1EZSC

Crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
total genus 53
structure length 223
sequence length 223
chains with identical sequence D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezsC01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezsC02
1UO6A 3BIUH 3TPIZ 2HVXA 3BTDE 3FP6E 1TRMA 1GJBB 1ZPZA 1C1VH 1Y5AT 5HYOA 1DITH 3M36A 2QIQA 1ESAA 1W2KH 2QCYA 4XBCA 4NFFA 1ID5H 1C5ZB 2Z94A 5T6GA 3U1IB 1EP6A 1EXFA 2VVVA 3MU8A 2AFQB 1TB6H 1WQVH 4TPIZ 1YCPH 1LHCH 1DWBH 4AB9A 2ZGCA 3E3TA 1ELGA 2Y82A 4NZQA 1TNJA 1YBWA 2OQ5A 4SGAE 1ZHMA 4DW2U 3QO6A 1UK3A 2WV5A 2RA0A 4INKA 1TX6A 2A0QB 4A1XA 1NZQH 3SV6A 3ITIA 3RXBA 4WF8A 1GBHA 3MNSA 2FX4A 1KIGH 4WMEA 1AQ7A 3ZZ7A 1C1WH 2PFEA 1QB9A 1YPHE 1GI2A 1MCVA 1S5SA 4ABAA 4D9QA 1SGTA 2ZHWH 1YCPM 3VPKA 3QK1A 1TPAE 4MPVA 5A2MH 1O32A 3A85A 1SG8B 2ALPA 2VWNA 1W12U 1ZMLA 3EDXB 2I6QA 4IC6A 1MH0A 1GCTC 2OBQA 2PWXA 1NRSH 2XC5A 3E8LA 1IHSH 1OP2A 1SFQB 1BRCE 2VIPA 1F2SE 4AFZA 1FV9A 1AFEH 8LPRA 1J17T 1P9SA 3UNSA 3P8OA 3HKJB 2ODQA 1EUFA 2ZKSA 4XSKU 4Q7ZA 3VGCB 1K1LA 1HXFH 2AIPA 1V2LT 4O03A 2AIQA 1BBRH 1GHZA 1Z7KA 2BQ7B 4JZDH 2OC7A 1LTOA 1O5FH 1GI5A 3GDSA 4Z0KA 1ACBE 3QUMP 2BDIA 1W7GH 5I46H 1AIXH 4B74A 5HGGA 3RXVA 2YOLA 3FP8E 3PM3A 3A8BA 2XBYA 1GBIA 2B7DH 1KLIH 2QF0A 1XUGA 1PYTC 1LPZB 3M7TA 1HJAC 2TGDA 3GCHC 2OC1A 3L6PA 1UTMA 2R0KA 3ZZAA 2GT8A 2GCHF 1FY3A 4AGJA 2BY9X 2PKAA 2VWMA 1OP0A 3NUMA 1NRQH 1GPZA 3OY6U 1CBWB 1WTHD 2R3YA 1ZOMA 3ZVDA 2TRMA 4XBBA 6GCHG 5C20A 2BDGA 3RLYH 1LKAA 2F3CE 1NT1A 1SHHB 1FPHH 4NZLA 1NM6A 3ZZ5A 2EA3A 3RXGA 1GJCB 5EQSA 1BCUH 3PWCA 1GCDA 3SJIA 3BEUA 3KN2A 1BMMH 2BQWB 2J92A 2C8XB 1D6WA 4NA8A 3PO1B 2ZG0H 1CHOF 3MH4A 1TNHA 1SMFE 8GCHF 1WYKA 1TRNA 4ZXXH 5F8TA 3ZVEA 3NZIA 1ELFA 3Q3XA 1PFXC 2QY0B 3QTVH 4DIHH 3CP7A 1A2CH 1GHVH 2BZ6H 2Z7FE 3TU7H 3T29A 1FUJA 5LH8A 4AFUA 3M7UA 1CT0E 2ZQ1A 1UK4A 1HAXB 2GCTC 5IYTA 3E0NB 1N8OC 2ANWA 1GBLA 5EG4A 4UFEH 1BDAA 2H6MA 1YPMH 4NFEA 1EZXC 1KXFA 2BD4A 5CMXH 5FCKA 1ESBA 1H9LB 2BMGB 1ABJH 1EX3A 1Z1JA 4AYVB 1CA8B 1DY9A 2K1QA 1QQUA 3KF2A 2OXSA 4K5ZA 3BF6H 4K69A 4YO9A 1P2QA 1UCYH 3V7TA 4O9VA 1FLEE 1UTQA 4YOGA 1THSH 3ZZ3A 2FOAA 1GDQA 4WWYA 1D3PB 1O5EH 3MU4A 1IQKA 1EPTA 4BAQB 1S6FA 1IHTH 2SFAA 3U8OH 1MQ5A 3MU5A 4A1TA 2FO9A 5EQQA 3Q00A 1C5YB 3LGYA 1SHYA 2Y7XA 1E36B 5E0HA 2ZDKA 1UTOA 1PPZA 4R8TB 1YPKH 3B23B 2ILNA 6ESTA 2Z3DA 1J15A 4I32A 2BLOA 1O3GA 3BTWE 1O3AA 1QRXA 3UREA 2BLVA 1V2OT 1GBMA 1A1RA 2HNTE 1ETTH 1QJ7B 1B5GH 4E05H 1AWHB 3RXAA 1TNGA 3SBKA 3LPRA 3O8DA 4ZROA 4AN7A 1HAYB 3SNDA 3MMGA 4AORA 2ZDVH 4ASHA 1SBWA 1H9HE 1EJNA 1XUFA 1AB9B 2ZPRA 3K6YA 2V35A 4AFSA 3RUOA 1GHAF 1ZHPA 2UUFB 1K9OE 3FP7E 1NN6A 1DANH 2ZI2H 3ZV8A 1T4VH 3BEIB 6CHAB 2Q6GA 2HRVA 1ELDE 1KDQB 1W13U 1C1OA 2KAIA 2NU2E 4BAOB 4DIIH 1O2SA 1GMHG 2GV7A 1TPPA 1FONA 4RSPA 5FX6A 3RU4D 3SI3H 2AYWA 4FUGA 2FOCA 1LVBA 3NPSA 4NIYA 2QA9E 1PPCE 1T7CA 1P11E 1MBMA 1H1BA 3ZVFA 2XC4A 1O33A 1XUJA 4TY6A 1SGEE 4Y0YE 5EXNA 1MMJN 3RC4A 2FYQA 1EQ9A 1IAUA 1TALA 4E7NA 1O2RA 1ZJKA 7ESTE 1C2FA 1QA7A 4BXSA 2Q6DA 2VVCA 1C5RA 4JZFH 1OX1A 2PKSB 2SNWA 3UQVA 4FUJA 4B2BA 4GVUA 1Y3XA 3RDZA 4HI3A 3P8NA 1FXYA 1C5XB 2ZPSA 1T8MA 1C1QA 3RU4T 1P06A 2FOEA 1G3DA 2Y81A 2OD3B 1E38B 4BTTB 1LHFH 4DJZB 1SGFG 2I6SA 2YNAA 4ZMAH 2FXRA 1GBFA 5G4BA 2RDLA 4H6TA 5EU8A 4FXGH 1F0TA 4IW4E 1O2NA 1MTNB 2F9VA 1BQYA 3LGTA 4YTAA 2G52A 1K2I1 4AZ2B 2B8OH 5A0AE 5EPNA 1HBTH 3GCOA 3TJOA 4IN2A 5DKMA 3STJA 1YKTA 3MWIU 3PV4A 1ESTA 4B71A 4FVBA 2Q1JA 4UEHH 1MKWK 3GY4A 4ZKOU 1OWIA 1P12E 3ZZ9A 2ZTYA 4AOQA 1VGCB 4AG2A 1GHYH 1H9IE 5JB8S 1GI0A 1TX8A 4MDSA 2SGEE 3JZ2B 1SOZA 2Z3CA 1P2IA 1P2KA 2VVUA 3P92A 2ZFSA 1DE7H 2A7HA 1SLXB 1GVZA 2UUJB 3LGVA 3F68H 3T5FH 4Y0ZE 1CA0B 1NESE 1SFIA 3VB3A 1B7XB 5EPYA 1C2EA 1IQJA 4X2YA 2C3SA 3NK8A 1SLUB 2C8YB 4D8NA 1K1JA 5K7RA 1CGHA 1W3CA 1UVOA 2NWNA 2P16A 2GZ8A 1MAYA 3KGPA 4RKOB 1V3XA 2FI3E 1THPB 4INHA 1O2UA 1P01A 3BN9A 1L1GA 1A7SA 1ZGVA 3UTUH 3PTNA 3P8FA 4AX9H 4NIXA 4Y8XA 7GCHF 3ATKA 1PPHE 4H42U 4GPGA 1DSUA 1QJ1B 2SGAA 2HNTF 3FZZA 2HOBA 2R2WU 3F9HA 3H7OA 2UWPA 1Z6EA 1HAIH 2Y5HA 4ZKRU 1C5UA 4O97A 3SHCH 1PPBH 1BTPA 3BG8A 1OSSA 2ZDLA 3MO9A 1SQOA 1TX7A 5JBAS 2CN0H 1P2MA 1J14A 1QFKH 1LQDB 5DP8A 1C1UH 1WTGH 3A80A 2ZTZA 1GI6A 1GDNA 3M5NA 3OY5U 4ISHH 3Q76A 1GJAB 2R3UA 2QF3A 2WYGA 1Q31A 1NRNH 4AFQA 2IPHA 1V2VT 1BITA 1DOJA 2CF9H 1C5WB 1G2LA 4XBDA 1SGFA 3SU3A 1V2RT 3O8CA 1ARBA 1RTLA 5AHGH 3QLPH 1HAPH 1GL0E 1GMDF 4ISNA 1K1NA 5AFZH 1C1PA 2M5TA 3PROA 1FQ3A 3GY2A 1MTNC 3SJOA 4IC5A 4CRBA 3D23A 1Z8JB 1S81A 1XXDA 1CE5A 2ZWLH 5GDSH 2UUYA 2ZZUH 2CGAA 2FX6A 3HPTB 5CHAC 1KXEA 3UNRA 1O2XA 3PYHA 1YCPK 1SPJA 4X6PA 5JB9S 4GSOA 2EI6A 2B0FA 2GZ9A 3LH3A 3EA8A 2FI5E 3ENSB 2G5NA 3PB1E 4DY7B 2Z6BD 2C93B 1CO7E 1DWCH 4OS2A 2GX4A 2WPKS 2ZFTA 1ZSJA 1NFWA 1NRPH 2BX4A 1GGDC 1GI1A 1MZAA 1EOJA 1KLJH 3RXCA 2BB4A 2G81E 2BY8X 3UR9A 1QCPA 3A87A 1O3HA 1JRSA 1O5AB 5T3HA 1GJ7B 1WU1A 1TABE 1EPTB 1CVWH 1YPHC 1C5QA 2CHAC 4H4FA 5DP4A 3RXLA 1Z8IB 3ODDA 2A5IA 1SGDE 2V0BA 3MH7A 1D9IA 2SGPE 2ZGJA 1T4UH 3ZVCA 3RXTA 4X1PU 4I8KA 4UFDH 1GI4A 4CRCA 3A7TA 5H4IB 4Z6AH 