1EZSC

Crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords ECOTIN
total genus 53
structure length 223
sequence length 223
chains with identical sequence D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezsC01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezsC02
2FI5E 3UOUA 3RC6A 3M7TA 3UQVA 1QIXB 3VPKA 3A85A 1LVOA 1S6HA 4CHAB 3SI3H 4O3TA 3V0XA 4H42U 4K1SA 1C2JA 3RMOH 5FXLA 4GCHF 2GX4A 1O5GH 5FPTA 4FUHA 5E2OA 4NA9H 1SQAA 5LPFA 1BHXF 1Z6EA 2STAE 4GHQA 1C2LA 2H5CA 3ZVBA 1E35B 2UUJB 5GCHF 3LH1A 2QXHA 2CHAC 3CS7A 2ZU5A 5GDSH 3ZVGA 1MU8B 1SGRE 4UDWH 1MMJN 5A8YA 3L33A 1AVWA 2FM2A 3RLWH 2F83A 3H7OA 2C90B 1QCPA 2STBE 4B76A 2UWLA 4D9RA 1BBRH 3PMHB 3DD2H 4X2XA 2FOMB 1B0EA 3Q00A 1Z71A 4X6PA 1O34A 2F9OA 2AEIH 4AOQA 1SLUB 5JBAS 3RUOA 2Y7ZA 4MDSA 1GI5A 1EAIA 2ASUB 4MNYA 1XUIA 3SOSA 5AHGH 1CGHA 1SFQB 3VXFH 3PROA 4WJG2 1QBOA 2J2UA 1V2KT 2VVUA 4ZMAH 1AY6H 1EUFA 1PPBH 2V6NA 3MNXA 2J9NA 1YLDA 3SI4H 2ZFTA 2AGEX 1O32A 1ABIH 2HALA 1NU7B 3NK8A 2C4FH 5AFYH 5E0HA 1T8OA 3V7TA 1ZPZA 1W7XH 1GMHG 4BXWA 1C5OH 3SNDA 3RMLH 3STJA 3OU0A 1DICA 1P9UA 3Q3YA 3E8LA 2O8LA 1O3OA 1SSXA 5DP5A 2XTTB 1TPOA 2ZDVH 1AKSB 3RXCA 1SGPE 1P2OA 1EZQA 3D49H 2FLRH 3DUXH 1V2MT 2ZPQA 3T28A 1ZJDA 3A7XA 1NT1A 1O3DA 1KXBA 1EZUC 1O2XA 1HAHH 2ZHWH 2JKHA 2WPHS 3E16B 3U8OH 1ANDA 1SMFE 3BF6H 1Z1JA 2ANYA 2DE9A 2W3KA 2FESH 3M36A 2BOHB 1G3DA 4I33A 1BMMH 4YESB 1Z1IA 2ZQ2A 1V2NT 3UNSA 4X1QU 1K2I1 1P2IA 3QZRA 4IN1A 1HAGE 3GICB 1IHTH 3UR9A 2PLXA 2ZDLA 3UTUH 2ZGCA 4CH8B 1C5UA 4I8HA 5CHAC 1T8MA 1SC8U 1TNGA 1IQHA 4FUJA 5CHAB 6ESTA 1C2DA 1E36B 1UHBA 1S0QA 1FI8A 2A0QB 1P2MA 1VGCB 4QT8C 1MUEB 2FOGA 2R9PA 3URCA 5J4QA 1KTSB 3S7KB 2ZU3A 4X6MA 1O3AA 5DP3A 2FI4E 1GBEA 2ZF0H 3AAVA 3TU7H 1DWDH 1S6FA 3HKJB 1A5IA 3O8BA 1LHEH 2BD4A 5C1XA 1O30A 3LONA 4NSYA 2Q6FA 1D3QB 3FP7E 4RSPA 1CGIE 2BDCA 3BTHE 4E06H 1O3EA 1W10U 3KN2A 1NFYA 1G3EA 2QIQA 4D9QA 4FUFA 4Y8XA 3S9BA 1W3CA 4TY7A 2PTNA 2J34A 1HAPH 3SUFA 3UOPA 1ABJH 3G01A 3RXRA 3H5CB 1Y3YA 1A0LA 2ZPRA 1AE5A 5F6MA 3SORA 1F5LA 1ZGIA 1UVOA 2OBOA 2B5TB 1O2HA 4I8JA 4ISHH 4DT7B 2BQ7B 2SFAA 1GL0E 1EPTC 4FUEA 1OP0A 2Z9JA 3PLKA 2YNAA 5EODA 2QYIA 3E3TA 1QB9A 3BTTE 5GWZA 1INCA 3PO1C 3GYLB 1A4WH 1TE0A 2HNTC 2AGIX 1H1BA 1RIWB 4YTAA 2PW8H 2H9TH 1KXCA 3SU5A 1QA0A 1W2KH 3P70B 4O9VA 2PKSC 1SFIA 2PKSB 2A1DB 3OSYA 1EKBB 4Q80A 4IGDA 1YBWA 2Y82A 2G5NA 2BOKA 3M7UA 2UUKB 3M5MA 4GVUA 1XUGA 2BY6X 3ESTA 1ZRBA 1OWJA 2QAAA 2WPLS 2C3SA 3KQBA 1GGDB 1DLKB 1V2TT 3Q76A 3VXEH 3K2UA 1Y5AT 3OY5U 1NRNH 4Y7BA 3SV8A 1ZOMA 3PMJA 1NY22 1ELBA 4AYVB 1UCYE 5A0BA 2Z3DA 4ABAA 5JB8S 3MU4A 4UEHH 1XMNB 3BN9A 1TWXB 1BRUP 1ZSJA 4FUCA 1FMGA 3VEQB 2IPHA 3EAJA 1IQNA 7GCHG 4K8YA 2BHGA 2CMYA 4ISNA 1YPGH 5DJ7A 1P8VC 2H5DA 3UNQA 6LPRA 4K60A 2BY7X 2P94A 2HWLB 3MH7A 1KLJH 1V2WT 2BZ6H 2NU0E 4IC5A 1C1QA 2ZDNA 2A5AA 4NSVA 4Y0ZE 4MVNA 5T6DA 5K7RA 1V2UT 2FOBA 1AWFH 1U6QA 3PTNA 1G2LA 2SNWA 4WMFA 2QV1A 1MZDA 2XC5A 1HJAB 1GJDB 2AGGX 1DXPA 2TGAA 3U9AH 4MNWA 4UFDH 1IQFA 1O35A 4A1XA 1E34B 1YYY1 1TGCA 3FP6E 4RKJB 1XVOA 2ZFPH 5LPRA 2OBQA 2TGPZ 3RM2H 1UTQA 1QQUA 3SU4A 1G3BA 1NFWA 1XXDA 4INKA 1QRWA 4ZXXH 2BXUH 2KAIB 3LC3A 2ZO3H 4MPUA 2FX6A 2WV5A 1TBQH 5A2MH 1C2KA 1GCDA 5EPYA 2FXRA 1C1SA 2OXSA 4D76A 1ORFA 1C1MA 4LK4A 1ZGVA 3EGKH 3SJ9A 1GI0A 1CQQA 4KELA 4FVBA 3SU0A 1OX1A 1C5ZB 1V3XA 1WQSA 1TNIA 3MU1A 1FDPA 3QTOH 4MPVA 1CGJE 2XBYA 5G4BA 5DP9A 4ISOA 2FZZA 5TCCA 4ISIH 3EYDA 5TJXA 1GI4A 1HJ9A 2GP9B 4A92A 3BTEE 4JYTA 4B1TA 2FX4A 4DIIH 1C5RA 4Z0KA 1TB6H 1XM1A 2PV9B 1N8OC 3OTJE 3GCNA 1O2LA 1SOTA 3LPRA 1GBJA 2FYRA 1ELGA 1THRH 4CBOA 2ZDKA 2BD2A 1V2ST 4AFSA 1SR5C 5EOKA 3P92A 1QR3E 3A7TA 3VB6A 2BD9A 3T27A 4BAMB 3BTDE 1SGDE 1MH0A 3P6ZB 2BXTH 1PPFE 1TRMA 2RDLA 2UUFB 3RU4D 2WUBA 1HAOH 2OUAA 4DW2U 3NUMA 2GV6A 4WH8A 2FODA 3FAOA 3BTQE 5C20A 2OC0A 2ZCKP 5L6NH 1AMHA 1ZJKA 2CF9H 3DHKH 3TJNA 1BJUA 1V2QT 3M5NA 1A7SA 2SGFE 1N8OB 1FN8A 1K9OE 1OWKA 5T6FA 1O0DH 4U32A 1Z7KA 1VITG 1V2JT 4CBNA 1OWDA 3RM0H 2GCHF 4K5ZA 3S69A 3QK1A 1UVTH 2VGCC 1UO6A 2Z7FE 4IW4E 5DP4A 5JB9S 2BB4A 1AFQC 1GVLA 1GHAG 1J8AA 3LJJA 1HDTH 1UJ1A 2FWWA 1HAXB 2VINA 1Q3XA 1G30B 3K6YA 3UY9A 1C1OA 1ZPBA 9ESTA 1GI7B 4SGAE 1FY3A 2GMTB 4FU8A 1C1NA 2VIQA 3GOVB 1IQEA 5FHTA 1PYTD 2BYAX 3KNXA 4YT7H 3ELAH 1PQAA 2FOEA 3A80A 1TRNA 3RXMA 1FZZA 3C1KA 2A4RA 1H4WA 3PLPA 5F8ZA 2CN0H 1AKSA 1DWBH 4MNVA 1YGCH 4IMQA 3BTWE 3D62A 4FVDA 1DOJA 2GTBA 2ZU2A 2BD3A 2PSXA 1CA0C 1GG6C 1MKWK 3SGBE 1Y3UA 2FLBH 1FPCH 2BVXH 4CRCA 1XUKA 3NWUA 1CBWC 1YPHC 3CS0A 2OINA 1IQMA 5E0GA 3HGPA 1C2FA 2HNTE 1EXFA 1QA7A 2BX3A 2CXVA 4JCNA 5HM9A 1C1PA 3B23B 2Z3CA 1AVXA 1PQ7A 1FY5A 3ATLA 1TBRH 3FZZA 1GL1A 1BA8B 5DK1A 1TX8A 1C9PA 2HRVA 3K6ZA 1FJSA 4ISLA 1BBRK 2SGAA 2WYGA 1ANBA 1NU9A 2NU2E 5A09A 3QTVH 3UFAA 2A32A 3EE0B 1V2LT 1UHBB 1ZTLA 4ZHAA 1Z8RA 3KIDU 3S9AA 3ZV8A 1W8BH 2KAIA 3TK5A 3ZVCA 5B6OA 6CHAC 3BV9B 3ZZ7A 1FN6A 2EC9H 2V3HH 2HVXA 2Q6GA 1TOMH 2SGPE 5C1UA 1SLWB 4AYYB 1AI8H 4GLYA 1ELVA 4X2YA 2ZIQH 4X1PU 3RMNH 2RG3A 2ZKSA 4FUDA 4GUXA 3STIA 3ZZCA 4BXSA 4DVAU 1GHBF 2BLWA 4NCYA 2FOHA 1DPOA 3F9GA 3BEIB 3KF2A 4AGKA 