1EZWA

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
347
structure length
347
Chain Sequence
AEVSFGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDWISGGRAIIGMGPGDKATFDKMGLPFPCKIPIWNPEAEDEVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVKARSIQGSDIPFYMGAQGPIMLKTAGEIANGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEATKIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIGKGDFGTAIGLVDEDMIEAFSIAGDPDTVVDKIEELLKAGVTQVVVGSPIGPDKEKAIELVGQEVIPHFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 128
structure length 347
sequence length 347
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1ezwA00
1NQKA 3RAOA 1M41A 1LUCB 5DQPA 1TVLA 1LUCA 1F07A 1FVPA 1RHCA 4US5A 5LXEA 3FGCB 1XKJA 3C8NA 4J2PA 3FGCA 2B81A 1BRLB 1YW1A 1BRLA 5AECA 4UWMA 1NFPA 4US5D 3B4YA 1EZWA 3SDOA 1Z69A 3B9OA 3B9NA 2I7GA 1BSLA
chains in the Genus database with same CATH superfamily
3N4AA 1OFAA 1HG3A 4QG6A 3TYZA 4I9MA 2OEKA 4PBGA 2E9BA 3RK8A 4GO8A 1UR4A 4OE7A 1HO4A 1YRRA 2Y2WA 1E72M 2P3ZA 2YBUA 5AHIA 1KD0A 4A29A 3H24A 4Z2HA 3CEPA 4IG2A 4GIEA 2D24A 1W1VA 3MWCA 1E6ZA 3I7QA 1YDVA 4F48A 4O18A 3MWAA 1EQPA 3S5SA 4GNKB 1Z3NA 3DESA 2O92A 4AD4A 3I4EA 2ESCA 2WVSA 1KWGA 4LRTA 7REQA 5E09A 3ITYA 4O11A 4M80A 4DXKA 3KBMA 3KP1A 1KKOA 4RZ4A 3TSBA 2CZFA 3TXVA 3UQNA 3TCEA 4Z2IA 3GHSA 4L5ZA 3ZSTA 4GFIA 1R3TA 1CB7B 4JL1A 3A9IA 1QHPA 2OGYA 4GNVA 1LLOA 3AJ7A 2ONEA 3V18A 5ENLA 2BP1A 1TMHA 3E0VA 2XUCA 1E43A 2X2YA 4UR8A 2CXEA 1HX0A 5HINA 1TPH1 2CBIA 1LYXA 4WKFA 3TUUA 3U7BA 4RNHA 2HJPA 7TAAA 3GXMA 3CPGA 5CLTA 3F7JA 3CIWA 4LB4A 2E28A 2OGJA 2V3DA 1EJWC 5AB3A 4S2BA 1LG1A 4WCJA 2YA0A 3TDFA 1CLXA 4GCAA 1LBLA 1KFLA 3C3NA 1ZJBA 2WZIA 1WDRA 4XTIA 2P10A 4RNJA 3MMDA 2P0OA 3EA1A 3DKJA 2PP3A 4GNJA 1O68A 1OGGA 5FJUA 2OT0A 3PULA 3DYOA 2FZBA 3TQPA 1VBUA 4I8DA 1KCLA 3MA8A 