1EZVY

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ezvY00
3UBXG 2W9EL 3VWKC 1J0ZA 1T1YB 4MAYD 1T83A 4CDHA 5IMMA 5EUKA 3VXNB 1NEZB 4O5LL 2H1PL 5GGUA 5BV7C 1EAJA 3UYRH 4ZXBD 1JRHL 3B9DA 4NJ9H 4J4PA 1DUYB 3KPSE 1CXFA 3HFMH 4KH2A 3PGDA 2DLHA 4OGYH 5BMFL 3L5WB 5J06A 3GSNH 2CKNA 2ICEA 5BS0A 3O6LL 5C6PB 3QG6A 5E2WL 4EQ2A 1YEIH 3ECBA 3QEQA 1CYGA 1U92A 4NNXA 1JP5A 4NQEE 1BIHA 1I75A 3U9UA 3F58L 3UDWA 1GGBH 1T5XA 5B8CB 4S11A 2CPCA 2EO9A 5C0FA 3ARFA 4JZOB 4G7VH 3I50H 4OIAA 2BNQB 2PTVA 4WW2C 3C6SA 1RZIA 2XICA 2ZWLT 1EK3A 2ZNWA 5L0QC 2BVUA 5J12B 1A22B 1JRHI 4IIQA 3IDJA 5T3XL 4AM0A 4NPYA 1X5IA 3KLAA 4KJYB 4O2EB 5DK3A 2A74B 2BNQD 1T6VN 3RWCA 1QQDB 25C8L 4EUPA 3DSFL 4XP6L 5CJQH 5EWIH 3O2WL 3FTGA 4RA3A 1KTKE 1MY5A 3QZWG 5DMKB 1MFAH 5ERWB 4MD0B 3UO1L 4M5ZL 5DHYA 5HPMA 4FMKA 5K9QI 4IEFB 1F4AA 2AGJH 3AU1B 3FO9A 4HPOH 5B39G 5D6DC 1YN7A 2GFBA 3BJ91 3GSNB 1G1YA 2IADB 1QVOA 3BGMA 1KPVA 2JJVA 4R4FH 2VLKE 4QRPE 2DQTH 2YD2A 4ZFFB 1CF8L 5J0BA 2MHAA 4L3EA 3EW3B 2JCCF 3EGSB 4Q2ZA 3U79A 1G6RA 2GJZB 3MBEA 3TPUB 4LL9A 4PFEA 1S7WA 1CFNB 2XY2A 2NY3B 1AFVL 4S1DD 5EZJB 3T1WA 3BMVA 5IFJB 1MQKL 4RFNB 5EORL 3VA2C 5FHAH 5I1KL 4M1CC 3EYVB 2Z91A 2XG4A 1ROWA 2FNBA 2AS5M 5LQBL 1CE1H 4PJBE 3O9WC 5FFLA 1BBDL 1T04B 5ESAB 3FRPG 1NANH 1YC8A 1JN6A 1VGKA 2I27N 2NY3D 5FIEA 3CMOH 5C71A 4JY6B 1PAMA 4WUUE 5D70H 4J3UA 3WFEH 4YHKL 4KVCH 4AJ0A 3NIDE 3QUML 5FV2A 1R5VA 3MOQA 1J1OL 2KH2B 4OFIA 5EU4A 2A83B 4QHNA 5H94B 3WD5H 5I75C 5SWQB 3BYTA 3PGFH 5JQ6H 4A6YL 5J11C 5AZ2L 2IMNA 1J87A 1NCUA 3GSXB 2XWTA 5C0AA 2LAGB 3MV9B 3CCHA 5IVZB 4EI5B 1CDCA 4JY5L 5D93B 2C1PA 3AM8C 4K7FA 5CEXA 5B3NA 4NOFA 3OKEB 1YEKH 1U3YA 4WFFE 1X5YA 2Y4SA 3KYOB 3HZVB 4N0CD 1A7OL 5EBWA 4NFCA 2X89A 3MV9D 2DICA 2DLTA 3EOBB 2C3GA 3WIHA 4Z5RB 3V52L 5I1AA 1RJCA 2JB5H 4LMQI 4AIXA 1MFBL 4YEFA 3LEXB 12E8H 4TVPL 2EH7L 4QHLA 1FLRL 1O0VA 3U7YH 3WDHA 4LLDA 2DQUH 2IGFH 2WBJD 3PL6D 1HHKB 4X4XB 4DEPB 3TA3B 3HLAB 3L5HA 1MWAH 4HV8A 3CIQA 4ODUB 4RMTA 3CLEL 1MCIA 1XCQA 3CD4A 1YDPB 3FFCE 4UTAH 5GS0C 4YZFF 5A3IC 5HHME 2YPLA 4JG1H 1S8DA 4OLUL 1N8ZB 1EO7A 3P4LA 2VDLH 3JTSA 1LNUB 3PQYE 4JQIL 1PG7H 2QSCL 1LP9F 3IS0X 3UX9B 2B5IC 5DD3L 3OKDB 2FATH 2R9HC 3NFSH 4PJ8B 4HBQA 3KLDA 4AIOA 4GMSL 5C2BL 3MREA 3IDNA 2GYSA 3N9GL 4JFOA 3GSQA 4LRNL 4WW2A 3P77B 4LLAA 6FABH 5DFWH 3ZL4H 5IP4A 3FFDB 3VE0B 2ZCLL 2VL4A 1BEYL 2CQVA 2XFXA 2VSCA 3QXDA 3IU3B 3FB6B 1O7VA 1RJZB 4PJ8D 1I1AC 3BAEH 4DGYH 2PCPB 1JZ3A 5E08L 1LDSA 5JQHC 3BN9D 1CXEA 4XMKH 2EC9T 4GRLA 2QQQA 3OGOE 4M93B 1BGXL 4IJ3C 1MLBB 3VXME 3DV6B 4XXDB 3QPXH 3BT2H 3A6BL 4A2MA 1X9QA 1G7PA 1ZS8B 2AKRA 1N6UA 5D6DA 2B0SH 1DLHB 4XB8A 5BCAA 2Q76A 1FBIH 2HLAB 1BFSA 4JPWH 3KPPA 4Z0BH 1FDLH 4RMUA 2X4RB 4HLJA 4LCUB 4NKIH 4WCYH 2D9QB 1MAML 4U0QB 4PREB 1GHFL 5T3XE 4FQJH 1BFVH 4G8IB 5FUZH 2C9AA 3MV7B 5CWSB 3PG2A 1R3HB 4L3CB 3BW9B 1TVHA 4LPUA 3AMLA 3T4YA 4OIBA 4C56E 5IMMB 2ZUYA 4IRZL 5EUKB 3ARBC 4RZCB 4DKFL 4Y5VA 2XG5A 1JVKA 4YXKH 5GGUB 1QTYT 4YC2C 5IHBA 5JOPE 3MV7D 1WFUA 4D9LL 2X9YA 3OKLB 4BM7A 1GGCH 4WW2F 1VACA 2I26N 3PGDB 2Z31B 4DVBB 3MROA 4JFQA 5K59F 3O8XD 2IAMC 1UWXK 5C7XL 3S37L 1LK3L 2ICEB 3QG6B 5MEOA 5KVFH 3PWLA 2AEWA 1U92B 3H3BC 5DK2A 4QYOA 4NNXB 4U1IB 3U9UB 1IC5L 1I3UA 4HWUA 2Z31D 2QV2A 1G6RH 1T5XB 5C0FB 3RGHA 3ARFB 1RV6X 2BCKB 3AY4C 3IU4H 5ENWA 4J2XA 1FLTX 2ICWJ 3D3VA 3GMRA 3C6SB 1RZIB 2HLFC 3ZTNH 1P9MC 2GIYA 4JFZH 3RAJH 3BI9X 5FECA 4IIQB 3IDJB 3O81A 1S7QA 5EOTA 4AM0B 4NPYB 2B1AL 1G9MC 2G2RA 3KLAB 2YMXL 2GQHA 3MLSL 3ARFD 3QXUA 2YEZA 3BPCA 1WBYB 1FFNA 3RWCB 2NX5B 5IB1A 5EZLA 3FTGB 5F7EH 5FYKL 1G1CA 5FOBA 1YEHH 1BM3H 4JKWA 5MEQA 3BDXA 4H88H 5DHYB 1BZ9A 3EO0B 5HPMB 4QNPF 3FO9B 3WSQL 3ARGB 4ZPVA 1YN7B 2GFBB 5F3BA 2NX5D 2Q6WA 1MCPL 1QVOB 3BGMB 1KPVB 4RWYL 5M94B 3VH8G 1KIRA 2MHAB 4HXBL 4L3EB 1IGFH 1E4XH 4PIRF 1BF8A 3ARGD 1G6RB 4XVJH 1S7WB 3I3DA 1TTUA 3EYUH 4XPTH 4ZUSA 1JZ4A 1ITCA 1Q8MA 3WIHH 3MLTA 4TVPE 1R3JB 4N0FA 1OW0C 2Z91B 5JHDA 3SGDI 3TH4T 4OKVA 1F3JB 1FG9C 1CGXA 2OI9C 3S4SG 2M8XA 1JN6B 3VG9B 1HEZA 1VGKB 3EYQD 2AJXH 3O3EA 3F7PC 3TIDA 3HCVA 2EDHA 2BY1A 2CUMA 5DUPH 1QSZA 4ORGA 4PJDA 4U6TA 1MCBA 1X4ZA 1R5VB 4G8FA 2MKLC 4HIEA 4WENB 1S9KC 3CK0L 1WWAX 3VGGA 3Q5TA 5IROC 5T1DH 4QHNB 3T2QA 1RJLA 3DURA 1TTFA 2V2WA 2EDBA 4JB9H 2OJZH 4L1DA 3U0PB 3MA9H 2OQJA 2XWTB 1J8HE 4WHCA 1RIVH 5ALCH 5F6HI 3CCHB 4F15B 4IMLA 5HGGS 2C1PB 2MFNA 4K7FB 3BIAX 1GXEA 1L6XA 3SGKC 5IQ7L 4OLWL 1NLBH 3VXRE 2L4OA 4DN3H 2NY5C 1J1PL 4ZO9A 2VXQH 3RKPA 2LTQC 4LCIH 5EBWB 4HD9A 3KYNA 4JFFA 3UJIL 3OB0K 4NHUA 3IDXH 3DYPA 5I1AB 4L8SB 4BSJA 1J1XH 3NCYS 4HUXA 4HKJB 3RZCC 4LVHC 2M1KA 5EC2A 1Q9WA 1Q0XH 3EJYC 1JTPA 4I0PB 4QHLB 3ULVF 2X1OA 5DHVH 5T3ZL 2X89D 1BQSA 2AV7A 5J4MA 1N59A 2F9BT 2X6MA 4G9FD 5DJXA 4WI7A 2K7QA 2BNRE 4Y2DA 3RBSA 4HWEH 3TO4A 4OQTL 3WHXB 5FB8B 4HKZA 4XT1C 4I0PD 1BWMA 4OKDA 1YEGL 2D03L 1UB5A 2KZWA 4CGTA 5C0NC 3QDHA 4KGJA 5I15H 4RSVA 2E9IA 5HVGB 2I25N 3S5LA 4FFYH 2YPLB 1T2QH 5J3HD 4PRIA 1S8DB 2PXYC 1UXWA 5B21A 3ZHDA 2VR9A 4OF3A 3RX5A 5D5MA 1LE9A 2HTLC 3MACH 2VDRH 4N0YH 3SDAB 2DF3A 