2F91A 1FV9A 3GDUA 3I78A 1TAWA 1O2JA 4J2YB 4DOQA 2AYWA 2XC0A 2BQWB 1UMAH 2ZHEH 1GHZA 5A8XA 2ZU1A 1A46H 1ESBA 1HPGA 4WXVA 2FO9A 3RXOA 2VJ1A 4Q7ZA 1AFEH 1OWHA 1O2TA 1TYNA 3A88A 1D3TB 4THNH 1C2HA 2SGQE 1KLTA 1GJ9B 3SHAH 1EAXA 4Y7AA 2R3YA 4ESTE 5PTPA 1C5TA 3T2NA 1RTKA 3K65B 1O3LA 3LGUA 3M3TA 3GCHC 1CT4E 4YLQH 1ZSLA 1B7XB 4E05H 2PKAB 1TRYA 1YKTA 1O3HA 4ABFA 3AASA 3UR6A 3MNSA 4JZFH 5EXLA 2A4GA 4BAKB 2RCEA 3QZQA 1TNHA 3QN7A 1FAXA 4FUGA 1AZ8A 1T4UH 3P8NA 2R2WU 1HLTH 4DCDA 2I6QA 2ZFSA 1UTOA 8ESTE 2Q1JA 1DE7H 1JXPA 3V12A 1CT2E 1UTJA 1LPGB 4KTCA 2YNBA 1GHBG 1LKBA 1SG8B 1GJCB 2O8TA 3T29A 1P01A 1TQ7B 4U01A 1OS8A 5EG4A 2QGRA 2V0BA 2PR3A 3EA8A 1BTUA 2ZGJA 5DG6A 5DPAA 3E0PB 1NESE 1RJXB 4A1VA 4JZIA 3DT0H 1G3CA 1RTFB 2BDBA 1O3FA 2VWLA 1ACBE 3ZZAA 3GCOA 3HK3B 4ABJA 1C5MD 1P2JA 2DUCA 2ZNKH 2GD4B 3F1SB 4CREA 1W11U 3SU6A 3A84A 4Y11E 4B2AA 1AWHB 1P05A 1KLIH 4TPYA 1C2EA 1OKXA 3VB7A 1TNLA 3VB4A 3OX7U 2AMQA 2THFB 1GI8B 1DX5M 2PWXA 1ESAA 1QL9A 1TGNA 1Q2WA 1J15A 1EP5A 2FTMA 1X7AC 4ZUHA 1G36A 2ZGHA 3VB5A 1K1OA 1GMDG 2PFEA 4K69A 1C5SA 1ID5H 2BY9X 1C5WB 1PFXC 1FONA 2WPJS 3RXBA 2Z3EA 2TIOA 3ZVDA 2H6MA 1A0HB 1LVYA 1ZRKA 1O36A 4ABGA 1IOEA 3LGWA 1O5AB 4ZAEA 3TGJE 5FPSA 2FEQH 1YPHE 3E0NB 1QTFA 3QUMP 1SLXB 1GCTB 1O5DH 2O8MA 3RXEA 1QRZA 4MPXA 1WOFA 2ZGBH 1YCPM 3BG8A 1QL8A 5T3HA 3K9XB 5FCKA 2PUXB 1A0JA 4XSKU 1QFKH 5SGAE 1JMOH 2A7CA 3A7YA 2QF3A 1UTPA 2Y5HA 2ZTXA 3AAUA 4TWYA 3A8AA 2VWMA 3SUEA 4CH2B 1HV7A 2P95A 2K1QA 3GCTF 2PGBB 3ZZBA 4BAOB 1TQ0B 2AERH 2UUYA 2F9VA 3AW0A 3R3GB 1CU1A 1D3PB 5HXFA 1L4DA 2Y81A 1ZTKA 3E6PH 4GSOA 4Y71A 4LZ1H 1ZLRA 1PYTC 3SGQE 1NO9H 3MMGA 9LPRA 1PJPA 5HGGA 2F9UA 1THSH 1C5LH 2FTLE 2ZDAH 1MBMA 2GDDA 1NRQH 2XNIA 2VVCA 1QGFA 1YPMH 3BTGE 3RXIA 1SGTA 4O3UA 4YZUA 1RGQA 1DLEA 4HFPB 4NZQA 1P11E 1BT7A 5A8ZA 4IC6A 4XFQA 1NPMA 1OP8A 2XCNA 1CA0B 1GG6B 1EZXC 1Z8JB 1CHGA 2VH0A 3A82A 1MD7A 4GHTA 4Y0YE 1K1NA 2PGQB 1GGDC 2FPZA 1S5SA 3DA9B 1CA8B 3MU5A 3ODDA 1C2MA 3TH2H 3QWCH 1F0RA 3PWBA 1ESTA 2BDYA 3RXTA 2FMJA 1BTPA 1BMNH 4K1TA 1S0RA 1AVGH 4X1SU 1F0UA 1LPZB 5ABWA 1O3KA 1CHOG 1BOQA 4YM9A 1N6XA 1O3MA 1YPKH 3RXUA 2PKAA 2R3UA 2JH0D 1F0TA 1HB0B 2TGDA 4AN7A 1VCQA 1O2MA 1C5YB 2Q6DA 1JWTA 3S9CA 1TALA 1ELEE 4YT6H 4FXGH 4NFFA 2W7UA 1ELFA 3SN8A 1C1TA 4WY3A 1V2PT 4K2YA 3ZV9A 2A5KA 3NKKA 8KME2 3M5LA 1LHGH 4OS4A 2WINI 3HGNA 2XRCA 2H9EH 3SUGA 5EQRA 5DO4H 1V2VT 3FZDA 3RC5A 4R8TB 3V3MA 4ZHMU 2P3FH 3PMAB 1ZSKA 2D1JA 1BTXA 2B9LA 1EJMA 1O2NA 1P3CA 2BD5A 4XOJA 1W13U 4CRBA 1GBLA 3S0NA 2VB0A 4Y8YA 1K22H 4UFFH 4WF8A 5A0CA 1A3BH 1GI6A 1MTUA 4F4OC 1SGEE 1Y3WA 2J4IA 2GVFA 2P16A 4JZEH 2QF0A 4Q7XA 6GCHF 1SBWA 3RXKA 3BG4C 1SGCA 1EZSC 2FDAA 2IJOB 5EU8A 5K0HA 4CR9A 1AE8H 2G51A 3QLPH 3SW2B 4BTUB 3AW1A 1TNKA 3GDVA 3NPSA 1C2GA 3SJKA 1Y3VA 2XBVA 1JIRA 3M7QA 3RXVA 4CHAC 2GCTC 2Y5FA 1LMWB 2QCYA 4IN2A 5E2PA 4X6NA 4YOJA 1RFNA 3U1IB 1EJAA 2P59A 2PUQH 3IG6B 1BUIA 4IBLH 5EGMA 1PPZA 4KKDA 1KXEA 1F7ZA 4ZXYH 1QL7A 1CO7E 2Z9KA 1LVMA 3EA7A 1L1GA 4PROA 2LNCA 5LH8A 3LU9B 3DFJA 1QB1A 3M35A 3T62A 5DKMA 1GHYH 2ILNA 1QQ4A 5JYIA 2GZ7A 1C5VA 1ZYOA 3M61U 2A2XH 1MBQA 1UK3A 2J94A 2HNTF 5H4IB 5TCAA 3FVFB 5HM2A 2FOFA 2ZFRH 5IYTA 1WU1A 4A1TA 2CGAA 2ZWLH 3LGTA 4XDEA 3ATMA 1XUJA 4JK5A 1A2CH 5EQQA 1DUAA 4ZHLU 1P04A 3LIWA 2BMGB 2O8WA 4WMEA 3PV4A 4E7NA 2ZHQH 3URDA 4KTSA 2RA3A 1GDUA 1MTVA 1NTPA 1GMHF 3P8OA 1OPHB 1E38B 2WV4A 1GMDF 1TFXA 1D3DB 1D6WA 4DGJA 4OS5A 1YCPH 4E7RG 1EJNA 3V13A 1MCVA 6GCHG 3RU4T 4BTIB 3JZ2B 1O3NA 1SQOA 3RXLA 1AB9C 2IN2A 3BTFE 1QURH 3MH6A 3PO1B 2VH6A 2EEKA 2BY5X 2TRMA 1W7GH 2EI8A 1H9LB 5BRRE 1NFXA 3M3VA 1AUJA 2P3UB 1B5GH 1F5KU 1SGNE 3I77A 3AVZA 4NWLA 1GJ4H 1ELDE 4X8SH 4J1YA 1C5PA 1H8DH 3VGCC 4TYDA 4ABEA 2OC7A 3TVJB 1WTHD 2W5EA 2UWPA 3EA9A 1UVSH 1T31A 2XW9A 3PWCA 3GCTG 1F2SE 1SPJA 1GI3A 1QY6A 1VZQH 1PPCE 4DJZB 1KTTB 4RN6A 1J9CH 1NC6A 1TGBA 4LOYH 2ODYB 2A45B 4JMYA 2V3OH 3SNEA 1O3IA 1O2OA 1GBFA 1YPLH 1FY1A 1WYKA 1MTWA 1NS3A 1YPJH 4MQAA 2FIRH 4LZ4B 2Z9IA 1QRXA 5IDKA 4BAHB 2NU1E 3UUZA 1A5HA 3A83A 3RXDA 2D2DA 4AFQA 1L1JA 2BVSH 1ZTJA 4YO9A 3TJUA 3SU2A 1O37A 2Y6TA 2ZC9H 2QN5T 2UWOA 2G8TA 7ESTE 2A7HA 2D8WA 1TPSA 4F49A 1UCYH 5C3NA 3T26A 5JBCS 1HAIH 2EA3A 3U8RH 2XCFA 3ZZ8A 1UTMA 1MCTA 3ATKA 4XBBA 3MWIU 1LTOA 2BDIA 1TX7A 3ZZ3A 1SGFG 1WAYB 3LDXH 3A86A 2J38A 4AGJA 1UTLM 2VIPA 1H9IE 3GCHB 1TA2A 3BTME 1HXFH 1RXPA 2BVRH 2FOAA 1GI2A 3M3SA 4O97A 3GY7A 3T25A 2O8UA 3M5OA 1O33A 1C1UH 3JZ1B 1HGTH 3ATIA 1DWCH 1V6DA 4X6OA 3SJ8A 4OGXA 1ZMNA 5EXMA 1GMCF 4KP0A 2C8YB 2H2ZA 1KXFA 1PQ8A 5J4SA 4NA7A 1C4V2 4DIHH 3C27B 3RXPA 1C4U2 1GI9B 3TH3H 1GWAA 4NA8A 1BMLA 3TPIZ 5GCHG 3E1XB 3DFLA 2C93B 2OC8A 1KSNA 5FAHA 2G4UA 1E0FD 1AN1E 1BHXB 1GDQA 1GBKA 1HCGA 1TABE 3TLOA 7GCHF 5E0JA 1GJBB 1AHTH 1E37B 1TGTA 2BTCE 1GJ6A 2XYAA 5DP6A 1YCPK 1AO5A 3PTBA 1P06A 1HYLA 1FXYA 3B8JA 1SL3A 4H6SB 1D4PB 3LGIA 3P95A 4HTCH 1LQDB 2PSYA 1RTLA 1Y5BT 2DE8A 2OQUA 1P57B 1ARCA 2XC4A 4XE4A 1TONA 4WXIA 1ZMJA 1Y8TA 3NZIA 2B7DH 3RXAA 1TPPA 6CHAB 1SLVB 3ZZ5A 1BDAA 1MAYA 3SV7A 1P0SH 4MNXA 3RDZA 2ZA5A 1XKAC 2A2QH 3BTKE 1XUFA 1MU6B 1O39A 1O2KA 2TGTA 8LPRA 