4MQAA 1BZXE 5F8XA 1B0EA 2BLWA 2XW9A 1G36A 4KTCA 1CQQA 1DT2A 1LVYA 4KKDA 1MBQA 1RFNA 3T25A 1EJAA 5HM2A 1W10U 2A7CA 1O0DH 3ESTA 1DS2E 1YP9A 1BUIA 2GMTC 2ZFFH 3H5CB 4Y10E 1JBUH 1Y3WA 1BBRK 2XBVA 1OYTH 1HJ9A 5FPTA 3E6PH 2EI7A 3HATH 2ULLA 1O3DA 2AGIX 1AE8H 1SGNE 2H1UA 3SNCA 1UVSH 3A8CA 3BEFB 1SGCA 3SU5A 1C1RA 1O2TA 1OWEA 1FMGA 3BTGE 4FUDA 1FDPA 3W94A 2PLXA 4GHQA 4A6LA 2OP9A 2J94A 3S9BA 1AN1E 5TCCA 1SLWB 3D49H 3FFGA 5LPEA 4BAMB 5DGJA 2BHGA 4A7IB 1K21H 1MTSA 1YPJH 1LVOA 3G01A 1C5NH 1BTHH 2GV6A 1RIWC 3A82A 3R3GB 2WINI 1K22H 3PMBB 3MO3A 4WXVA 3ZVBA 2A1DB 1VJ9U 2P8OC 3KL6A 2VIWA 2OTVA 4MPUA 1XUKA 1XKBC 3PLPA 2R9PA 4CRAA 4FU7A 2XWAA 1FN6A 1YPLH 3BIVH 1DLEA 3A7WA 1XXFA 1BRBE 5JPMH 1C2JA 4GCHG 1A0LA 1SVPA 2BTCE 3SGBE 2CMYA 2VIDA 1V2KT 2P3FH 2ZFRH 1PPEE 4NSYA 2F83A 1MD8A 2YNBA 2J2UA 1AVGH 1QR3E 2BDCA 2TIOA 4YLUA 2BVSH 3ZV9A 1EAWA 2NU4E 3KNXA 3E91A 1C2DA 3KEEA 2PHBA 2JETB 4B2CA 4UE7H 9ESTA 1GHAG 1EJMA 1HV7A 1O5DH 3BV9B 1XVOA 1D3TB 1F7ZA 1ZPCA 1EPTC 2FP7B 5E0JA 1ZMJA 3SQEE 1VITF 1DXPA 2HLCA 4WJG2 2AGGX 3D65E 3C1KA 5F6MA 4NIVA 4OGXA 2FOFA 2FI4E 2BYAX 4K3JA 2OINA 1BHXB 1V2ST 1FI8A 3RM0H 1TMBH 4YT7H 1MTWA 1P04A 2Y6TA 4J1YA 1AUTC 7LPRA 1O3NA 2HPQH 1J16A 3EA9A 4OS1A 1V6DA 4ZAEA 1UCYK 1U6QA 2BXUH 1NTPA 3QZQA 2VWOA 1L1JA 1JRTA 4I8HA 3MYWA 3BG4C 1TPOA 3KQCA 3GCNA 4SGBE 4ZXYH 1ETRH 4K1EA 5HMAA 2LNCA 3E16B 2Y7ZA 1GG6C 1ELAA 1QBOA 3ZZ4A 5LPRA 1O2QA 3AAVA 2CF8H 3TNTA 3ZZDA 4BXWA 1RXPA 1C2MA 4BANB 1GJDB 4D7GA 1TPSA 3BSQA 2O8LA 2TGTA 3RXOA 1YPEH 1UVUH 4KP0A 1EB1H 1M9UA 1MKXH 1OP8A 2ZHQH 3DT0H 1G37A 4CBOA 1NFUA 1QHRB 2G5VA 2CV3A 2XCNA 2BQ6B 3ATIA 1HIAB 1AMHA 3SU0A 3FAOA 5BRRE 4X8SH 2F91A 2HNTC 2ANMH 1BRUP 2F9PA 2BLQA 1DX5M 4CHAB 3UY9A 2FOBA 3TGIE 2JKHA 4HFPB 1E34B 5FPYA 1GBCA 1E0FD 2H5CA 4K2YA 1ZPBA 5DP6A 2A2XH 5J4QA 3GCTF 1H8DH 4CH8B 1NPMA 1THRH 3U1JB 1AZ8A 1FY8E 2GVFA 1KSNA 1HCGA 2O8TA 2ZDNA 4B1TA 2BY5X 4VGCB 1EP5A 1G3EA 1TOCB 2HWLB 1HDTH 4IGDA 4YOIA 1O34A 2JETC 3L33A 1IQMA 2VU8E 4X8TH 1D3DB 1O3IA 4X2XA 1ZSKA 1P2NA 4DT7B 3A89A 1SQTA 1AFQB 1D3QB 1UMAH 1W11U 2O8UA 2FYRA 4GLYA 1SGQE 2J4IA 2XWBI 1CHGA 4I8LA 7GCHG 4H6SB 1INCA 1QBNA 2D1JA 5I25A 2ZA5A 2ZGBH 3OTJE 1AHTH 3QZRA 4LXBH 1C5OH 4E7RG 2SGQE 3PLKA 3A8DA 1TNLA 4KELA 3DUXH 4J2YB 3E1XB 4UFGH 1G30B 1UTJA 1O39A 1BT7A 1SGIB 4X2WA 3MOCA 3RXMA 1FPCH 4B76A 3VGCC 3SU2A 4MVNA 3SV2H 4FU8A 4ZKNU 1OOKB 2FODA 4TYDA 3TGKE 1QY6A 3K65B 2ZHFH 1FY5A 1YLCA 1K1PA 4B2AA 1SC8U 2WPIS 5JBBS 1NFXA 3SU4A 1ELCA 2GZ7A 4ISIH 4O3UA 5IDKA 2B5TB 3AW0A 3HK6B 1BTXA 4X6OA 3SJKA 4XOJA 3UOPA 2FIRH 5ESBA 2XYAA 1C2KA 1P2JA 1NRRH 1FAKH 1N6XA 1NS3A 4I8GA 1SGYE 2ZIQH 4MNWA 4JK6A 1GBJA 1S82A 3LJOA 2Y5FA 3UWIA 2GT7A 3I29A 2Y80A 1UHBA 1CBWC 1L0ZA 3D62A 5E8EH 1SLVB 3URDA 1S0QA 2GP9B 2W5EA 4X1RU 2STAE 1F0UA 1UVPA 1DPOA 2ALVA 3ZZBA 3SV8A 3GICB 4X6NA 1DSTA 4JK5A 1HUTH 1HJ8A 4NA7A 2GTBA 3S69A 5GWZA 3MNXA 1A3BH 4F4OC 3SNAA 4D7FA 1J8AA 3PWBA 4NSVA 3A88A 5DK1A 4FUCA 4CHAC 2ZEBA 3U8RH 1KTSB 2ZHDA 3W95A 3M35A 4BTUB 1XM1A 1DM4B 1OPHB 1ANCA 4DVAU 3PO1C 4MPWA 3S7KB 4UDWH 1MUEB 3LKWA 4F49A 3T26A 1S0RA 3P17H 3PMJA 3CS0A 5FAHA 1SQAA 3KCGH 3GY6A 1EZSC 2AS9A 4AB8A 1ELVA 5C67A 3HGNA 2C8ZB 1Y3UA 1MQ6A 3MNBA 3SGAE 4NGAH 3H7TA 4Q7YA 1C1SA 1O5CB 2ZFPH 1GHXH 2EI8A 3P70B 1CSOE 4Y6DA 4U2WA 1HGTH 1LO6A 4A92A 1GMCG 4IN1A 2TGPZ 8ESTE 5FHTA 5F8ZA 1WBGB 3MTYA 3P95A 1EAIA 3BTME 3KQBA 3VB6A 1A5GH 2ZDMA 3BTTE 1YF4A 4WVPE 5SGAE 1W8BH 1SI5H 4ESTE 4X2VA 3LC5A 1O2LA 3VEQB 4ABEA 1A46H 1QQ4A 1HFDA 1QRZA 4K8BA 1AY6H 1GWAA 1LDTT 2FLBH 1O3PB 1D6RA 3A84A 3GDUA 3AASA 2QGRA 3A86A 1TWXB 1MTVA 3M3TA 2RG3A 1P3CA 3RP2A 3QGJA 3S9AA 4JYVH 3ZZ6A 2O8WA 3FANA 1TBRH 2QXHA 2WUCA 3U9AH 2OUAA 2FWWA 4JMYA 2WPHS 3UIRA 4ISLA 3GY7A 1WUNH 3VB5A 1K1IA 2PSYA 1DVAH 3SUGA 3AVZA 1Z71A 1P05A 1T8NA 6GCHF 1UTLM 4Y79A 2FOGA 4D9RA 4ZUHA 1C5MD 3TLOA 2ZTXA 1GHBF 2AGEX 1Y5BT 4Y8YA 1S85A 2VH6A 2BD9A 5FXLA 1EZUC 2QAAA 4ABFA 1E35B 4NWKA 2J95A 1QL8A 5C5NA 1AB9C 1GI3A 2SNVA 1WQSA 1XUHA 2FLRH 1K1OA 3ZZCA 3BTHE 3WY8A 6CHAC 3UOUA 3DHKH 4Y8ZA 1NFYA 4U01A 1GJ5H 4FUBA 1HIAA 2H2ZA 1ABIH 5E2PA 3RXUA 2XRCA 3S0NA 4ABBA 1DXWA 1FZZA 3M5OA 5EXMA 1O35A 4ABHA 2UWOA 1TYNA 2D8WA 5C1XA 2FOMB 1HNEE 2AMPA 5DP9A 1SGPE 4Q80A 2TPIZ 5ESTE 4FUHA 3SUFA 1FNIA 2HGTH 3MU1A 3MH6A 2AERH 1EAXA 3LIWA 5DG6A 2A32A 1G9IE 3DFLA 1T8LA 2BX3A 3F9GA 1UK2A 2PKSC 4RN6A 3DD2H 1AI8H 1C5LH 1Z8GA 3LONA 4BOHA 2W7SA 1BA8B 1OS8A 1BMAA 3RC5A 4OS4A 3V13A 1HB0B 5C2ZA 1D4PB 3SGQE 5AFYH 3SZNA 4XE4A 3GY3A 2GDEH 3F6UH 2XCFA 3Q77A 5DP3A 3S9CA 4ABJA 4IMZA 2H5DA 1TGSZ 4AGKA 1HAZB 1V2TT 2PTCE 1PQAA 1ETSH 1KXCA 1P10A 3SJ8A 2GGVB 1YGCH 1JOUB 3EQ0H 4Y71A 1T31A 1TGCA 1GHWH 1RRKA 2A4OA 3LGUA 5LGOA 3Q3KA 1BHXF 1LHGH 4HTCH 1ZTJA 1PQ8A 1WSSH 1LMWB 2ZQ2A 4Q7XA 4TY7A 2TBSA 1PPGE 2GCHG 1O31A 2Z3EA 1JXPA 1F5KU 3VB4A 2O9QA 1C5PA 2C90B 1LCYA 2A2QH 4NG9H 1TRYA 4JZIA 1VGCC 1Y3VA 1RTKA 2PUQH 5EW1H 2QXIA 5HM9A 2BVXH 3MO6A 1L2EA 4OGYA 3MNCA 1QL9A 3SQHE 1FIZA 2FOHA 4WMDA 2GD4B 2WV4A 4X8UH 2FZZA 3QWCH 2A7JA 1Y3YA 1AWFH 1CA0C 3A7XA 2VB0A 1KYNA 1GJ8B 3IWMA 4ZHAA 3K6ZA 2ZGHA 3QX5H 