4LP4A 2FEEL 3BVNB 1YEDA 4IMKC 4M48L 1A3QA 1DFBL 4RRPA 2YPLD 2XZZA 1D5ZA 2NR6C 2BMKA 4PRPB 1OD7A 4NWTH 4KZEH 3MREB 3IDNB 3BOVA 2AJYL 3GSQB 4JFOB 4NBXB 3SDAD 4DVRH 5E4IA 1AP2A 3HG1E 5IHLB 5L0QB 1ZTXH 1F5WA 1ETZA 4LRIC 4U6HA 5CLTA 4MZ2A 4NC2B 1EGJA 3L5XH 3FB5A 2XFXB 3QXDB 1HILA 3G6DL 1DVFA 3QWRA 4PRPD 5IJKC 2ZCKH 5IQ9A 5D4QA 1R3IH 4HK0A 1GOFA 4PRNA 4LLUA 2VH5H 4XZUA 2V5MA 4GRLB 2A6JB 1KB9J 1UENA 5DJ6B 4BFEA 2FEEI 3AXLA 2UZIH 2R0LH 1RK1A 1TNMA 3WXWL 1G7PB 4HAFA 3T1FB 2EDOA 3HFML 4P59H 3BPLC 1RUPL 1T0MB 2Q76B 5HHOE 5EC1A 1AHWC 3GSNL 4XMPH 1KJ2A 3KPPB 2OTUA 1UB6A 5CAYB 3EUUA 1A3LL 2P5EA 2NYYD 1WBZA 2DKSA 3T0AA 1GZPB 1DBJH 4AG4H 5D5MF 1GGBL 1ZKAA 1JE6A 2E7LC 1TVHB 3T4YB 4G7VL 3I50L 2UUDH 2VXUH 1ZA3A 3G5YA 4Y5VB 5FYKE 1RSFA 5J6HB 4MA3B 3Q1SH 1IAKA 2FL5A 2BJMH 1N64H 4M6MH 35C8H 7FABH 4NQVB 4MJ2A 43C9A 4Z77A 2BRRH 3EDEA 2E3VA 4UILH 4LSVH 5F97E 1FNEB 5IF0A 1VACB 4YXLH 1JJUA 1UCTA 3MROB 4JFQB 4JGJA 2EYSA 4PJ5A 1XZ0A 5MEOB 5CJQL 5TF0A 2VTFA 2AV1A 1IEBA 3GJFA 1BVLA 1V3JA 3LS5H 3PWLB 5HYSA 1MFAL 5FV1L 5C07A 5DK2B 3RVXD 4QYOB 3RPKA 5K9QG 1OGAE 4K8RC 2AGJL 2WIIA 2YUXA 4XAKE 1N4XH 2AW2A 2C1OB 1OCWL 3E2HC 4M4PA 5ENWB 3SGKA 2CK0H 4R4FL 1BVZA 3D3VB 3GMRB 2DQTL 5CZKA 3FOMB 4X8XA 1L7TH 5FECB 1S7QB 5EOTB 2G2RB 1F4YH 5MI0C 3D0LA 2YEZB 1BQLH 3BPCB 2FIRT 1FFNB 1WAAE 5D1XA 5FHAL 5IT2H 5IB1B 4KPHH 2QL1A 1I8KA 3KLSA 3TP4A 4JGMA 4P2QA 1CE1L 3HS0A 5MEQB 4PGDA 3VDBA 5C0EA 1M05B 3OR7A 2FJFA 3AS2A 4ZPVB 5ADPH 2A1WH 1DL7H 1U3JA 3WCYA 3BEVA 3HTLX 3CMOL 4C4KT 4J3XA 1HYSD 2Q6WB 2ZCHH 1CDJA 2C3VA 2P5WA 4LKXA 4JY4A 5HYQA 3WFEL 2J7LA 3PV7A 3B9KC 5IB3A 3BKCH 1U8LA 1KIRB 3JV4A 3GKZA 3KPQA 3V79C 5E8DL 3SEPA 1C5BL 3WD5L 3H8NA 4PGCB 3PGFL 5JQ6L 4YGVA 2APTA 5HI3D 2MKWA 2PXYA 4D0CA 4M6OH 3U48A 1DUZA 3TEUA 1OAUH 1RIUH 5HVFB 5F6IC 4ZUSB 2JJWA 5KSBF 5IWLC 2R29H 3VGDA 4N0FB 5JHDB 4IMKA 1YEKL 4N68A 2IQAA 2VR4A 5T3ZE 1NANI 5CP3A 3LN4A 3HI5H 4I18C 3GHBH 1HEZB 1GGUA 4F7CA 3TIDB 3HI6H 3LPFA 4XCNA 5H8DA 3HCVB 2HT2D 4ORGB 4PJDB 5JHDD 12E8L 1XIWA 3K4DA 3GSOA 4G8FB 1CS6A 4QRQB 3U7YL 5DD6A 3SCMC 1IM3A 2V2WB 4K9EC 2AJ3A 3L3KA 5DT1L 1L0QA 2IGFL 4JDZA 1H3PH 3NABL 4IMLB 2OSLA 5DSCA 1MWAL 2EECA 1EAPA 3JUZA 4HGWA 4LAQH 3S7GA 5JW4Q 3JWOC 1F00I 3ROOB 4LPTA 2AJVH 4P57A 4O51A 5DGRA 4UTAL 3D1MC 4DZBB 4JG1L 3KYNB 1KCRH 4JFFB 3VI4E 4NHUB 4KRLB 5IHZA 5I1EH 4W6YB 2VDLL 1UM6H 1PG7L 2BNQE 3SKNA 1Q9WB 3MUZ1 2C4FT 4YGAB 2HT3D 3N50A 5FXCH 1EGJH 1FNSH 4QOKA 5B38A 4L4VB 2AV7B 1G7LA 1N59B 2FATL 4I48A 4JFFD 4JO2H 4P46A 4CAGA 3MBXH 2CMRH 1LD9B 1NFDF 4RFEA 4Y2DB 2DQCH 3TO4B 4H0HB 4HKZB 4G80A 3RBGA 3ZL4L 4QXGH 1UB5B 2YS4A 3IAQA 4BZ2H 4FMFA 3VXQA 4L4VD 2V5TA 5A40E 1G9EA 3PWVA 5I1JL 4LDEB 3S5LB 3BAEL 4Y2DD 5J9PA 2YD8A 2M2DA 4H20L 1LE9B 3M17A 2Y23A 3MV8D 3TO4D 1W0VA 4IBLT 1KJ2H 1QR4A 4WDIA 4CUCA 4TNWK 4ODTH 1UG9A 3GSVB 2NY1B 3VRLF 3QPXL 3BT2L 1JZ7A 1AQKH 1YEDB 2HG5B 2ZSWA 2F53A 2EXYC 3UMTA 1UZ8A 1D5ZB 4PPTA 5SV3A 2ERJB 1VHPA 2B0SL 3V6FA 5DUML 3V6BR 2BMKB 2F8VA 1JHKH 1ZLUK 1NFKA 3HUJE 3T0BA 3FJTA 1FBIL 3MXWH 2KL6A 4X7FC 3DLQR 4JPWL 4MXWH 4PY8J 4Z0BL 5FYJL 1AP2B 1FDLL 2NY1D 3G9VA 1FH5H 4NKIL 4WCYL 1ETZB 4U6HB 4DKEH 4ZUUA 4ONGL 4N5ED 4FQJL 1BFVL 1KOAA 3FB5B 5FUZL 3KVQA 1HILB 1DVFB 5TE7H 3TJHD 3QNYB 5IQ9B 4HK0B 1BVKB 3RKDC 1E0OB 3QUYA 4LLUB 3M8OH 3UC0H 4XZUB 4B0MM 3EDFA 5HXMA 5FM5M 4KTDL 4O58H 2H32A 5ECJE 1RK1B 5ESVB 1DVFD 5EG6C 3QWRD 3GJFH 2P49B 3GFUA 4NGHL 5FUCE 4JFEB 2YK1H 4YHZL 4QTIH 1HHJA 3LOWA 5EC1B 2AXJA 1KJ2B 5A2JH 1GC1C 3MLRH 5GZOD 4X9GA 3FCTA 1UB6B 4JJHA 5KVFL 3QDGD 3K1DA 3V4PH 4I0CC 2P5EB 2PTTA 4MWFA 2OXGA 4JFED 1WBZB 5BQ7A 2OR9H 3MRLA 2N7BA 4YDVA 3G6JA 3IGAA 2MQ3A 1YYMH 5DFTA 5AWNH 4I9WD 4E5XA 3S36X 2AQ2A 1QBBA 3ZKND 1ZA3B 3OXSA 2XKSA 3G5YB 1Z5LA 4HS6B 3ZTNL 4IOIA 2P5ED 2FL5B 1SEQL 4JFZL 3RAJL 4C55A 3NPSC 1S9XA 4JLRA 43C9B 4Z77B 2J88H 4I18A 3OXRA 3DYMA 4ZOCA 1JNJA 3L9RB 3IDMA 4IRSC 5ALBL 1IGYA 2EYSB 3RVVD 4PJ5B 4Z78A 2VN7A 1XZ0B 4WU7B 5JDSA 4POYA 4NP4L 2ENSA 3QIUB 1IEBB 3GJFB 1BVLB 3WO3B 1YEHL 2XOTA 1BM3L 5HYSB 5C07B 4H88L 5KOVC 4GXUM 5TDNB 4GS7C 4KMLB 4U31A 2HTKD 3VFSA 3RTQC 2ICWA 2VLJA 3DVIA 1M7IA 4OLVL 3U30C 3OB8A 4N8PA 3RL2A 3QIUD 2XIDA 4NNYA 4I2XB 3KXFE 1MF2H 5C07D 1E4XL 1YUHB 5C0GA 3RVWD 4AT6A 4XVJL 5CP3H 5E2UH 5KS9B 4KRNA 4U1SB 2BVOA 1Z2KA 1P5VA 1MPAH 3D0LB 3EYUL 4XPTL 3U2SA 1DANU 5D1XB 1XR9A 4MCYA 3IDYB 1N26A 3HN3A 3WIHL 2X4PA 1KN4L 2IANA 1T6WA 4BJLA 1H5BA 1PKOA 2IQ9H 3HS0B 3V5DB 3NCEB 4PGDB 5C0EB 3ARQA 3OR7B 4NQSA 3IFLH 3PUCA 1SJVA 4KTYA 1OM3L 1CICC 1DQLH 2AJXL 2R1YA 3BEVB 5D1XD 1QLRA 4KKAC 1DBAH 2C3VB 2DQEL 3LD8C 2P5WB 2P8MB 4LKXB 4JY4B 3VGAB 3WFHA 1OB1A 3NIGE 2ADJB 3L7EA 1LO2L 5IB3B 1U8LB 3JV4B 1E4XI 3KPQB 2CGRH 4UNTA 5GISL 3MNWB 5T1DL 2B8OT 3VFOA 1CDUA 4JB9L 2OJZL 3MA9L 4JRWA 4RMRA 3VFTB 3AS3A 1DUZB 2PW2B 1RIVL 2P5WD 5ALCL 3ALPA 1U8OA 3I9GH 5C3LD 1P69B 3L5IA 4N5UA 4KDVA 1N6VA 3MZGB 1DLFL 4D9QD 1NLBL 1T1ZA 2IQAB 4KI5D 4DN3L 3CPLA 5CGTA 5GXBB 1J88A 3PWUA 2ZUUA 3LN4B 2VXQL 4XB7A 4LCIL 2DB8A 5EO1A 4L8DA 4F7CB 3V8CA 1A02N 4BFIA 3IDXL 4P5MA 5DFVD 