4OS6A 1XXFA 3R0FA 4Q7YA 1IHSH 1IQLA 4CRGA 3MOCA 1AFQB 3MO6A 3F9EA 1WUNH 2NU4E 1CT0E 5AVDA 1DY8A 3KGPA 4FUBA 4K8BA 1S85A 2GDEH 1DXWA 1O2RA 2ZU4A 1PQ5A 5DGJA 1ETSH 2OLGA 3U8TH 1TMTH 1ELTA 1C1WH 4CRFA 3RMMH 2AMDA 4KGAA 3A7ZA 2BZAA 2BLVA 1BRBE 3SZNA 4B74A 1IQIA 2TPIZ 3LKWA 4OS7A 3D23A 1EB2A 5JPMH 1P09A 1UCYK 4XBDA 1P2KA 1O2YA 4B2CA 5I46H 1Y5UT 1D9IA 4AG1A 1P12E 2GT7A 4HI3A 2G00A 3TJVA 4ZKNU 1A61H 2XWBI 4I8KA 2FS8A 1ELCA 1UK2A 1AGJA 1SHYA 1Z8IB 1C2IA 2ZG0H 4UFEH 2C8ZB 1BQYA 1TGSZ 4B71A 4CR5A 1VGCC 4X0WU 1JIMA 3U69H 5DP7A 1ANCA 4A5TS 5L2YH 1LCYA 1KYNA 1OYTH 2Y7XA 1CVWH 1KDQA 4VGCC 3UNRA 5ESBA 1UK4A 1QB6A 1DFPA 1O38A 3SNAA 1L0ZA 2G81E 3RC4A 3EDXB 3NXPA 1GJAB 3HATH 1HAVA 1TX6A 1EOJA 4NIWA 3A8BA 2QA9E 2XXLA 4M7GA 4X8TH 4I7YH 3LGVA 2ZFQH 2VU8E 1QHRB 3RXFA 8GCHG 3O8CA 3FANA 3SQEE 4HGCA 2ZTZA 1THPB 2GV7A 1LPKB 3A8CA 1A3EH 3TGKE 2R0KA 4TPIZ 4I32A 2B8OH 1GBBA 4SGBE 1TOCB 3UWJH 3L3TA 3MH4A 3QX5H 2OC1A 4JYVH 3KQCA 1FY8E 1HAYB 3VGCB 3PYHA 3P8FA 4H6TA 4U30A 1N1LA 4UD9H 2GCHG 4Y76A 2FI3E 2HPPH 1O3JA 4H4FA 3MO9A 4K1EA 1V2OT 1HAZB 4BOHA 5C2ZA 2B0FA 1WTGH 1O2GH 1HJAC 1FY4A 2Z9GA 5L30H 1MTNB 5C5NA 3QGJA 4NIXA 2AH4X 2QXIA 4WWYA 4AFZA 4AZ2B 1P02A 3O8RA 1B0FA 2WYJA 1Y59T 2Z94A 1ANEA 3U1JB 1EASA 3RXGA 4BAQB 1VCPA 3GY5A 1DWEH 3IWMA 1BTHH 3Q3KA 4ABHA 3HK6B 2VWOA 5C5OA 3A7VA 4D7FA 1NRRH 1CBWB 8GCHF 4ABIA 4ZROA 1EP6A 3ZVFA 1T8NA 5EW2H 1Z8GA 1C5QA 2JH6D 2QXGA 1HBTH 2G52A 2BDGA 1OYQA 2R2MB 2I6SA 1O3PB 1BJVA 3O8DA 3SQHE 1JRTA 2G4TA 2GGVB 2WUCA 1O31A 1P2QA 4ZH8A 5EXNA 1O2VA 1A5GH 4ZKRU 3ZZDA 3L6PA 2BDAA 3GYMA 1O2PA 2ZFFH 5L2ZH 4K3JA 1LHCH 4X1RU 7LPRA 4ZKSU 3UWIA 1MTNC 2J95A 4MG3A 1O5FH 1ZZZA 1L4ZA 4NZLA 5F03A 2P8OB 1SQTA 3BSQA 5AF9H 4DY7B 1BBRE 1GBDA 4AX9H 4DG4A 1TA6A 4I8LA 2A4OA 2ALPA 3PM3A 4X2VA 2TBSA 1PPHE 2ANWA 5C1YA 2V35A 2W7SA 1O5EH 1TBZH 2Y80A 1G37A 3LT3A 4DURA 1DANH 2AFQB 4YOGA 1OSSA 4U2WA 2ESTE 1MAXA 3F68H 4IMZA 3TJOA 1HUTH 3KL6A 2VIOA 3FFGA 1AZZA 1HNEE 3MNCA 1T4VH 3SV2H 3P17H 3E90B 2WPMS 3F6UH 2VIDA 3CENA 3ZZ4A 1VJAU 1GBMA 5F8TA 2C8WB 4GAWA 3LJOA 4KTUA 2A7JA 5EPNA 1J14A 2BD8A 4OS2A 3FP8E 5CE1A 2ZECA 2J92A 1VCWA 3UQOA 1TNJA 4VGCB 1IAUA 1BTWA 4B73A 1W12U 5FX5A 2PTCE 1RD3B 1KDQB 1GBCA 1H9HE 1K1MA 2JETB 5FPYA 1SB1H 2JETC 2ODQA 4OS1A 2VIVA 3TK9A 1HAVB 2Z6BD 1P3EA 1TLDA 3NCLA 4AFUA 1GCTC 1L1NA 1IQKA 3PLBA 3QO6A 1JBUH 3SHCH 2WPIS 1CHOF 5DP8A 1DM4B 5GPIB 1UTNA 3B9FH 1DDJA 1Z6JH 3EQ0H 2GT8A 1T8LA 3GDSA 4ASHA 1SOZA 1ZR0A 1N6YA 3BG4B 2R0LA 2VWNA 1EPTA 1P10A 4X8UH 1UVUH 3MHWU 1MZAA 4ABBA 3ATWA 1PPEE 2Y5GA 3A7WA 4BANB 1WV7H 2OP9A 3LH3A 1SHHB 3H7TA 4I31A 1QJ6B 1HFDA 1MD8A 2ZQ1A 1F5RA 1VITF 3RXSA 4Y8ZA 3RXHA 1UVPA 4Z6AH 1ZHMA 2BLOA 1W0ZU 1HRTH 1G2MA 1MQ5A 1C9TA 1GHAF 3SU1A 3OYPA 5FBEA 4B75A 1C5XB 4AB9A 1DS2E 1BRAA 3TITA 1AU8A 1QBVH 1QJ1B 2BDHA 5HMAA 3Q3XA 3SGAE 1S81A 3KEEA 3KQDA 1FIZA 1BITA 1K1LA 7KMEH 1P03A 2ZI2H 3A81A 4CRAA 2BX4A 1C5NH 1FUJA 2LPRA 3ODFA 3W95A 1NZQH 3MO3A 1IQGA 3A89A 5LPEA 2W3IA 1LDTT 3SBKA 2YOLA 3ENSB 5F8XA 1S84A 4BNRA 3SO3A 3BIVH 3ZVAA 1CSOE 1MKXH 3HPTB 3ZYEA 4RKOB 1OP2A 1A1RA 3LC5A 5I25A 1ETRH 1GHVH 1OWIA 3UREA 1NN6A 1GDNA 3MFJA 1GBTA 5E8EH 2XWAA 1K1PA 1KIGH 1TIOA 2D26C 1MQ6A 2HLCA 1G32B 2ZHFH 3VFEA 1DT2A 2WPKS 1WQVH 4A7IB 4D8NA 1HIAB 3RXQA 1AQ7A 3PMBB 1O3GA 4MTBA 3GISB 3D65E 2ZP0H 1BTZA 1PPGE 1Y3XA 1GBAA 5T6GA 1AUTC 1SGYE 4Y6DA 2AS9A 1QJ7B 1EB1H 3GY8A 2ZPSA 1O2SA 4WH6A 1F92A 4INLA 2BD7A 1ELAA 1YM0A 1GBHA 4R0IA 1XKBC 2FP7B 1NRSH 2ODPA 1LO6A 3CP7A 2FOCA 1WBGB 2H9HA 1DUEA 3KQEA 3SU3A 2QC2A 1LQEA 2SGDE 1EAUA 3TH4H 5GXPA 2P93A 4A6LA 4Y79A 3Q77A 1GJ8B 1LVBA 1NFUA 3TIUA 5HYOA 2OD3B 3LGYA 4LXBH 3MYWA 4UFGH 1ZHRA 2OCVB 2CHAB 4TY6A 2ZCLP 3IITA 1DY9A 2FYQA 1T32A 2M5TA 4X2WA 2BLQA 3SUDA 3MU8A 3TNSA 2FS9A 3GY6A 1YF4A 1JRSA 3M37A 1SI5H 1RIWC 1IQJA 4I8GA 1UTKA 4HZHA 1BZXE 3SV9A 1NRPH 2A4QA 1O2QA 2Z9LA 3U98H 1XVMA 2QXJA 2CF8H 1ZMLA 4ABDA 1LHFH 4B2BA 1H8IH 1SGFA 3TNTA 2O9QA 1VJ9U 4FU9A 4INHA 5JDUB 1OOKB 1YP9A 2F9PA 3SNCA 3KHVA 3SJIA 1BTYA 1RS0A 4ZKOU 2EI7A 1GJ7B 1MKXK 2RA0A 1HJ8A 1ZPCA 4X1NU 1FAKH 2C8XB 1TPAE 1BIOA 2VGCB 5JBBS 2SNVA 1FIWA 2CJIA 3W94A 4GPGA 5CMXH 3SJOA 1TMUH 3MU0A 2XBWA 2ZHDA 5ESTE 2ZZUH 3UPEA 1DSUA 1NROH 1ZHPA 4Y10E 1F0SA 3BEFB 1C1VH 1NM6A 4Q2KA 3E91A 1VITH 1ETTH 4JK6A 1FPHH 1GHXH 1D6RA 1YC0A 2VNTA 4NIYA 3UIRA 4WMDA 2F3CE 3BIUH 2ANMH 1P9SA 1EX3A 2HOBA 1GPZA 4MPWA 1S82A 1EATA 1K28D 3MI4A 1OXGA 2ZTYA 4D7GA 1QBNA 2GMTC 2AIPA 4BTTB 1C1RA 1JOUB 3QGNB 1J17T 5FBIA 2SGEE 1O2ZA 1V2RT 3A87A 1C4Y2 3QDZB 3GY4A 1TMBH 2W26A 1YLCA 4OGYA 2ALVA 2G55A 2NWNA 4UONA 2GKVE 1J16A 2ANKH 1GBIA 5A0AE 1K21H 1SGIB 3GY3A 3SV6A 1L2EA 2AIQA 5EQSA 1FLEE 4GCHG 2VIWA 1HXEH 4NFEA 4X8VH 2G5VA 1GVKB 5ETXA 1KXAA 1O2UA 4MLFB 5EW1H 1DITH 1GVZA 1FNIA 5BPEA 1O5CB 1AD8H 3OY6U 1DVAH 1P2NA 1W14U 2F9NA 4TWWA 1VR1H 4NGAH 2BY8X 5GIBA 1O2WA 3RLYH 3RXJA 3F9HA 4CRDA 1BCUH 3TK6A 2CV3A 3S7HB 4JZ1A 1YPEH 5AFZH 1SGQE 1M9UA 1W0YH 2XBXA 5GJ4B 2BM2A 1HIAA 1G9IE 2IOTA 1KY9A 1T7CA 4IS5A 1GMCG 4NG9H 2ZCHP 5FX6A 1MKWH 1O2IA 3ITIA 2F9BH 3BEUA 3ZVEA 1O5BB 3WY8A 4NWKA 4JYUH 3ZZ6A 3VB3A 1O3CA 2BQ6B 1KXDA 1EOLA 4XBCA 4AORA 3T5FH 2NU3E 1QNJA 5C67A 1OWEA 1AB9B 2OQ5A 2ZDMA 2HGTH 1LHDH 4YLUA 3ZYDA 3MNBA 3PB1E 2ZGXH 1RRKA 2HPQH 4UE7H 1XUHA 3A8DA 5FCRA 1CE5A 1BRCE 3HKIB 1WSSH 1BB0B 2P3TB 1Q31A 2JH5D 2GZ9A 3MTYA 3F9FA 1EQ9A 3TGIE 1SVPA 1LKAA 5LGOA 3RP2A 1O3BA 3N7OA 4AB8A 2A31A 4NIVA 2EI6A 3ZZ9A 1XX9A 2VVVA 2GCTB 1DSTA 3I29A 3MH5A 3LOXA 3RU4E 2QY0B 1FQ3A 3GY2A 2H1UA 3P8GA 2AMPA 2ULLA 3SNBA 1K1JA 2P8OC 1GJ5H 3KCGH 4JZDH 1K1IA 2GZ8A 1BMAA 1MTSA 1ARBA 1AIXH 4FUIA 1EPTB 2A5IA 1S83A 4FU7A 4WVPE 1EAWA 4YOIA 1GHWH 4O03A 5JBTA 1WCZA 2OTVA 1GI1A 2ZEBA 4AG2A 2PHBA