4MNXA 1ZSLA 5C3NA 1F5RA 3TK5A 3SNBA 1F0RA 1TQ7B 8KME2 1JIMA 2BY6X 1GBTA 1CHOG 1OWKA 3E90B 3SV9A 3PLBA 5BPEA 1ZTKA 8GCHG 1BMLA 1TOMH 1C2LA 1HRTH 1F5LA 3RMOH 3V0XA 3T27A 3RXHA 5GCHF 4THNH 3RMLH 1O3JA 1GMHF 3GISB 1Y8TA 1HAVB 3HGPA 4XFQA 1A3EH 1GCTB 1KXDA 1UHBB 2H9EH 4AG1A 1AD8H 5EGMA 3EYDA 1OKXA 1UVTH 1F0SA 2WPJS 3UNQA 5DP7A 1WCZA 1YLDA 3T28A 2OBOA 1YYY1 2BXTH 3SO3A 1GI9B 5A8YA 4HGCA 3LJJA 3MHWU 2A4RA 1Z1IA 3MU0A 5FPSA 4MNVA 1AUJA 4GHTA 6LPRA 2JH6D 1ANBA 3L3TA 5JDUB 2H9HA 1O3MA 1A5HA 3ATLA 3K2UA 3GDVA 2PUXB 2G8TA 1MKXK 2FESH 2WYJA 4YZUA 1G32B 2Z9LA 1A0HB 2A5KA 1KXBA 1O2ZA 1NC6A 2NU1E 1RD3B 2OLGA 2VIQA 2BY7X 1HJAB 4YOJA 3GCHB 4QT8C 4NIWA 1DFPA 1LHDH 4CH2B 2OC0A 3P6ZB 3RM2H 3SHAH 1ZZZA 3M7QA 5FCRA 3TGJE 4GAWA 2W7UA 1BOQA 1JMOH 2Z9GA 5PTPA 3ZYDA 4ZHMU 2VJ1A 1V2WT 3BTQE 1KLTA 3A8AA 4NA9H 1AGJA 1LPKB 1O2PA 4FUEA 4I31A 3M5LA 1DICA 5GJ4B 2Z9JA 1AKSB 3V12A 3U98H 1O3OA 3BTEE 4KGAA 2QXGA 5GXPA 1DDJA 2J9NA 2RCEA 1GL1A 3RXDA 1CT4E 1VITH 2OQUA 2XNIA 3VB7A 4FVDA 2ZU2A 1O2WA 1QNJA 2TGAA 3LC3A 5EOKA 3QGNB 4BAHB 4JZ1A 1MZDA 2RA3A 2AMDA 1LVMA 1IQFA 1UCYE 3SV7A 4D76A 1L1NA 1DUAA 2W3KA 2QC2A 1TLDA 2A31A 1OWHA 1WOFA 2G55A 1VCWA 2GCTB 1N8OB 3SI4H 1SOTA 1A0JA 2ZCKP 2ODPA 1TAWA 3I77A 4M7GA 1Q2WA 2FMJA 3EGKH 2B9LA 1BJUA 3TK9A 2ZPQA 1MAXA 2IJOB 3SU6A 3ELAH 2A4QA 1P09A 1GBBA 4IS5A 5TCAA 1LHEH 1T32A 1O3CA 1C5SA 1CGIE 1DWDH 4NWLA 3AAUA 1P02A 4NCYA 2BD8A 5GIBA 2ZF0H 1C9PA 5A0CA 1JIRA 1O2YA 4XDEA 2Z9IA 5FBIA 2UUKB 1GBDA 1H8IH 3Q3YA 2P3TB 1GVKB 1VCQA 2P94A 2HPPH 2G51A 3KQEA 4JZEH 1NU9A 2R0LA 3S7HB 1ELBA 4GUXA 2G4UA 1TIOA 1YPGH 2A4GA 2EC9H 1VZQH 1ZLRA 3DFJA 1ANDA 3IG6B 4DOQA 2ZC9H 1ANEA 4X1QU 1SSXA 2FPZA 1O3FA 2FM2A 1EASA 3OX7U 5JYIA 1XUIA 5T6FA 1JWTA 3T2NA 1FJSA 3TK6A 3RXFA 3ODFA 3UFAA 2Z9KA 4PROA 3ZYEA 1QGFA 4X8VH 2UWLA 1OYQA 1QA0A 1EB2A 2LPRA 1HYLA 5HXFA 3LT3A 1GHBG 4A5TS 1GI8B 2Y5GA 3TH2H 4K8YA 3O8BA 1SGRE 3A81A 4JYUH 1WAYB 4MTBA 5C1UA 2XBWA 1A4WH 1EOLA 2ZGXH 3RMMH 1KTTB 3RXEA 4CR9A 1GJ6A 4TWWA 4X0WU 3UWJH 2PSXA 4AYYB 4MPXA 2ANKH 3ATWA 2FS8A 5T6DA 3STIA 1K28D 1AVWA 3SORA 1O5BB 1HPGA 1NU7B 4Y7BA 1IQEA 2DE9A 3EA7A 1C5VA 5FX5A 2WPLS 2O8MA 1NO9H 2F9OA 1S6HA 2C4FH 2PGQB 1V2UT 2FTMA 4WXIA 1FIWA 4OS5A 4CRFA 2GKVE 2D2DA 5ETXA 1VR1H 2G4TA 2QN5T 4FUFA 3NWUA 4BTIB 4YLQH 1C9TA 3N7OA 5DP5A 4LZ4B 2BDYA 2VIOA 4B75A 3GOVB 4U32A 9LPRA 5J4SA 2VWLA 3ATMA 3UR6A 1TNKA 3SNEA 2P3UB 1E37B 2ZU1A 3IITA 3RXQA 1GJ9B 2THFB 4MNYA 3ZZ8A 2ZCLP 3EE0B 3TIUA 4JYTA 2AMQA 2ZECA 3LU9B 1F92A 1V2NT 3BTFE 4CR5A 1ARCA 1O36A 4K60A 1TBZH 2PV9B 1BJVA 1GMDG 1HAVA 2V3HH 1XVMA 1N6YA 1ZRBA 4X6MA 1B0FA 1OWDA 2Q6FA 2ESTE 5E2OA 4CBNA 1O38A 2ZU4A 2F9BH 3RU4E 1NROH 1HAGE 1YM0A 1TGNA 4RKJB 1QB1A 1W0YH 2HALA 1O2VA 1EKBB 4GCHF 3SN8A 1W14U 5EW2H 3TH4H 1FN8A 3M3VA 1O3EA 1TNIA 2FDAA 1SR5C 4CRGA 1P9UA 1TA2A 3T62A 1A61H 4A1VA 2AEIH 1QL7A 2FS9A 2QYIA 2GDDA 3F9EA 2V6NA 2XTTB 3TH3H 2NU0E 2VGCB 1PYTD 3VXFH 2ZDAH 4K1TA 5GPIB 1L4DA 2IN2A 2J34A 1ELEE 3UQOA 1ORFA 1AU8A 2ZFQH 5E0GA 3QTOH 4KTUA 4VGCC 3B8JA 3I78A 2VINA 1V2QT 4DCDA 1IQIA 1CGJE 1HAOH 1TBQH 2P59A 1UTKA 3JZ1B 4FU9A 4Y7AA 3K9XB 1AFQC 3UPEA 1IQHA 5LPFA 1GDUA 1LQEA 5GCHG 1FY1A 4JCNA 5L30H 4ABGA 1G2MA 1ZR0A 2CXVA 3A7YA 2W3IA 1BB0B 1O2JA 1XMNB 2BD7A 1ZTLA 3RXKA 1AVXA 1QJ6B 1A5IA 3HKIB 1Y5UT 1RTFB 4BNRA 3TVJB 3E0PB 2R2MB 1AKSA 1H4WA 2BD2A 3OSYA 1C1MA 1W0ZU 3RXIA 4TWYA 2ODYB 2QV1A 2VNTA 3GYMA 3AW1A 2ANYA 3MH5A 3F9FA 2BVRH 1O2IA 1KY9A 2JH5D 2ZHEH 1Z6JH 2WPMS 3DA9B 3GY8A 2ZNKH 3M37A 3M61U 4ISOA 5CE1A 1G3BA 1VCPA 2SGDE 3NXPA 1GBAA 1V2MT 7KMEH 3ZVAA 1DWEH 1C5TA 2AH4X 2D26C 5AF9H 1C2IA 1SL3A 1C1TA 1ZMNA 2G00A 5CHAB 1C2GA 1GI7B 1DLKB 2IOTA 1G3CA 3U69H 1UTNA 3SJ9A 4YESB 1BRAA 3CS7A 4UONA 1IQNA 2F9NA 5B6OA 4OS7A 1DUEA 1P8VC 3VFEA 2W26A 1EATA 3V3MA 1O3BA 1GJ4H 1YC0A 1GGDB 1ZHRA 4Y76A 1C2HA 4WY3A 1VJAU 3UUZA 2QXJA 1BTYA 3GYLB 3TJNA 4DG4A 2OCVB 2OC8A 3P8GA 2VGCC 2STBE 2CHAB 1MU8B 1OXGA 3LDXH 3NKKA 1QRWA 1AE5A 1HXEH 5DPAA 1EZQA 3B9FH 1NY22 3KIDU 2H9TH 1O2GH 3KQDA 1VITG 1QB6A 2XBXA 1UJ1A 1MD7A 3LGWA 5C5OA 2CJIA 1MTUA 2VH0A 1P3EA 1TONA 4KTSA 2ZCHP 5K0HA 3SUDA 4I33A 4WH8A 1Q3XA 1P2OA 2PKAB 2NU3E 4YT6H 2XXLA 4Q2KA 2GMTB 3A7ZA 1RJXB 4ZHLU 2EEKA 3A83A 1AO5A 3KHVA 1O2MA 2BD3A 4ZKSU 1DY8A 1C1NA 1X7AC 4DURA 3MFJA 2ZU5A 4ABIA 5A8XA 4CREA 3C27B 2PW8H 5F03A 3PMHB 5EODA 2BDHA 4TPYA 1BTWA 4Y11E 3OU0A 1WV7H 4HZHA 1GBEA 4UD9H 1FAXA 1GBKA 1O30A 4DGJA 5A0BA 2P95A 1TGBA 1O2HA 1C4U2 1LKBA 3TITA 1RIWB 4K1SA 4BAKB 1QBVH 1PJPA 3SU1A 2FEQH 2ZU3A 4I8JA 1ZRKA 3SUEA 4UFFH 2PR3A 1TQ0B 2WUBA 1BTZA 2BDBA 3VXEH 2P8OB 3RXRA 5DJ7A 2BZAA 2VIVA 1QURH 1KXAA 1TGTA 4FUIA 3SOSA 1UTPA 1Y59T 1ZJDA 1RGQA 5AVDA 4E06H 1P03A 5EXLA 3TNSA 2BOKA 1TMUH 4R0IA 4INLA 1N1LA 4LOYH 3URCA 3PMAB 1BMNH 1MKWH 3M3SA 4X1SU 4B73A 1ZYOA 5DO4H 5L6NH 3CENA 2V3OH 5JBTA 3RXPA 1C4Y2 1PPFE 1IQLA 2BM2A 1LPGB 4WMFA 3BTKE 1IOEA 3GCTG 3RMNH 1QIXB 4YM9A 1BTUA 3PTBA 4I7YH 3FZDA 3TJUA 1PQ7A 5L2YH 1P57B 2ASUB 4O3TA 1TA6A 3RLWH 3O8RA 1O5GH 2ZP0H 5EQRA 1MCTA 4ZH8A 2ZO3H 1BBRE 1EAUA 1XX9A 3RXJA 2XC0A 3LOXA 1HLTH 1T8OA 1S83A 1O2KA 3SW2B 1RS0A 1TFXA 1CT2E 2FTLE 3R0FA 2BOHB 1Z8RA 2BD5A 2A45B 3OYPA 1OWJA 4U30A 3HK3B 1GMCF 5A09A 5L2ZH 1TMTH 1SB1H 2C8WB 1HAHH 1L4ZA 1O37A 1BIOA 2P93A 3QN7A 1J9CH 3BG4B 1QTFA 1P0SH 1V2JT 1ELTA 1XKAC 2PTNA 5ABWA 3EAJA 4LZ1H 2PGBB 2JH0D 4IMQA 3LGIA 4MG3A 1C4V2 1V2PT 1MU6B 3MI4A 1FY4A 1TE0A 1AZZA 5TJXA 1GG6B 5JBCS 3M5MA 3LH1A 3A7VA 4MLFB 3FVFB 4WH6A 1S84A 2DE8A 1PQ5A 1IQGA 1O3KA 5FBEA 3GY5A 1K1MA 2BDAA 2SGFE 3TJVA 3F1SB 3QDZB 4CRDA 1KDQA 2DUCA 5A8ZA 1ZGIA 3RXSA 3U8TH 1CU1A 1W7XH 4X1NU 2A5AA 1GVLA 4IBLH 4LK4A 2F9UA 1O3LA 2J38A 3NCLA 1O2OA 2KAIB 4OS6A 3ZVGA 3RC6A 5C1YA 4ABDA