2OR7A 1X7QA 5HDBE 5ID1A 2P8PA 3N1FC 1XIWB 3BPOB 1CGVA 4GRMA 1Q0XL 1B3JA 3GSOB 3SO3C 2ADIA 1I8IA 3FN9A 4LQFH 1WZMA 5T5NF 4JCLA 5DD6B 4E41A 4HEPG 3ARDB 1OAXH 2AJ3B 4RGNC 2IPKB 4JDZB 2HT4C 4FG6C 4YO0A 5DSCB 2OSLB 3OMZA 3SQBA 3VRJA 4BH7A 1CFBA 4HGWB 1IAMA 4XC3H 4P57B 4HMCA 3U4BH 4LLYA 4OV6F 2CIIB 5I15L 3EFDL 1UM4L 3ARDD 4PJEF 2JE8A 2X4UA 2FJHA 4HJ0C 5DI8B 4FFYL 4AIZA 3LDBB 1T2QL 2Z92A 5BJTA 1LEIA 2H3NA 4QRRA 5IHZB 5FYJE 3U83A 5LXGH 3MACL 2B4CC 3TNMA 3P73A 4N0YL 4TNWF 1BQHA 4PJGA 3NACH 4Z7UF 3CX2A 5EBMA 4AK1A 4EDWH 5JPNA 1WWCA 2VLRA 4WFHD 3WLWD 4QOKB 2V7NA 5B38B 1G84A 1G7LB 4I48B 3PXJA 4P46B 2AEPH 4R4NC 1RZFH 3DYOA 1TVBA 4NWTL 5GZNC 4RFEB 3L5JA 4DVRL 1NEZG 5AZEH 2AXFA 2NX5E 4G80B 5DC4B 1P6FA 1JI2A 2KKQA 4QOKD 1AH1A 2H32H 4JAMA 3QQ9C 4PGEA 4P46D 1MREL 3PWVB 1HK6A 2ZCKL 4XVTH 4KK6C 4JKLA 4X9IA 3WS3A 1NCNA 4IRSA 1QYGH 5J9PB 3OAYK 3IDUA 5D2NB 3M17B 1DZBA 1W0VB 4KUCD 3KS0J 1YECH 1FFPA 2K1MA 5FO8B 3OPZH 1CXKA 2UZIL 5GGRY 2R0LL 1UT9A 4L4JA 3NZHH 4TYUA 3KPNA 1MRDL 1JMZA 2F53B 4LARH 2VSDA 5EU7C 1UZ8B 2XNAA 3W9EA 1MIEH 3V6FB 2IG2H 4GG6A 3RRQA 3UJJL 1AGCB 4P59L 4DGVH 1I4FA 4OQ1A 1KPUA 2R1XA 1V3LA 4XMPL 3ELAT 1TENA 4BSWA 3H6JA 2NXYC 4P2OC 2F53D 2NY4B 4KMTH 4ZUUB 2FO1A 1LO0H 2NMSA 4I0KA 3BH9B 4OZIA 4ZODA 5IOPA 1ZHLA 3MLWH 4AG4L 1KACB 4NQTA 4FS0A 3GI9H 3QUYB 3RL1A 1S7XA 2VXUL 4K3HA 3UZVB 4YX2H 4N0UA 1DR9A 4CMMA 2NY4D 4U7SA 3Q1SL 2H32B 2FLBT 2BJML 3MCLL 1X6LA 35C8L 7FABL 9CGTA 3UYPA 1C8PA 2BRRL 3PP3H 4UILL 2NXZD 4LSVL 4RAVA 1JHLH 3QUYD 1HHJB 4RMSA 3K3QA 5JIIA 4FN0A 4K55A 4J3VA 3FCTB 4X83A 1CDYA 2DMCA 4BK4A 1UJ3A 1CD9B 2VDOH 4XHQA 1WZKA 3LS5L 1JUFA 4MWFB 3CJJA 3IFOA 5BQ7B 1WIPA 3MRLB 4YPJA 5C0CA 4UBDC 3C5ZD 4YDVB 3G6JB 2A73B 5CGMA 3SE9H 4Y4KC 4G9FE 2CIKA 4OZGA 1R5IA 1N4XL 4KRPB 4E5XB 2CK0L 3ZE1E 1GOHA 3GZKA 5GPRA 3SKOA 4IOIB 1MNUH 5J7CC 3SDDA 1NCCH 4GG6F 1L7TL 2I60L 1J05A 1S9XB 4JLRB 1R6VA 1AC6A 3X3GH 1YEEH 3P4OA 2EZ0C 4LVEA 1EIBA 3QCVH 3OXRB 4I18B 3X11A 3HZMA 4G43A 1F4YL 3IDMB 4KRPD 1BQLL 5GGTA 1IGYB 1CGWA 1ZLVH 5J8OA 4Z78B 3AGVA 4OM1L 2YOCA 2C3WA 5JDSB 1C7TA 4KPHL 4K7PY 5DRZB 3HE7B 4FQIH 2DLFH 4YDIH 1J5OH 3O3BA 1NDGA 5EH1A 3BMWA 5BRZA 1U8JA 4NRXA 2A1WL 4UB0L 1P4LA 4NO0A 3VFSB 5ADPL 2ICWB 2CKBA 2VLJB 4XNMB 1RZ8A 2ZCHL 4LEOA 1M7IB 5IEKA 1IGTA 3HE7D 1NAMA 3RL2B 4NNYB 1QO3A 5DO2C 3LQAH 4M9PA 5C0GB 2DYPD 2V5RA 5CEYA 5GGSY 4AT6B 4YBHA 3VFUB 1JZ6A 2VLJD 4PRPE 4M6OL 4LFHD 1T1WA 1OAUL 5K33A 4F9PC 1ZGLA 3U2SB 1KTLA 1XR9B 4MCYB 3ZZ1A 1OTTD 1FJ1A 2NY7H 2R29L 2X4PB 3WNLA 3DECA 3K2MC 2VZSA 2WBKA 5FK9B 4ELMA 4CMHB 1H5BB 3TZVC 1KIPA 3KJ4B 4W4OA 1K3IA 3HI5L 3GHBL 1HXMA 3PABA 2R1YB 1L9MA 1KXVC 1VB9A 1QLRB 1EERB 3HI6L 2L7JA 3TN0C 2WQRA 1EXUA 3L3OB 4JZNA 3TWCH 1OB1B 3WFHB 4Y4HC 5IHUH 5I74C 3I3BA 2DRUA 1CXHA 5JZ7C 1NDMA 5EO9A 4X0KA 4LLVB 4YLQT 3VFOB 4G6JH 3UBXA 3X12A 2ZOLA 3MFFA 5ILTH 1QZ1A 1H3PL 1U8OB 4LAQL 1JYVA 5KSVA 1UYWH 2AJVL 1T1ZB 2AERT 3PWUB 4M03A 4JQVA 1MHEA 5EO1B 5LG1A 3VCLA 1E4WH 4GAGH 3CSGA 4JPKH 4P5MB 3RUGF 4DGIH 5I1EL 1UM6L 4FXGA 2J8UF 1X7QB 2PR4H 5ID1B 5JXEA 2YBRA 4GRMB 1EVUA 2X4QA 2W65A 4LSUL 1I3GH 1I8IB 3QCUH 1CR9H 5GSVA 1OWRM 1FIEA 4E41B 1EGJL 1EHNA 1FNSL 3SKJL 3V4UH 4JO2L 2N56A 5TQ0H 2WW8A 3P9LA 5JMRA 2X70A 3V6ZA 4G8GA 4ELMF 4YO0B 4BH7B 3VRJB 2ATPA 5HHPA 2DQDH 1U0QA 1KFAL 4E41D 3TGXA 4LLYB 4BZ2L 4GMTH 4KKBD 1HYRC 5SX5H 2X4UB 5CJ8A 2DI7A 4AIZB 3C8DA 3E3QC 3VXOB 3MLXH 5BJTB 4GKSA 4WI3A 1KLUA 3B3IB 1LEIB 2H3NB 3KAAA 3FQNA 5JUEH 3KLHD 3TNMB 1KJ2L 3QZWA 3P73B 1KXQE 4PJGB 1YNLH 1V8HA 5EBMB 4FQXC 5C6WH 4HCRA 1AQKL 5KVDH 5JPNB 3PF2A 5B39A 2VLRB 2V7NB 5IM7A 3MODH 5DVKA 1JHKL 3EJJX 2VLLA 1TVBB 5T1KD 5CBEB 3R0NA 3MXWL 5HD8C 4MXWL 2MCG1 1NCWH 3ZDXE 1FH5L 3P3YA 5I8CA 4Z7WA 4DKEL 5IUSA 1Y6KR 4IOFD 4JAMB 5JR1L 2XRAH 4PGEB 5TE7L 1I1YA 3ZDZF 3WS3B 3F8UB 4IRSB 4MLIA 1HIMH 2KZ1B 1OSPH 3T3PF 3M8OL 3UC0L 4MNQA 1FFPB 3OF6A 4NQDA 2VR5A 3TYFB 4O58L 3BX7C 3FRPA 4ODWA 3KPNB 4P4KC 2BP3A 2GSGA 4JVPA 5DQDL 4FFVD 2XNAB 2CO6B 2YK1L 4EBQH 1A14L 4ZAKB 1ONQA 1KPUB 2R1XB 1L6ZA 4JRXE 4UV7H 5E4EC 1IGMH 4BSWB 5BZDA 5E95B 4PYHA 3V4PL 5JHDE 4KJQC 5D8JH 3W5MA 2OR9L 4OZIB 1QA9B 1TZHA 5IOPB 2X4TA 3JWDL 1ZT1B 1BJ1J 4ZAKD 2B39A 5CILH 3VXSD 3LEYH 3B2VH 4XPHL 5ANMA 1SEBA 5C3TA 1EEQA 1YYML 5AWNL 3RL1B 1S7XB 2P45B 5GGTH 5HGDA 2HVKA 4PJDE 4N0UB 4CMMB 4NM8H 1KEGH 5F1NA 1K8IA 4JVWA 2QSQA 3QI9C 4I4WB 1OF2A 4DKAA 2J88L 5FF6A 3OKMA 4PD4K 4OJFH 4RAVB 2NLJB 3MRQA 3QDJA 2AK4A 3TN0A 1KEMH 3ARXA 3R1GH 2DM7A 1RI8A 1QOKA 3VFRA 4Y4HA 2CKBH 5JLZA 3THMH 4GLRH 4PJ9C 2VNCA 1UJ3B 1NAMH 3DSNA 4UINH 3MCKB 1ZVSA 3L6FA 2EIEA 3NH7H 3IFOB 2HFEB 4O9HH 1J0JA 3QBTB 5FHBH 1IL1B 4M7LT 3ZKXB 4GW5A 2DMBA 4OZGB 1R5IB 5AAMA 4KK8D 5EIIA 4HC1A 4RMWA 3FHAA 1U8KA 3BQUC 3SKOB 1MF2L 3SDDB 2FRGP 1J05B 2A38A 2EC9U 4DUVA 1VDGA 5I18H 3P4OB 4KUZH 3U0WH 4L4VE 3C6LC 3HZMB 3MOBH 4G43B 5I9QC 5I0DA 3DXAD 1P6AB 3WFBL 1PLGH 1AQDA 5DJCA 5LWYH 5D7IA 4Y4FA 3MV8E 4JPIA 1S7VA 3SDDD 5E94A 3NPZB 2LQRA 1MJ8H 2IQ9L 4U6YA 4MD4A 3O3BB 3Q5OA 5ADOH 1NDGB 5BRZB 2K3TA 1XGQA 5DQJA 4NRXB 1DQLL 1P4LB 