 2A5AA 2R2WU 1TWXB 2VIVA 5FXLA 4F48B 2A4GA 3SNEA 3DSGA 4MQAA 4MTBA 2A0QB 7LPRA 1GHXH 2FDAA 1C5SA 1HAZB 1PQ5A 1WBGB 2ILNA 4UFFH 5EJZA 1YPHE 1NFWA 1O3GA 4I7YH 3F2HA 2W7SA 4A7IB 2ZCKP 3PV4A 1P05A 3D62A 4X1PU 5ESTE 2ANYA 3PTNA 1K1PA 3TNTA 1T4UH 5CDFE 1GBLA 2WV5A 1C1NA 3QN7A 2J92A 8ESTE 2C8XB 2ZU2A 3OY5U 2H2ZA 1ETSH 5T6GA 3GYMA 2Z3CA 1O2JA 3OX7U 1D3QB 2PHBA 2V3OH 2Y82A 2IPQX 2HNTF 1BMFD 2CF8H 1C2MA 1HV7A 1HNEE 3P17H 4K8BA 1G2MA 1IQGA 1LCYA 4GHTA 1EPTC 1HXEH 4LZ1H 4AB9A 1ABJH 1C5XB 1V2TT 2Z9GA 1ELCA 2H9TH 1K2I1 4MPWA 3HK6B 1O2IA 1VCPA 2XTTB 5A0AE 2ZHDA 1DFPA 3PMAB 1IOEA 1AVWA 1L1JA 1QRXA 4X1NU 3SU6A 3GS9A 1SHHB 1G37A 5C1UA 2JJ2D 1OWKA 2F9PA 1VR1H 1ARBA 3LGYA 3U1JB 4K1TA 3AK5A 3DCLA 1Z8IB 1FNIA 1S85A 1ZHRA 5C20A 3N7OA 2ZI2H 5EOKA 1UTMA 3Q3XA 1MZDA 2BX4A 1GJ7B 1KXFA 3N99A 1BTWA 4B2CA 4YOJA 5A09A 1EP6A 1UTKA 1C2DA 5C94A 1OX1A 3W95A 4NIXA 3UTUH 4KTUA 1C5LH 4Q7YA 1HIAB 1SLUB 2G5VA 1BBRE 1FAKH 4WJG2 2FP7B 5CHBA 2P8OB 1BOQA 2GDEH 3ZZ7A 3PROA 1THRH 3SJIA 1EPTA 3LDXH 2GMTB 4TY6A 5C1YA 3BTKE 1CHGA 3E0PB 2QC2A 3GY2A 1ZSLA 3TJVA 3GY4A 1WXRA 4FUHA 2XYAA 1GI0A 1A1RA 2F9UA 3A80A 4NIVA 1KTSB 2BLWA 2AIPA 1ESAA 1TA2A 1AFQB 1C1RA 1F0RA 2H5DA 1EAIA 3H7TA 2A1DB 1K1MA 2LP6A 1SGFA 3MH4A 1C1MA 3T25A 3V13A 4B1TA 4I31A 2C90B 1IQLA 1NFUA 2A32A 2G55A 2QA9E 2VH6A 4I8HA 1EJNA 4BAQB 2VWLA 5HMAA 4DOQA 1ZHMA 2BD8A 2W6ID 2A31A 1GJDB 2A45B 4D9QA 1W10U 4D9RA 1BHXB 1GHWH 1SC8U 1Y3WA 2Q6GA 5LPFA 3SV6A 2OXSA 2WSSD 3KQEA 1FPHH 3GY7A 2K8IA 2J34A 4B74A 3KCGH 3BTWE 1O3BA 3CENA 1UVTH 4I86A 4TT3D 3ZVAA 1NC6A 4D7GA 1ZYOA 3UQVA 2QCYA 5C2ZA 2QF3A 2ZG0H 2GV6A 1RGQA 2ZCHP 1GI3A 4WXIA 2P94A 5A8YA 2A4RA 4IW4E 1OWDA 1YYY1 3RXQA 2XBXA 2VIOA 1C2KA 4NFEA 2EI7A 1ZPZA 2G8TA 4ACAA 2ZDMA 3RP2A 2FWWA 1DUEA 1FY3A 3RMLH 2A4OA 3VEQB 1Y3VA 5DP4A 4BNRA 1OSSA 1RTFB 4BTUB 4Y0YE 2A2XH 3SO3A 3M7UA 2OBOA 3TGIE 2ZQ1A 1O2YA 2WV9A 1SFQB 1P0SH 5FCKA 1JIMA 3KEEA 2RDLA 3LGUA 4JK5A 4B2BA 1MQ6A 3VG8A 1ZTLA 1XUIA 1ZJKA 4AX9H 4Y76A 1G30B 4UDWH 4RSPA 2GV7A 3TK5A 2VIPA 3MTYA 1CQQA 1C2GA 3RXDA 3FFGA 2AFQB 2HLDD 3SU3A 3VFEA 4INHA 4NWLA 1DS2E 5DN6D 1O3CA 1HAHH 2VVUA 1ELFA 1EQ9A 2J38A 1O2MA 3G01A 1AQ7A 2XCNA 1FXYA 4ZCNA 1ZLRA 2OC7A 3PRDA 3AAVA 2VBCA 1ELTA 1TNJA 4DVAU 3SJ8A 3ZIAD 1BIOA 1TOCB 1TX7A 3MYWA 1QB9A 1D4PB 4Y7AA 4J2YB 3FO8D 2XC4A 2ZDVH 2ZNKH 3SV2H 4TWYA 3S69A 1BA8B 2TIOA 3T26A 1LO6A 1SQAA 3ZZDA 1ANEA 1DXPA 4F4OC 4ASUD 2Z9KA 2BDBA 2GZ8A 3A7ZA 4ZKRU 4XE4A 2CK3D 3MH7A 1AI8H 2A5KA 4D7FA 4ZKNU 5C3NA 3SNBA 4JZFH 1P2NA 2G52A 1C9PA 1GHYH 2H1UA 