4JICA 2PU1A 5JQ9A 2PWHA 4DZHA 1FFRA 1SR9A 1Q7ZA 1HKVA 1DJZA 3LCGA 4TX9A 2D2HA 2NQHA 1NF0A 5D9PA 1Z41A 4H83A 1M04A 4REQB 4HNVA 3ERPA 3SGUA 5HOSA 1XS2A 4PL1A 5HMSA 2BBFA 1K9EA 1M7PA 3MP3A 3WBEA 2EO7A 4Z0SA 4RJEA 1XGEA 4UQCA 1W1IE 1LT7A 2CLHA 3BV7A 1XICA 2OSYA 4C6CA 3UJRA 3L2LA 4IPIA 2XIOA 3M0IA 1J96A 4AZCB 2YXXA 1FWIC 1BRLA 1PPIA 4PMUA 2HCVA 4MB1A 2X41A 1J93A 1C3FA 5AC8A 2CFFA 2OFJA 1S5TA 4Z2LA 3C2OA 4EAMA 2J78A 3CQHA 1IXNA 4AZ5A 1I2NA 1BWLA 4J2MA 4PMVA 1IZJA 2QXWA 4Q4PA 1ME9A 3VDAA 1W5OA 3AC0A 3E9AA 3RITA 2YL9A 1UKPA 2E1DA 3KHJA 2ZC1A 4HD5A 3DUGA 4M51A 1SUXA 4XBKA 2QGYA 3V7PA 5TQLA 3HG2A 2VELA 2ZXDA 2BFGA 3FX4A 1UR2A 3C8NA 3L9CA 3N04A 1Q8AA 2IS7A 4E2OA 4FALA 4IMCA 3R43A 1I4NA 2FPYA 3WQPA 1WNOA 4HPHA 3GBEA 4J3SA 3H7VA 3VCNA 1NWUA 2RAGA 2DUZA 3OA3A 5D9MA 1LUCB 1KTNA 1OADA 3KLKA 4QRNA 4U5KA 4XG1A 1W3HA 2XTKA 3SSJA 3STPA 3CMJA 2OJPA 1Q4WA 2CNCA 1MNSA 3WQFA 2QCGA 4BWLC 2FH6A 4IIDA 1NF7A 5I00A 1ICPA 1QNVA 3TLLA 2J79A 3OP2A 2ZOXA 5AHEA 4A2RA 4M81A 4LW7A 4GY0A 5FF0A 4ERGA 5I79A 3TFXA 5I3IA 3BUVA 3ZM8A 3KXQA 3QV7A 4EX4A 2W3ZA 3GQYA 3KWSA 4B16A 1E6RA 4DX3A 4IP5A 3NQAA 2H9AA 2V68A 3M5ZA 4L4MA 2XVNA 3GR4A 4UQ9A 3G24A 3R5EA 4ACZB 3M5VA 3WJXA 4JTDA 5CSSA 4H9YA 3DBPA 3K8MA 1U5HA 3PSVA 1ZZMA 4X2PA 4A8LA 1E6SM 1JZ5A 1L6FA 2OCZA 5T9BG 1FH9A 3B3DA 3BAJA 4YYCA 2XN0A 1XIFA 2XSAA 1MEIA 2RJHA 2VC7A 4KIEA 4OIFA 1LCOA 1WBJA 3XISA 4M3PA 1DJHA 5CAHA 3M6YA 1I45A 1VEMA 1I60A 1S2UA 2V8ZA 4ACZA 3DU0A 3BOFA 2VUNA 4G8TA 4QITA 5CXPA 4V27A 5I07A 2BGSA 1A80A 3SUTA 4JNYA 3W9ZA 4P61A 4ZGYA 2X40A 3MW7A 1QI3A 4J9JA 3EX2A 5I3GA 1EBHA 4ZO8A 5JIPA 1W56A 3K4DA 4JIHA 4IMDA 2IPWA 1ZJAA 5DCEA 1UD8A 1QK0A 3EGJA 1OX4A 3WBYA 2EAWA 3V0UA 3L4ZA 1UWRA 3BXWA 4TU1A 1W3NA 4EPEC 3W86A 1J9YA 2QYGA 1AZ1A 5CG0A 4F0SA 1C8XA 3MCMA 2WNZA 3L66A 2R24A 3AIUA 4TX8A 2AOSA 2VFEA 1EA9C 