1OLLA 2E8YA 4NO0B 4WWKD 2CKBB 1DBAL 4LEOB 1IGTB 3N0PB 1T5WA 5F1SA 5GGRA 1NAMB 1YJDH 3TV3H 1B0WA 1QO3B 3QA3A 2CGRL 2Q7YA 3DBXA 4QHKJ 3VD3A 5DA4A 5FYLH 4FQCH 4FHBD 4UOJA 5CEYB 4ZS6D 5BRZD 4K23L 4MJIA 4NO0D 4LAJH 3ZT6A 4GG8B 1RPQA 1ZGLB 3I9GL 1KTLB 3H9YA 1FJ1B 3DX8A 3VWKD 4KC3B 2CXKA 1F4XH 2VIRA 4IRJA 3SDXE 5JW3L 2GKIA 2H9GB 2NY0B 2CK2A 4QXUH 1YC7A 2XA3A 1FFRA 1AXTL 1FZJB 1HXMB 3PABB 5C0BA 4XP5H 1F4WH 5DWUH 5IW6A 4JZNB 1KCKA 3HRPA 1TIUA 2VDKL 3G6AA 1B88A 3W11C 4WHDA 1GPOH 4LQFL 3QDGE 2NY0D 1WGOA 1NDMB 3UYOD 1V3KA 5EO9B 4X0KB 3X12B 4JFEE 1OAXL 4QY8A 2ZOLB 3MFFB 4POZC 1MJUH 3U36A 4QWWC 4XC3L 5KSVB 1CQYA 2QHLA 3T3ME 3WHE0 4EEEA 2NPLX 4P4KA 3U4BL 4BYHA 5C2UB 2P5EE 1NC4B 4HCRH 1CLCA 2FGWH 1IBGH 43CAA 3VCLB 2VERN 2IWGA 5LXGL 1IC4H 4FXGB 1YY9D 4NQCA 4MMZC 5FYLD 3H7BA 2X4QB 3NACL 2W65B 3PWJA 4YHPA 3CU1A 4PJ7F 1NC4D 4PJAB 5E8NA 4EDWL 1MEXL 3D0VA 5GSVB 2H2SC 2Q86A 2FWOB 5JIPA 5GRXG 2AEPL 1RZFL 3P9LB 3IAGC 3ZKMD 2X70B 5L8KB 3V6ZB 3GGWB 3NCCB 5JXED 4P3CH 5AZEL 4DK3A 2ATPB 1PY4A 5HHPB 5HTSA 1Z0NA 1N5AA 3P11H 3QUXA 5I17A 1OAQH 4NIKB 5GSRA 5E6IC 4WI5A 3DGGA 5C07E 4CRPA 1KV3A 3MSPA 2WINB 5IGXL 2DWEA 5EPMA 2VJXA 3M07A 5CSZA 4Q6YA 1MHHA 1QYGL 1DBBH 1KLUB 3FQNB 4XC1H 4WNQA 3QZWB 1R0AH 3OPZL 1P7KA 4HWBH 5HY9A 4I2XE 5GGSA 5KSUA 3S8WA 5B39B 2OXHA 2RB8A 1M7XA 4LARL 5JW5A 3MRMA 1MIEL 4OCNC 5CIPA 2IG2L 5KS9E 4L5FH 2VLLB 3OGCA 4KV5F 1OAKH 2NZIA 3TBTA 3VH8A 5CCKL 5D7JA 3CFIC 3W9DB 5HI5C 5CS7A 5I8CB 4Z7WB 5GS1C 2WUCH 4KMTL 5ISZD 2C4XA 4LKCB 1KJMA 1LO0L 3BXNA 4LOUD 3MRKA 3CU7A 3SKMA 3C6LA 1I1YB 3MLWL 3KPTA 3H3PH 1A21A 2BSSB 1XR8A 1J12A 3NA9H 3SE4C 3GI9L 1SM3L 4YNYA 1C5CH 4L9LC 4MNQB 3NTCH 3IDIA 1NBZA 4NQDB 1KB5A 3S4SA 2YC1A 4ODWB 4D9QE 5DZOA 5J1AA 3F7RA 2GSGB 4YFLI 1FC2D 4KI5E 4NQUA 4Z95H 3ULUH 5TJWK 1ONQB 3Q6FA 4MNQD 3RDTC 1NAKH 2D3VA 4YR6A 4IOSD 3OF6D 4NQDD 3PV6A 4KAQL 3NFNA 4C59B 5BZDB 3OKKA 4HC1H 3CVIH 2VDOL 4HK3N 4ZFZA 3N85H 5ITBH 5D1QB 3U4EA 2AEQH 1Z6JT 5FGBA 3UP1A 4OB5H 2X4TB 1JPSH 1UWGL 4J1UA 5ETUB 2X10A 4IHOB 4NJAL 4POUB 5ANMB 1SEBB 1UKSA 1X6NA 3SE9L 3GUTA 4L8CA 1Z9SA 1VEMA 5DJ2B 2BSTA 2EDTA 5HGDB 3MMEA 5CKGA 2HVKB 1FNLA 4I77H 1T66C 1RAMA 3MGOA 2R56H 5FO7A 1MNUL 5D1QD 5F1NB 1K8IB 1NCCL 3REWA 3X3GL 1YEEL 5H2BA 1OF2B 5FF6B 4B7IA 5E24E 2YD1A 5DMIH 2O93L 3OKMB 5D2LA 3MRQB 3QDJB 2AK4B 2ICWI 2OL3A 1BX2A 4WJ5A 5JLZB 3UTSA 4PJBA 3QULA 4OD3H 3VFWA 3WIFA 2RFXA 3AREC 4FQIL 4X7CC 2CR6A 1ZVSB 2DLFL 3L6FB 4YDIL 1CXIA 1J5OL 5GRWA 5CD5D 3LQZA 4J12A 4WUUA 3T0EC 2H6PA 2AXHA 1A0QH 4X7SH 5SWSA 2AK4D 1IMHC 4GW5B 2R9HD 5EZIL 5EIIB 4G6AC 4J3OC 4PP1D 2ZUSA 3B8SA 4RX4A 1U8KB 1TCRA 1WLHA 5IV2A 5IKCA 1A1NA 1XGUA 3LQAL 4JM2C 5F7NC 2HA1A 4I3RH 3ULUD 1RZ7H 4EJ1C 2OZ4L 4FRWA 4L9DA 1AQDB 4NN5C 5DJCB 5D7IB 4JPVH 4Y4FB 2NY7L 1CE6A 4JPIB 1S7VB 1VEOA 3BUTA 4GXVL 5DJ8A 3LB6D 5DJAA 4U6YB 4MD4B 4OLEA 2CDEA 5CMAA 2NW3A 3VFVB 1QEWA 1XGQB 1AIFA 5D2NE 4Y4FD 3O3DB 1D7FA 3TWCL 3WXVH 2MQCA 5GGRB 4APQA 4HUKB 5DLMH 3CNKA 3QA3B 5E6IA 2Q7YB 3DBXB 3BRDA 2CO7B 4F9LA 4XNQA 3E6FA 5FOJA 2F53E 5L2KA 3CFJA 1NQBA 3BZFA 3RWJA 4MJIB 4MB4A 5FYKU 3S3PA 4PJBF 4C57C 5ILTL 1DQML 2YRLA 4J23A 5F21B 2BY2A 4N9GA 1MCSA 1DP0A 2VABA 3FFCA 1TPXC 3F62A 1VFBB 2YD7A 3DX8B 2FSEA 5AG9A 4S0TD 2VIRB 4IRJB 5AYQA 4JKMA 3BP5B 4PBXA 2X5PA 4MJID 4NKDB 3NIDF 1KLGA 3PQYA 4TTDC 1XH3B 1E4WL 4OCRH 4GAGL 4HKXA 4DGIL 3BKMH 1A7NH 2E9WA 2V5SA 5IW6B 3OKYA 4DTGH 3ILQC 4K7PH 1QPXA 3G6AB 4IRJD 3WS6A 1ZV5A 1I3GL 4XVUD 1WF5A 1CR9L 1MCEA 4GW1B 5EU6A 5F44A 5J1TC 3S5LG 1WTGT 5IESL 4QY8B 5B4MD 4Z9KB 3V4UL 5EU3A 2QR0A 3SE4A 5TQ0L 3QUKB 3HHRB 3QWQB 4PV9A 5M7QA 4ELKA 5L8LB 1OY3B 4U05A 1CTNA 3U36B 2DQDL 2A0LD 3NCMA 4QEGA 3D2UA 3V6OE 4GMTL 2NNAB 4MA1B 1DE4A 4MD5A 1VADA 1DQQA 2IBBA 3M45A 4Y5XA 43CAB 5L6YH 1IJ9A 1MCJA 3MLXL 3VXMA 3TFKC 4YBLC 3CX5K 4HAGA 3CFCL 4NQCB 1JPGB 1QFWM 3J7HA 3H7BB 1RZKC 1YNLL 4YHPB 1FIGH 3PWJB 4D0DA 2FB4L 5E8NB 3TYGH 5KVDL 1V5JA 2IBGA 3D0VB 3G9AB 4GBXC 2R2EA 5MERA 1A2YA 3TC9A 1T80A 4LU5H 5I71B 1PG7W 3KS0H 4NC1E 4KFZC 2GCYA 2P24B 1UCBH 1NCWL 1YNKH 5CHNB 2V7HA 1N5AB 3QUXB 4OLZH 1HZHH 5I17B 1KB5H 3DGGB 2BHZA 2DWEB 5EPMB 5CSZB 1T4KA 2BOCA 3IXTA 3QUZA 2X40A 1MHHB 5JMOC 1S9WA 1HIML 2VLJE 3HC4L 3INUH 1OSPL 4WNQB 1QFHA 3QUXD 1P7KB 4NRZA 5HY9B 5GGSB 5KSUB 2A9NL 4OZ4A 5I8OH 2ORBH 2DQFA 5JW5B 3H0TA 1PZUB 3MRMB 4H0GA 5KZCB 3OGCB 3TBTB 3VH8B 3CLFH 4NCC1 5D7JB 1U3HC 4UV7L 1VFMA 1WWBX 2AEIT 4XPFH 3X17A 5D8JL 1KJMB 3BXNB 1TQCB 2DD8L 3SKMB 1JZ8A 3M1BA 3IRZA 5GJTH 3MLUL 3TNNB 4U1GB 5KZCD 1XR8B 4R90L 1F6AA 5CILL 3B2VL 3EJZD 5EO0A 4F58H 4YNYB 5D7JD 4ONFH 5GGTL 5A2IH 1IAIH 2VXTL 5DMGC 1IEAA 3IDIB 1NBZB 3OZ9H 1FCGA 5KTEH 1KEGL 1KB5B 3BZ4A 3S4SB 1ZHNA 2QKIB 3MRHA 1D5IH 5EOCH 5J1AB 3FO0H 1BIIB 1PJ9A 4FABL 4V2BA 3A67H 5JNYA 4JO1H 2C4FU 3U82B 3QUMA 3Q6FB 5TE4H 4YR6B 3A6OA 2CKBL 3MPCA 3KPMB 3THML 3PV6B 3NFNB 5C6TL 4A6YA 1WTLA 3OKKB 2IBZY 1KJVA 2H8PB 1ZEAH 1JIBA 4H8WC 4Y5YA 2QADB 4ZFZB 3SGJC 4UINL 5A1AA 3U4EB 1FHGA 3NH7L 5F70A 4YDLC 4O9HL 5FHBL 4J1UB 3E6HA 4TULH 3ZDYE 3BPNB 3GUTB 4HW6A 3T8XA 2GHWB 