1VGCC 2AS9A 1P04A 2I6QA 2VNTA 4OS6A 3EE0B 3E1XB 2J95A 3UIRA 1Z1IA 1O3FA 3GDSA 4CHAB 1TALA 4GVUA 1DWCH 1P3CA 1TA6A 2BD4A 2FO9A 3BTGE 4R8TB 3DFLA 3PLPA 1UK2A 1V3XA 3VB5A 5F6MA 3VXEH 1P09A 2GKVE 2QXJA 3SNDA 1GI2A 1JRSA 3RLYH 1NT1A 1N1LA 1MTWA 2BDAA 3MU8A 2IJD1 2BTCE 4CRBA 5DP9A 2OTVA 3SW2B 3SV9A 1GMDG 2OD3B 3A8AA 1UCYH 1FIZA 3M5LA 4WH8A 2BHGA 1SOZA 2BZAA 2FIRH 3QWCH 2ZU3A 1UJ1A 2SGPE 1HAVB 2EQNA 3LPRA 2F9OA 3QTOH 1F0UA 5IYTA 4AOQA 1GVKB 4MLFB 3E6PH 2C93B 2ZTYA 2AEIH 8GCHG 2HRVA 3A7TA 2JIZD 2C3SA 2QF4A 3BIVH 1F2SE 1HAPH 4ABJA 1L4DA 4BXWA 3PRBA 3MI4A 3RXSA 3RM2H 4ZHAA 1SR5C 1TABE 1QGFA 1HAGE 3PWBA 1FUJA 4YT6H 1A2CH 2ZGHA 1DSTA 1C5NH 3WY8A 2BQ7B 2FOFA 1HYLA 4J1YA 4XBDA 2WINI 2YNAA 4RN6A 4DIHH 1L2EA 1JWTA 1ZSJA 4HG6A 1MD8A 1Z7KA 1MUEB 1O35A 1AZZA 1V2RT 4AB8A 1XXDA 5DK1A 1P57B 1Z71A 4E7RG 3U1IB 2PW8H 2BOHB 1DOJA 3MMGA 3FKSD 2UUKB 1O2VA 1QRWA 3BTFE 1CE5A 1ZGVA 4NA9H 5JB9S 2M2AA 1EAWA 1GVLA 1GG6B 3F2FA 2BVXH 1V2NT 3GICB 1XVOA 3SI3H 1BQYA 2I6SA 3BTHE 2KCYA 1GDUA 4NCYA 2F83A 2PKAA 4Z0KA 5GCHG 2OQUA 1GCTB 3FN8A 3SU0A 4WXVA 2ZGXH 2P3FH 2PKSB 4RKJB 3GY6A 1DLKB 1B0EA 1YC0A 1LTOA 1DX5M 1UVOA 3F9FA 4MNYA 4KTCA 2ZU5A 3OE7D 2A5IA 3BTQE 1A3EH 2ZTZA 5A2MH 2SGFE 1E1RD 3U98H 1RRKA 5A8XA 1BB0B 1TNHA 3OEHD 2V35A 4UONA 1EJMA 1WAYB 4GAWA 1S0QA 1DPOA 1GWAA 3GISB 1KLIH 4GCHF 2XNDD 5DO4H 2HWLB 3HGPA 3TJOA 2STBE 1UVPA 1YP9A 2D26C 2XNIA 2UUYA 1HAIH 1NU7B 1P9UA 3U9AH 5CHAC 4FUEA 2VVCA 1EZQA 5A0BA 2OLGA 1KYNA 2GTBA 3RXKA 3WWBA 3QO6A 2HGTH 4AG1A 1UTQA 5E0GA 3RC5A 3SBKA 1JRTA 2BX3A 4ABHA 1ELEE 2B9LA 1MTNC 1XMNB 3E3TA 3F68H 1FLEE 3T2NA 3MNBA 3P92A 4CHAC 1D6WA 1W13U 3I29A 1QHRB 1KDQB 1QCPA 4X0WU 2CHAC 3W1EA 3ATIA 1A0JA 3Q76A 3PO1C 1WU1A 1ANBA 1HGTH 2ZDKA 5J4QA 3QGJA 1BJUA 4ISHH 3KIDU 2GVFA 3R3GB 3TK9A 3B23B 3AASA 1PPFE 1QJ6B 1ZTJA 1S6HA 2GDDA 3NCLA 2FZZA 1QA7A 1H9LB 1IQNA 4JZIA 3PLKA 1MBQA 4D76A 1W2KH 4M9FA 2ZA5A 1MAYA 1ZMNA 3RXTA 1ETTH 3RXJA 1HDTH 2PP6A 1WTHD 3TH2H 2OQ5A 1XVMA 3RXBA 3LH1A 1UTPA 1HFDA 3T5FH 2TGDA 2O8WA 5SGAE 4X6OA 4OS4A 1PPGE 3ZVEA 1O3OA 2ZKSA 3HPTB 3OTPA 1LHFH 2WPHS 5L2YH 2W6JD 3C1KA 4THNH 5BPEA 2Z3EA 1S6FA 2Y5GA 4IGDA 4DW2U 4GUXA 2ODYB 2WYGA 1N6XA 2AYWA 3U8RH 1NO9H 3ATKA 1K1LA 3EE7A 1BMAA 2WV4A 4I8LA 2AERH 6ESTA 2KAIA 5CE1A 1OPHB 1CBWB 2FESH 6GCHF 2VJ1A 2HPPH 4KP0A 1IAUA 3P8OA 2PFEA 4Y7BA 4AYYB 4SGBE 1AE5A 1KLJH 2BVRH 1OKXA 1NBME 2XCFA 2FTMA 4CRCA 3BN9A 4NIYA 4B73A 2TRMA 3BV9B 1SHYA 1SQOA 1XUHA 3DUXH 3VB7A 3BF6H 3GY8A 4B6FA 1YPMH 1SGFG 4BOHA 2FI3E 4IC6A 4YM9A 1E79D 4OS7A 