2P0IA 1FWNA 1VJZA 4JBRA 3VIGA 4P2VA 4UMBA 3P81A 2PRLA 2QCCA 5DY2A 1J4EA 4YHGA 1AQMA 2XJ7A 1VLWA 3GDLA 4L9XA 3PFMA 5DY3A 4R5EA 1GVRA 3E2SA 4ZXOA 4DB7A 1QJWA 2KAUC 3VIIA 4D6EA 1LRTA 3Q94A 3I10A 3ZIZA 2DFAA 1OFEA 2J7EA 2VWTA 4OQVA 1F3EA 2GDVA 3EX4A 5REQB 3RX3A 2FDMA 4DRSA 2JGQA 2YL5A 1YDNA 2E9LA 3QM3A 6CGTA 2AMGA 3WL1A 1LG2A 4HPGA 2NQLA 1O5RA 3QFEA 4ZTXA 3U3HA 4PULA 4QXIA 9XIAA 3S8HA 3POHA 3NSNA 3G1YA 1RLCL 2V6AA 5BRPA 4K36A 1UOZA 3TN5A 1OFQA 4JHOA 2PDYA 1M5WA 3FAXA 1FDYA 3K13A 4HOWA 1DXIA 1DOSA 4Y90A 4F79A 1ZJHA 1HKJA 5I3JA 4PMRA 3B03A 4GZ7A 3IRSA 3OVGA 3MV11 4Z0JA 1TCMA 4WDTA 2IXUA 4GUGA 3W71A 2GDQA 1EA0A 2ACSA 2PTZA 1C93A 3LBCA 1KM1A 3M6DA 2PS2A 3C0SA 2VO5A 4UMCA 3WMCA 1WDWA 4WOQA 2VEMA 1XLAA 1NARA 2EG7A 4B4FA 3CUZA 4H00A 4IPLA 4LVGA 2ZE0A 1B3VA 3G5EA 3EWXA 4MWAE 4B90A 3QV9A 1UHVA 5AYBA 5TAOA 1X1ZA 1TG7A 3HPFA 4M6UA 3FA5A 5JXQA 1GYLA 4F9JA 2BY0A 2XU2A 4DQWA 2D2JA 4R7OA 2PU0A 3GU9A 1UZ4A 1A5MC 3V1HA 1M7JA 2QDEA 3EDKA 4NJGA 1U30A 2FJUB 2R1LA 2PBOA 3PF3A 3EX6A 2Z2BA 4V33A 1WA3A 4WZHA 3H2AA 4N6EA 5C2GA 2GQ9A 2WQPA 1GG0A 4WSHA 3GYEA 1H7RA 4RNIA 2NX9A 4XISA 4NYYA 5FJOA 4UZSA 3P84A 3THCA 4GBDA 5H91A 1W1PA 4WY0B 1VBJA 4A21A 5TBOA 2JKAA 2WB5A 5I77A 2QV4A 4IFOA 3WF1A 3NQCA 1VYSX 2WMJA 1PVNA 5CQ1A 3AHXA 3ARVA 4K1WA 1WZLA 2WXDM 2QS8A 3BLLA 3R8RA 4L9ZA 1ZRQA 3V36A 1QDSA 3WF3A 2ZZ3A 2NQJA 1P6CA 3CIVA 3HG5A 2DZSA 4MY8A 4IOTA 3VOFA 5BXPA 5HUOA 1GQKA 3TYBA 5XIAA 3NZQA 4U28A 3CIXA 4HBKA 4RPPA 5AHNA 5DRCA 1XCFA 3UG5A 3GM8A 1XRSA 2E77A 3EDFA 3V3WA 4F2TA 4UQDA 5F2IA 1ZBWA 4DF2A 4KCWA 1WP6A 4HOXA 5D37A 3UP8A 4AVNA 2Y5JA 5CZKA 4C60A 3TQKA 1K4HA 2RKXA 3GFZA 2VFHA 3U2EA 1EXBA 2D22A 2JIWA 3FNDA 3CL6A 3PPFA 3A4XA 4PFHA 4ZOAA 4WJXA 4KF1A 4QQUA 2XN1A 3QQ0A 1YPIA 4GQQA 1MDLA 3APTA 2A3AA 1UKQA 3C2FA 5HBFA 2XH4A 4FX6M 3T08A 1L8PA 3AYRA 1JQXA 