chains in the Genus database with same CATH superfamily
1UO6A 3BIUH 3TPIZ 2HVXA 3BTDE 3FP6E 1TRMA 1GJBB 1ZPZA 1C1VH 1Y5AT 5HYOA 1DITH 3M36A 2QIQA 1ESAA 1W2KH 2QCYA 4XBCA 4NFFA 1ID5H 1C5ZB 2Z94A 5T6GA 3U1IB 1EP6A 1EXFA 2VVVA 3MU8A 2AFQB 1TB6H 1WQVH 4TPIZ 1YCPH 1LHCH 1DWBH 4AB9A 2ZGCA 3E3TA 1ELGA 2Y82A 4NZQA 1TNJA 1YBWA 2OQ5A 4SGAE 1ZHMA 4DW2U 3QO6A 1UK3A 2WV5A 2RA0A 4INKA 1TX6A 2A0QB 2M2AA 4A1XA 4XD7D 1NZQH 3SV6A 5T1VA 3ITIA 3RXBA 4WF8A 1GBHA 3MNSA 2FX4A 1KIGH 4WMEA 1AQ7A 3ZZ7A 1C1WH 1QB9A 1YPHE 1GI2A 1MCVA 1S5SA 2PFEA 4ABAA 4D9QA 1SGTA 2ZHWH 4P02A 1YCPM 3VPKA 3QK1A 1TPAE 4MPVA 5A2MH 1O32A 3A85A 1SG8B 2ALPA 2VWNA 1W12U 1ZMLA 3EDXB 4RT0A 3F2HA 2I6QA 3FO8D 4IC6A 3UAIC 1MH0A 1GCTC 2OBQA 2PWXA 1NRSH 2XC5A 3E8LA 1IHSH 1OP2A 1SFQB 1BRCE 2VIPA 1F2SE 4AFZA 1FV9A 1AFEH 8LPRA 1J17T 1P9SA 4P00A 3UNSA 3P8OA 3HKJB 2ODQA 1EUFA 2ZKSA 4XSKU 4Q7ZA 3VGCB 1K1LA 1HXFH 2AIPA 1V2LT 4O03A 2AIQA 1BBRH 1GHZA 1Z7KA 2BQ7B 4JZDH 2OC7A 1LTOA 1O5FH 4B6EA 1GI5A 3GDSA 4Z0KA 1ACBE 3QUMP 2BDIA 1W7GH 5I46H 1AIXH 4B74A 5HGGA 2VBCA 3RXVA 5GNDA 2YOLA 1WDIA 3PV5A 3FP8E 3PM3A 3A8BA 2XBYA 1GBIA 2B7DH 1KLIH 2QF0A 1XUGA 1PYTC 1LPZB 3M7TA 1HJAC 2TGDA 2KR7A 3GCHC 2OC1A 3L6PA 1UTMA 2R0KA 3ZZAA 2GT8A 2GCHF 1FY3A 4AGJA 2BY9X 2PKAA 2VWMA 1OP0A 3NUMA 1NRQH 1GPZA 3OY6U 1CBWB 1WTHD 2R3YA 1ZOMA 3ZVDA 2TRMA 3AK5A 4XBBA 6GCHG 5C20A 2BDGA 3RLYH 1LKAA 2F3CE 1NT1A 1SHHB 1FPHH 4NZLA 1NM6A 3ZZ5A 2EA3A 3RXGA 1GJCB 5EQSA 1BCUH 3PWCA 1GCDA 3SJIA 4I86A 3BEUA 3KN2A 1BMMH 2BQWB 2J92A 3F2GA 2C8XB 1D6WA 4NA8A 3PO1B 2ZG0H 1CHOF 3MH4A 1TNHA 1SMFE 8GCHF 1WYKA 1TRNA 4ZXXH 5F8TA 3ZVEA 3FOAA 3NZIA 1ELFA 3Q3XA 1PFXC 2QY0B 3QTVH 4DIHH 3CP7A 1A2CH 1GHVH 2BZ6H 2Z7FE 3TU7H 3T29A 1FUJA 5LH8A 4AFUA 3M7UA 1CT0E 2ZQ1A 1SKYE 1UK4A 1HAXB 2GCTC 5IYTA 3E0NB 1N8OC 2ANWA 1GBLA 5EG4A 4UFEH 1BDAA 2H6MA 1YPMH 2KCPA 4NFEA 1EZXC 1KXFA 2BD4A 5CMXH 5FCKA 1ESBA 1H9LB 3DSOA 2BMGB 1ABJH 1EX3A 1Z1JA 4AYVB 1CA8B 1DY9A 2K1QA 1QQUA 3KF2A 2OXSA 4K5ZA 3BF6H 4K69A 4YO9A 1P2QA 1UCYH 3V7TA 4O9VA 1FLEE 1UTQA 4YOGA 1THSH 3ZZ3A 2FOAA 1GDQA 4FETA 4WWYA 1D3PB 1O5EH 3MU4A 1IQKA 1EPTA 4BAQB 5CHBA 2WZQA 1S6FA 2L6OA 1IHTH 2SFAA 3U8OH 1MQ5A 3MU5A 4A1TA 2FO9A 5EQQA 3Q00A 1C5YB 3LGYA 1SHYA 2Y7XA 3N99A 1E36B 5E0HA 2ZDKA 1UTOA 1PPZA 4R8TB 1YPKH 3B23B 2ILNA 6ESTA 2Z3DA 1J15A 4I32A 2WHXA 2BLOA 1O3GA 3BTWE 1O3AA 1QRXA 3UREA 2BLVA 1V2OT 1GBMA 1A1RA 2HNTE 1YY3A 1ETTH 1QJ7B 1B5GH 4E05H 1AWHB 3RXAA 1TNGA 3SBKA 3LPRA 3O8DA 4ZROA 4AN7A 1HAYB 3SNDA 3MMGA 4AORA 2ZDVH 4ASHA 1SBWA 2YMSD 1H9HE 1EJNA 1XUFA 1AB9B 2ZPRA 3K6YA 2V35A 2WV9A 4AFSA 3RUOA 1GHAF 1ZHPA 2UUFB 1K9OE 3FP7E 1NN6A 1DANH 2ZI2H 3ZV8A 1T4VH 3BEIB 6CHAB 2Q6GA 2HRVA 1ELDE 1KDQB 1W13U 1C1OA 2KAIA 2NU2E 4BAOB 4DIIH 1O2SA 1GMHG 2GV7A 1TPPA 1FONA 2IJD1 4RSPA 5FX6A 3RU4D 3SI3H 2AYWA 4F55A 4FUGA 2FOCA 1LVBA 3NPSA 4NIYA 2QA9E 1PPCE 3ZIAD 1T7CA 1P11E 1MBMA 1H1BA 3ZVFA 2XC4A 1O33A 1XUJA 4TY6A 1SGEE 4Y0YE 5EXNA 1MMJN 3RC4A 2FYQA 1EQ9A 1IAUA 1TALA 4E7NA 1O2RA 1ZJKA 7ESTE 1C2FA 1QA7A 4BXSA 2Q6DA 2VVCA 1C5RA 4JZFH 1OX1A 2PKSB 2SNWA 1FX0B 4FUJA 4Q4LA 3UQVA 4B2BA 4GVUA 1Y3XA 3RDZA 4HI3A 3P8NA 3PRDA 1FXYA 1C5XB 2ZPSA 1T8MA 1C1QA 3RU4T 1P06A 2FOEA 1G3DA 2Y81A 2OD3B 1E38B 4BTTB 1LHFH 4DJZB 1SGFG 2I6SA 2YNAA 4ZMAH 1H8HD 2FXRA 1GBFA 5G4BA 2RDLA 4H6TA 5EU8A 4FXGH 1F0TA 3SYJA 4IW4E 1O2NA 1MTNB 2F9VA 1BQYA 3LGTA 4YTAA 2G52A 1K2I1 4AZ2B 2B8OH 5A0AE 5EPNA 1HBTH 3GCOA 3TJOA 4IN2A 5DKMA 3STJA 1YKTA 3MWIU 3PV4A 1ESTA 4B71A 4FVBA 2Q1JA 4UEHH 1MKWK 3GY4A 4ZKOU 1OWIA 1P12E 2WPDD 2ZTYA 3ZZ9A 4AOQA 1VGCB 4AG2A 1GHYH 1H9IE 5JB8S 1GI0A 1TX8A 4MDSA 2SGEE 3JZ2B 1SOZA 5F53A 2Z3CA 1P2IA 1P2KA 2VVUA 3P92A 2ZFSA 1DE7H 2A7HA 1SLXB 1GVZA 2UUJB 3LGVA 3F68H 3T5FH 4Y0ZE 1CA0B 1NESE 1SFIA 3VB3A 1B7XB 5EPYA 1C2EA 1NBME 1IQJA 4X2YA 3SZEA 2C3SA 3NK8A 1SLUB 2C8YB 4D8NA 1K1JA 3OE7D 5K7RA 1CGHA 1W3CA 1UVOA 2NWNA 2P16A 2GZ8A 1MAYA 3KGPA 4RKOB 1V3XA 2FI3E 1THPB 4INHA 1O2UA 1P01A 3BN9A 1L1GA 1A7SA 1ZGVA 3UTUH 3PTNA 2XNDD 3P8FA 4AX9H 4NIXA 4Y8XA 7GCHF 3ATKA 1PPHE 4H42U 5FL7D 4GPGA 1DSUA 1QJ1B 2SGAA 1UW7A 2HNTF 3FZZA 2HOBA 2R2WU 3F9HA 3H7OA 2UWPA 1Z6EA 1HAIH 2Y5HA 4ZKRU 1C5UA 4O97A 3SHCH 1PPBH 1BTPA 3BG8A 1OSSA 2ZDLA 3F3BA 3MO9A 1SQOA 1TX7A 5JBAS 2CN0H 1P2MA 1J14A 1QFKH 1LQDB 5DP8A 3OTPA 2RFKC 1C1UH 1WTGH 3A80A 2ZTZA 1GI6A 1GDNA 3M5NA 3OY5U 4ISHH 3Q76A 1GJAB 2R3UA 2QF3A 2WYGA 1Q31A 1NRNH 4AFQA 2IPHA 3UB0A 1V2VT 1BITA 1DOJA 2CF9H 1C5WB 1G2LA 4XBDA 1SGFA 3SU3A 1V2RT 