5CMXH 1T4VH 2XRCA 1BRBE 1FQ3A 3KGPA 1SGCA 1H4WA 1G3DA 2Y7XA 5AFZH 3RC4A 4X2XA 1QBOA 1T8OA 4ABAA 3CS0A 1GHAG 3K6YA 2DE8A 3I78A 1YKTA 1A0LA 2GCTB 4YO9A 1DICA 3ZZ8A 5EODA 4UD9H 1EAXA 4Y6DA 1MKXK 2V3MA 1TOMH 3Q3KA 1TIOA 1YY3A 1T8NA 4LXBH 3LU9B 2P95A 1S5SA 1HJ9A 3P8NA 3MNXA 2GGVB 3RM0H 4YLUA 4YOGA 1O2SA 4Y8XA 3NKKA 1YPLH 3CNRA 2BXUH 1SB1H 4UFGH 1GMHG 1TONA 4ISLA 2D1JA 5T6FA 4X8TH 3DSOA 2RA3A 2P3UB 1K1NA 1GMCG 3QZRA 3KQCA 2Z3DA 4X1RU 1SLXB 4DG4A 3U8OH 1L1GA 4F49A 2UWOA 2TGPZ 2Q6FA 2HPQH 1PQ8A 1KXAA 4FOUC 3SUEA 3SJKA 2A4QA 2BD9A 1MABB 4NA7A 2AMQA 3BTTE 3TU7H 4TPYA 3A85A 2V7QD 1YPKH 5ABWA 2QF5A 3H5CB 3LC5A 1G9IE 1QY6A 4Y8ZA 3A89A 1GI9B 1O5EH 1QQUA 1O2QA 1FONA 3A86A 5EQSA 5FBEA 1AUTC 5DP7A 1J16A 4JMYA 3UY9A 5EJLA 1YGCH 1VKYA 5AFYH 2ZF0H 1HJ8A 1DWDH 3OFND 1TLDA 1O31A 3LGVA 5JBBS 1JXPA 1FJSA 2Y5FA 1LQDB 2A7HA 2VGCC 1GG6C 2BD7A 4NGAH 2FOMB 3VB6A 3FP8E 1TPAE 3ATWA 3ZZ3A 1THSH 5HKKD 1TMUH 3UR6A 3BTME 2Z94A 5LGOA 1GJAB 1BTXA 4M7GA 3VB4A 5EXMA 1A4WH 3SU2A 4Y79A 1LKBA 3MFJA 4H42U 3RXAA 3U8TH 1V2MT 1EXFA 1ZSKA 1GHAF 4WVPE 3E0NB 2UWPA 1AKSA 4XBBA 1C5TA 1CA0C 1LHCH 1YPEH 3GCNA 3KF2A 5F53A 3SU5A 2ZDLA 4FUFA 6CHAB 4XOJA 3QLPH 1QURH 4Y8YA 5E2OA 3ODFA 1SFIA 2AGGX 1WTGH 4I33A 1NRQH 4AFQA 1F0TA 2P93A 3KN2A 3TJUA 1O2TA 2R0KA 1C2FA 3NRLA 1E35B 1GI4A 1QBNA 1H1BA 1UTNA 5C0TA 1C4Y2 1O5AB 2J9NA 2ZPRA 2KM0A 2A7JA 1GDNA 2FOAA 2PSXA 1V2JT 1GJ4H 2AHME 3U69H 1H8ED 5KGOA 3ZZ4A 4X8UH 1TRNA 2R9PA 3VGCB 4RKOB 4X2WA 4K69A 1ZTKA 3RXCA 1O3JA 1NBMD 1A7SA 1Y3XA 1DT2A 1J9CH 2WPJS 2YMSD 1W8BH 2BLVA 2JKHA 1ARCA 1EX3A 1MTVA 2XWAA 3OEED 1KY9A 4WH6A 2BQWB 1HB0B 2ZQ2A 2Z9IA 1QJ1B 5FX6A 2KZ4A 4MNVA 2FMJA 1C5PA 3Q3YA 1O2XA 4I32A 8LPRA 4NG9H 3B8JA 4KELA 3PB1E 2F43B 2J94A 4Q80A 1DDJA 1HLTH 2ZU1A 1QRZA 4OGYA 1BT7A 1EJAA 4AFUA 1EOJA 2ZHWH 3M3TA 1BMMH 2NU2E 1XUKA 1GBMA 5ESBA 5LPRA 4ABBA 2NU0E 4WMEA 4CRDA 1EB1H 3SUGA 1MKXH 3EGKH 5AHGH 4X2YA 3QX5H 3SU4A 3ZV8A 3D49H 1LHDH 1COWD 2ZU4A 4O3UA 1TAWA 2AIQA 1GGDC 3ZZ6A 4U01A 2XW9A 3KYFA 1IQIA 1O2WA 1UK4A 3F2GA 1GMDF 4ZXYH 1GI6A 2O8MA 1NROH 3PTBA 5EQQA 3TJNA 3GY5A 5C0UA 4DJZB 1SLVB 2ESTE 3E90B 4K3JA 3RXHA 4FU9A 1O2LA 4TPIZ 4CRGA 3MWIU 1N8OC 2WUCA 3I77A 3SGBE 2TGTA 1O39A 4A1TA 4A1XA 2XBVA 1CA8B 4ZMAH 1OWIA 3QK1A 2DUCA 2FOCA 1ZOMA 1C2IA 2HNTC 5B6OA 1GVZA 1O2NA 1V2KT 3BEUA 1BMLA 1BJVA 1G36A 2FYQA 1E0FD 4IBLH 1HJAB 2J98B 1AU8A 1K1OA 1BTPA 2QXGA 1C2HA 1HJAC 1IQHA 1LQEA 1BHXF 1TX8A 1ESBA 2OK5A 1AN1E 1C2LA 4WY3A 4LOYH 3BSQA 4A6LA 4U32A 3RXUA 2OP9A 3DT0H 1CGIE 4A92A 1D3TB 1SGYE 