chains in the Genus database with same CATH superfamily
4TT3D 2FI5E 3UOUA 3RC6A 3M7TA 3UQVA 1QIXB 3VPKA 3A85A 1LVOA 1S6HA 4CHAB 3SI3H 4O3TA 2J98A 3V0XA 4H42U 4K1SA 1C2JA 3RMOH 5FXLA 3WW7A 4GCHF 2GX4A 4F55A 1O5GH 5FPTA 4FUHA 5E2OA 4NA9H 1SQAA 5LPFA 1BHXF 1Z6EA 2STAE 4GHQA 4YXWD 1C2LA 2H5CA 3ZVBA 1E35B 2UUJB 5GCHF 3LH1A 2QXHA 2CHAC 3CS7A 2ZU5A 5GDSH 3ZVGA 1MU8B 1SGRE 4UDWH 1MMJN 5A8YA 3L33A 1AVWA 3GS9A 2FM2A 3RLWH 2F83A 3H7OA 2C90B 1QCPA 2STBE 4B76A 2UWLA 1COWD 1BBRH 2M2AA 3PMHB 4D9RA 3DD2H 4X2XA 2FOMB 1B0EA 3Q00A 1Z71A 4X6PA 1O34A 2F9OA 2AEIH 4AOQA 1SLUB 2QE7D 5JBAS 3RUOA 2Y7ZA 4MDSA 1GI5A 1EAIA 2ASUB 4MNYA 1XUIA 3SOSA 5AHGH 3PRBA 1CGHA 1SFQB 1VKYA 1SQRA 3PROA 4WJG2 3VXFH 1QBOA 2J2UA 1V2KT 2VVUA 4ZMAH 1AY6H 1EUFA 1PPBH 2V6NA 3MNXA 2J9NA 1YLDA 2W6JD 3SI4H 2ZFTA 2AGEX 1O32A 1ABIH 2HALA 1NU7B 3NK8A 2C4FH 5AFYH 5E0HA 1T8OA 3V7TA 1ZPZA 1W7XH 1GMHG 4BXWA 1C5OH 3SNDA 3RMLH 3STJA 3OU0A 1DICA 1P9UA 3Q3YA 3E8LA 2O8LA 1O3OA 1SSXA 5DP5A 2XTTB 1TPOA 2ZDVH 1AKSB 3RXCA 1SGPE 1P2OA 1EZQA 3D49H 2FLRH 3DUXH 1V2MT 2ZPQA 3T28A 1ZJDA 3A7XA 1NT1A 1O3DA 1KXBA 1EZUC 1O2XA 1HAHH 2ZHWH 2JKHA 2WPHS 3E16B 3U8OH 1ANDA 1SMFE 3BF6H 1Z1JA 2ANYA 2DE9A 2FESH 2W3KA 3M36A 2BOHB 1G3DA 4I33A 1BMMH 4YESB 1Z1IA 3F0PA 2ZQ2A 1V2NT 3UNSA 4X1QU 1K2I1 1P2IA 3QZRA 4IN1A 1HAGE 3GICB 1IHTH 3UR9A 2PLXA 2ZDLA 3UTUH 2ZGCA 4CH8B 1C5UA 4I8HA 5CHAC 1T8MA 1SC8U 1TNGA 1IQHA 4FUJA 5CHAB 6ESTA 1C2DA 1E36B 1UHBA 1S0QA 1FI8A 2A0QB 1P2MA 1VGCB 4QT8C 1MUEB 2FOGA 2R9PA 3URCA 5J4QA 1KTSB 3S7KB 2ZU3A 4X6MA 1O3AA 3FO8D 5DP3A 2FI4E 1GBEA 2ZF0H 3AAVA 3TU7H 1DWDH 1S6FA 3HKJB 1A5IA 3O8BA 1LHEH 2BD4A 5C1XA 1O30A 3LONA 4NSYA 2Q6FA 1D3QB 3FP7E 4RSPA 1CGIE 2BDCA 3BTHE 4E06H 1O3EA 1W10U 3KN2A 1NFYA 3DSGA 1G3EA 2QIQA 4D9QA 4FUFA 4Y8XA 3S9BA 1W3CA 4TY7A 2PTNA 2J34A 1HAPH 3SUFA 3UOPA 1ABJH 3G01A 3RXRA 3H5CB 1Y3YA 1A0LA 2ZPRA 1AE5A 5F6MA 3SORA 1F5LA 1ZGIA 1UVOA 2OBOA 2B5TB 1O2HA 4I8JA 4ISHH 4DT7B 2BQ7B 2SFAA 1GL0E 2KFWA 1EPTC 4FUEA 1OP0A 2Z9JA 3PLKA 2YNAA 2EQNA 5EODA 2QYIA 3E3TA 1QB9A 3BTTE 5GWZA 1INCA 3PO1C 3GYLB 1A4WH 1TE0A 2HNTC 2AGIX 1H1BA 3ZIAD 1RIWB 4YTAA 2PW8H 2H9TH 1KXCA 3SU5A 2KX4A 2KR7A 1QA0A 1W2KH 3P70B 4O9VA 2PKSC 1SFIA 2PKSB 2A1DB 3OSYA 1EKBB 4Q80A 4IGDA 1YBWA 2Y82A 4Q63A 2G5NA 2KM0A 2BOKA 3M7UA 2UUKB 3M5MA 4GVUA 1XUGA 2BY6X 3ESTA 1ZRBA 1OWJA 2QAAA 2WPLS 2C3SA 3KQBA 1GGDB 1DLKB 1V2TT 3Q76A 3VXEH 3K2UA 1Y5AT 3OY5U 1NRNH 4Y7BA 3SV8A 1ZOMA 3PMJA 1NY22 1ELBA 4AYVB 1UCYE 5A0BA 1E1QD 2Z3DA 4ABAA 5JB8S 1S6LA 3MU4A 4UEHH 1XMNB 3BN9A 1TWXB 1BRUP 1ZSJA 5KGOA 4FUCA 1FMGA 3VEQB 2IPHA 3EAJA 1IQNA 7GCHG 3NRLA 4K8YA 2BHGA 2CMYA 4ISNA 1YPGH 5DJ7A 1P8VC 2H5DA 3UNQA 6LPRA 4K60A 2BY7X 2P94A 1QZ8A 2HWLB 3MH7A 1KLJH 1V2WT 2BZ6H 2NU0E 4IC5A 1C1QA 2ZDNA 2A5AA 4NSVA 4Y0ZE 4MVNA 5T6DA 4AC9A 5K7RA 1V2UT 2FOBA 1AWFH 1U6QA 3PTNA 1G2LA 2SNWA 4WMFA 3EE7A 2QV1A 1MZDA 2XC5A 1HJAB 2KCOA 4F48B 1GJDB 2AGGX 1DXPA 2TGAA 3U9AH 4MNWA 4UFDH 1IQFA 1O35A 4A1XA 1E34B 1YYY1 1TGCA 3FP6E 4RKJB 1XVOA 2ZFPH 5LPRA 2OBQA 2TGPZ 3RM2H 1UTQA 1QQUA 3SU4A 1G3BA 1NFWA 1XXDA 4INKA 3SYJA 1QRWA 4ZXXH 2BXUH 5HIYA 2KAIB 5EJZA 3LC3A 2ZO3H 4MPUA 2FX6A 2WV5A 1TBQH 5A2MH 1C2KA 1GCDA 5EPYA 2FXRA 1C1SA 2OXSA 3UAIC 4D76A 1ORFA 1C1MA 4LK4A 1ZGVA 3EGKH 3SJ9A 1GI0A 1CQQA 4KELA 3U28C 4FVBA 3SU0A 1OX1A 1C5ZB 1V3XA 1WQSA 1TNIA 3MU1A 1FDPA 3QTOH 4MPVA 1CGJE 2XBYA 5G4BA 5DP9A 1NBME 4ISOA 2FZZA 5TCCA 4ISIH 3EYDA 5TJXA 1GI4A 1HJ9A 2GP9B 4A92A 3BTEE 2QF4A 4JYTA 4B1TA 2FX4A 2J98B 4DIIH 1C5RA 4Z0KA 1TB6H 1XM1A 2PV9B 1N8OC 1W0KD 3OTJE 3FKSD 3GCNA 1O2LA 1SOTA 3LPRA 1GBJA 2FYRA 1WXRA 1ELGA 1THRH 4CBOA 2ZDKA 2BD2A 1W0JD 5C17A 1V2ST 4AFSA 1SR5C 5EOKA 3P92A 1QR3E 2JDID 3A7TA 3VB6A 2BD9A 3T27A 4BAMB 2LELA 3BTDE 1SGDE 1MH0A 3P6ZB 2BXTH 1PPFE 1TRMA 5CHBA 2RDLA 2UUFB 3RU4D 2WUBA 1HAOH 2OUAA 4DW2U 3NUMA 3PV2A 2GV6A 4WH8A 2FODA 2LP6A 3FAOA 3BTQE 5C20A 2OC0A 2ZCKP 5L6NH 1AMHA 1ZJKA 1OHHD 2CF9H 3DHKH 3TJNA 1BJUA 3OEED 1V2QT 3M5NA 1A7SA 2SGFE 1N8OB 1FN8A 1K9OE 1OWKA 5T6FA 1O0DH 4U32A 1Z7KA 1VITG 1V2JT 4CBNA 1OWDA 3RM0H 2GCHF 4K5ZA 3S69A 3QK1A 1UVTH 2VGCC 1UO6A 2Z7FE 4IW4E 5DP4A 5JB9S 2BB4A 1AFQC 1GVLA 1GHAG 4M9FA 5C94A 1J8AA 3LJJA 1HDTH 1UJ1A 2FWWA 4Q4LA 1HAXB 2VINA 1Q3XA 1G30B 3K6YA 3UY9A 1C1OA 1ZPBA 9ESTA 1GI7B 4SGAE 1FY3A 2GMTB 4FU8A 1C1NA 2VIQA 3GOVB 1IQEA 5FHTA 1PYTD 2BYAX 3KNXA 4YT7H 3ELAH 1PQAA 2FOEA 3A80A 1TRNA 3RXMA 1FZZA 3C1KA 2A4RA 1H4WA 3PLPA 5F8ZA 2CN0H 1AKSA 1DWBH 4MNVA 1NBMD 