2QQLL 2Y7QA 2BSTB 2IBZX 2QADD 1AR2A 2XXCB 4X6FA 4HG4J 3REWB 5E00A 4MAUH 2LFGA 1HQRA 4E41E 5H2BB 5I18L 4KUZL 3U0WL 1CZ8H 2ILLA 3MOBL 5D2LB 1A4JA 1OTUC 1Y6NR 1XF3A 1BX2B 1PLGL 1UM5H 4WJ5B 4JM2F 5LWYL 3UTSB 4WU5A 4PJBB 1G9NH 3QULB 4GLRI 3VFWB 3WIFB 1MH5A 2RFXB 3PJSB 1MJ8L 4BK5A 3I6GB 2J5LC 5HHQA 3QDAA 5ADOL 3LQZB 4OLYH 4NUGL 4WUUB 2H6PB 5SWSB 5HBBA 4O4YH 1IGJA 4HFWA 1PVHA 3UTSD 1XGPA 2HRPH 1JTTA 3C08H 3FT2A 1TCRB 3O45A 4PJGE 5IV2B 2WLZA 3TV3L 5IKCB 1A1NB 4CBPA 1XGUB 1QRKA 2APXA 4FQCL 1J8HA 1P84K 5SWSD 3LKQB 5DVLA 4M00A 4GKZA 3D18B 4RX4D 2A6DA 1CE6B 4M1DH 1F4XL 4EN3A 4GBXA 5DJAB 1RFDL 2EC8A 5INCA 4PB9L 2CDEB 2XWJB 4QXUL 4FTVA 2NW3B 1IM9A 5CMAB 2ZUTA 1QEWB 4CNIA 5F7YC 1AIFB 4WFFD 3TBSA 5BVPH 1F4WL 2EDDA 1BJ8A 5LGJA 2IPTH 4APQB 1I1RA 1PSKL 1VA9A 3T0VA 4XNQB 3E6FB 2ZUQC 3O4LA 5L2KB 3CFJB 3RWJB 3IETA 2VDPL 4K94C 4OFYA 1LEGA 4JHAH 3VXSE 4LVNB 1KUMA 2VABB 3FFCB 3EYFA 3V2AR 4APQD 1MJUL 2FSEB 3F58H 1VPOH 4Y7MA 3MA7A 5L2KD 4HCRL 3SDCC 4B5EA 3PGCA 1KLGB 2FGWL 3R0MA 2WWMC 2VAAA 1I3VA 2E27H 3FFCD 3BD4A 2GJ6A 4HKXB 1Y0LA 1IC4L 3GMOA 1WT5C 4Q6IC 3RWHA 1A9BA 3C2AH 1NCTA 4LLQA 1JZ2A 5K9JL 4ZXBC 2P48B 4M7KH 1JNNL 5EU6B 4WV1A 2WUBH 4DN4H 5EU3B 2QR0B 25C8H 2I9TB 3HB3D 3BZDA 3FHQA 3O2WH 4ELKB 4P3CL 1CGSH 4PRDA 1U2HA 4QHUA 3T0XA 4M5ZH 3P11L 4KQ4H 3T04D 3D2UB 4ALAL 5EU6D 3CSBA 4D9RD 1DE4B 4MD5B 5E7BA 4UQ3A 3QCTL 1VADB 1RHFA 2ED8A 5FKAA 3V95A 4HJJH 2R23A 4Y5XB 3I02A 3VXMB 4G7YH 4O2CA 4OZGE 3DXAE 1LP9E 4X9FA 4XC1L 3QIBA 1R0AL 3D2UD 1ZSDA 4HWBL 2X09A 4CVWA 1OHQA 2GT9B 5HHOA 5MHSE 2R2EB 5MERB 1A2YB 5B8CC 3DVFA 4L5FL 5EUOA 5I1KH 1LO5A 4KXZH 1OAKL 2CSPA 4CN4A 2GCYB 5GS0L 5LQBH 3QPQD 5J12C 2V7HB 1BBDH 3IKCA 4HS8H 4OZFG 2APWA 2WUCL 3BN3B 4OD1H 2RGSA 2Z93A 3SGEH 5JOFA 4R2GB 3KPRA 1NMCB 2BK8A 1V7NH 4X4MA 5DUBA 3H3PL 1T4KB 2BOCB 3IXTB 3QUZB 2YXFA 5BRZE 3NA9L 4PY8I 1PG7X 1S9WB 3ULSA 2BVQA 1C5CL 1IQDA 1AXSA 3NTCL 2BVTA 3HA0A 3P4NA 4NRZB 4R2GD 4RMQA 4A6YH 4Z8FL 5AZ2H 4NKMA 1E27A 4OZ4B 4DFIA 2DQFB 3BDYH 2ZUVA 3QUZD 3H0TB 3QNZA 4F8TA 4X6EA 3ZO0A 4S1DC 3SE3A 4WUKH 4XRCA 4R3SA 4YFEA 4QRUA 1OGAA 1U58A 4UIKH 4HC1L 3CVIL 4GH7B 2ZOKA 4OI7A 3F65A 4HIXH 1IT9H 5ITBL 2AEQL 2HN7B 4X6BA 4XPGL 4EZMA 1JPSL 2NY3C 4PJFA 1F6AB 4NSKB 3IF1A 1KG0A 5EO0B 1AKJA 4RFNC 1TLKA 4MHHG 4RAHA 2EH7H 3X13A 1FLRH 1IEAB 1SYSA 3HZYA 4I77L 1PEWA 3LRSA 2R56L 4JQXC 3BZ4B 1ZHNB 3MRHB 5KSAA 3GB7A 3LN9A 1I8LA 3OJMB 3HPJA 5DMIL 5GRZA 3QEGH 5JNYB 5K9OA 4RGMB 5IW1A 1P53A 1JNLL 1FL5A 4HJGB 4OD3L 4A6YB 2DAVA 2F8XC 4Y5YB 5FUCC 1V05A 2H26A 1QBAA 3VFNA 5C70A 4N0CC 1EJ6A 4FA8A 2DS4A 1A0QL 4R0LA 4X7SL 4EI5C 4ENED 3E6HB 5D93C 1GSMA 1K8DA 1FO0H 1VENA 3T8XB 3CZFA 3EDKA 4BZYA 4X6FB 2X9XA 3WEXB 4PJAE 5E00B 1HQRB 1KBGH 4I3RL 5C2BH 3B83A 4LEXH 2R15A 4Z7OE 4MAYA 1A4JB 4PTUA 1XF3B 3QHZH 1OTSD 3F7YA 4Q6IA 1WT5A 5ICZA 2QQNL 4U1NA 2VQTA 4WU5B 1BEYH 4JPVL 2J2ZA 5C0IA 1MH5B 4WO4A 2BY0A 1VFAB 1J0IA 2X1PA 5HHQB 2M26A 4TQEH 3MXVL 3FN0L 4DEPC 1NCDH 3TA3C 5BZWA 1IGJB 2WANA 4HFWB 2Y25A 1BGXH 1XGPB 3O4OB 1FFOA 3MNZA 2YD3A 3WXVL 4PJHB 1KCUH 3O45B 1WAAF 1F58L 4LCCA 3IJSA 3S3JA 1UH4A 3OV6A 1J8HB 4LIQL 5ISZE 2A2QT 1XFPA 1FO0B 3JBG7 2G5RA 2CDFA 4OFPA 2Q7NA 4C54A 1B6DA 1MAMH 2WAHA 4JE4B 2YPVH 3SKUD 4HHAA 1JFQL 3DTXA 1D9KA 2FHCA 4EN3B 4Z7WE 2QLVB 2VC2H 1JBJA 1F13A 5INCB 5B8CA 4PJ8C 4FTVB 1IM9B 4KROB 2BNQA 4R4BA 4EOWL 5F71A 3TBSB 4DKFH 2X44D 3B43A 4DTGL 4MNQE 3RNQA 4K7PL 4JO3H 4D9LH 4NQDE 4JREB 4OIIH 1IKNA 3VMPA 2VRAA 3CSYA 4FTVD 3JSSA 2DI8A 3O4LB 5C7XH 4KROD 1CD1B 3S37H 1LK3H 2H41A 3RFZC 3IETB 2VL5A 2UZXB 3I6LD 1PBYA 4ZTOH 4PR5B 1YY8B 4OBSA 2RR3A 4M93C 5DMKA 3EYFB 1FZOB 3DARA 4XI5D 4JHZA 1I7UA 3O4LD 2EEDA 3MA7B 1I7RA 4FQLH 3ARTA 2VUYA 2DLGA 1MCCA 5EFIB 4OFYD 2VAAB 5KJRH 3F7VA 5ANME 3TLRA 2GJ6B 4U1LA 4XP9H 1Y0LB 1QD0A 3GMOB 1BBJA 4LLQB 1CLOL 5MENA 2B1AH 3TYGL 3MLSH 3HUJA 3V7AE 1NSNL 4WV1B 1T83C 4LU5L 2GJ6D 4PV8B 4NZJA 5EBLA 1PZ5A 3TBYA 5GJSL 2HH0L 4BFBD 1YNKL 4PRDB 5IG7A 3WN5A 1T04A 1KT2A 4JQXA 5C08D 4OLZL 1HZHL 4KKCD 3ZLQC 3P30H 4OF5A 4ZDHA 4LPXA 2OK0H 1MCPH 2Z31C 3BIBX 5FKAB 1LO3H 1DBMH 3SBWA 3INUL 3EOAA 3FQRA 3QIBB 4X4YA 3HPLA 2A83A 1F8TH 1U95B 1ZSDB 3U46A 1UH3A 1UWEL 1KTDA 5I8OL 2ORBL 2JJUA 3LKNA 5IVZA 1JPST 4MXVE 4WY7L 3ARFC 5EUOB 1LO5B 3QIBD 1CICD 3CLFL 1N0LA 5D7IE 3C87A 1FZMA 4WEMB 4IIQC 1H3TA 2R2BB 2J12B 2Z93B 1YEFL 5JOFB 3KPRB 2EE2A 5EU5A 4M61A 5GJTL 1TVDA 3K8MA 4NZTH 2WBJA 1E6OH 3BE1H 3PL6A 5DUBB 4Z5RA 1FFQA 4F58L 3ULSB 1DEDA 2BVQB 3GDBA 3MJGX 3VFMA 4HIJA 1IQDB 1IAIL 2SEBA 3OZ9L 4P9HH 5KTEL 3P4NB 3KPRD 3OKOB 3NZ8A 4NKMB 1D5IL 1E27B 4YPGA 3FO0L 3ARGC 4X4XA 2G75A 4DQOL 1EHLH 4XCYA 1OPGL 1WSST 4MJIE 4H25A 3A67L 4X6EB 4JO1L 3TJEH 1TNNA 4OLWH 2BXYA 4XRCB 3L3GB 5F9DC 3REVA 2YXMA 4R3SB 4QRUB 4UIMA 1OGAB 5JW4M 4D3CH 1ZEAL 5D6CA 2ZOKB 4X6BB 3V9FA 2WWKO 4HS3B 4E9LA 4U0RB 3EYQC 4RMVA 4PJFB 5C0JB 4XWOD 4TULL 4HULB 3IF1B 3N1QC 1KG0B 1AKJB 2IF7A 4MJ6A 4Q9BA 4HH9A 3KXFA 3HAEG 1IAII 3CDCA 3O0RH 5DVMA 4AMKH 4BQCA 5F7HA 1OGAD 3X13B 1SYSB 3HZYB 3LRSB 5T3ZH 4WHYH 1AI1L 3UTOA 5KSAB 3GB7B 4PJ8A 1EDQA 