2Y7ZA 3GY3A 1NESE 2KAIB 5KEDA 3F6UH 2L6OA 3K9XB 2WHXA 2BDHA 4IMZA 1P2OA 5DKMA 1V2VT 1K0HA 1UMAH 3M5MA 4ABEA 3SORA 1TGNA 1O3PB 1YBWA 3A8BA 1TMTH 1TGSZ 2Q1JA 1EAUA 3PLBA 2XBYA 3SJOA 1Y5BT 7KMEH 1VJAU 2BY7X 1TBRH 3RXGA 5K0HA 1GL1A 2EI6A 2WPKS 1THPB 1IQJA 2JETC 1FN8A 2PTNA 2ZFTA 5HIYA 3UOUA 3WWFA 1SMFE 4JYVH 1ESTA 1W0YH 3FZDA 4K2YA 3STIA 5GCHF 4LZ4B 1O2UA 3GDVA 1O38A 4ABDA 4ISIH 5FBIA 3FP6E 2K1QA 1AB9C 1GHZA 4NA8A 1NN6A 3LJJA 3A82A 1UTOA 3F3BA 4BTTB 2PUQH 1HIAA 1UTJA 1SGPE 3RXEA 2F9VA 3JZ1B 4AYVB 3AVZA 3ZVDA 1MH0A 1ZMLA 4AFSA 1HAXB 4B76A 1MTSA 4DT7B 1NFXA 1YCPM 1A0HB 4UE7H 2CV3A 3A7WA 1QTFA 1O33A 1Y5AT 5F8ZA 4E7NA 1W0JD 1JBUH 1QA0A 1QNJA 1EPTB 1ZR0A 1F0SA 1UHBA 2GT8A 4CRFA 1YLCA 4Z6AH 2SGEE 4WWYA 1BBRH 3A81A 3RXLA 1XUJA 1DUAA 1FN6A 4MVNA 2ZO3H 3UOPA 1C5YB 1Z6EA 1LPGB 2PLXA 1O37A 1FY4A 3UNSA 5GIBA 3DHKH 1GBIA 1T31A 1E38B 4XFQA 2R0LA 1O3IA 1CGJE 1O3AA 1MKWH 2Z9JA 3VB3A 1WSSH 5E0JA 1MCTA 2O8UA 5T6DA 2HVYB 3M61U 1XX9A 3M5NA 2SGDE 2BD5A 1GI7B 3ZZ5A 2EC9H 2GCHF 4O3TA 3ZV9A 5CHAB 1AZ8A 4ABIA 1K1IA 1CA0B 5JPMH 5AVDA 2J98A 2XXLA 3RXVA 4CR5A 2KFWA 1GBJA 2SFAA 1NPMA 3UUZA 5IDKA 1C5RA 5DSFA 4BAHB 1C5OH 2ZPQA 5FHTA 2L74A 1UTLM 3MH6A 3S0NA 4MPXA 1QB6A 1V2WT 2ANWA 1ID5H 1YCPK 3S9AA 5JB8S 1AO5A 2CGAA 4UEHH 1C1PA 1CT2E 1XXFA 2ZPSA 1LVBA 1AFQC 4IMQA 1KMHB 4QT8C 1SGRE 1P01A 1YWUA 1UK3A 3Q77A 9ESTA 1F92A 4FU8A 2GT7A 1SKYE 5A0CA 2G4TA 1ELDE 3T28A 1GL0E 2O9QA 2ZECA 4O03A 2BDYA 2TPIZ 5TCCA 4OS5A 2W3IA 2BD3A 2ZFQH 1O3KA 4H6SB 3A8CA 4PROA 2QGRA 3ZZBA 4AGJA 1E37B 4YLQH 5L30H 3OAAD 1RD3B 3TPIZ 4OS2A 1ABIH 3V7TA 2PUXB 2ZHQH 3EA8A 4FXGH 5HYOA 4I8GA 1BZXE 5EXNA 3ZVFA 1L1NA 1OYQA 1G3EA 2BZ6H 3AW0A 1KLTA 3AW1A 1DM4B 4YOIA 1WCZA 3KL6A 1GHVH 4YT7H 3TGJE 1P06A 2QN5T 4JZEH 1Y59T 2WPDD 1GJ9B 2PGBB 4CR9A 4CH2B 2QV1A 2OC0A 1EATA 1CHOG 1BTHH 3GCHB 1G32B 1V2ST 2UWLA 1DANH 2BY6X 1GJBB 1GBAA 5J4SA 5EPYA 2EA3A 5TJXA 1PPEE 3OSYA 4X1SU 2RDEA 1OWEA 1JIRA 4FUJA 1LVOA 1CT0E 2THFB 1TGBA 4I8KA 1BRUP 3A83A 1Z8GA 3MU5A 3VXFH 2ALVA 2GCHG 3W94A 1AVXA 4XRNA 3CS7A 4NIWA 3SU1A 3DA9B 7GCHG 1E1QD 3UNRA 1SGDE 1ANDA 4FETA 1TE0A 4Q4LA 1GI1A 5DP3A 4Z1MD 2ANMH 1H8IH 1AIXH 1TGTA 2JJ1D 1C2JA 1F5RA 1B5GH 2ZGJA 3F0PA 3R0FA 2XWBI 1C1TA 1X7AC 3SOSA 3TGKE 1ZPBA 1WYKA 1P10A 1AWFH 4CBOA 1WQSA 2PWXA 1HPGA 5GJ4B 3F9GA 5C17A 1BBRK 1INCA 4ISOA 2BY5X 2Y6TA 4INLA 3M3VA 1V2UT 1WDIA 2NU1E 1PFXC 5F8XA 3P8FA 4CBNA 3OU0A 1O5DH 2CXVA 4GSOA 4I8JA 3RXOA 2FS8A 4SGAE 3F1SB 3EQ0H 2FOEA 1H8DH 1OYTH 1Z1JA 2WYJA 1O5BB 3MHWU 3JZ2B 3PWCA 3RU4E 2EI8A 