1YGCH 4IMQA 3BTWE 5DSFA 3D62A 4FVDA 1DOJA 2GTBA 2ZU2A 2BD3A 2PSXA 1CA0C 1GG6C 1MKWK 2GJGA 1Y3UA 2FLBH 1FPCH 2BVXH 3SGBE 4CRCA 1XUKA 3NWUA 1CBWC 1YPHC 3CS0A 2OINA 1IQMA 5E0GA 3HGPA 1C2FA 2HNTE 4ZCNA 1EXFA 1QA7A 2BX3A 2CXVA 4JCNA 5HM9A 1C1PA 3B23B 2Z3CA 1AVXA 1PQ7A 1FY5A 3ATLA 1TBRH 3FZZA 1GL1A 1BA8B 5DK1A 1TX8A 2KCAA 1C9PA 2HRVA 3K6ZA 1FJSA 4ISLA 1BBRK 2SGAA 2WV9A 1ANBA 2WYGA 1NU9A 2NU2E 5KEDA 5A09A 3QTVH 3UFAA 4FETA 2A32A 3OEHD 3EE0B 1V2LT 1UHBB 1ZTLA 4ZHAA 1Z8RA 3KIDU 3S9AA 3ZV8A 1W8BH 2KAIA 3TK5A 3ZVCA 5B6OA 2WZQA 6CHAC 3BV9B 3ZZ7A 1FN6A 2EC9H 2V3HH 2HVXA 2Q6GA 1TOMH 2SGPE 5C1UA 1SLWB 1YY3A 4AYYB 1AI8H 4GLYA 1ELVA 4X2YA 2ZIQH 5FL7D 4X1PU 3RMNH 2RG3A 2ZKSA 4FUDA 4GUXA 3STIA 3ZZCA 4BXSA 4DVAU 1GHBF 2BLWA 4NCYA 2FOHA 1DPOA 3F9GA 3BEIB 3KF2A 4AGKA 2F91A 1FV9A 3GDUA 3I78A 1TAWA 1O2JA 4J2YB 4DOQA 2V3MA 2AYWA 2XC0A 2BQWB 1UMAH 2ZHEH 1GHZA 5A8XA 2ZU1A 1A46H 1ESBA 1H8ED 1HPGA 4WXVA 2FO9A 3RXOA 2VJ1A 4Q7ZA 3WWBA 1AFEH 1OWHA 1O2TA 1TYNA 3A88A 1D3TB 4THNH 1C2HA 2SGQE 1KLTA 5KECA 1GJ9B 3SHAH 1EAXA 4Y7AA 2R3YA 4ESTE 5PTPA 1C5TA 3T2NA 1RTKA 3K65B 1O3LA 3LGUA 3M3TA 3GCHC 1CT4E 4YLQH 1ZSLA 1B7XB 4E05H 2PKAB 1TRYA 1YKTA 1O3HA 4ABFA 3AASA 3UR6A 3MNSA 4JZFH 5EXLA 5F53A 2A4GA 4BAKB 2RCEA 3QZQA 1TNHA 3QN7A 3DCLA 1FAXA 4FUGA 1AZ8A 1T4UH 3P8NA 2R2WU 1HLTH 4DCDA 2I6QA 2ZFSA 1UTOA 8ESTE 2Q1JA 1DE7H 1JXPA 3V12A 1CT2E 1UTJA 1LPGB 4KTCA 2YNBA 1GHBG 1LKBA 1SG8B 1GJCB 2O8TA 3T29A 1P01A 1TQ7B 4U01A 1OS8A 5EG4A 2QGRA 2V0BA 2PR3A 3EA8A 1BTUA 2ZGJA 5DG6A 5DPAA 3E0PB 1NESE 1RJXB 4A1VA 4JZIA 3DT0H 1G3CA 1RTFB 2BDBA 1O3FA 5B6LA 2VWLA 1ACBE 3ZZAA 3GCOA 3HK3B 4ABJA 1C5MD 1P2JA 2DUCA 2ZNKH 2GD4B 3F1SB 4CREA 1W11U 3SU6A 3A84A 4Y11E 4B2AA 1AWHB 1P05A 1KLIH 4TPYA 1C2EA 1OKXA 3VB7A 1TNLA 3VB4A 3OX7U 3H09A 2AMQA 2THFB 1GI8B 1DX5M 2PWXA 1ESAA 1QL9A 1TGNA 1Q2WA 1J15A 1EP5A 2FTMA 1X7AC 4ZUHA 1G36A 2ZGHA 3VB5A 1K1OA 1GMDG 2PFEA 4K69A 1C5SA 2HVYB 1ID5H 2BY9X 1C5WB 1PFXC 1FONA 2WPJS 3RXBA 2Z3EA 2TIOA 3ZVDA 2H6MA 1A0HB 1LVYA 1ZRKA 3SZEA 1O36A 4ABGA 1IOEA 3LGWA 1O5AB 4ZAEA 3TGJE 5FPSA 2FEQH 1YPHE 3E0NB 1QTFA 3QUMP 1SLXB 1GCTB 1O5DH 2O8MA 3RXEA 1QRZA 4MPXA 1WOFA 2ZGBH 1YCPM 3BG8A 1QL8A 5T3HA 3K9XB 5FCKA 2PUXB 1A0JA 4XSKU 1QFKH 2VBCA 5SGAE 1JMOH 2A7CA 3A7YA 2QF3A 1UTPA 2Y5HA 2ZTXA 3AAUA 4TWYA 3A8AA 2VWMA 3SUEA 4CH2B 1HV7A 2P95A 2K1QA 3GCTF 2PGBB 3ZZBA 4BAOB 1TQ0B 2AERH 2UUYA 2F9VA 1EFRD 3AW0A 3R3GB 1CU1A 1D3PB 5HXFA 1L4DA 2Y81A 1ZTKA 3E6PH 4GSOA 4Y71A 4LZ1H 1ZLRA 1PYTC 3SGQE 1NO9H 3MMGA 9LPRA 1PJPA 5HGGA 2F9UA 1THSH 1C5LH 2FTLE 2ZDAH 1MBMA 2GDDA 1NRQH 2XNIA 2VVCA 1QGFA 1YPMH 3BTGE 3RXIA 1SGTA 4O3UA 4YZUA 1RGQA 1DLEA 4HFPB 4NZQA 1P11E 1BT7A 1MABB 5A8ZA 4IC6A 4XFQA 1NPMA 1OP8A 2XCNA 1CA0B 1GG6B 1EZXC 1Z8JB 1CHGA 2VH0A 5HKKD 3A82A 1MD7A 4GHTA 4Y0YE 1K1NA 2PGQB 1GGDC 2FPZA 1S5SA 3DA9B 1CA8B 3MU5A 3ODDA 1C2MA 3TH2H 3QWCH 1F0RA 3PWBA 1ESTA 2BDYA 3RXTA 2FMJA 1BTPA 1BMNH 4K1TA 1S0RA 1AVGH 4X1SU 1F0UA 1LPZB 5ABWA 1O3KA 1CHOG 1BOQA 4YM9A 1N6XA 1O3MA 1YPKH 3RXUA 2PKAA 2R3UA 2JH0D 1F0TA 1HB0B 2TGDA 4AN7A 1VCQA 1O2MA 1C5YB 2Q6DA 1JWTA 3S9CA 1TALA 1ELEE 4YT6H 4FXGH 4NFFA 3AK5A 2W7UA 1ELFA 3SN8A 1C1TA 4WY3A 1V2PT 4K2YA 3ZV9A 2A5KA 3NKKA 8KME2 3M5LA 1LHGH 4OS4A 2WINI 3HGNA 2XRCA 5DN6D 2H9EH 3SUGA 5EQRA 5DO4H 1V2VT 3FZDA 3RC5A 4R8TB 3V3MA 3DSOA 4ZHMU 2P3FH 3PMAB 1ZSKA 2D1JA 1BTXA 2B9LA 1EJMA 2W6ID 1O2NA 2WSSD 1P3CA 2BD5A 4XOJA 1W13U 4CRBA 1GBLA 3S0NA 2VB0A 2KCPA 4Y8YA 1K22H 4UFFH 4RI0A 4TSFD 4WF8A 5A0CA 1A3BH 1GI6A 1MTUA 4F4OC 1WDIA 1SGEE 1Y3WA 2J4IA 2GVFA 2P16A 4JZEH 2QF0A 4Q7XA 5CDFE 6GCHF 1SBWA 3RXKA 3BG4C 1SGCA 1EZSC 2FDAA 2IJOB 5EU8A 5K0HA 4CR9A 1AE8H 2G51A 3QLPH 3SW2B 4BTUB 3AW1A 1TNKA 4B6FA 3GDVA 3NPSA 1C2GA 3SJKA 1Y3VA 2XBVA 1JIRA 3M7QA 3RXVA 4CHAC 2GCTC 2Y5FA 1LMWB 2QCYA 4IN2A 5E2PA 4X6NA 4YOJA 1RFNA 3U1IB 1EJAA 2P59A 2PUQH 3IG6B 1BUIA 4IBLH 5EGMA 1PPZA 4KKDA 1KXEA 1F7ZA 4ZXYH 1QL7A 1CO7E 2Z9KA 1LVMA 3EA7A 1L1GA 4PROA 2LNCA 5LH8A 3LU9B 3DFJA 1QB1A 3M35A 3T62A 5DKMA 1GHYH 2ILNA 1QQ4A 5JYIA 2GZ7A 1C5VA 4OM9A 1ZYOA 3M61U 2A2XH 1MBQA 1UK3A 2J94A 2HNTF 5H4IB 5TCAA 3FVFB 5HM2A 2FOFA 2ZFRH 5IYTA 1WU1A 4A1TA 2CGAA 2ZWLH 3LGTA 4XDEA 3ATMA 1XUJA 4JK5A 1A2CH 5EQQA 1DUAA 4ZHLU 1P04A 3LIWA 2BMGB 2O8WA 4WMEA 3PV4A 4E7NA 2ZHQH 3URDA 4KTSA 2RA3A 1GDUA 1MTVA 1NTPA 1GMHF 3P8OA 1OPHB 1E38B 2WV4A 1GMDF 1TFXA 1D3DB 1D6WA 4DGJA 4OS5A 1YCPH 4E7RG 1EJNA 3V13A 1MCVA 6GCHG 3RU4T 4BTIB 3KYGA 3JZ2B 1O3NA 1SQOA 3RXLA 1AB9C 2IN2A 3BTFE 1QURH 2EY4C 3MH6A 3PO1B 2VH6A 2EEKA 2BY5X 2TRMA 1W7GH 2EI8A 1H9LB 5BRRE 1NFXA 3M3VA 1AUJA 2P3UB 1B5GH 1F5KU 1SGNE 3I77A 3AVZA 2XNDD 4NWLA 1GJ4H 1ELDE 3KYFA 4J1YA 4X8SH 1C5PA 1H8DH 3VGCC 4TYDA 4ABEA 2OC7A 3TVJB 1WTHD 2W5EA 2UWPA 3EA9A 1UVSH 1T31A 2XW9A 3PWCA 3GCTG 1F2SE 1SPJA 1GI3A 1QY6A 1VZQH 1PPCE 4DJZB 1KTTB 4RN6A 1KMHB 1J9CH 1NC6A 1TGBA 4LOYH 2ODYB 2A45B 4JMYA 2V3OH 3OTPA 3SNEA 1O3IA 1O2OA 1GBFA 1YPLH 1FY1A 1WYKA 1MTWA 1NS3A 1YPJH 4MQAA 2FIRH 4LZ4B 2Z9IA 1QRXA 5IDKA 4BAHB 2NU1E 3UUZA 1A5HA 3A83A 3RXDA 2D2DA 4AFQA 1L1JA 2BVSH 1ZTJA 4YO9A 3TJUA 2V7QD 3SU2A 