3O8CA 1ARBA 1RTLA 5AHGH 3QLPH 1HAPH 1GL0E 1GMDF 4ISNA 1K1NA 5AFZH 1C1PA 2M5TA 3PROA 1FQ3A 3GY2A 1MTNC 3SJOA 4IC5A 4CRBA 3D23A 1Z8JB 1S81A 1XXDA 3F2FA 1CE5A 2ZWLH 5GDSH 2UUYA 2ZZUH 2CGAA 2FX6A 3HPTB 5CHAC 1KXEA 3UNRA 1O2XA 3PYHA 1YCPK 1SPJA 4X6PA 5JB9S 4GSOA 2EI6A 2B0FA 2GZ9A 3LH3A 3EA8A 2FI5E 3ENSB 2G5NA 3PB1E 4DY7B 3N7DA 2CK3D 2Z6BD 2C93B 1CO7E 1DWCH 4OS2A 2GJGA 2GX4A 2WPKS 2ZFTA 1KMHB 1ZSJA 1NFWA 1NRPH 2BX4A 1GGDC 1GI1A 1MZAA 1EOJA 1KLJH 3RXCA 3NRLA 2BB4A 2G81E 2BY8X 3UR9A 1QCPA 3A87A 1O3HA 1JRSA 1O5AB 5T3HA 1GJ7B 1WU1A 1TABE 1EPTB 3MQKC 1CVWH 1YPHC 1C5QA 2CHAC 4H4FA 5DP4A 3RXLA 1Z8IB 3ODDA 2A5IA 1SGDE 2V0BA 3MH7A 1D9IA 2SGPE 2ZGJA 1T4UH 3ZVCA 3RXTA 4X1PU 4I8KA 4UFDH 1GI4A 4CRCA 3A7TA 3DSPA 5H4IB 4Z6AH 4MQAA 1BZXE 5F8XA 1B0EA 2BLWA 2XW9A 1G36A 4KTCA 1CQQA 1DT2A 1LVYA 4KKDA 1MBQA 1RFNA 3T25A 1EJAA 5HM2A 1W10U 2A7CA 4DT4A 1O0DH 3ESTA 1DS2E 1YP9A 1BUIA 2GMTC 3DSGA 2ZFFH 2V3MA 3H5CB 4Y10E 1JBUH 1Y3WA 1BBRK 2XBVA 1OYTH 1HJ9A 5FPTA 3E6PH 2EI7A 3HATH 2ULLA 1O3DA 2AGIX 1AE8H 1SGNE 2H1UA 3SNCA 5EIYA 1UVSH 3A8CA 3BEFB 1SGCA 3SU5A 1C1RA 1O2TA 1OWEA 1FMGA 3BTGE 4FUDA 1FDPA 3W94A 2PLXA 4GHQA 4A6LA 2OP9A 2J94A 3S9BA 2YMSB 1AN1E 5TCCA 1SLWB 3D49H 3FFGA 5LPEA 4BAMB 5DGJA 2BHGA 4A7IB 1K21H 1MTSA 1YPJH 1LVOA 4F48B 3G01A 1C5NH 1BTHH 2RDEA 2GV6A 1RIWC 3A82A 3N7EA 3R3GB 2WINI 4ACBA 1K22H 3PMBB 3MO3A 4WXVA 3ZVBA 2A1DB 1VJ9U 2P8OC 3KL6A 2VIWA 2OTVA 4MPUA 1XUKA 1XKBC 3PLPA 2R9PA 2F43B 4FU7A 2XWAA 4CRAA 1FN6A 1YPLH 3BIVH 1DLEA 3A7WA 1XXFA 1BRBE 5JPMH 1C2JA 3WW7A 3KYFA 4GCHG 1A0LA 1SVPA 2BTCE 3SGBE 1E1RD 2CMYA 2VIDA 3KQ5A 1V2KT 2P3FH 2ZFRH 1PPEE 4NSYA 2F83A 1MD8A 2YNBA 2J2UA 1AVGH 1QR3E 2BDCA 2TIOA 4YLUA 2BVSH 3ZV9A 1EAWA 2NU4E 3KNXA 3E91A 1C2DA 3KEEA 2PHBA 2JETB 4B2CA 4UE7H 9ESTA 1GHAG 1EJMA 1HV7A 1O5DH 3BV9B 1XVOA 1D3TB 1F7ZA 1ZPCA 1EPTC 2FP7B 5E0JA 1ZMJA 3SQEE 1VITF 1DXPA 2HLCA 4WJG2 2AGGX 3D65E 3C1KA 5F6MA 4NIVA 4OGXA 2FOFA 2FI4E 2BYAX 4K3JA 2OINA 1BHXB 1V2ST 1FI8A 2XOKD 3RM0H 1TMBH 4YT7H 1MTWA 1P04A 2Y6TA 4J1YA 1AUTC 7LPRA 1O3NA 1YLNA 2HPQH 1J16A 3EA9A 4OS1A 1V6DA 1H8ED 1E79D 4ZAEA 1UCYK 1U6QA 2BXUH 1NTPA 3QZQA 2VWOA 1L1JA 1JRTA 4I8HA 3MYWA 3CNRA 3BG4C 1TPOA 2WSSD 3KQCA 3GCNA 4SGBE 4ZXYH 1ETRH 4K1EA 5HMAA 2LNCA 3E16B 2Y7ZA 1GG6C 2V7QD 1ELAA 1QBOA 3ZZ4A 5LPRA 1O2QA 3AAVA 2CF8H 3TNTA 3ZZDA 4BXWA 1RXPA 1C2MA 1BMFD 4BANB 1GJDB 4D7GA 1TPSA 3BSQA 2O8LA 2TGTA 3RXOA 1YPEH 1UVUH 4KP0A 1EB1H 1M9UA 1MKXH 1OP8A 2ZHQH 3DCLA 3DT0H 1G37A 4CBOA 1NFUA 1QHRB 2G5VA 2CV3A 2XCNA 2BQ6B 2F4LA 3ATIA 1HIAB 1AMHA 3SU0A 3FAOA 5BRRE 4X8SH 2F91A 2HNTC 2ANMH 1BRUP 2F9PA 2BLQA 1DX5M 4CHAB 3UY9A 2FOBA 3TGIE 2JKHA 4HFPB 1E34B 5FPYA 1GBCA 1E0FD 2H5CA 4K2YA 1ZPBA 5DP6A 2A2XH 5J4QA 1WXRA 3GCTF 1H8DH 4CH8B 1NPMA 1THRH 3U1JB 1AZ8A 1FY8E 2GVFA 1KSNA 1HCGA 2O8TA 2ZDNA 4B1TA 2BY5X 4VGCB 1EP5A 5IK2D 1G3EA 1TOCB 2HWLB 1HDTH 4IGDA 2K8IA 4YOIA 4FOUC 1O34A 2JETC 3L33A 1IQMA 2VU8E 4X8TH 1D3DB 1O3IA 3F0PA 1ZSKA 4X2XA 1P2NA 4DT7B 5HKKD 3A89A 1SQTA 1AFQB 1D3QB 1UMAH 1W11U 2O8UA 1MABB 2FYRA 4GLYA 1SGQE 2J4IA 2XWBI 1CHGA 1S6LA 4I8LA 5DSFA 7GCHG 4H6SB 1INCA 1QBNA 2D1JA 5I25A 2ZA5A 2JJ2D 2ZGBH 3OTJE 1AHTH 3OAAD 3QZRA 4LXBH 1C5OH 4E7RG 2SGQE 3PLKA 3A8DA 1TNLA 4KELA 3DUXH 4J2YB 3E1XB 4UFGH 1G30B 1UTJA 1O39A 1BT7A 1SGIB 4X2WA 3MOCA 3RXMA 1FPCH 4B76A 3VGCC 3SU2A 4MVNA 1COWD 3SV2H 4FU8A 4ZKNU 1OOKB 2FODA 4TYDA 3TGKE 1QY6A 3K65B 2ZHFH 1FY5A 1YLCA 1K1PA 4B2AA 1SC8U 2WPIS 5JBBS 1NFXA 3SU4A 1ELCA 2GZ7A 4ISIH 4O3UA 5IDKA 2B5TB 3AW0A 3HK6B 1BTXA 4X6OA 3SJKA 4XOJA 3UOPA 2FIRH 5ESBA 2XYAA 1C2KA 1P2JA 1NRRH 1FAKH 1N6XA 1NS3A 4I8GA 1SGYE 2ZIQH 4MNWA 4JK6A 1GBJA 1S82A 3LJOA 2Y5FA 3UWIA 2GT7A 3I29A 2Y80A 3FN8A 1UHBA 1CBWC 1L0ZA 3D62A 5E8EH 1SLVB 3URDA 1S0QA 2GP9B 2W5EA 4X1RU 2STAE 1F0UA 1UVPA 1DPOA 2ALVA 3ZZBA 3SV8A 3GICB 4X6NA 1DSTA 4JK5A 1HUTH 1HJ8A 4NA7A 2GTBA 4ZCNA 3S69A 5GWZA 3MNXA 1A3BH 4F4OC 3SNAA 4D7FA 1J8AA 3PWBA 2KCYA 4NSVA 3A88A 5DK1A 4FUCA 4CHAC 2ZEBA 3U8RH 1KTSB 2ZHDA 3W95A 3M35A 4BTUB 1XM1A 1DM4B 1OPHB 1ANCA 4DVAU 3PO1C 4MPWA 3S7KB 4UDWH 1MUEB 3LKWA 4F49A 4ABDA 3T26A 1S0RA 3P17H 3PMJA 3CS0A 5FAHA 1SQAA 3KCGH 3GY6A 1EZSC 2AS9A 4AB8A 1ELVA 5C67A 3HGNA 2C8ZB 1Y3UA 1MQ6A 3MNBA 3SGAE 4NGAH 3H7TA 4Q7YA 1C1SA 1O5CB 2ZFPH 1GHXH 2EI8A 3P70B 1CSOE 4Y6DA 4U2WA 1HGTH 1LO6A 4A92A 1GMCG 4IN1A 5C0UA 2TGPZ 8ESTE 5FHTA 5F8ZA 1WBGB 3MTYA 3P95A 2HLDD 1EAIA 3BTME 3KQBA 3VB6A 1A5GH 2ZDMA 3BTTE 1YF4A 4WVPE 5SGAE 1W8BH 1SI5H 4ESTE 4X2VA 5C17A 3LC5A 1O2LA 3VEQB 4ABEA 1A46H 1QQ4A 1HFDA 1QRZA 4K8BA 1AY6H 1GWAA 1LDTT 2FLBH 1O3PB 1D6RA 3A84A 3GDUA 3AASA 2QGRA 3A86A 1TWXB 1MTVA 3M3TA 2RG3A 1P3CA 3RP2A 3QGJA 3S9AA 4JYVH 3ZZ6A 2O8WA 3FANA 1TBRH 2QXHA 2WUCA 3U9AH 2OUAA 2FWWA 4JMYA 2JJ1D 2WPHS 3UIRA 4ISLA 3GY7A 1WUNH 3VB5A 3WWFA 1K1IA 1QZ8A 2PSYA 1DVAH 3SUGA 3AVZA 1Z71A 2KCOA 1P05A 1T8NA 6GCHF 1UTLM 4Y79A 2FOGA 4D9RA 4ZUHA 1C5MD 3TLOA 2ZTXA 1GHBF 2AGEX 1Y5BT 4Y8YA 1S85A 2VH6A 2BD9A 5FXLA 1EZUC 2QAAA 4ABFA 1E35B 4NWKA 2J95A 1QL8A 5C5NA 1AB9C 1GI3A 4Z1MD 2SNVA 1WQSA 1XUHA 2FLRH 1K1OA 3ZZCA 3BTHE 3WY8A 6CHAC 