3STJA 1GBBA 2IPHA 3NWUA 5FX5A 7ESTE 1AHTH 1BTYA 1C4V2 5I46H 3RXFA 4FUGA 1K21H 3ITIA 1M9UA 1CO7E 1D3DB 3LIWA 3TVJB 2FX4A 1TBQH 3SI4H 1GBTA 3ZZ9A 4ABGA 4BAOB 2ZEBA 4K60A 2HNTE 1C9TA 1J8AA 2ZDAH 2J4IA 1GPZA 1FZZA 4FVDA 3ZZAA 3BG4C 3SV8A 1NRSH 3GOVB 1BTUA 1SQTA 3MU0A 1OP8A 4R0IA 1HAVA 5GWZA 3UWJH 1CSOE 1GCDA 1P8VC 2FI4E 1YPJH 5T3HA 1K9OE 1MU8B 3DFJA 3TITA 1BUIA 4B6EA 3L3TA 2Y81A 5EQRA 2BOKA 1HAYB 1OHHD 2VB0A 1PPCE 1O3HA 1ZJDA 3PO1B 2ZTXA 2KX4A 4DURA 2FPZA 5C1XA 2JH0D 2FXRA 1J15A 4DGJA 4HTCH 1KXCA 2OBQA 4X8VH 4MPUA 5JDUB 1VCWA 1GDQA 1V6DA 1GCTC 1NFYA 1SGQE 2QXHA 2F9BH 1YPGH 1GI5A 1IHSH 1K28D 1TX6A 4ZXXH 2BDIA 5HM2A 4JYUH 1TQ0B 1S81A 2B0FA 4P02A 2ZP0H 3IG6B 4MNWA 1TNLA 5JBAS 4ZROA 3TK6A 1UW7A 5GDSH 4IC5A 3MNCA 2PTCE 1O2PA 4WF8A 3SGQE 3E91A 4A1VA 1K1JA 3ATLA 4Q63A 1DE7H 2EY4C 3MU4A 5DJ7A 4ZKSU 1Q3XA 2CMYA 1Z8JB 1GBHA 1IQEA 3C27B 3F0OA 1QBVH 4K8YA 4TWWA 3RXPA 3UB0A 3BTDE 3TH4H 3H09A 1Y8TA 1TPSA 2K0QA 4A5TS 3EAJA 1O3MA 4HFPB 4KTSA 4NSVA 1GJ5H 1O30A 2V0BA 2RCEA 3QGNB 1N8OB 3OTJE 1CU1A 1A5GH 5FL7D 2FI5E 5LH8A 4MDSA 4ZHMU 1NM6A 2BDGA 1AVGH 2F9NA 1G2LA 5HXFA 2D2DA 1MQ5A 3URDA 3M35A 1VZQH 3A84A 2NWNA 2H9EH 2Z6BD 4CREA 1SLWB 1TNGA 1SG8B 3GCTG 3S7HB 1QB1A 1YLNA 4AFZA 3KQBA 4RI0A 2W7UA 3K65B 1ZMJA 1ELGA 2FX6A 1MTNB 4TYDA 4B2AA 1D9IA 1O32A 5DG6A 4WMDA 3T27A 2QYIA 1S0RA 1ELAA 1F5LA 1BRAA 2G00A 3FVFB 3O8RA 4FUDA 2D8WA 1O3LA 3F9HA 1OP2A 1L4ZA 4NFFA 4CRAA 3SQEE 2VIWA 1P2QA 3ENSB 1OWJA 4X6MA 1CVWH 1L0ZA 1Y3YA 5C5OA 1RS0A 2PSYA 1EUFA 2JDID 1RTKA 1SQRA 1C1SA 2B7DH 3BEFB 2PKSC 3RMOH 1J14A 2WPMS 4ACBA 1TPOA 2B8OH 1IQMA 1SBWA 1ZHPA 2W5EA 4GHQA 2IOTA 3A8DA 5GXPA 2VWMA 1YLDA 4DY7B 9LPRA 2QAAA 5C5NA 2ODQA 8KME2 4K1SA 3GCOA 4X2VA 1NZQH 1GHBG 1GJCB 2SNWA 2H6MA 2C8YB 1V2OT 1VGCB 3RUOA 4AN7A 1TB6H 1OOKB 4AZ2B 3A87A 5EG4A 1A5HA 2VU8E 3SGAE 2RFKC 4Y11E 1EOLA 2H5CA 2AMDA 4FUBA 3FOAA 1AFEH 4ISNA 4XBCA 3P6ZB 5ETXA 3BG4B 3ZVCA 4H4FA 1DITH 3GYLB 1TYNA 2BD2A 3M36A 6GCHG 1O5FH 1AD8H 2NU4E 1YPHC 4AG2A 1D6RA 2ZZUH 1SGTA 1V2LT 4HI3A 2YMSC 4E05H 1F7ZA 4ZAEA 1W12U 1KIGH 1EFRD 3SZNA 4MNXA 4BAKB 5FAHA 1W0ZU 5G4BA 1H9IE 1MCVA 2R3UA 5JBTA 2QY0B 2YMSB 1QFKH 1RFNA
chains in the Genus database with same CATH topology