1O37A 2Y6TA 2ZC9H 2QN5T 2UWOA 2G8TA 7ESTE 2A7HA 2D8WA 1TPSA 4F49A 1UCYH 5C3NA 3T26A 5JBCS 1HAIH 2EA3A 3U8RH 2XCFA 3ZZ8A 1UTMA 1MCTA 1E1RD 3ATKA 4XBBA 3MWIU 1LTOA 2BDIA 1TX7A 3ZZ3A 1SGFG 1WAYB 3LDXH 3A86A 2J38A 4AGJA 1UTLM 2VIPA 1H9IE 3GCHB 1TA2A 3BTME 1HXFH 4ASUD 1RXPA 2BVRH 3FOAA 2FOAA 1GI2A 2YMSB 3M3SA 4O97A 3GY7A 3T25A 2O8UA 3M5OA 1O33A 1C1UH 3JZ1B 1HGTH 3ATIA 1DWCH 1V6DA 4X6OA 3SJ8A 4OGXA 1ZMNA 4I86A 5EXMA 5C0UA 1GMCF 4KP0A 2C8YB 2H2ZA 1KXFA 1PQ8A 5J4SA 4NA7A 1C4V2 4DIHH 3C27B 3RXPA 1C4U2 1GI9B 3CNRA 3TH3H 1GWAA 4NA8A 1BMLA 3TPIZ 5GCHG 3E1XB 3DFLA 2C93B 2OC8A 1KSNA 5FAHA 2G4UA 1E0FD 1AN1E 1BHXB 1GDQA 1GBKA 1HCGA 1TABE 3TLOA 7GCHF 5E0JA 1GJBB 1AHTH 1E37B 1TGTA 2BTCE 1GJ6A 2XYAA 5DP6A 1YCPK 1AO5A 1FX0B 3PTBA 1P06A 1HYLA 1FXYA 3B8JA 1SL3A 4H6SB 1D4PB 3LGIA 3P95A 4HTCH 1LQDB 2PSYA 1RTLA 1Y5BT 2DE8A 2OQUA 1P57B 1ARCA 2XC4A 4XE4A 1TONA 4WXIA 1ZMJA 1Y8TA 3NZIA 2B7DH 3RXAA 1TPPA 6CHAB 1SLVB 3ZZ5A 1BDAA 1MAYA 3SV7A 1P0SH 4MNXA 3RDZA 2ZA5A 1XKAC 2A2QH 3BTKE 1XUFA 2K8IA 1MU6B 1O39A 1O2KA 5EJ1A 2TGTA 3F3BA 4OS6A 8LPRA 1XXFA 3R0FA 4Q7YA 1IHSH 4XD7D 2HLDD 1IQLA 4CRGA 3MOCA 1AFQB 3MO6A 1UW7A 3F9EA 1WUNH 2NU4E 2WPDD 1CT0E 5AVDA 1DY8A 3KGPA 5T1VA 4FUBA 4K8BA 1S85A 2GDEH 1DXWA 1O2RA 2ZU4A 1PQ5A 5DGJA 1ETSH 2OLGA 3U8TH 1TMTH 1ELTA 1C1WH 4CRFA 3RMMH 2AMDA 4KGAA 3A7ZA 2BZAA 2BLVA 1BRBE 3SZNA 4B74A 1IQIA 2TPIZ 3LKWA 4OS7A 3D23A 1EB2A 5JPMH 1P09A 1UCYK 4XBDA 3PRDA 1P2KA 1O2YA 4B2CA 5I46H 1Y5UT 3OAAD 1D9IA 4AG1A 1P12E 2GT7A 4HI3A 2G00A 3TJVA 4ZKNU 1A61H 2XWBI 4I8KA 2FS8A 1ELCA 1UK2A 1AGJA 1SHYA 1Z8IB 1C2IA 2ZG0H 4UFEH 2C8ZB 1BQYA 1TGSZ 4B71A 4CR5A 1VGCC 4X0WU 1JIMA 2F43B 3U69H 5DP7A 1ANCA 4A5TS 5L2YH 1LCYA 1KYNA 1OYTH 2Y7XA 1CVWH 1KDQA 4VGCC 3UNRA 5ESBA 1UK4A 5HIZA 1QB6A 1E79D 1DFPA 1O38A 3SNAA 1L0ZA 2G81E 3RC4A 3EDXB 3NXPA 1GJAB 2J97A 3HATH 1HAVA 1TX6A 1EOJA 4NIWA 3A8BA 2QA9E 2XXLA 4M7GA 4X8TH 4I7YH 3LGVA 2ZFQH 2VU8E 1QHRB 3RXFA 8GCHG 3O8CA 3FANA 3SQEE 4HGCA 2ZTZA 5C0TA 1THPB 2GV7A 1LPKB 3A8CA 5EIYA 1A3EH 3TGKE 2R0KA 4TPIZ 4I32A 2B8OH 3N7DA 1GBBA 4SGBE 1TOCB 3UWJH 3L3TA 3MH4A 3QX5H 2OC1A 4JYVH 3KQCA 1FY8E 1HAYB 3VGCB 3PYHA 3P8FA 4H6TA 4U30A 1N1LA 4UD9H 1YWUA 2GCHG 4Y76A 2FI3E 2HPPH 1O3JA 4H4FA 3MO9A 4K1EA 2J5UA 1V2OT 1HAZB 4BOHA 5C2ZA 2B0FA 1WTGH 2L74A 1O2GH 1HJAC 1FY4A 2Z9GA 5L30H 1MTNB 5C5NA 3QGJA 4NIXA 4HG6A 2AH4X 2QXIA 4WWYA 4AFZA 4AZ2B 1P02A 2YMSD 3O8RA 1B0FA 2WYJA 1Y59T 2Z94A 1ANEA 3U1JB 1EASA 3RXGA 4BAQB 1VCPA 3GY5A 1DWEH 3IWMA 1BTHH 3Q3KA 4ABHA 3HK6B 2VWOA 5C5OA 3A7VA 4D7FA 2L6OA 1NRRH 1CBWB 8GCHF 4ABIA 4ZROA 1EP6A 3ZVFA 1T8NA 5EW2H 1Z8GA 1C5QA 2JH6D 2QXGA 1HBTH 2G52A 2BDGA 1OYQA 2R2MB 2I6SA 1O3PB 1BJVA 3O8DA 3SQHE 1JRTA 2G4TA 2GGVB 2WUCA 1O31A 1P2QA 4ZH8A 5EXNA 1O2VA 1A5GH 4ZKRU 3ZZDA 3L6PA 2BDAA 3GYMA 1O2PA 2ZFFH 2QF5A 5L2ZH 4K3JA 1LHCH 4X1RU 7LPRA 4ZKSU 3UWIA 1MTNC 2J95A 4MG3A 1O5FH 1ZZZA 1L4ZA 4NZLA 5F03A 2P8OB 1SQTA 3BSQA 5AF9H 4DY7B 3F2FA 1BBRE 1GBDA 4AX9H 4DG4A 1TA6A 4I8LA 2A4OA 2ALPA 3PM3A 4X2VA 2TBSA 1PPHE 2ANWA 5C1YA 2V35A 2W7SA 1O5EH 1TBZH 2Y80A 1G37A 3LT3A 4DURA 1DANH 2AFQB 4YOGA 1OSSA 4U2WA 2ESTE 1MAXA 3F68H 4IMZA 3TJOA 1HUTH 3KL6A 2VIOA 3FFGA 1AZZA 1HNEE 3MNCA 1T4VH 3SV2H 3P17H 3E90B 2WPMS 3F6UH 2VIDA 3CENA 3ZZ4A 1VJAU 4B6EA 1GBMA 5F8TA 2C8WB 4GAWA 3LJOA 4KTUA 2A7JA 5EPNA 1J14A 2BD8A 4OS2A 3FP8E 5CE1A 2JJ1D 2ZECA 2J92A 1VCWA 3UQOA 1TNJA 4VGCB 1IAUA 1BTWA 4B73A 1W12U 2IJD1 5FX5A 3DSPA 2PTCE 1RD3B 1KDQB 1GBCA 1H9HE 1K1MA 2JETB 5FPYA 1SB1H 2JETC 2ODQA 4OS1A 4P02A 2VIVA 3TK9A 1HAVB 2Z6BD 1P3EA 1TLDA 3NCLA 4AFUA 1GCTC 1L1NA 1IQKA 3PLBA 3QO6A 1JBUH 4FOUC 3SHCH 2WPIS 1CHOF 5DP8A 1DM4B 3N99A 5GPIB 1UTNA 3B9FH 1DDJA 1Z6JH 3EQ0H 3UB0A 2GT8A 1T8LA 3GDSA 4ASHA 1SOZA 1ZR0A 1N6YA 3BG4B 2R0LA 2VWNA 1EPTA 1P10A 4X8UH 1UVUH 3MHWU 1MZAA 4ABBA 3ATWA 3OFND 1PPEE 2Y5GA 3A7WA 4BANB 1WV7H 2OP9A 3LH3A 1SHHB 3H7TA 4I31A 1QJ6B 1HFDA 1MD8A 2ZQ1A 1F5RA 1VITF 3RXSA 4Y8ZA 3RXHA 1UVPA 4Z6AH 1ZHMA 3PV5A 2K0QA 2BLOA 1W0ZU 1HRTH 1G2MA 1MQ5A 1C9TA 1GHAF 3SU1A 3OYPA 5FBEA 4B75A 1C5XB 4AB9A 1DS2E 1BRAA 3TITA 1AU8A 1QBVH 1QJ1B 2BDHA 5HMAA 3Q3XA 3SGAE 1S81A 3KEEA 3KQDA 1FIZA 4ACAA 1BITA 1K1LA 2F4LA 7KMEH 1P03A 2ZI2H 1SKYE 3A81A 4CRAA 2BX4A 1C5NH 1FUJA 2LPRA 3ODFA 3W95A 1NZQH 3MO3A 1IQGA 3A89A 5LPEA 2W3IA 2KCYA 1LDTT 3SBKA 2YOLA 3ENSB 5F8XA 1S84A 4BNRA 3SO3A 3BIVH 3ZVAA 1CSOE 1MKXH 3HPTB 3ZYEA 4RKOB 1OP2A 1A1RA 3LC5A 5I25A 1ETRH 1GHVH 1OWIA 3UREA 1NN6A 1GDNA 3MFJA 1GBTA 5E8EH 2XWAA 1K1PA 1KIGH 1TIOA 2D26C 1MQ6A 2HLCA 1G32B 2ZHFH 3VFEA 1DT2A 2WPKS 1WQVH 4A7IB 4D8NA 1HIAB 3RXQA 1AQ7A 3PMBB 1O3GA 4MTBA 3GISB 3D65E 2ZP0H 1BTZA 1PPGE 1Y3XA 1GBAA 5T6GA 1AUTC 1SGYE 4Y6DA 2AS9A 1QJ7B 1EB1H 3GY8A 2ZPSA 3F2GA 1O2SA 4WH6A 1F92A 4INLA 2BD7A 1ELAA 1YM0A 1GBHA 4R0IA 1XKBC 2FP7B 1NRSH 4RT0A 2ODPA 1LO6A 3CP7A 2FOCA 1WBGB 1BMFD 2H9HA 1DUEA 3KQEA 3SU3A 2QC2A 2AHME 1LQEA 2SGDE 1EAUA 3TH4H 5GXPA 2P93A 4A6LA 4Y79A 3Q77A 1GJ8B 1LVBA 1NFUA 3TIUA 5HYOA 2OD3B 2JJ2D 3OE7D 3LGYA 4LXBH 3MYWA 4UFGH 1ZHRA 2OCVB 2CHAB 4TY6A 2ZCLP 3IITA 1DY9A 2FYQA 1T32A 2M5TA 4X2WA 