3DGBA 1GOMA 3QZAA 5DT5A 1J0JA 3CO8A 4JTJA 5AC7A 2BTMA 4O1EA 1VEOA 2H8XA 4JEJA 1S3TC 3W7OA 4XKYA 3MSGA 2XFFA 4ZO7A 3RU8X 1PDZA 3W7DA 4XVDA 4D9PA 2PDMA 1PHQA 1JDDA 2CKSA 4NRSA 4FLSA 4PCFA 3MQTA 2NT0A 2XWDA 1TPB1 5K2ZA 3WLMA 3LPPA 3T4WA 4ACYA 1A0CA 4RW5A 2AMXA 2BGNE 3H4XA 3FK4A 1XLFA 5D32A 3P80A 5C55A 3PZOA 1IGWA 2DU2A 1XI3A 3EBVA 3BSMA 1EX1A 1OF8A 3DG3A 3KCOA 2QDGA 3TZNA 1H2JA 3GS6A 3N14A 1Q8JA 3DGRA 1JUEA 1BF2A 4AD3A 3TJXA 4I5XA 1ISVA 4QGCA 5J04A 4W4QA 3KZSA 5MKGB 4YWSA 4NAFA 1W8GA 4F0HA 3SQMA 3JZEA 4FR1A 1OCNA 3BH4A 3GDKA 5G2HA 4WIWA 2X16A 2F8QA 4YXGA 1WKDA 5HR6A 3LCXA 2P5NA 4NZ3A 1HKIA 1OABA 4UNKA 3WDJA 3E0LA 4IWWA 4GX9A 3VNZA 6TAAA 5C2XA 3DIPA 2NX3A 2ZTKA 3UY7A 3B0XA 3B8TA 2G41A 4CQ8A 2J25A 3AXHA 4Q8VA 1K3UA 4FXFA 2VGFA 3PBWA 2B7PA 3PBUA 4BQ4A 3SY1A 3VDHA 1ZY9A 1XC6A 7A3HA 3WJYA 4KEMA 5A2BA 1ADSA 1H41A 5KTLA 4DHGA 3CL8A 1RSCA 2A3BA 3KCJA 1QHZA 4GXWA 1L6WA 3BMWA 4G1NA 2OODA 3DECA 1W5PA 1RJRA 3VK5A 4JPGA 4LANA 4C6JA 3UR7A 2VZUA 1OD8A 1M9HA 3QH2A 3WD3A 4MWAC 3WLSA 5D33A 3AMKA 4QFUA 1GKRA 1HKKA 1UP3A 1ONWA 3TOYA 3GXNA 1CGYA 3QGAC 1Q6RA 3CYVA 4D8LA 4C7DA 1V3MA 4O12A 1VR6A 5KITA 3OB8A 3MKVA 4HHLA 2FHFA 4WRHA 3FYPA 1OCJA 4MNMA 1Z7AA 4P7QA 4C6QA 2QUUA 1TX2A 3PM6A 1XBYA 3QXBA 4M1RA 1V3IA 1KR0A 1XSIA 2HV5A 3PP7A 2O7QA 4CKQA 1QNRA 1OG6A 4ENLA 2WMGA 3GZ3A 1R3SA 3ME3A 2Q8LA 1GCYA 5HMEA 2BVTA 4IMEA 2ANUA 1A50A 4ZFMA 1KFBA 1K02A 4MSSA 4JIPA 4KERA 4MHBA 1TPC1 3I65A 3WF2A 3L12A 2FB3A 3VKKA 1SZNA 4Y96A 3N2CA 1C92A 4HSHA 2NSOA 4ASTA 1KXHA 1L2UA 3BLFA 2NUXA 4B5NA 5BOOA 4J3ZA 1UMLA 4LUSB 2PE4A 4QJ1A 4DPQA 3QFWA 3GIYA 3B4UA 1GZGA 5CSUA 3WQEA 3V4BA 1H11A 1BGAA 2BLEA 1EJXC 4KIRA 3MDWA 1OJXA 4LS0A 3PBGA 1LBMA 3G6LA 4IL2A 4LUSA 3H54A 4P5UA 3W7NA 5ECVA 3ICJA 3O6YX 2HVOA 5A94A 3TAKA 2A6LA 3BOLA 3CMFA 4E2BA 5FAJA 4QBXA 1FCQA 5D38A 4TV6A 2WVVB 