3VG9C 5D1ZA 1KN2H 3O41A 2FR4A 1CZ8L 1SQ2N 5GRVL 3HPJB 4OCMC 3PHQA 1AKJD 5K9OB 4MB3A 4CADA 4XTRD 4MMXC 3QO0A 5IW1B 3OG6B 1UM5L 3OAZH 1T0NA 1QHOA 3I2CH 4TUKH 5KSAD 1I3RA 3C5SB 4OF6A 1JYNA 2H26B 4JDVA 4LIQE 3ROLA 3RP1A 1MWAA 4KY1H 4R0LB 4UI2A 4F15C 1MCFA 4O4YL 1QG3A 3K46A 3VGEA 1DFBH 2AABH 2DBJA 3JXAA 2X1QA 1DLHA 4F7MA 1W8NA 2P8LA 3FL7A 2HLAA 3PWPE 3ZHLA 2G9HA 3CFEA 4YE4H 1MSPA 4MAYB 1FL3A 4L8SC 3D48R 4PTUB 3F7YB 4UV4H 4ZTPH 3GSUA 4YQXH 4U1NB 4W6XB 4I0PC 4K8RL 5C0IB 4TVSa 4R96A 4WO4B 4E0RA 3W2DH 2P1YA 5HJ3A 4F7EA 3BUYB 3JUYA 4P3WA 5BW7A 3BEWA 2J8OA 1T0PB 1UJTA 1GRWA 3DX7A 5J3HC 3O8XA 1PX4A 5BZWB 4WI8A 4RZCA 4FQPA 4D8PB 5BVPL 1O7SA 1FFOB 3MNZB 5T3ZD 4YK4B 4WO4D 2J6EH 3WXWH 2IPTL 1NBYA 4PTTA 4LCCB 1S5IL 3IJSB 1S3KH 3OKLA 3QQNA 1RUPH 2Z31A 4DVBA 1IAOA 4EVNA 5DURD 2DL2A 3D85B 5EB9A 3BSZH 1VKXA 1QLEH 1UEMA 2CDFB 4J6RL 4JHAL 3SDAC 1A3LH 3S3SA 4HGMA 1INEL 3JV5A 3WKMH 4HHAB 2F54B 3DTXB 2ZPKH 1RVFH 1D9KB 4U1IA 2CLRA 3DUUA 2E7BA 5IW3A 1VPOL 3PP4H 3NIGF 3I75A 3D85D 1QFOA 2ZUXA 4RBPH 1F45A 2BCKA 4LSQH 1JV5A 4Y88A 2E27L 4R4BB 4OZHB 3BGFB 2F54D 4IDJH 3WUWG 3RU8H 3C2AL 1D9KD 3RNQB 1CQKA 2CRIA 3MJ7A 4ZFGL 3CSYB 3BFOA 4M7KL 3MO1A 1P84J 1WBYA 5FDWA 2WUBL 5LKNA 1CG9B 4DN4L 2VL5B 1WFOA 2NX5A 5CP7A 5I30H 4GRLC 4ZYKB 2LE9A 3MQIA 1CGSL 3A6CH 3SO5A 3NCJH 3EO0A 1CT8A 4KQ4L 1WZ1L 2NYYC 1I7UB 5HDBF 3ARGA 3T0DA 2EIBA 1I7RB 1LDPL 4KKNA 3S35H 1FNGA 2ARWA 4HJJL 2JTDA 1OCWH 1RUAL 4G6MH 3V8OA 1KF9B 3F7VB 4G7YL 3SN6N 4U1LB 1XMWA 4Q97A 3PXHA 2Q87A 1BBJB 4K9EL 5MENB 4KKLD 4DOHB 3HUJB 2DQGH 3GMMB 5CSBA 3JWOL 4M6AA 3QYCA 5DR5L 4K3EH 1KJ3L 5F7FA 1AR1D 3Q3GA 5D2LE 1R3JA 3NVQA 4OCSH 5EBLB 1PZ5B 3TBYB 4Y5VC 1DQDH 1CWVA 1FC1A 1F3JA 3UTSE 4D2NA 5MEND 5IG7B 3WN5B 4EQ3A 4HS8L 1KT2B 5IVOA 2B1HH 4GAJH 4OD1L 3ZE2E 3RVXC 4ZDHB 1U8PA 1V7NL 1IFHH 1MFCL 1IE5A 5SWSE 5JA9A 1N7ML 1Q1JL 1CN4A 7CGTA 1A6UH 1C7SA 3EOAB 4PGJA 4NFDA 3FQRB 5E8DH 4GW4A 4X4YB 3HPLB 2W07A 1C5BH 3U46B 2YD4A 4X6CE 4XBEH 1KTDB 3U0PA 2Z8SA 3QXAB 5F8QC 3BDYL 3LKNB 4CJ0A 1WUNT 2N1KA 1ULVA 4KXZI 1RUQH 2JK5B 1VFUA 4YDJB 2P44B 5SWZA 4WUKL 1U8MA 3DETD 4F2MB 1NGYA 1TDQA 4Y1AA 1FZMB 4UIKL 4X7TA 3SGEI 4KK9D 2BFVH 4HIXL 3V7AG 1IT9L 8FABA 3HNSH 5EU5B 4G9FA 1NEUA 4M61B 3OHXA 2WBJB 3GSWB 3PL6B 4L8SA 1S5HA 4HKJA 5IEHA 1HYSC 3VFMB 3RI5K 3K81A 4HIJB 2Y6SD 4I0PA 2KQNA 2SEBB 1ZANL 3EOTL 5DC9B 5BOZG 1V7MH 2UUDK 3NZ8B 3B5TA 4YPGB 5DT1H 2G75B 2Z35A 3MLYL 4OI9A 3NABH 4LSPL 4XCYB 5HI3C 5L2KE 4H25B 4MXQD 3QEGL 3WHXA 5FB8A 1A6AA 3REVB 4UIMB 1RURL 4XPBH 2ARJA 5D6CB 4PJCA 3BWAB 1M1SA 3ULVC 2DIJA 2GAZA 3SDAA 1FVEA 3CXHK 4JN1L 1FO0L 4MJ6B 1WICA 4HH9B 3KXFB 2RIKA 3BVNA 2H2PD 2HT2C 1KTRL 1T89A 1T3FA 5I2IB 4YJZL 1L4IA 4NN7B 4KJWD 3TH2T 4PRPA 1KBGL 1GL4B 1HCFX 1GC1L 5D1ZB 5EU6E 3O41B 8CGTA 2FR4B 2BSRA 4D9RE 4LEXL 2PYED 5DD5H 3PHQB 3KXFD 4L4TD 1Z0MA 4XNZB 2WIMA 5C09A 4CADB 3QHZL 5TF1H 3QO0B 1T0NB 4LPVA 2HFGL 5DHVA 1CFVH 5I1JH 1I3RB 1D3CA 5D1ZD 4JDVB 3MRGA 1ZLWH 3ROLB 3ZE1F 4TQEL 1MWAB 4H20H 2QSVA 3DGCR 1NCDL 4EDXA 2A6JA 5DJ6A 4PRAA 2VLMD 1J18A 2Q3ZA 1KCUL 4HQQH 3T1FA 2HT3C 5DUMH 4F7MB 1KGCD 2RBLA 2P8LB 1T0MA 3U7WH 1INQA 2G9HB 3CFEB 5FYJH 2Q20A 1FL3B 4WGVB 2DN7A 3GSUB 2YPVL 4ONGH 1E4JA 4QHKI 1DDHA 1GZPA 3R06A 4OF8A 2RHEA 4R96B 4E0RB 5HJ3B 4F7EB 2VC2L 3RVUD 3BEWB 1AJ7L 1QSVA 3DX7B 5BVJB 4Y2DC 5GRUH 3O8XB 3C60A 4D0BA 1I1FA 3ZTJH 3TO4C 4KTDH 4X8JA 1OT1A 4MA3A 5J6HA 4MQSB 1ZK9A 4NGHH 4NQVA 4JO3L 1NBYB 2P7TA 4PTTB 4OIIL 2AJSH 3WUZA 4BQ8A 2R2HA 1VFOA 4YHZH 1Q94A 3DO7A 1FNEA 2BVYA 1IAOB 5E8PA 1S9YA 4EVNB 4KJQD 3BWUC 1VKXB 1JWMA 2R0KH 1E28A 4LLWB 3X14A 4ZTOL 4WFGE 4LSSH 4Z7VE 3K4AA 3FZUD 3B2UD 2NY1C 3EOYG 1P7QD 5F7KC 2IFFH 2CLRB 3DUUB 4N5EC 1FYTE 3U0TA 2ERJC 3WNNA 3P40A 3I75B 4FQLL 3TJHC 2FX8L 1LILA 1DSFH 2C1OA 1JV5B 1WBXA 5KJRL 3E1F1 1IILE 3FOMA 5F1KC 4XP9L 1SEQH 1HH9A 1OP5H 1PEZA 5E03A 4JFDE 5EDXA 4MLSA 4P2YA 3P0VH 3LEVL 2UY6A 2AJUH 3MJ7B 1DVFC 3IVKA 5FYJD 3QEUA 3MO1B 4OD2A 5LBSH 4NO5A 5ALBH 5FDWB 4ISVB 1DBKL 2C7UA 4OCYL 5CP7B 3T08A 4NP4H 1WCQA 5CJXC 3TM6A 5GZOC 1QSFA 1ACYH 2JJSA 3GBNL 3FQWA 5E9DD 5H35B 4O00A 2LVCA 4YHLH 1CT8B 2XQYG 1M05A 1NJ9B 3P30L 3UAJD 4UDTB 3L7FB 1P1ZA 5E2TH 1CK0H 1FNGB 2OK0L 1TXKA 3RHWK 1LO3L 4OLVH 3FN3A 4NDMB 1S7SB 4JFPA 1DBML 4PYGA 3ZKNC 1T21A 4FNLH 3H7LA 2X42A 1QBLH 5GRJL 2FEDD 5L2JA 1F8TL 4F3FA 4PGCA 2J3SA 1D5BA 4RCAA 3JVGA 3DI2B 5D9SA 3ZT7A 5GRYA 1FQ9C 2GITA 4JRXA 1A7PH 1W72H 4AEEA 2Z0BA 3Q3GB 1SYVA 1QKZH 4K71B 1KN4H 3HR5A 3RVVC 3Q6GH 3VGHA 1KULA 1UXSA 4OCXH 3AC0A 4F8QA 3DX9A 4OFDA 2W0PA 1DTUA 2WK2A 1RD6A 1OM3H 4WRLA 3DJ9A 1U8PB 5IFHH 4NZTL 1E6OL 3BE1L 5JO5A 2HTKC 2DQEH 4H26A 1DQJA 1LO2H 2JJTA 3RI5F 4GW4B 4QRQA 5GISH 2D9CA 2KBGA 3QIUC 2NY2B 5JXAH 5J6GA 5HGBA 4PJHE 4P9HL 3V5HB 1C08B 1JF5A 4ETQA 3RVWC 4JHBA 3BJLA 3ZDXF 1OT2A 3NAAH 1B0GA 3UTTA 1EHLL 5E0QA 1GJIA 1CI5A 3GJFK 3TJEL 2CXGA 5SWZB 3ROOA 1DLFH 4Z0XA 3RJQB 1U8MB 1MCWW 2F74B 2NY2D 1NGYB 4Y1AB 4X7TB 4D3CL 1WK0A 8FABB 4DZBA 3GI8H 4G9FB 3OHXB 4FTVE 5SWZD 1S5HB 4IS6A 3HE6A 5D1XC 5IEHB 3IDYC 1G7IA 3I6LE 3O0RL 5EIVA 