2BLQA 3SUDA 3MU8A 3TNSA 2FS9A 3GY6A 1YF4A 1JRSA 3M37A 1SI5H 1RIWC 1IQJA 4I8GA 1UTKA 3FN8A 4HZHA 1BZXE 3SV9A 1NRPH 2A4QA 1O2QA 2Z9LA 3U98H 2RFKC 1XVMA 2QXJA 2CF8H 1ZMLA 4ABDA 1LHFH 4B2BA 1H8IH 1SGFA 3TNTA 2JIZD 2O9QA 1VJ9U 4FU9A 4INHA 5JDUB 1OOKB 1YP9A 2F9PA 3SNCA 3KHVA 3SJIA 3N7EA 1BTYA 1RS0A 4ZKOU 2EI7A 1GJ7B 1MKXK 2RA0A 1HJ8A 1ZPCA 4X1NU 2XOKD 1FAKH 2C8XB 1TPAE 1BIOA 2VGCB 5JBBS 2SNVA 1FIWA 2CJIA 3W94A 1K0HA 4GPGA 5CMXH 3SJOA 1TMUH 3MU0A 2XBWA 2ZHDA 5ESTE 2ZZUH 3UPEA 1DSUA 1NROH 1ZHPA 4Y10E 1F0SA 3BEFB 1C1VH 3KQ5A 1NM6A 4Q2KA 3E91A 5GNDA 1VITH 1ETTH 4JK6A 3W1EA 1FPHH 1GHXH 1D6RA 1YC0A 2VNTA 4NIYA 3UIRA 4WMDA 4RT1A 2F3CE 3BIUH 2ANMH 1P9SA 1EX3A 2HOBA 1GPZA 4MPWA 1H8HD 1EATA 1K28D 1S82A 2WHXA 3MI4A 1OXGA 2ZTYA 4D7GA 1QBNA 2GMTC 2AIPA 3F2HA 4BTTB 1C1RA 1JOUB 3QGNB 3VG8A 1J17T 5FBIA 2SGEE 1O2ZA 1V2RT 3A87A 1C4Y2 3QDZB 3GY4A 1TMBH 2W26A 1YLCA 4OGYA 2ALVA 2G55A 2NWNA 4UONA 2GKVE 1J16A 2ANKH 1GBIA 5A0AE 1K21H 2CK3D 1SGIB 3GY3A 3SV6A 2OK5A 1L2EA 2AIQA 5EQSA 1FLEE 4GCHG 2VIWA 1HXEH 4NFEA 4X8VH 2G5VA 1GVKB 5ETXA 1KXAA 1O2UA 4MLFB 5EW1H 1DITH 1GVZA 1FNIA 5BPEA 4DT4A 1O5CB 1AD8H 3OY6U 1DVAH 1P2NA 1W14U 2F9NA 4TWWA 1VR1H 4NGAH 2BY8X 5EJLA 5GIBA 1O2WA 3RLYH 3RXJA 3F9HA 4CRDA 1BCUH 3TK6A 2CV3A 3S7HB 4JZ1A 1YPEH 5AFZH 1SGQE 1M9UA 1W0YH 2XBXA 5GJ4B 2BM2A 1HIAA 1G9IE 2IOTA 1KY9A 1T7CA 4IS5A 1GMCG 4NG9H 2ZCHP 5FX6A 1MKWH 1O2IA 3ITIA 2F9BH 3BEUA 3ZVEA 1O5BB 3WY8A 4NWKA 4ACBA 4JYUH 2YMSC 2RDEA 3ZZ6A 3VB3A 1O3CA 2BQ6B 1KXDA 1EOLA 4XBCA 4AORA 3T5FH 2NU3E 1QNJA 5C67A 1OWEA 1AB9B 2OQ5A 2ZDMA 2HGTH 1LHDH 4YLUA 3ZYDA 3MNBA 3PB1E 2ZGXH 1RRKA 2HPQH 4UE7H 1XUHA 3A8DA 5FCRA 1CE5A 5IK2D 1BRCE 3HKIB 3MQKC 1WSSH 1BB0B 2P3TB 1Q31A 2JH5D 2GZ9A 3MTYA 3F9FA 1EQ9A 3TGIE 1SVPA 1LKAA 5LGOA 2KZ4A 3RP2A 1O3BA 3WWFA 3N7OA 2IPQX 4AB8A 2A31A 4NIVA 2EI6A 2PP6A 3ZZ9A 1XX9A 2VVVA 2GCTB 1DSTA 1YLNA 3I29A 3MH5A 3LOXA 3RU4E 2QY0B 1FQ3A 3GY2A 2H1UA 3P8GA 2AMPA 2ULLA 3SNBA 1K1JA 2P8OC 1GJ5H 3KCGH 4JZDH 1K1IA 2GZ8A 1BMAA 1MTSA 1ARBA 4XRNA 1AIXH 4FUIA 1EPTB 2A5IA 1S83A 4FU7A 4WVPE 1EAWA 4P00A 4YOIA 1GHWH 4O03A 4Z1MD 5JBTA 1WCZA 2OTVA 3F0OA 1GI1A 2ZEBA 4AG2A 2PHBA
chains in the Genus database with same CATH topology
2FI5E 3UOUA 3RC6A 3M7TA 3UQVA 1QIXB 3VPKA 3A85A 1LVOA 1S6HA 4CHAB 3SI3H 4O3TA 3V0XA 4H42U 4K1SA 1C2JA 3RMOH 5FXLA 4GCHF 2GX4A 1O5GH 5FPTA 4FUHA 5E2OA 4NA9H 1SQAA 5LPFA 1BHXF 1Z6EA 2STAE 4GHQA 1C2LA 2H5CA 3ZVBA 1E35B 2UUJB 5GCHF 3LH1A 2QXHA 2CHAC 3CS7A 2ZU5A 5GDSH 3ZVGA 1MU8B 1SGRE 4UDWH 1MMJN 5A8YA 3L33A 1AVWA 2FM2A 3RLWH 2F83A 3H7OA 2C90B 1QCPA 2STBE 4B76A 2UWLA 4D9RA 1BBRH 3PMHB 3DD2H 4X2XA 2FOMB 1B0EA 3Q00A 1Z71A 4X6PA 1O34A 2F9OA 2AEIH 4AOQA 1SLUB 5JBAS 3RUOA 2Y7ZA 4MDSA 1GI5A 1EAIA 2ASUB 4MNYA 1XUIA 3SOSA 5AHGH 1CGHA 1SFQB 3VXFH 3PROA 4WJG2 1QBOA 2J2UA 1V2KT 2VVUA 4ZMAH 1AY6H 1EUFA 1PPBH 2V6NA 3MNXA 2J9NA 1YLDA 3SI4H 2ZFTA 2AGEX 1O32A 1ABIH 2HALA 1NU7B 3NK8A 2C4FH 5AFYH 5E0HA 1T8OA 3V7TA 1ZPZA 1W7XH 1GMHG 4BXWA 1C5OH 3SNDA 3RMLH 3STJA 3OU0A 1DICA 1P9UA 3Q3YA 3E8LA 2O8LA 1O3OA 1SSXA 5DP5A 2XTTB 1TPOA 2ZDVH 1AKSB 3RXCA 1SGPE 1P2OA 1EZQA 3D49H 2FLRH 3DUXH 1V2MT 2ZPQA 3T28A 1ZJDA 3A7XA 1NT1A 1O3DA 1KXBA 1EZUC 1O2XA 1HAHH 2ZHWH 2JKHA 2WPHS 3E16B 3U8OH 1ANDA 1SMFE 3BF6H 1Z1JA 2ANYA 2DE9A 2W3KA 2FESH 3M36A 2BOHB 1G3DA 4I33A 1BMMH 4YESB 1Z1IA 2ZQ2A 1V2NT 3UNSA 4X1QU 1K2I1 1P2IA 3QZRA 4IN1A 1HAGE 3GICB 1IHTH 3UR9A 2PLXA 2ZDLA 3UTUH 2ZGCA 4CH8B 1C5UA 4I8HA 5CHAC 1T8MA 1SC8U 1TNGA 1IQHA 4FUJA 5CHAB 6ESTA 1C2DA 1E36B 1UHBA 1S0QA 1FI8A 2A0QB 1P2MA 1VGCB 4QT8C 1MUEB 2FOGA 2R9PA 3URCA 5J4QA 1KTSB 3S7KB 2ZU3A 4X6MA 1O3AA 5DP3A 2FI4E 1GBEA 2ZF0H 3AAVA 3TU7H 1DWDH 1S6FA 3HKJB 1A5IA 3O8BA 1LHEH 2BD4A 5C1XA 1O30A 3LONA 4NSYA 2Q6FA 1D3QB 3FP7E 4RSPA 1CGIE 2BDCA 3BTHE 4E06H 1O3EA 1W10U 3KN2A 1NFYA 1G3EA 2QIQA 4D9QA 4FUFA 4Y8XA 3S9BA 1W3CA 4TY7A 2PTNA 2J34A 1HAPH 3SUFA 3UOPA 1ABJH 3G01A 3RXRA 3H5CB 1Y3YA 1A0LA 2ZPRA 1AE5A 5F6MA 3SORA 1F5LA 1ZGIA 1UVOA 2OBOA 2B5TB 1O2HA 4I8JA 4ISHH 4DT7B 2BQ7B 2SFAA 1GL0E 1EPTC 4FUEA 1OP0A 2Z9JA 3PLKA 2YNAA 5EODA 2QYIA 3E3TA 1QB9A 3BTTE 5GWZA 1INCA 3PO1C 3GYLB 1A4WH 1TE0A 2HNTC 2AGIX 1H1BA 1RIWB 4YTAA 2PW8H 2H9TH 1KXCA 3SU5A 1QA0A 1W2KH 3P70B 4O9VA 2PKSC 1SFIA 2PKSB 2A1DB 3OSYA 1EKBB 4Q80A 4IGDA 1YBWA 2Y82A 2G5NA 2BOKA 3M7UA 2UUKB 3M5MA 4GVUA 1XUGA 2BY6X 3ESTA 1ZRBA 1OWJA 2QAAA 2WPLS 2C3SA 3KQBA 1GGDB 1DLKB 1V2TT 3Q76A 3VXEH 3K2UA 1Y5AT 3OY5U 1NRNH 4Y7BA 3SV8A 1ZOMA 3PMJA 1NY22 1ELBA 4AYVB 1UCYE 5A0BA 2Z3DA 4ABAA 5JB8S 3MU4A 4UEHH 1XMNB 3BN9A 1TWXB 1BRUP 1ZSJA 4FUCA 1FMGA 3VEQB 2IPHA 3EAJA 1IQNA 7GCHG 4K8YA 2BHGA 2CMYA 4ISNA 1YPGH 5DJ7A 1P8VC 2H5DA 3UNQA 6LPRA 4K60A 2BY7X 2P94A 2HWLB 3MH7A 1KLJH 1V2WT 2BZ6H 2NU0E 4IC5A 1C1QA 2ZDNA 2A5AA 4NSVA 4Y0ZE 4MVNA 5T6DA 5K7RA 1V2UT 2FOBA 1AWFH 1U6QA 3PTNA 1G2LA 2SNWA 4WMFA 2QV1A 1MZDA 2XC5A 1HJAB 1GJDB 2AGGX 1DXPA 2TGAA 3U9AH 4MNWA 4UFDH 1IQFA 1O35A 4A1XA 1E34B 1YYY1 1TGCA 3FP6E 4RKJB 1XVOA 2ZFPH 5LPRA 2OBQA 2TGPZ 3RM2H 1UTQA 1QQUA 3SU4A 1G3BA 1NFWA 1XXDA 4INKA 1QRWA 4ZXXH 2BXUH 2KAIB 