4JZ1A 1XM1A 2BVSH 3V0XA 1C5UA 2BQ6B 2HLCA 3FANA 2ZIQH 1GBCA 4Y0ZE 2VH0A 1FAXA 3GCTF 3AAUA 1MTUA 1GBFA 3OYPA 1AE8H 1YM0A 1JOUB 1OS8A 4B71A 4BXSA 3M5OA 3BTEE 3RDZA 1T7CA 1FI8A 1PQ7A 2VWOA 1O2ZA 1P12E 1WQVH 1TMBH 2G51A 1TNIA 1C2EA 2ZCLP 1C5WB 1J17T 2O8LA 2GZ7A 1KXBA 2H9HA 1QR3E 3HK3B 2IN2A 4KKDA 1O36A 1QL7A 3MO9A 3RC6A 1UCYK 1NTPA 1TRMA 4Q7ZA 3UQOA 3VGCC 4JYTA 2A2QH 1C4U2 1LMWB 5JBCS 1PQAA 1RXPA 3P95A 1FY8E 1P02A 2ZFRH 4VGCC 5JYIA 2HALA 2ZHFH 3LJOA 5HGGA 2G4UA 3HGNA 4GPGA 2UUFB 1V2QT 3ESTA 4FU7A 5L6NH 1DY8A 4JZDH 3UWIA 1O3DA 4O97A 3KNXA 2GMTC 1OXGA 1DLEA 2AMPA 2Y5HA 1TQ7B 2FLRH 4BAMB 1O0DH 1DXWA 1U6QA 1XUFA 3E16B 1SI5H 3MOCA 1ELVA 2R3YA 4IN1A 4CH8B 1ORFA 2Y80A 2ZGCA 3H7OA 4X6PA 4JCNA 1YCPH 2G81E 2WPLS 3EA9A 2VIDA 3M7QA 4IS5A 4BANB 1E36B 1C1WH 1FPCH 2GCTC 1NRRH 1O34A 4DIIH 2JH5D 1A3BH 1Q31A 2SGQE 1UO6A 3S9CA 1UHBB 1LKAA 2CHAB 2RA0A 1AGJA 2YOLA 4YESB 5K7RA 3ZVGA 1Q2WA 3KHVA 5E0HA 1YF4A 1Z6JH 4Q7XA 2GX4A 1P9SA 3EA7A 5HM9A 4ZHLU 5C67A 4LK4A 5E8EH 2V3HH 4NZQA 3QUMP 2M5TA 3UR9A 2ALPA 1TNKA 1W11U 1Y3UA 2QIQA 1XKAC 3PYHA 3A7XA 3LOXA 1EZUC 1C5VA 4BTIB 2VIQA 2ULLA 8GCHF 1LVYA 2P16A 2BY8X 1BRCE 2OC8A 1T32A 1W7GH 1ZZZA 3UNQA 4Y10E 4B75A 4ZUHA 2BLQA 3IWMA 3BEIB 3SUFA 3SHAH 3LGTA 4FVBA 1SSXA 4YZUA 5FPYA 2IJOB 3QDZB 1A5IA 5DGJA 3MH5A 2HVXA 3NUMA 3ELAH 1SL3A 1QL8A 3OY6U 1KXEA 1T8MA 2TBSA 5L2ZH 4NSYA 4UFDH 1NU9A 1GBKA 1SGIB 1T8LA 3O8CA 1BCUH 2FOBA 4MPVA 2BYAX 3PMBB 3DD2H 1B7XB 1UVUH 1GI8B 3K6ZA 4U30A 1C1QA 3A7YA 5FPTA 1N6YA 3D65E 4OS1A 2VGCB 1LPZB 3KQDA 3L33A 2GD4B 1TGCA 4U2WA 2AGIX 2P59A 2BXTH 2FOHA 1AMHA 2FEQH 2GZ9A 3SV7A 2W3KA 1S84A 1NS3A 1FY5A 4X1QU 2B5TB 1HRTH 1CBWC 3L6PA 4IN2A 2W26A 5I25A 1FDPA 1O3NA 3O8BA 3BG8A 3MO6A 4HGCA 1O3EA 3FZZA 3M7TA 2C4FH 1MBMA 6CHAC 1EZXC 2SGAA 3A88A 1AUJA 3NXPA 1DWBH 5F8TA 1WUNH 1KSNA 2FODA 4HZHA 3PM3A 2ZHEH 4X6NA 1GJ8B 2AH4X 3M3SA 3LH3A 1PYTC 3NPSA 3ZZCA 1VITH 4H6TA 1BMNH 4WMFA 2UUJB 3VPKA 4VGCB 4O9VA 2ZWLH 3GCHC 3RU4T 1ZPCA 1DWEH 1BITA 4ZKOU 2VINA 3A7VA 1O2KA 4GCHG 5PTPA 6LPRA 3TH3H 1GBDA 2Z9LA 3HKJB 1RTLA 5AF9H 1VCQA 1VITF 3D23A 5FPSA 4NWKA 2STAE 2J2UA 3T29A 5DP6A 1PPZA 1VJ9U 1PPBH 2CJIA 1H9HE 2LNCA 2OC1A 5LPEA 1SGNE 1FIWA 1LDTT 1QQ4A 1UVSH 2ZFSA 2FS9A 4AORA 1SOTA 4K5ZA 1ELBA 3ZYEA 2C8WB 1RIWC 1A46H 2ANKH 3QTVH 1C1VH 2NU3E 1Y5UT 2ASUB 3Q00A 1F5KU 1P2IA 2PGQB 2O8TA 2CN0H 3RXMA 1GGDB 1KXDA 2QF0A 4AGKA 4ABFA 3LC3A 2SNVA 1P03A 1BDAA 1LHGH 2BDCA 4MG3A 1JMOH 2TGAA 1P2MA 2PR3A 2XBWA 1SGEE 1P2KA 2F91A 2OUAA 3TLOA 1C5QA 1B0FA 1GJ6A 2VVVA 1IHTH 3EDXB 1G3BA 5DP5A 2JETB 1LVMA 3PMJA 1MZAA 2HOBA 1HUTH 1EASA 3ZYDA 2G5NA 5H4IB 3FP7E 3LGWA 2V6NA 2BLOA 2EEKA 2ZDNA 3MO3A 2FLBH 2JH6D 3LT3A 5FCRA 3URCA 1FY1A 2R2MB 1QIXB 4Q2KA 3P70B 1PYTD 3BIUH 4XDEA 3RMNH 3RXRA 3RU4D 1XKBC 1ANCA 1ACBE 1C5ZB 1LPKB 4TY7A 1MKWK 1QL9A 4XSKU 1G3CA 3V12A 1P3EA 1O2OA 