4Y1AD 3IRPX 4AMKL 2YUZA 2D0HA 1A47A 4PG2A 4HWNA 4L4VA 4HUNB 3O3AA 1HXYB 2Y07H 3MRFB 4ZSOE 3FAWA 5HYJA 2GY5A 1LD9A 1KN2L 2Z35B 4Q9RH 3O4LE 1JPTH 3V5KB 2PO6A 3MV8A 1L9NA 3VGAC 4JKPH 1A6AB 1KYOJ 1HDMA 4C4KO 1T2JA 3EFDH 3I2CL 1UM4H 4TUKL 3K7UA 2ARJB 1MVUA 4PJCB 4P5TA 4KI5C 3D25A 1ZWIB 4M7ZB 4PJDF 1TMCB 2YZ8A 3RWEA 4KY1L 2GAZB 1FVEB 4Z7QF 3GSVA 1IKFL 1CLYH 2AQ3A 2GJ6E 4R26L 1BD2A 2HG5A 1INDH 1OVZA 1UKQA 1T3FB 1PKQE 3U1SL 2AABL 5IVXE 5C08E 1MVFA 1EJOH 3DMMA 1OD9A 2X7LA 4G5ZH 1X5LA 2BSRB 3DHJA 5BOPA 3B9VA 3GK8L 3MUJA 4YE4L 2FX7H 4FFWD 5C09B 3VWJA 1JGLL 2VQUA 4UV4L 4ZTPL 1XIWC 3BPOC 4YQXL 5A2LH 3SDXA 1FE8L 5DHVB 2BX5A 1A6ZB 4LCWA 3CDGA 4HUUA 1IRAY 4PLNC 1WEJL 4QRTA 2BHYA 1MREH 3H9SE 3RGVB 3W2DL 3QNYA 2J4WL 3DX6A 2O26U 3ARDC 3MRGB 1SMAA 4YHYB 1BVKA 2XY1A 5C09D 4EDXB 5CJXA 4PRAB 3WBDA 2R39A 5DD1H 3BIKA 1UFUA 2X4NA 3QDGA 3BZEA 5ESVA 2XTLA 2J6EL 1MRDH 4XH2A 3RGVD 3K80A 5IVNA 2CLZA 4UMGA 4MJ5B 4JFEA 2VDML 1S3KL 3UJJH 4JO4H 3WLWC 3LDBC 4LNVA 1INQB 3BSZL 3LV3B 1QLEL 1KELH 4BUGA 4HBCL 2JB6B 5CFHA 5EUOE 4GRWH 3WKML 4G9DA 4O02L 2ZPKL 1RVFL 2IMMA 1DDHB 3R06B 3DRQA 1ZHKA 3PP4L 2UVEA 4P46C 3KPRE 4HMDA 1S7UA 4X4ME 5DS8A 1GZQA 4LSQL 4PJIA 4PS4H 4F7PA 3C60B 3U9PH 4D0BB 2RJMA 1I1FB 4HS6A 2BZDA 4X8JB 4ONHA 2I5YL 4IDJL 4JM4H 3RU8L 3MCLH 2A6KA 1KC5H 2CRYA 3LCYA 1UVQA 2P7TB 2DL9A 1NBQA 2R2HB 1F3RB 1Q94B 3DO7B 4Z7NF 3L9RA 2E5EA 5GGVY 5E8PB 5A2FA 1S9YB 5FM8A 4KK5D 4NM4H 3C60D 3O6FA 5D2NC 1JWMB 1PYWA 3SDXF 4WU7A 1E28B 3X14B 5I30L 1EZVY 2KUTA 3LKSB 2Z8WC 3QIUA 5ICXB 1HSAA 4GQ9L 3A6CL 4P2RA 1SJHA 3NCJL 1CDHA 3AB0B 1A5FH 5TDNA 1AY1L 3NIFF 3C09B 3U0TB 2W92A 1IC7H 1BFOA 2VWEE 1X4YA 3S35L 3QRGH 3RHWF 1Q0YL 4G6ML 4PJFE 1WBXB 1EZVX 1MAJA 2J8UE 3DNKA 4I2XA 4I3SH 2HWZH 4JGUA 1HH9B 5I0ZA 2I60H 4HDIA 4O2FA 1CL7H 1YUHA 2NY4C 3B9AA 1CLZH 2NW2A 3FQUA 2ZZUT 4WW1A 5KS9A 4U1SA 3IVKB 2DQGL 2X4SA 3QEUB 3DVGA 3ORJA 1UC6A 4OD2B 2PTUA 4NO5B 3T3MF 2C7UB 3LQMA 3QUYC 4K3EL 4OM1H 4RGOH 2OTPA 3MRIA 2EDWA 4ODXB 3T0ED 5F9JA 1MQ8A 4OCSL 3P4MA 2MCPL 1QSFB 4U3XA 1DQDL 4DJMA 2HAZA 4RWHA 3FQWB 3V5DA 2B1HL 4K3JL 4GAJL 4JZJA 1P1ZB 4UB0H 4WHTB 1CDIA 3C5ZC 1IFHL 4HIIB 3PE9A 4Y16A 3C5JB 2P8MA 3QT2A 2ADJA 4BQ9A 4JFPB 1QSFD 2ZUWA 2AJZA 1A6UL 3QJFA 1PFCA 1T21B 3MNWA 4WI4A 5L2JB 1G7QB 4UNUA 4F3FB 5I6XB 4XBEL 1D5BB 4NHCL 2YWYA 5D9SB 4M7LH 3VFTA 5A43C 2PW2A 3WLBA 4PGBA 2F58H 2OR8A 1A6PA 2EDFA 2GITB 4JRXB 2ATKA 4KRPC 1RUQL 1AXIB 4BELD 2VITA 1SYVB 3UPAA 2V2XA 3HR5B 1UXSB 3K8LA 5EU7E 3DX9B 1AGFB 3RX8A 3AROA 3S9DB 1NUDA 3GJEA 2BFVL 1MFDL 1X5XA 3HNSL 2R2CA 1S78D 4JRXD 4NC1C 5JO5B 3H2WA 2BHUA 4H26B 4QHMA 1DQJB 3MUGA 1NMAH 3SHSA 2XKNA 5KS9F 3VW3H 3HE7C 1JF6A 5J6GB 3MYZA 5HGBB 4AL8L 1V7ML 4B41A 3Q5YA 2V17H 3ARDA 4ETQB 5E5MA 2IPKA 1GOGA 1B0GB 3UTTB 2X4OA 2D0GA 2PN5A 4XGZA 1ITBB 4Z0XB 2EIDA 3PP3K 5CGYD 4OSUH 1N0XH 1OTTC 5DRXA 4TTDD 2CIIA 3JTTA 2F54E 3CFBA 4XPBL 3T65A 3FAXA 5DI8A 5AD0A 2B2XH 3UTTD 1Q9LA 5IB5A 2XZAH 1DANT 4IS6B 3CH1A 3HE6B 5KN5A 2FO4A 3K2UH 4KI5F 4OZHE 1G7IB 1U8IA 2Y72A 2EDQA 4LSUH 3ARRA 4TPRH 4CMHC 1H5BC 3SKJH 3P9MB 1AD0A 3KJ4C 4F80A 1II4E 3CXDH 3O3AB 1D5XB 5IMOA 2F19H 5HYJB 4X6DA 2A6IA 5C9KA 2IH1A 2JF1A 2VXVH 1KIUA 2HMID 3HE6D 4K3DH 2PO6B 5DD5L 3MV8B 5TF1L 1HDMB 1KFAH 2LVEA 2VQ1A 1CFVL 4ZNCD 4LVOB 1MVUB 4P5TB 3D25B 5HYJD 3QG7H 2XZCH 4TRPH 2AK1H 3O6MH 5D2NA 2PO6D 3RWEB 2DWDA 2FHBA 3U6RB 1RU9L 4N0RA 2VDQH 4V1DA 2C5DC 1TJIH 5FO8A 4X7DC 1NUFA 1BD2B 3LQAC 1EPFA 4P5TD 5IBTH 5MENE 4HQQL 4JFXA 4DOHE 1AGCA 3DMMB 2X7LB 3U7WL 3H42H 4MVBD 1T7ZA 3IFNH 3VWJB 4QTHB 1BD2D 3D69A 1B90A 1A4KA 4TUOA 1O5DT 3SDXB 4LCWB 3CDGB 5JR1H 4HUUB 1A7QL 1D5MA 2OTWA 3BH9A 4QO1A 4QRTB 5JORB 1URLA 2AXGA 3OJVC 4GKNA 4M6NH 3DX6B 4QCIB 1C1EH 3DMMD 4KVNH 3LKOA 2P47B 4OCWH 3VWJD 5GRUL 2FECL 1WQVT 3MRDA 3CXHJ 3KLHC 4X5LA 3BIKB 2X4NB 4LCWD 4OZFA 3QDGB 2ZSVA 3BZEB 2D31A 4XH2B 1HWGB 4EXPX 4W68A 2CLZB 5DQDH 2AJSL 1ZVYA 4FFZH 3C5ZA 1A14H 4KUCF 4PG9A 4WEBL 1A6VH 4Y89A 1SY6A 5GHWL 2R0KL 3MOAL 4CU6A 4LSSL 1YMMB 3AUVA 3V6OA 4G9DB 2OJEB 4UTBH 1JF1A 5FO9A 4MS8D 2IFFL 3DRQB 1ZHKB 2C26A 3JWDH 5DMGD 5I16A 4IOFC 4UAOC 4YHIB 2A73A 3IJYA 2VKWA 4XPHH 5CZXD 1S7UB 1DSFL 2FECI 5DS8B 1GZQB 4PJIB 4F7PB 2WMPA 2FH6A 4XCEA 2HYMA 4WTWA 1YMMD 1CFSB 4ONHB 3NN8A 2DTMH 2P4AB 2AVGA 3MJ8A 1IEHA 4LCYA 2A6KB 3MRCA 4HWZA 3P0VL 1UVQB 1RUKH 1PQZA 2AJUL 3SJVB 4FFVC 2FJGA 5LBSL 4YDKH 3O6FB 1PYWB 4AEIH 5FCUH 4LF3B 4LHUG 5TQ2H 4OCLC 5J56B 5DRZA 1ZOXA 3HE7A 1HSAB 1ACYL 3BO8B 4P9MH 5T33H 1G7JA 4P2RB 1SJHB 4YHLL 3SJVD 2MMXA 3FO2A 5F3HA 5F88A 2DYPA 2AAVA 2XQBH 1HNGA 1F6FB 5E2TL 5DYOA 3O6FD 1BFOB 1CK0L 4XNMA 1ZT4A 4ZAKC 4XMLH 3R4DA 3TF7C 5SX5K 1AO7D 2PYEE 3QFJA 4UZGA 5H37H 1MCOH 4L4TE 4P2RD 3MLVH 4FNLL 4HDIB 3DIFB 3IJHA 1QBLL 3QFDA 4KTEH 4O2FB 4BA8A 3VFUA 2NW2B 3FQUB 4P3DA 3MR9A 4WW1B 2X4SB 1ZLSH 3DVGB 3WFBH 3L3IA 2PF6A 2EE9A 2GTZA 4M4RA 1A7PL 1W72L 3MRIB 3TCLA 1QKZL 1KXTB 4YFLF 5FK9A 5F9JB 3Q6GL 3P4MB 2ITDA 5HI4C 4OCXL 4FXLA 3VMOA 2VLME 3G6JF 4H1LH 4J8RA 1KB9K 1I8MA 2Y5TB 2IFGA 4JZJB 3PHSA 5IFHL 1KGCE 2ED9A 4EIGB 4Y16B 