3UOUA 3DHKH 4Y8ZA 1NFYA 4U01A 1GJ5H 4FUBA 1HIAA 2H2ZA 1ABIH 5E2PA 3RXUA 2XRCA 3S0NA 4ABBA 1DXWA 1FZZA 3M5OA 5EXMA 1O35A 4ABHA 2UWOA 1TYNA 2D8WA 5C1XA 2FOMB 1HNEE 2AMPA 5DP9A 1SGPE 4Q80A 2TPIZ 1K0HA 2KZ4A 5ESTE 4FUHA 3SUFA 1FNIA 2HGTH 3MU1A 3MH6A 2AERH 1EAXA 3LIWA 5DG6A 2A32A 1G9IE 3DFLA 1T8LA 2BX3A 3F9GA 1UK2A 2PKSC 3OFND 4RN6A 3DD2H 1AI8H 1C5LH 1Z8GA 2J98B 3LONA 4BOHA 2W7SA 1BA8B 1OS8A 1BMAA 3RC5A 4OS4A 3V13A 1HB0B 5C2ZA 1D4PB 3SGQE 5AFYH 3SZNA 4XE4A 3GY3A 2GDEH 3F6UH 2XCFA 3Q77A 5DP3A 3S9CA 4ABJA 4IMZA 2H5DA 1TGSZ 4AGKA 1HAZB 1V2TT 2PTCE 1PQAA 1ETSH 1KXCA 1P10A 3SJ8A 2GGVB 3KYGA 1YGCH 1JOUB 3EQ0H 4Y71A 1T31A 1TGCA 1GHWH 1RRKA 2A4OA 3LGUA 5LGOA 3Q3KA 1BHXF 1LHGH 4HTCH 1ZTJA 1PQ8A 1WSSH 1LMWB 2ZQ2A 4Q7XA 4TY7A 2TBSA 1PPGE 2GCHG 1O31A 2Z3EA 1JXPA 1F5KU 3VB4A 2O9QA 1C5PA 2C90B 1LCYA 2A2QH 4NG9H 1TRYA 4JZIA 1VGCC 1Y3VA 1RTKA 2PUQH 5EW1H 2QXIA 5HM9A 2BVXH 2K0QA 3MO6A 1L2EA 4OGYA 3MNCA 5C0TA 1QL9A 3SQHE 1FIZA 2FOHA 4WMDA 2GD4B 2WV4A 4X8UH 2FZZA 3QWCH 2A7JA 1Y3YA 1AWFH 1CA0C 3A7XA 2VB0A 1KYNA 1GJ8B 3IWMA 4ZHAA 3K6ZA 4M9FA 2ZGHA 3QX5H 4MNXA 1ZSLA 5C3NA 1F5RA 2KM0A 3TK5A 3SNBA 1F0RA 1TQ7B 8KME2 1JIMA 2BY6X 1GBTA 1CHOG 1OWKA 3E90B 4OM9A 3SV9A 3PLBA 5BPEA 1ZTKA 8GCHG 3FKSD 1BMLA 1TOMH 1C2LA 1YWUA 1HRTH 1F5LA 3RMOH 3V0XA 3T27A 3RXHA 2QF5A 5GCHF 4THNH 3RMLH 1O3JA 1GMHF 2JDID 3GISB 1Y8TA 1HAVB 3HGPA 3OEED 4XFQA 1A3EH 1GCTB 1KXDA 1UHBB 2H9EH 4AG1A 1AD8H 5EGMA 3EYDA 1OKXA 1UVTH 1F0SA 2WPJS 3UNQA 5DP7A 1WCZA 1YLDA 3T28A 2OBOA 2KX4A 1YYY1 2BXTH 3SO3A 1GI9B 5A8YA 4HGCA 3LJJA 3MHWU 2A4RA 1Z1IA 3MU0A 5FPSA 4MNVA 1AUJA 2PP6A 4GHTA 6LPRA 2JH6D 1ANBA 3L3TA 5JDUB 2H9HA 1O3MA 1A5HA 3ATLA 3K2UA 3GDVA 2PUXB 2G8TA 1MKXK 2FESH 2WYJA 4YZUA 1G32B 2Z9LA 1A0HB 2A5KA 1KXBA 1O2ZA 1NC6A 2AHME 2NU1E 1RD3B 2OLGA 2VIQA 2BY7X 1HJAB 4YOJA 4RT1A 3GCHB 4QT8C 4NIWA 1DFPA 1LHDH 4CH2B 2OC0A 3P6ZB 3RM2H 3SHAH 1ZZZA 3M7QA 1E1QD 5FCRA 1W0JD 3TGJE 4GAWA 2W7UA 1BOQA 1JMOH 2Z9GA 5PTPA 3ZYDA 3PV2A 4ZHMU 2LP6A 2VJ1A 1V2WT 3BTQE 1KLTA 3A8AA 4NA9H 1AGJA 1LPKB 1O2PA 4FUEA 4I31A 3M5LA 1DICA 5GJ4B 2Z9JA 1AKSB 3V12A 3U98H 1O3OA 3BTEE 4KGAA 2QXGA 5GXPA 1DDJA 2J9NA 2RCEA 1GL1A 3RXDA 1CT4E 1VITH 2OQUA 2XNIA 3VB7A 4FVDA 2ZU2A 1O2WA 2QE7D 1QNJA 2TGAA 3LC3A 5EOKA 3QGNB 4BAHB 4JZ1A 1MZDA 2RA3A 2AMDA 1LVMA 1IQFA 1UCYE 3SV7A 4D76A 1L1NA 1DUAA 2W3KA 2QC2A 1TLDA 2A31A 1OWHA 1WOFA 2G55A 1VCWA 2GCTB 1N8OB 3SI4H 1SOTA 1A0JA 4AC9A 2ZCKP 2ODPA 1TAWA 3I77A 4M7GA 1Q2WA 2FMJA 3EGKH 2B9LA 1BJUA 3TK9A 2ZPQA 1MAXA 2IJOB 3SU6A 3ELAH 2A4QA 1P09A 1GBBA 4IS5A 5TCAA 1LHEH 1T32A 1O3CA 1C5SA 1CGIE 1DWDH 4NWLA 3AAUA 1P02A 4NCYA 2BD8A 5GIBA 2ZF0H 5HIZA 1C9PA 5A0CA 1JIRA 1O2YA 4B6FA 2YMSC 2Z9IA 4XDEA 5FBIA 4ACAA 2UUKB 1GBDA 1H8IH 3Q3YA 2P3TB 1GVKB 1VCQA 2P94A 2HPPH 2G51A 3KQEA 4JZEH 1NU9A 4ASUD 2R0LA 3S7HB 1ELBA 4GUXA 2G4UA 1TIOA 1YPGH 2A4GA 2EC9H 1VZQH 1ZLRA 3DFJA 1ANDA 3IG6B 4DOQA 2ZC9H 1ANEA 4X1QU 1SSXA 2FPZA 1O3FA 2FM2A 1EASA 3OX7U 5JYIA 1XUIA 5T6FA 1JWTA 3T2NA 1FJSA 3TK6A 3W1EA 3RXFA 3ODFA 3UFAA 2Z9KA 4PROA 3ZYEA 1QGFA 2J98A 4X8VH 2UWLA 1OYQA 1QA0A 1EB2A 2LPRA 1HYLA 4TSFD 5HXFA 3LT3A 5DN6D 1GHBG 4A5TS 1GI8B 2Y5GA 3TH2H 4K8YA 4HG6A 3O8BA 1SGRE 3A81A 4JYUH 1WAYB 4MTBA 5C1UA 2XBWA 1A4WH 4YXWD 1EOLA 2ZGXH 3RMMH 1KTTB 3RXEA 4CR9A 1GJ6A 4TWWA 4X0WU 3UWJH 2EQNA 2PSXA 4AYYB 4MPXA 2ANKH 3ATWA 2FS8A 2LELA 4TT3D 5T6DA 1K28D 3STIA 1AVWA 3SORA 1O5BB 1HPGA 1NU7B 4Y7BA 1IQEA 2DE9A 5CDFE 3EA7A 1C5VA 5FX5A 2WPLS 2O8MA 1NO9H 2F9OA 1S6HA 2C4FH 2PGQB 1V2UT 2FTMA 4WXIA 1FIWA 4OS5A 4CRFA 2GKVE 2D2DA 5ETXA 1VR1H 2G4TA 2QN5T 4FUFA 3NWUA 4BTIB 4YLQH 1C9TA 3N7OA 5DP5A 4LZ4B 2BDYA 2VIOA 4B75A 3GOVB 4U32A 9LPRA 5J4SA 2VWLA 3ATMA 3UR6A 1TNKA 3SNEA 2P3UB 1E37B 2ZU1A 3IITA 3RXQA 1GJ9B 2THFB 4MNYA 3ZZ8A 2ZCLP 3EE0B 3TIUA 4JYTA 2AMQA 2ZECA 3LU9B 1F92A 1V2NT 3BTFE 4CR5A 1ARCA 1O36A 4K60A 2JIZD 1TBZH 2PV9B 1BJVA 1GMDG 1HAVA 2V3HH 4RI0A 1XVMA 1N6YA 1ZRBA 2W6JD 4X6MA 1B0FA 4XRNA 1OWDA 2Q6FA 2ESTE 5E2OA 4CBNA 1O38A 2ZU4A 2F9BH 3RU4E 2HVYB 1NROH 1HAGE 1YM0A 1TGNA 4RKJB 1QB1A 1W0YH 2HALA 1O2VA 1EKBB 4GCHF 3SN8A 1W14U 5EW2H 3TH4H 1FN8A 3M3VA 1O3EA 1TNIA 2FDAA 1SR5C 4CRGA 1P9UA 1TA2A 3T62A 1A61H 4A1VA 2AEIH 1QL7A 2FS9A 2QYIA 2GDDA 3F9EA 2V6NA 2XTTB 3TH3H 2NU0E 2VGCB 1PYTD 3VXFH 2ZDAH 2IPQX 4K1TA 5GPIB 1L4DA 2IN2A 2J34A 1ELEE 3UQOA 1ORFA 1AU8A 2ZFQH 5E0GA 3QTOH 4KTUA 4VGCC 3B8JA 3I78A 2J5UA 2VINA 1V2QT 4DCDA 1IQIA 1CGJE 1HAOH 1TBQH 5EJ1A 2P59A 1UTKA 3JZ1B 4FU9A 4Y7AA 3K9XB 4Q63A 1AFQC 3UPEA 1IQHA 5LPFA 1GDUA 1LQEA 5GCHG 1FY1A 4JCNA 5L30H 4ABGA 1G2MA 1ZR0A 2CXVA 3A7YA 2W3IA 1BB0B 1O2JA 1XMNB 2BD7A 1ZTLA 3RXKA 1AVXA 1QJ6B 1A5IA 3HKIB 1Y5UT 2QF4A 1RTFB 4BNRA 3TVJB 3E0PB 2R2MB 1AKSA 1H4WA 2BD2A 3OSYA 1C1MA 1W0ZU 5KEDA 3RXIA 4TWYA 2ODYB 2QV1A 2VNTA 3GYMA 3AW1A 2ANYA 3MH5A 3F9FA 2BVRH 1O2IA 1KY9A 2JH5D 2ZHEH 1Z6JH 2WPMS 3DA9B 3GY8A 2ZNKH 3M37A 3M61U 4ISOA 5CE1A 3WWBA 1G3BA 1VCPA 2SGDE 3NXPA 1GBAA 1V2MT 3EE7A 7KMEH 3ZVAA 1DWEH 1C5TA 2AH4X 5HIYA 2D26C 5AF9H 1C2IA 1SL3A 1C1TA 1ZMNA 2G00A 5CHAB 1C2GA 1GI7B 1DLKB 2IOTA 1G3CA 3U69H 