1A61H 2OCVB 3S9BA 3QZQA 2FOGA 5EW1H 1O2RA 4ESTE 1TFXA 3UPEA 4DCDA 1E34B 3RMMH 1MMJN 2C8ZB 1O5CB 3CP7A 5GPIB 1HCGA 2CF9H 4FUCA 2BB4A 5DP8A 3SNAA 3UREA 3EYDA 3SJ9A 5BRRE 1OP0A 2ZC9H 3O8DA 1MU6B 1O2GH 1GBEA 4X8SH 1OWHA 1VITG 2PV9B 2FYRA 2PKAB 1KDQA 1CGHA 1PJPA 1AB9B 3LONA 1NRNH 4INKA 4K1EA 3NZIA 2WPIS 5EGMA 5TCAA 1S82A 1EP5A 3SQHE 4KGAA 3K2UA 1CHOF 1HXFH 1S83A 4UFEH 3S7KB 1W14U 1FV9A 1O2HA 1Z8RA 1HBTH 1TRYA 3M37A 1C5MD 3HKIB 1UCYE 5DPAA 1K22H 1NY22 1O5GH 3SN8A 2ZFFH 1GMHF 3P8GA 2GP9B 2XC0A 7GCHF 1KTTB 1DY9A 2A7CA 2XC5A 1EB2A 1GMCF 2OINA 3TIUA 4NZLA 1WOFA 3ATMA 1XUGA 2ZGBH 3T62A 1MD7A 5EW2H 4YTAA 1ZGIA 4Y71A 3TNSA 1GHBF 3ODDA 1W3CA 5EXLA 2RG3A 2BM2A 5EU8A 3SNCA 1ETRH 3HATH 3LGIA 2DE9A 5EPNA 1AWHB 1MAXA 2ODPA 1P11E 1ZRBA 4ZH8A 5A8ZA 2AGEX 4ASHA 2LPRA 3GDUA 4E06H 2QXIA 1FMGA 3ZVBA 2BY9X 5E2PA 1DVAH 1AY6H 1DSUA 1EZSC 1HAOH 2Q6DA 3PMHB 3SUDA 4JK6A 3NK8A 2FTLE 1NRPH 1RJXB 1C1OA 2VWNA 1RIWB 1TBZH 2ZFPH 1IQFA 1C1UH 1CT4E 1WV7H 1LHEH 3F9EA 4D8NA 3E8LA 4FUIA 3MU1A 2P3TB 3RXIA 1P2JA 2YNBA 1EKBB 2Z7FE 3MNSA 3V3MA 1W7XH 3RLWH 1BTZA 3IITA 1SVPA 1TPPA 3B9FH 4GLYA 2WUBA 3UFAA 5F03A 3SHCH 1AKSB 1V2PT 1IQKA 4OGXA 3LKWA 1ZRKA 2F3CE 2BMGB 1SPJA 3FAOA 1PPHE 1QJ7B 2FM2A 1D3PB 2P8OC 2A5AA 2R2WU 1TWXB 2VIVA 5FXLA 2A4GA 3SNEA 4MTBA 4MQAA 2A0QB 7LPRA 1GHXH 2FDAA 1C5SA 1HAZB 1PQ5A 1WBGB 2ILNA 4UFFH 1YPHE 1NFWA 1O3GA 4I7YH 2W7SA 4A7IB 2ZCKP 3PV4A 1P05A 3D62A 4X1PU 5ESTE 2ANYA 3PTNA 1K1PA 3TNTA 1T4UH 1GBLA 2WV5A 1C1NA 3QN7A 2J92A 8ESTE 2C8XB 2ZU2A 3OY5U 2H2ZA 1ETSH 5T6GA 3GYMA 2Z3CA 1O2JA 3OX7U 1D3QB 2PHBA 2V3OH 2Y82A 2HNTF 2CF8H 1C2MA 1HV7A 1HNEE 3P17H 4K8BA 1G2MA 1IQGA 1LCYA 4GHTA 1EPTC 1HXEH 4LZ1H 4AB9A 1ABJH 1C5XB 1V2TT 2Z9GA 1ELCA 2H9TH 1K2I1 4MPWA 3HK6B 1O2IA 1VCPA 2XTTB 5A0AE 2ZHDA 1DFPA 3PMAB 1IOEA 1AVWA 1L1JA 1QRXA 4X1NU 3SU6A 1SHHB 1G37A 5C1UA 1OWKA 2F9PA 1VR1H 1ARBA 3LGYA 3U1JB 4K1TA 1Z8IB 1FNIA 1S85A 1ZHRA 5C20A 3N7OA 2ZI2H 5EOKA 1UTMA 3Q3XA 1MZDA 2BX4A 1GJ7B 1KXFA 1BTWA 4B2CA 4YOJA 5A09A 1EP6A 1UTKA 1C2DA 1OX1A 3W95A 4NIXA 3UTUH 4KTUA 1C5LH 4Q7YA 1HIAB 1SLUB 2G5VA 1BBRE 1FAKH 4WJG2 2FP7B 2P8OB 1BOQA 2GDEH 3ZZ7A 3PROA 1THRH 3SJIA 1EPTA 3LDXH 2GMTB 4TY6A 5C1YA 3BTKE 1CHGA 3E0PB 2QC2A 3GY2A 1ZSLA 3TJVA 3GY4A 4FUHA 2XYAA 1GI0A 1A1RA 2F9UA 3A80A 4NIVA 1KTSB 2BLWA 2AIPA 1ESAA 1TA2A 1AFQB 1C1RA 1F0RA 2H5DA 1EAIA 3H7TA 2A1DB 1K1MA 1SGFA 3MH4A 1C1MA 3T25A 3V13A 4B1TA 4I31A 2C90B 1IQLA 1NFUA 2A32A 2G55A 2QA9E 2VH6A 4I8HA 1EJNA 4BAQB 2VWLA 5HMAA 4DOQA 1ZHMA 2BD8A 2A31A 1GJDB 2A45B 