3LC3A 2ZO3H 4MPUA 2FX6A 2WV5A 1TBQH 5A2MH 1C2KA 1GCDA 5EPYA 2FXRA 1C1SA 2OXSA 4D76A 1ORFA 1C1MA 4LK4A 1ZGVA 3EGKH 3SJ9A 1GI0A 1CQQA 4KELA 4FVBA 3SU0A 1OX1A 1C5ZB 1V3XA 1WQSA 1TNIA 3MU1A 1FDPA 3QTOH 4MPVA 1CGJE 2XBYA 5G4BA 5DP9A 4ISOA 2FZZA 5TCCA 4ISIH 3EYDA 5TJXA 1GI4A 1HJ9A 2GP9B 4A92A 3BTEE 4JYTA 4B1TA 2FX4A 4DIIH 1C5RA 4Z0KA 1TB6H 1XM1A 2PV9B 1N8OC 3OTJE 3GCNA 1O2LA 1SOTA 3LPRA 1GBJA 2FYRA 1ELGA 1THRH 4CBOA 2ZDKA 2BD2A 1V2ST 4AFSA 1SR5C 5EOKA 3P92A 1QR3E 3A7TA 3VB6A 2BD9A 3T27A 4BAMB 3BTDE 1SGDE 1MH0A 3P6ZB 2BXTH 1PPFE 1TRMA 2RDLA 2UUFB 3RU4D 2WUBA 1HAOH 2OUAA 4DW2U 3NUMA 2GV6A 4WH8A 2FODA 3FAOA 3BTQE 5C20A 2OC0A 2ZCKP 5L6NH 1AMHA 1ZJKA 2CF9H 3DHKH 3TJNA 1BJUA 1V2QT 3M5NA 1A7SA 2SGFE 1N8OB 1FN8A 1K9OE 1OWKA 5T6FA 1O0DH 4U32A 1Z7KA 1VITG 1V2JT 4CBNA 1OWDA 3RM0H 2GCHF 4K5ZA 3S69A 3QK1A 1UVTH 2VGCC 1UO6A 2Z7FE 4IW4E 5DP4A 5JB9S 2BB4A 1AFQC 1GVLA 1GHAG 1J8AA 3LJJA 1HDTH 1UJ1A 2FWWA 1HAXB 2VINA 1Q3XA 1G30B 3K6YA 3UY9A 1C1OA 1ZPBA 9ESTA 1GI7B 4SGAE 1FY3A 2GMTB 4FU8A 1C1NA 2VIQA 3GOVB 1IQEA 5FHTA 1PYTD 2BYAX 3KNXA 4YT7H 3ELAH 1PQAA 2FOEA 3A80A 1TRNA 3RXMA 1FZZA 3C1KA 2A4RA 1H4WA 3PLPA 5F8ZA 2CN0H 1AKSA 1DWBH 4MNVA 1YGCH 4IMQA 3BTWE 3D62A 4FVDA 1DOJA 2GTBA 2ZU2A 2BD3A 2PSXA 1CA0C 1GG6C 1MKWK 3SGBE 1Y3UA 2FLBH 1FPCH 2BVXH 4CRCA 1XUKA 3NWUA 1CBWC 1YPHC 3CS0A 2OINA 1IQMA 5E0GA 3HGPA 1C2FA 2HNTE 1EXFA 1QA7A 2BX3A 2CXVA 4JCNA 5HM9A 1C1PA 3B23B 2Z3CA 1AVXA 1PQ7A 1FY5A 3ATLA 1TBRH 3FZZA 1GL1A 1BA8B 5DK1A 1TX8A 1C9PA 2HRVA 3K6ZA 1FJSA 4ISLA 1BBRK 2SGAA 2WYGA 1ANBA 1NU9A 2NU2E 5A09A 3QTVH 3UFAA 2A32A 3EE0B 1V2LT 1UHBB 1ZTLA 4ZHAA 1Z8RA 3KIDU 3S9AA 3ZV8A 1W8BH 2KAIA 3TK5A 3ZVCA 5B6OA 6CHAC 3BV9B 3ZZ7A 1FN6A 2EC9H 2V3HH 2HVXA 2Q6GA 1TOMH 2SGPE 5C1UA 1SLWB 4AYYB 1AI8H 4GLYA 1ELVA 4X2YA 2ZIQH 4X1PU 3RMNH 2RG3A 2ZKSA 4FUDA 4GUXA 3STIA 3ZZCA 4BXSA 4DVAU 1GHBF 2BLWA 4NCYA 2FOHA 1DPOA 3F9GA 3BEIB 3KF2A 4AGKA 2F91A 1FV9A 3GDUA 3I78A 1TAWA 1O2JA 4J2YB 4DOQA 2AYWA 2XC0A 2BQWB 1UMAH 2ZHEH 1GHZA 5A8XA 2ZU1A 1A46H 1ESBA 1HPGA 4WXVA 2FO9A 3RXOA 2VJ1A 4Q7ZA 1AFEH 1OWHA 1O2TA 1TYNA 3A88A 1D3TB 4THNH 1C2HA 2SGQE 1KLTA 1GJ9B 3SHAH 1EAXA 4Y7AA 2R3YA 4ESTE 5PTPA 1C5TA 3T2NA 1RTKA 3K65B 1O3LA 3LGUA 3M3TA 3GCHC 1CT4E 4YLQH 1ZSLA 1B7XB 4E05H 2PKAB 1TRYA 1YKTA 1O3HA 4ABFA 3AASA 3UR6A 3MNSA 4JZFH 5EXLA 2A4GA 4BAKB 2RCEA 3QZQA 1TNHA 3QN7A 1FAXA 4FUGA 1AZ8A 1T4UH 3P8NA 2R2WU 1HLTH 4DCDA 2I6QA 2ZFSA 1UTOA 8ESTE 2Q1JA 1DE7H 1JXPA 3V12A 1CT2E 1UTJA 1LPGB 4KTCA 2YNBA 1GHBG 1LKBA 1SG8B 1GJCB 2O8TA 3T29A 1P01A 1TQ7B 4U01A 1OS8A 5EG4A 2QGRA 2V0BA 2PR3A 3EA8A 1BTUA 2ZGJA 5DG6A 5DPAA 3E0PB 1NESE 1RJXB 4A1VA 4JZIA 3DT0H 1G3CA 1RTFB 2BDBA 1O3FA 2VWLA 1ACBE 3ZZAA 3GCOA 3HK3B 4ABJA 1C5MD 1P2JA 2DUCA 2ZNKH 2GD4B 3F1SB 4CREA 1W11U 3SU6A 3A84A 4Y11E 4B2AA 1AWHB 1P05A 1KLIH 4TPYA 1C2EA 1OKXA 3VB7A 1TNLA 3VB4A 3OX7U 2AMQA 2THFB 1GI8B 1DX5M 2PWXA 1ESAA 1QL9A 1TGNA 1Q2WA 1J15A 1EP5A 2FTMA 1X7AC 4ZUHA 1G36A 2ZGHA 3VB5A 1K1OA 1GMDG 2PFEA 4K69A 1C5SA 1ID5H 2BY9X 1C5WB 1PFXC 1FONA 2WPJS 3RXBA 2Z3EA 2TIOA 3ZVDA 2H6MA 1A0HB 1LVYA 1ZRKA 1O36A 4ABGA 1IOEA 3LGWA 1O5AB 4ZAEA 3TGJE 5FPSA 2FEQH 1YPHE 3E0NB 1QTFA 3QUMP 1SLXB 1GCTB 1O5DH 2O8MA 3RXEA 1QRZA 4MPXA 1WOFA 2ZGBH 1YCPM 3BG8A 1QL8A 5T3HA 3K9XB 5FCKA 2PUXB 1A0JA 4XSKU 1QFKH 5SGAE 1JMOH 2A7CA 3A7YA 2QF3A 1UTPA 2Y5HA 2ZTXA 3AAUA 4TWYA 3A8AA 2VWMA 3SUEA 4CH2B 1HV7A 2P95A 2K1QA 3GCTF 2PGBB 3ZZBA 4BAOB 1TQ0B 2AERH 2UUYA 2F9VA 3AW0A 3R3GB 1CU1A 1D3PB 5HXFA 1L4DA 2Y81A 1ZTKA 3E6PH 4GSOA 4Y71A 4LZ1H 1ZLRA 1PYTC 3SGQE 1NO9H 3MMGA 9LPRA 1PJPA 5HGGA 2F9UA 1THSH 1C5LH 2FTLE 2ZDAH 1MBMA 2GDDA 1NRQH 2XNIA 2VVCA 1QGFA 1YPMH 3BTGE 3RXIA 1SGTA 4O3UA 4YZUA 1RGQA 1DLEA 4HFPB 4NZQA 1P11E 1BT7A 5A8ZA 4IC6A 4XFQA 1NPMA 1OP8A 2XCNA 1CA0B 1GG6B 1EZXC 1Z8JB 1CHGA 2VH0A 3A82A 1MD7A 4GHTA 4Y0YE 1K1NA 2PGQB 1GGDC 2FPZA 1S5SA 3DA9B 1CA8B 3MU5A 3ODDA 1C2MA 3TH2H 3QWCH 1F0RA 3PWBA 1ESTA 2BDYA 3RXTA 2FMJA 1BTPA 1BMNH 4K1TA 1S0RA 1AVGH 4X1SU 1F0UA 1LPZB 5ABWA 1O3KA 1CHOG 1BOQA 4YM9A 1N6XA 1O3MA 1YPKH 3RXUA 2PKAA 2R3UA 2JH0D 1F0TA 1HB0B 2TGDA 4AN7A 1VCQA 1O2MA 1C5YB 2Q6DA 1JWTA 3S9CA 1TALA 1ELEE 4YT6H 4FXGH 4NFFA 2W7UA 1ELFA 3SN8A 1C1TA 4WY3A 1V2PT 4K2YA 3ZV9A 2A5KA 3NKKA 8KME2 3M5LA 1LHGH 4OS4A 2WINI 3HGNA 2XRCA 2H9EH 3SUGA 5EQRA 5DO4H 1V2VT 3FZDA 3RC5A 4R8TB 3V3MA 4ZHMU 2P3FH 3PMAB 1ZSKA 2D1JA 1BTXA 2B9LA 1EJMA 1O2NA 1P3CA 2BD5A 4XOJA 1W13U 4CRBA 1GBLA 3S0NA 2VB0A 4Y8YA 1K22H 4UFFH 4WF8A 5A0CA 1A3BH 1GI6A 1MTUA 4F4OC 1SGEE 1Y3WA 2J4IA 2GVFA 2P16A 4JZEH 2QF0A 4Q7XA 6GCHF 1SBWA 3RXKA 3BG4C 1SGCA 1EZSC 2FDAA 2IJOB 5EU8A 5K0HA 4CR9A 1AE8H 2G51A 3QLPH 3SW2B 4BTUB 3AW1A 1TNKA 3GDVA 3NPSA 1C2GA 3SJKA 1Y3VA 2XBVA 1JIRA 3M7QA 3RXVA 4CHAC 2GCTC 2Y5FA 1LMWB 2QCYA 4IN2A 5E2PA 4X6NA 4YOJA 1RFNA 3U1IB 1EJAA 2P59A 2PUQH 3IG6B 1BUIA 4IBLH 5EGMA 1PPZA 4KKDA 1KXEA 1F7ZA 4ZXYH 1QL7A 1CO7E 2Z9KA 1LVMA 3EA7A 1L1GA 4PROA 2LNCA 5LH8A 3LU9B 3DFJA 1QB1A 3M35A 3T62A 5DKMA 1GHYH 2ILNA 1QQ4A 5JYIA 2GZ7A 1C5VA 1ZYOA 3M61U 2A2XH 1MBQA 1UK3A 2J94A 2HNTF 5H4IB 5TCAA 3FVFB 5HM2A <