1UTNA 3SJ9A 4YESB 1BRAA 3CS7A 4UONA 1IQNA 2F9NA 5B6OA 4OS7A 1DUEA 1P8VC 3VFEA 2W26A 1EATA 3V3MA 1O3BA 1GJ4H 1YC0A 1GGDB 1ZHRA 4Y76A 1C2HA 4WY3A 1VJAU 3UUZA 2QXJA 1BTYA 3GYLB 3TJNA 4DG4A 2OCVB 2OC8A 3P8GA 2VGCC 2STBE 2CHAB 1MU8B 1OXGA 3LDXH 3NKKA 1QRWA 1AE5A 1HXEH 5DPAA 1EZQA 3B9FH 1NY22 3KIDU 2H9TH 5B6LA 1O2GH 3KQDA 1VITG 1QB6A 2XBXA 3PRBA 1UJ1A 1MD7A 3LGWA 5C5OA 2CJIA 1MTUA 2VH0A 2W6ID 1P3EA 1TONA 4KTSA 5EJLA 3OEHD 2ZCHP 5K0HA 3SUDA 4I33A 4WH8A 1Q3XA 1P2OA 2PKAB 2NU3E 4YT6H 2XXLA 4Q2KA 2GMTB 1EFRD 3A7ZA 1NBMD 1RJXB 4ZHLU 2EEKA 3A83A 1AO5A 3KHVA 5KGOA 1O2MA 2BD3A 4ZKSU 1DY8A 1C1NA 1X7AC 4DURA 3MFJA 2ZU5A 4ABIA 5A8XA 4CREA 3C27B 5C94A 2PW8H 5F03A 3PMHB 3U28C 5EODA 3GS9A 2BDHA 4TPYA 1BTWA 4Y11E 3OU0A 1W0KD 1WV7H 4HZHA 1GBEA 4UD9H 1FAXA 1GBKA 1O30A 4DGJA 5A0BA 2P95A 1TGBA 1O2HA 1C4U2 1LKBA 3TITA 1RIWB 4K1SA 4BAKB 1QBVH 1PJPA 3SU1A 2FEQH 2ZU3A 4I8JA 1ZRKA 3SUEA 4UFFH 2PR3A 1TQ0B 1VKYA 2WUBA 1BTZA 2L74A 2BDBA 3VXEH 2P8OB 3RXRA 5DJ7A 5KECA 2BZAA 2VIVA 1QURH 1KXAA 1TGTA 4FUIA 3SOSA 1UTPA 1Y59T 1ZJDA 1RGQA 5AVDA 4E06H 1P03A 5EXLA 3TNSA 2BOKA 1TMUH 4R0IA 4INLA 1N1LA 4LOYH 3H09A 3URCA 3PMAB 1BMNH 1MKWH 3M3SA 1OHHD 4X1SU 4B73A 1ZYOA 2KCAA 5L6NH 5DO4H 3CENA 2V3OH 5JBTA 3RXPA 1C4Y2 1PPFE 1IQLA 2BM2A 1LPGB 4WMFA 3BTKE 1SQRA 1IOEA 3GCTG 3RMNH 1QIXB 4YM9A 5EJZA 1BTUA 3PTBA 4I7YH 3FZDA 3TJUA 1PQ7A 5L2YH 1P57B 2ASUB 4O3TA 1TA6A 3RLWH 3O8RA 2OK5A 1O5GH 2ZP0H 5EQRA 1MCTA 4ZH8A 2ZO3H 1BBRE 1EAUA 1XX9A 3RXJA 2XC0A 3LOXA 1HLTH 1T8OA 1S83A 1O2KA 3SW2B 1RS0A 1TFXA 2EY4C 1CT2E 2FTLE 3R0FA 2BOHB 1Z8RA 2BD5A 2A45B 2KFWA 3OYPA 1OWJA 4U30A 3HK3B 1GMCF 5A09A 5L2ZH 1TMTH 1SB1H 2C8WB 1HAHH 1L4ZA 1O37A 1BIOA 2P93A 3QN7A 1J9CH 3BG4B 1QTFA 1P0SH 1V2JT 1ELTA 1XKAC 2PTNA 5ABWA 3EAJA 4LZ1H 2PGBB 2JH0D 2J97A 4IMQA 3LGIA 4MG3A 1C4V2 1V2PT 1MU6B 3MI4A 1FY4A 1TE0A 1AZZA 5TJXA 1GG6B 5JBCS 3M5MA 3LH1A 3A7VA 4MLFB 3FVFB 4WH6A 1S84A 2DE8A 1PQ5A 1IQGA 1O3KA 5FBEA 3GY5A 1K1MA 2BDAA 2SGFE 3TJVA 3F1SB 3QDZB 4CRDA 1KDQA 2DUCA 5A8ZA 1ZGIA 3RXSA 3U8TH 1CU1A 1W7XH 4X1NU 2A5AA 1GVLA 4IBLH 4LK4A 2F9UA 1O3LA 2J38A 3NCLA 1O2OA 2KAIB 4OS6A 3VG8A 3RC6A 5C1YA 3ZVGA 3F0OA
chains in the Genus database with same CATH topology
1UO6A 3BIUH 3TPIZ 2HVXA 3BTDE 3FP6E 1TRMA 1GJBB 1ZPZA 1C1VH 1Y5AT 5HYOA 1DITH 3M36A 2QIQA 1ESAA 1W2KH 2QCYA 4XBCA 4NFFA 1ID5H 1C5ZB 2Z94A 5T6GA 3U1IB 1EP6A 1EXFA 2VVVA 3MU8A 2AFQB 1TB6H 1WQVH 4TPIZ 1YCPH 1LHCH 1DWBH 4AB9A 2ZGCA 3E3TA 1ELGA 2Y82A 4NZQA 1TNJA 1YBWA 2OQ5A 4SGAE 1ZHMA 4DW2U 3QO6A 1UK3A 2WV5A 2RA0A 4INKA 1TX6A 2A0QB 4A1XA 1NZQH 3SV6A 3ITIA 3RXBA 4WF8A 1GBHA 3MNSA 2FX4A 1KIGH 4WMEA 1AQ7A 3ZZ7A 1C1WH 2PFEA 1QB9A 1YPHE 1GI2A 1MCVA 1S5SA 4ABAA 4D9QA 1SGTA 2ZHWH 1YCPM 3VPKA 3QK1A 1TPAE 4MPVA 5A2MH 1O32A 3A85A 1SG8B 2ALPA 2VWNA 1W12U 1ZMLA 3EDXB 2I6QA 4IC6A 1MH0A 1GCTC 2OBQA 2PWXA 1NRSH 2XC5A 3E8LA 1IHSH 1OP2A 1SFQB 1BRCE 2VIPA 1F2SE 4AFZA 1FV9A 1AFEH 8LPRA 1J17T 1P9SA 3UNSA 3P8OA 3HKJB 2ODQA 1EUFA 2ZKSA 4XSKU 4Q7ZA 3VGCB 1K1LA 1HXFH 2AIPA 1V2LT 4O03A 2AIQA 1BBRH 1GHZA 1Z7KA 2BQ7B 4JZDH 2OC7A 1LTOA 1O5FH 1GI5A 3GDSA 4Z0KA 1ACBE 3QUMP 2BDIA 1W7GH 5I46H 1AIXH 4B74A 5HGGA 3RXVA 2YOLA 3FP8E 3PM3A 3A8BA 2XBYA 1GBIA 2B7DH 1KLIH 2QF0A 1XUGA 1PYTC 1LPZB 3M7TA 1HJAC 2TGDA 3GCHC 2OC1A 3L6PA 1UTMA 2R0KA 3ZZAA 2GT8A 2GCHF 1FY3A 4AGJA 2BY9X 2PKAA 2VWMA 1OP0A 3NUMA 1NRQH 1GPZA 3OY6U 1CBWB 1WTHD 2R3YA 1ZOMA 3ZVDA 2TRMA 4XBBA 6GCHG 5C20A 2BDGA 3RLYH 1LKAA 2F3CE 1NT1A 1SHHB 1FPHH 4NZLA 1NM6A 3ZZ5A 2EA3A 3RXGA 1GJCB 5EQSA 1BCUH 3PWCA 1GCDA 3SJIA 3BEUA 3KN2A 1BMMH 2BQWB 2J92A 2C8XB 1D6WA 4NA8A 3PO1B 2ZG0H 1CHOF 3MH4A 1TNHA 1SMFE 8GCHF 1WYKA 1TRNA 4ZXXH 5F8TA 3ZVEA 3NZIA 1ELFA 3Q3XA 1PFXC 2QY0B 3QTVH 4DIHH 3CP7A 1A2CH 1GHVH 2BZ6H 2Z7FE 3TU7H 3T29A 1FUJA 5LH8A 4AFUA 3M7UA 1CT0E 2ZQ1A 1UK4A 1HAXB 2GCTC 5IYTA 3E0NB 1N8OC 2ANWA 1GBLA 5EG4A 4UFEH 1BDAA 2H6MA 1YPMH 4NFEA 1EZXC 1KXFA 2BD4A 5CMXH 5FCKA 1ESBA 1H9LB 2BMGB 1ABJH 1EX3A 1Z1JA 4AYVB 1CA8B 1DY9A 2K1QA 1QQUA 3KF2A 2OXSA 4K5ZA 3BF6H 4K69A 4YO9A 1P2QA 1UCYH 3V7TA 4O9VA 1FLEE 1UTQA 4YOGA 1THSH 3ZZ3A 2FOAA 1GDQA 4WWYA 1D3PB 1O5EH 3MU4A 1IQKA 1EPTA 4BAQB 1S6FA 1IHTH 2SFAA 3U8OH 1MQ5A 3MU5A 4A1TA 2FO9A 5EQQA 3Q00A 1C5YB 3LGYA 1SHYA 2Y7XA 1E36B 5E0HA 2ZDKA 1UTOA 1PPZA 4R8TB 1YPKH 3B23B 2ILNA 6ESTA 2Z3DA 1J15A 4I32A 2BLOA 1O3GA 3BTWE 1O3AA 1QRXA 3UREA 2BLVA 1V2OT 1GBMA 1A1RA 2HNTE 1ETTH 1QJ7B 1B5GH 4E05H 1AWHB 3RXAA 1TNGA 3SBKA 3LPRA 3O8DA 4ZROA 4AN7A 1HAYB 3SNDA 3MMGA 4AORA 2ZDVH 4ASHA 1SBWA 1H9HE 1EJNA 1XUFA 1AB9B 2ZPRA 3K6YA 2V35A 4AFSA 3RUOA 1GHAF 1ZHPA 2UUFB 1K9OE 3FP7E 1NN6A 1DANH 2ZI2H 3ZV8A 1T4VH 3BEIB 6CHAB 2Q6GA 2HRVA 1ELDE 1KDQB 1W13U 1C1OA 2KAIA 2NU2E 4BAOB 4DIIH 1O2SA 1GMHG 2GV7A 1TPPA 1FONA 4RSPA 5FX6A 3RU4D 3SI3H 2AYWA 4FUGA 2FOCA 1LVBA 3NPSA 4NIYA 2QA9E 1PPCE 1T7CA 1P11E 1MBMA 1H1BA 3ZVFA 2XC4A 1O33A 1XUJA 4TY6A 1SGEE 4Y0YE 5EXNA 1MMJN 3RC4A 2FYQA 1EQ9A 1IAUA 1TALA 4E7NA 1O2RA 1ZJKA 7ESTE 1C2FA 1QA7A 4BXSA 2Q6DA 2VVCA 1C5RA 4JZFH 1OX1A 2PKSB 2SNWA 3UQVA 4FUJA 4B2BA 4GVUA 1Y3XA 3RDZA 4HI3A 3P8NA 