4D9QA 1W10U 4D9RA 1BHXB 1GHWH 1SC8U 1Y3WA 2Q6GA 5LPFA 3SV6A 2OXSA 3KQEA 1FPHH 3GY7A 2J34A 4B74A 3KCGH 3BTWE 1O3BA 3CENA 1UVTH 3ZVAA 4D7GA 1NC6A 1ZYOA 3UQVA 2QCYA 5C2ZA 2QF3A 2ZG0H 2GV6A 1RGQA 2ZCHP 1GI3A 4WXIA 2P94A 5A8YA 2A4RA 4IW4E 1OWDA 1YYY1 3RXQA 2XBXA 2VIOA 1C2KA 4NFEA 2EI7A 1ZPZA 2G8TA 2ZDMA 3RP2A 2FWWA 1DUEA 1FY3A 3RMLH 2A4OA 3VEQB 1Y3VA 5DP4A 4BNRA 1OSSA 1RTFB 4BTUB 4Y0YE 2A2XH 3SO3A 3M7UA 2OBOA 3TGIE 2ZQ1A 1O2YA 1SFQB 1P0SH 5FCKA 1JIMA 3KEEA 2RDLA 3LGUA 4JK5A 4B2BA 1MQ6A 1ZTLA 1XUIA 1ZJKA 4AX9H 4Y76A 1G30B 4UDWH 4RSPA 2GV7A 3TK5A 2VIPA 3MTYA 1CQQA 1C2GA 3RXDA 3FFGA 2AFQB 3SU3A 3VFEA 4INHA 4NWLA 1DS2E 1O3CA 1HAHH 2VVUA 1ELFA 1EQ9A 2J38A 1O2MA 3G01A 1AQ7A 2XCNA 1FXYA 1ZLRA 2OC7A 3AAVA 1ELTA 1TNJA 4DVAU 3SJ8A 1BIOA 1TOCB 1TX7A 3MYWA 1QB9A 1D4PB 4Y7AA 4J2YB 2XC4A 2ZDVH 2ZNKH 3SV2H 4TWYA 3S69A 1BA8B 2TIOA 3T26A 1LO6A 1SQAA 3ZZDA 1ANEA 1DXPA 4F4OC 2Z9KA 2BDBA 2GZ8A 3A7ZA 4ZKRU 4XE4A 3MH7A 1AI8H 2A5KA 4D7FA 4ZKNU 5C3NA 3SNBA 4JZFH 1P2NA 2G52A 1C9PA 1GHYH 2H1UA 1VGCC 2AS9A 1P04A 2I6QA 2VNTA 4OS6A 3EE0B 3E1XB 2J95A 3UIRA 1Z1IA 1O3FA 3GDSA 4CHAB 1TALA 4GVUA 1DWCH 1P3CA 1TA6A 2BD4A 2FO9A 3BTGE 4R8TB 3DFLA 3PLPA 1UK2A 1V3XA 3VB5A 5F6MA 3VXEH 1P09A 2GKVE 2QXJA 3SNDA 1GI2A 1JRSA 3RLYH 1NT1A 1N1LA 1MTWA 2BDAA 3MU8A 2BTCE 4CRBA 5DP9A 2OTVA 3SW2B 3SV9A 1GMDG 2OD3B 3A8AA 1UCYH 1FIZA 3M5LA 4WH8A 2BHGA 1SOZA 2BZAA 2FIRH 3QWCH 2ZU3A 1UJ1A 2SGPE 1HAVB 3LPRA 2F9OA 3QTOH 1F0UA 5IYTA 4AOQA 1GVKB 4MLFB 3E6PH 2C93B 2ZTYA 2AEIH 8GCHG 2HRVA 3A7TA 2C3SA 3BIVH 1F2SE 1HAPH 4ABJA 1L4DA 4BXWA 3MI4A 3RXSA 3RM2H 4ZHAA 1SR5C 1TABE 1QGFA 1HAGE 3PWBA 1FUJA 4YT6H 1A2CH 2ZGHA 1DSTA 1C5NH 3WY8A 2BQ7B 2FOFA 1HYLA 4J1YA 4XBDA 2WINI 2YNAA 4RN6A 4DIHH 1L2EA 1JWTA 1ZSJA 1MD8A 1Z7KA 1MUEB 1O35A 1AZZA 1V2RT 4AB8A 1XXDA 5DK1A 1P57B 1Z71A 4E7RG 3U1IB 2PW8H 2BOHB 1DOJA 3MMGA 2UUKB 1O2VA 1QRWA 3BTFE 1CE5A 1ZGVA 4NA9H 5JB9S 1EAWA 1GVLA 1GG6B 2BVXH 1V2NT 3GICB 1XVOA 3SI3H 1BQYA 2I6SA 3BTHE 1GDUA 4NCYA 2F83A 2PKAA 4Z0KA 5GCHG 2OQUA 1GCTB 3SU0A 4WXVA 2ZGXH 2P3FH 2PKSB 4RKJB 3GY6A 1DLKB 1B0EA 1YC0A 1LTOA 1DX5M 1UVOA 3F9FA 4MNYA 4KTCA 2ZU5A 2A5IA 3BTQE 1A3EH 2ZTZA 5A2MH 2SGFE 3U98H 1RRKA 5A8XA 1BB0B 1TNHA 2V35A 4UONA 1EJMA 1WAYB 4GAWA 1S0QA 1DPOA 1GWAA 3GISB 1KLIH 4GCHF 5DO4H 2HWLB 3HGPA 3TJOA 2STBE 1UVPA 1YP9A 2D26C 2XNIA 2UUYA 1HAIH 1NU7B 1P9UA 3U9AH 5CHAC 4FUEA 2VVCA 1EZQA 5A0BA 2OLGA 1KYNA 2GTBA 3RXKA 3QO6A 2HGTH 4AG1A 1UTQA 5E0GA 3RC5A 3SBKA 1JRTA 2BX3A 4ABHA 1ELEE 2B9LA 1MTNC 1XMNB 3E3TA 3F68H <