2YRZA 3L3OA 5DQ9A 4XHJD 5HPOA 4KK8C 1WISA 2AJZB 2XN9A 3QJFB 1I85C 1UJ3C 4M5YL 5JXAL 5HVWA 4RNRA 1LEKA 4K23H 4HZAA 4LLVA 2DLEA 2CR3A 4R97B 3ZKXC 4M1GL 3NAAL 4Y16D 1UA6H 4PGBB 3WLBB 1ADQA 4LNRA 2E9BA 2D7TH 5CEZH 3MRJA 2ATKB 2N4IA 2VITB 1Y18A 2V2XB 4PUBL 1H15B 4MQXD 1F6LL 2V9TA 5JW3H 3SDDC 4LSDA 1F90H 1P7HL 2OZ4A 3AS1A 4G8EB 1HHGA 3GJEB 1AXTH 3GI8L 2XACC 3DHMA 3NA4A 4QHMB 3QQ3B 3DROA 1FSKB 3R8QA 4YAQA 3MUGB 5ABDE 2VDKH 3WO4B 1X4XA 3RVTD 1NC2D 2XKNB 4H1LB 4MDJB 2R1WA 5DF0A 1IVLA 4HKBA 2L7UA 2Y07L 4ONOA 2O5XL 5E5MB 4ZS6C 2Q8BH 4MGXA 4Q9RL 1G7HB 5EZOH 4P99A 1JPTL 3BP7A 2X4OB 5EA0H 2Y06H 3VI3E 1Z3GH 4XGZB 4JKPL 1FVCA 1F97A 5DRXB 5FA3A 5HYFA 5TDOA 3JTTB 3CFBB 5E2VH 3T65B 4ACPA 5AD0B 2FBJL 2XI9A 1QFUH 3VXOA 3HRZA 1Q9LB 3B3IA 5IB5B 1MAKA 5LGKA 3L3DA 1H3XA 5FCSH 5T1KA 4UU9A 4WWID 3CH1B 4U3HA 5KN5B 2FO4B 5D72H 2EDNA 2JCCA 3HKFA 1U8IB 1CLYL 1MI5A 1MEXH 3MLZH 1INDL 4WHYG 3T77A 1AD0B 1RZJH 4NRYB 4OF0A 5E9DE 2NY0C 4W4OC 3PNWA 1VESA 5IMOB 5CEZD 1U8NB 1EJOL 5B3JE 4X6DB 2A6IB 5CBEA 2IH1B 4G5ZL 3W81A 1X3DA 2FX7L 1F3DJ 2QJDA 3QIWA 1NLDH 2Y36L 2VQ1B 3WKNA 2BSED 3ZDYF 4OZFH 5E5RB 3N06B 5IGXH 4S0SD 5IB2A 2DWDB 3WFCH 1SY6H 4V1DB 1YJDC 5DD1L 4UT9L 1YY9C 1KNOB 3TYFA 3PDDA 1T1XA 2BXZA 4JQVC 4JFXB 4JO4L 4ZAKA 2YUWA 2Y9RT 3VXSA 4LSRH 3T4AA 4V1DD 5CCKH 3S97C 3ZKMC 1KELL 3SDYH 3D69B 5JXEC 1A4KB 4TUOB 3QDME 4NKOA 3MGTA 1D5MB 2OTWB 1QA9A 3LRGA 2W38A 2AXGB 1ZT1A 4GKNB 3W39A 3LKOB 4NBZB 2NXZB 3N1GC 2WWKT 1SM3H 2ZKHH 4PJGF 4LDOB 4PS4L 5DDHA 3DOSA 3P9WB 3U9PL 1U6AH 2ESVB 4XCCH 3MRDB 3HR6A 3WJJC 4JM4L 4OZFB 4P4RB 5MP6H 2ZSVB 4RDQG 3IDGB 2D31B 1KC5L 2YPKB 3OKNB 4I4WA 4XXCA 3FOLA 5C0DA 4AQOA 3C5ZB 3NGBC 2NLJA 1HHIA 4PG9B 1SVZA 4NM4L 1TJHL 3TVMB 4AEHL 2ESVD 2W9DH 4KAQH 1TQBB 1EEYA 5SWZE 1I85A 2QTEA 4OT1L 1JK8B 3MCKA 1JF1B 1QRNE 4B53A 1UACL 5FO9B 4Y1AE 1NH6A 2HFEA 2A77H 5I8EA 4ODSL 1A5FL 1UWGH 5I16B 4LOUC 2YD9A 1IL1A 3IJYB 4KHXL 3STZA 4NJAH 1IC7L 3TVMD 3QRGL 3DXAA 1L0XA 1LP9A 3HNTL 1BHGA 4XCEB 4KRMB 2FZ3A 3NN8B 4NZUL 3I3EA 4I3SL 1F42A 2HWZL 1J0HA 3TBVA 3MJ8B 4HUWB 4LSTL 4LCYB 1CL7L 1YNTA 3MRCB 4HWZB 1OP3H 4Y0GA 1J86A 1CLZL 1PQZB 1TETH 1T7YA 3H9HA 2FJGB 3CVHA 4WWKA 3HAEA 3W0WB 4RGOL 1LO4H 5DVOA 2BOBA 3S88H 4OZIF 5TE6H 4EI5D 3V0VA 4LBEA 4XPAL 2W0FA 1NCAL 4GJTB 1G7JB 4OTXH 2OX5A 3L1OH 5D7SH 5F8RC 3FO2B 5F3HB 1GYAA 3MJ9A 5F88B 2DYPB 4PJCE 4PY7A 1ORSA 3UPRA 2XTJB 5DYOB 4P23B 4W70A 1ZT4B 3D39E 3W0WD 1J11A 5EZIH 1VGEH 5IFAH 1ADQH 4K7PX 3QFJB 2JIXA 5IBLD 2D0FA 3VWKA 1CL7I 4H5SA 2W0KA 3IJHB 3QFDB 5ESQA 2EDKA 3RY6C 5D1QC 1W0YT 1LK2B 2XTJD 2OZ4H 4OUUA 3MR9B 4P3DB 4P23D 2ZNXA 4M7LL 4GG8A 3ZE0F 2O5ZH 5E8EB 4GAYA 2F58L 3L3IB 2CDGA 2GTZB 3QFJD 3TCLB 5C09E 4GXVH 3TA3D 2ITDB 4GXUN 2ADFH 5CZVH 4BQBA 2H9GA 4HH8A 4G3YH 4J8RB 4OZGF 1A6WH 1I8MB 4ZOEA 2FIKA 1FZJA 3DUSB 5GGVH 5CD5C 2D4DA 2VB5A 1XF4B 5TPWH 1X5JA 4ZOBA 1RZKL 5DQ9B 4PBWD 4MA8H 4AENA 1NMAL 3GMQA 1GAFH 1HI6A 1ZVHA 5J89A 2XN9B 4S2SA 4PP1C 5TGBB 3VW3L 4WTXA 3QWOA 5FKPA 1LEKB 4RNRB 4OFVA 2E8ZA 2V17L 5CINH 5A2KH 1N6QH 3ULUC 2MNUA 3K8KA 5AYUL 1DQMH 2DQJH 3ZYJA 1XT5A 2DKUA 4JRYE 4LNRB 3E0GA 3MRJB 2XN9D 1Y18B 4L29A 4OSUL 1I9IH 1N0XL 1H0DA 4X9BA 4R8WH 3FQTA 1NC4A 3LB6C 1HHGB 3HMXA 2B2XL 1QFPA 3EHBD 1RMFH 5FAAA 1FG2A 2XZAL 1JWSA 5I73B 3T2NH 1RJYA 3DROB 3ES6A 4YAQB 2O61B 4Y4FC 3K2UL 4PJAA 2LU4A 4TPRL 2R1WB 3IKKA 1HKFA 1EHAA 3KYMA 4X5WA 2FWOA 2P43B 5IESH 4HKBB 3CXDL 3QNXA 4N1CA 2F19L 4M62H 2VXVL 4M8VA 3GGWA 3BP7B 4K3DL 3FT4A 3MRRA 3WUWA 1FVCB 1K2DA 3WJJA 1UZ6E 3L3JA 5FA3B 4QXTA 4NN6B 1RHHA 3ZYOA 2XZQH 5TDOB 4JFYA 1I9RH 5JA8B 2WINA 1K9TA 5F9WB 2YUVA 1HQ4A 2OP4H 4EUPH 3MRPA 3QG7L 2XZCL 1WV7T 4TRPL 1CD8A 2AK1L 3HRZB 3O6ML 3O9WA 3L3DB 5T1KB 4UU9B 2WV3A 3CFCH 2XYCA 4KGLA 2VDQL 5C1MB 4GRWE 1TJIL 4Q74A 4Q9CA 1A1OA 2JCCB 2FB4H 1MI5B 3T0EE 3UROR 3VGFA 4IRJC 3T77B 1Q9OA 5BS0B 4XVUC 5IBTL 5ISZA 1ZT7A 2DJUA 4UAOB 3PNWB 1NKOA 2PKDA 4WI2A 3ECBB 3QEQB 5B4MC 3H42L 1OQOA 4J4PD 2GSIA 3W9DA 1BECA 4H8WL 3IFNL 3QIWB 1WIOA 1MI5D 2Z4QA 1QSFE 5BS0D 4OGAD 4LKCA 3RY4A 1U8HA 2A0LC 1P4IH 3AM8A 3EAKA 1I9EA 1IZKA 4KJPD 4M6NL 2BSSA 5IB2B 1C1EL 3OAUH 3QEQD 4KVNL 4S1SH 3QISA 4U6VH 2K9UA 2X9WA 3EKCA 3HC4H 4OCWL 5DMYA 4PJAF 3QIWD 4CKVX 2A9NH 3LPWA 4Z7OF 1Z9LA 2WSKA 1A1MA 1T1XB 4MA1C 3MCG1 4LMQE 4Y19A 1BF2A 4ZO7A 1K5NA 4EUPB 4FFZL 3RJDA 2NZ9D 2FX9L 2HKFH 1G7MA 5CLWA 1FP5A 2NCMA 1WVZA 4LK4A 1A6VL 2DMKA 1BREA 3VXSB 3T4AB 2NY6B 2EE6A 1BAFH 1EO8H 4HWBA 1XGRA 2YRPA 4NKOB 4UTBL 3MGTB 3RY6A 1ZGLP 5D1QA 4U6XA 2DD8H 3MLUH 3W39B 2IJ0C 4R90H 3RWDA 3UEZA 5ETUA 4IHOA 2NY6D 2CRMA 5I71C 5DJ2A 4Q2ZB 3ZTJG 2E6JA 2VXTH 3CVHH 5DDHB 3MBEB 3HAEH 2DDQL 1B4RA 2DTML 3QUXC 4QKXB 4N8CL 3DVNA 1RUKL 3FOLB 3LMJH 3Q2CA 4L3ED 4CDGC 4FABH 5C0DB 3MJ9H 1HHIB 5ITFA 4YBQD 4KU1A 4YDKL 4Z7WF 1E6JH 3UTTE 3MBED 4AEIL 4H0IA 5FCUL 5FUOH 4V2CB 5C6TH 5TQ2L 5D96B 1EEYB 1RUMH 1XCTA 3SE8L 4FP8L 4P9ML 5T33L 3G5XA 5I8EB 5BO1H 1EFXA 5HDQH 3G04A 1H9VA 2XQBL 1JTOA 3BD3A 1QR1A 5LAXA 3SOBH 3STZB 5BV7H 5EU4B 1JGVH 4NZRH 2YA2A 5FGRA 3DXAB 1LP9B 4TSCL 4XMLL 3MV11 4PLKD 2QQLH