1FXYA 1C5XB 2ZPSA 1T8MA 1C1QA 3RU4T 1P06A 2FOEA 1G3DA 2Y81A 2OD3B 1E38B 4BTTB 1LHFH 4DJZB 1SGFG 2I6SA 2YNAA 4ZMAH 2FXRA 1GBFA 5G4BA 2RDLA 4H6TA 5EU8A 4FXGH 1F0TA 4IW4E 1O2NA 1MTNB 2F9VA 1BQYA 3LGTA 4YTAA 2G52A 1K2I1 4AZ2B 2B8OH 5A0AE 5EPNA 1HBTH 3GCOA 3TJOA 4IN2A 5DKMA 3STJA 1YKTA 3MWIU 3PV4A 1ESTA 4B71A 4FVBA 2Q1JA 4UEHH 1MKWK 3GY4A 4ZKOU 1OWIA 1P12E 3ZZ9A 2ZTYA 4AOQA 1VGCB 4AG2A 1GHYH 1H9IE 5JB8S 1GI0A 1TX8A 4MDSA 2SGEE 3JZ2B 1SOZA 2Z3CA 1P2IA 1P2KA 2VVUA 3P92A 2ZFSA 1DE7H 2A7HA 1SLXB 1GVZA 2UUJB 3LGVA 3F68H 3T5FH 4Y0ZE 1CA0B 1NESE 1SFIA 3VB3A 1B7XB 5EPYA 1C2EA 1IQJA 4X2YA 2C3SA 3NK8A 1SLUB 2C8YB 4D8NA 1K1JA 5K7RA 1CGHA 1W3CA 1UVOA 2NWNA 2P16A 2GZ8A 1MAYA 3KGPA 4RKOB 1V3XA 2FI3E 1THPB 4INHA 1O2UA 1P01A 3BN9A 1L1GA 1A7SA 1ZGVA 3UTUH 3PTNA 3P8FA 4AX9H 4NIXA 4Y8XA 7GCHF 3ATKA 1PPHE 4H42U 4GPGA 1DSUA 1QJ1B 2SGAA 2HNTF 3FZZA 2HOBA 2R2WU 3F9HA 3H7OA 2UWPA 1Z6EA 1HAIH 2Y5HA 4ZKRU 1C5UA 4O97A 3SHCH 1PPBH 1BTPA 3BG8A 1OSSA 2ZDLA 3MO9A 1SQOA 1TX7A 5JBAS 2CN0H 1P2MA 1J14A 1QFKH 1LQDB 5DP8A 1C1UH 1WTGH 3A80A 2ZTZA 1GI6A 1GDNA 3M5NA 3OY5U 4ISHH 3Q76A 1GJAB 2R3UA 2QF3A 2WYGA 1Q31A 1NRNH 4AFQA 2IPHA 1V2VT 1BITA 1DOJA 2CF9H 1C5WB 1G2LA 4XBDA 1SGFA 3SU3A 1V2RT 3O8CA 1ARBA 1RTLA 5AHGH 3QLPH 1HAPH 1GL0E 1GMDF 4ISNA 1K1NA 5AFZH 1C1PA 2M5TA 3PROA 1FQ3A 3GY2A 1MTNC 3SJOA 4IC5A 4CRBA 3D23A 1Z8JB 1S81A 1XXDA 1CE5A 2ZWLH 5GDSH 2UUYA 2ZZUH 2CGAA 2FX6A 3HPTB 5CHAC 1KXEA 3UNRA 1O2XA 3PYHA 1YCPK 1SPJA 4X6PA 5JB9S 4GSOA 2EI6A 2B0FA 2GZ9A 3LH3A 3EA8A 2FI5E 3ENSB 2G5NA 3PB1E 4DY7B 2Z6BD 2C93B 1CO7E 1DWCH 4OS2A 2GX4A 2WPKS 2ZFTA 1ZSJA 1NFWA 1NRPH 2BX4A 1GGDC 1GI1A 1MZAA 1EOJA 1KLJH 3RXCA 2BB4A 2G81E 2BY8X 3UR9A 1QCPA 3A87A 1O3HA 1JRSA 1O5AB 5T3HA 1GJ7B 1WU1A 1TABE 1EPTB 1CVWH 1YPHC 1C5QA 2CHAC 4H4FA 5DP4A 3RXLA 1Z8IB 3ODDA 2A5IA 1SGDE 2V0BA 3MH7A 1D9IA 2SGPE 2ZGJA 1T4UH 3ZVCA 3RXTA 4X1PU 4I8KA 4UFDH 1GI4A 4CRCA 3A7TA 5H4IB 4Z6AH 4MQAA 1BZXE 5F8XA 1B0EA 2BLWA 2XW9A 1G36A 4KTCA 1CQQA 1DT2A 1LVYA 4KKDA 1MBQA 1RFNA 3T25A 1EJAA 5HM2A 1W10U 2A7CA 1O0DH 3ESTA 1DS2E 1YP9A 1BUIA 2GMTC 2ZFFH 3H5CB 4Y10E 1JBUH 1Y3WA 1BBRK 2XBVA 1OYTH 1HJ9A 5FPTA 3E6PH 2EI7A 3HATH 2ULLA 1O3DA 2AGIX 1AE8H 1SGNE 2H1UA 3SNCA 1UVSH 3A8CA 3BEFB 1SGCA 3SU5A 1C1RA 1O2TA 1OWEA 1FMGA 3BTGE 4FUDA 1FDPA 3W94A 2PLXA 4GHQA 4A6LA 2OP9A 2J94A 3S9BA 1AN1E 5TCCA 1SLWB 3D49H 3FFGA 5LPEA 4BAMB 5DGJA 2BHGA 4A7IB 1K21H 1MTSA 1YPJH 1LVOA 3G01A 1C5NH 1BTHH 2GV6A 1RIWC 3A82A 3R3GB 2WINI 1K22H 3PMBB 3MO3A 4WXVA 3ZVBA 2A1DB 1VJ9U 2P8OC 3KL6A 2VIWA 2OTVA 4MPUA 1XUKA 1XKBC 3PLPA 2R9PA 4CRAA 4FU7A 2XWAA 1FN6A 1YPLH 3BIVH 1DLEA 3A7WA 1XXFA 1BRBE 5JPMH 1C2JA 4GCHG 1A0LA 1SVPA 2BTCE 3SGBE 2CMYA 2VIDA 1V2KT 2P3FH 2ZFRH 1PPEE 4NSYA 2F83A 1MD8A 2YNBA 2J2UA 1AVGH 1QR3E 2BDCA 2TIOA 4YLUA 2BVSH 3ZV9A 1EAWA 2NU4E 3KNXA 3E91A 1C2DA 3KEEA 2PHBA 2JETB 4B2CA 4UE7H 9ESTA 1GHAG 1EJMA 1HV7A 1O5DH 3BV9B 1XVOA 1D3TB 1F7ZA 1ZPCA 1EPTC 2FP7B 5E0JA 1ZMJA 3SQEE 1VITF 1DXPA 2HLCA 4WJG2 2AGGX 3D65E 3C1KA 5F6MA 4NIVA 4OGXA 2FOFA 2FI4E 2BYAX 4K3JA 2OINA 1BHXB 1V2ST 1FI8A 3RM0H 1TMBH 4YT7H 1MTWA 1P04A 2Y6TA 4J1YA 1AUTC 7LPRA 1O3NA 2HPQH 1J16A 3EA9A 4OS1A 1V6DA 4ZAEA 1UCYK 1U6QA 2BXUH 1NTPA 3QZQA 2VWOA 1L1JA 1JRTA 4I8HA 3MYWA 3BG4C 1TPOA 3KQCA 3GCNA 4SGBE 4ZXYH 1ETRH 4K1EA 5HMAA 2LNCA 3E16B 2Y7ZA 1GG6C 1ELAA 1QBOA 3ZZ4A 5LPRA 1O2QA 3AAVA 2CF8H 3TNTA 3ZZDA 4BXWA 1RXPA 1C2MA 4BANB 1GJDB 4D7GA 1TPSA 3BSQA 2O8LA 2TGTA 3RXOA 1YPEH 1UVUH 4KP0A 1EB1H 1M9UA 1MKXH 1OP8A 2ZHQH 3DT0H 1G37A 4CBOA 1NFUA 1QHRB 2G5VA 2CV3A 2XCNA 2BQ6B 3ATIA 1HIAB 1AMHA 3SU0A 3FAOA 5BRRE 4X8SH 2F91A 2HNTC 2ANMH 1BRUP 2F9PA 2BLQA 1DX5M 4CHAB 3UY9A 2FOBA 3TGIE 2JKHA 4HFPB 1E34B 5FPYA 1GBCA 1E0FD 2H5CA 4K2YA 1ZPBA 5DP6A 2A2XH 5J4QA 3GCTF 1H8DH 4CH8B 1NPMA 1THRH 3U1JB 1AZ8A 1FY8E 2GVFA 1KSNA 1HCGA 2O8TA 2ZDNA 4B1TA 2BY5X 4VGCB 1EP5A 1G3EA 1TOCB 2HWLB 1HDTH 4IGDA 4YOIA 1O34A 2JETC 3L33A 1IQMA 2VU8E 4X8TH 1D3DB 1O3IA 4X2XA 1ZSKA 1P2NA 4DT7B 3A89A 1SQTA 1AFQB 1D3QB 1UMAH 1W11U 2O8UA 2FYRA 4GLYA 1SGQE 2J4IA 2XWBI 1CHGA 4I8LA 7GCHG 4H6SB 1INCA 1QBNA 2D1JA 5I25A 2ZA5A 2ZGBH 3OTJE 1AHTH 3QZRA 4LXBH 1C5OH 4E7RG 2SGQE 3PLKA 3A8DA 1TNLA 4KELA 3DUXH 4J2YB 3E1XB 4UFGH 1G30B 1UTJA 1O39A 1BT7A 1SGIB 4X2WA 3MOCA 3RXMA 1FPCH 4B76A 3VGCC 3SU2A 4MVNA 3SV2H 4FU8A 4ZKNU 1OOKB 2FODA 4TYDA 3TGKE 1QY6A 3K65B 2ZHFH 1FY5A 1YLCA 1K1PA 4B2AA 1SC8U 2WPIS 5JBBS 1NFXA 3SU4A 1ELCA 2GZ7A 4ISIH 4O3UA 5IDKA 2B5TB 3AW0A 3HK6B 1BTXA 4X6OA 3SJKA 4XOJA 3UOPA 2FIRH 5ESBA 2XYAA 1C2KA 1P2JA 1NRRH 1FAKH 1N6XA 1NS3A 4I8GA 1SGYE 2ZIQH 4MNWA 4JK6A 1GBJA 1S82A 3LJOA 2Y5FA 3UWIA 2GT7A 3I29A 2Y80A 1UHBA 1CBWC 1L0ZA 3D62A 5E8EH 1SLVB 3URDA 1S0QA 2GP9B 2W5EA 4X1RU 2STAE 1F0UA 1UVPA 1DPOA 2ALVA 3ZZBA 3SV8A 3GICB 4X6NA 1DSTA 4JK5A 1HUTH 1HJ8A 4NA7A 2GTBA 3S69A 5GWZA 3MNXA 1A3BH 4F4OC 3SNAA 4D7FA 1J8AA 3PWBA 4NSVA 3A88A 5DK1A 4FUCA 4CHAC 2ZEBA 3U8RH 1KTSB 2ZHDA 3W95A 3M35A 4BTUB 1XM1A 1DM4B 1OPHB 1ANCA 4DVAU 3PO1C 4MPWA 3S7KB 4UDWH 1MUEB 3LKWA 4F49A 3T26A 1S0RA 3P17H 3PMJA 3CS0A 5FAHA 1SQAA 3KCGH 3GY