1M03A 3IV8A 1UQZA 3L4VA 4HT3A 3W1TA 4DJEC 3SJNA 1H1YA 4NAEB 4HA4A 3ITTA 1WDDA 3ITGA 3PHAA 4YMZA 3B9EA 1GW9A 4EXAA 3GLCA 1WB0A 3GC4A 2JKPA 1ZPTA 1A0DA 2PF8A 3LERA 3GYCA 1KCZA 1HL8A 2Z1XA 3DFPA 1ESWA 2ON3A 4D2JA 1EKOA 2WVVA 4O15A 4FOUA 3LOTA 3WDIA 4HMNA 3T42A 5LNSA 1OT1A 3FKRA 1R7AA 1UB3A 2ZRVA 3N73A 3W25A 2DIEA 2H3BA 3WLJA 3ARXA 2XDFA 3RMEA 4JYDA 8A3HA 2WV8A 4GK8A 1WPCA 1JYXA 1M3UA 2R1KA 4GCXA 3NSXA 2GGJA 3A5FA 4HZMA 4K39A 1LOLA 2PWUA 2D2OA 4XKMA 4UWMA 1E1FA 3JZUA 3TN4A 4XZMX 1JZ7A 4UBPC 1GVEA 4UTJA 3AMDA 2QCMA 1PE1A 1J6PA 1S2AA 2GSEA 2ZUWA 2PWVA 1XP3A 1VIWA 3GTHA 3SECA 2X42A 3K4WA 2CWNA 4D71A 4M0XA 1GZJA 3TYAA 5FESA 1TWWA 4AHQA 5D05A 1Q6FA 2PRHA 2OLHA 1K7XA 1HL9A 4XVEA 2RGLA 1I2PA 4NASA 3G0SA 1BVNP 1TWDA 4CEUC 3QTPA 3NXLA 1X1NA 3TNOA 3H70A 4B4HA 1O66A 1OD0A 4QLLA 2O55A 4W93A 4NILA 1MI3A 3MT1A 3ZJ8A 1ONXA 7TIMA 2X0YA 4D6HA 2YJQA 2DW6A 3NM1A 3MSRA 3H26A 1CGUA 4O19A 3RDKA 2C71A 1UWSA 3LNMA 1MQPA 3NDYA 1DHKA 5AECA 1NOWA 1W17A 3H2MA 4JFTA 1YIXA 4NZCA 4RLIA 4ZEPA 2CETA 4IQDA 4N4QA 3BARA 4H8VA 3BLPX 1QWGA 3VOCA 1ONRA 3T81A 1G7VA 4Q6XA 3EMQA 3FEQA 2VR2A 4B5WA 2VR5A 3LHYA 1PIGA 1R9YA 1E1EA 4GHRA 5EPDA 1V0NA 2YB1A 4W5UA 1V6VA 4HPXA 5A5WA 3DHPA 3OLEA 2QIIA 1DE5A 1A3WA 2FTWA 1P1XA 4H8NA 4N9DA 4UQBA 4IIGA 4DNMA 4Y9OA 2OWCA 3GUGA 2V38A 3BW3A 4UNIA 3ZO9A 3QJAA 2QUTA 1ZFJA 3PVFA 2DORA 3H2FA 4JN8A 3U7VA 2WHJA 4CNNA 1UR9A 3SCQA 4PB4A 1PUDA 3VINA 4BK9A 2WWDA 4JIEA 3H7RA 4L4OA 2VFDA 3DX5A 4A22A 1YTKA 3RPDA 2A3HA 3NL5A 3VCRA 4AWTA 3T44A 3W38A 3AICA 1Q63A 1EP2A 5H8PA 2PDBA 3BJSA 1IEQA 3LEPA 3LTPA 1B0IA 4Y9PA 2FH8A 3F5KA 3KCLA 3BCJA 4K2SA 1R2TA 1WZKA 2B81A 4X22A 2OTDA 5C7HA 1IEIA 3U5UA 2WSPA 2WLYA 4UFMA 4YNGA 4Z17A 2VCAA 1RBLA 5CPMA 2Y0FA 1DEDA 4PRTA 3TMLA 3WDRA 2ZDRA 2CERA 3MZNA 4AWSA 2F9RA 3L65A 1O12A 3UZXA 3HMCA 4JDYA 3VKBA 1R38A 3WH9A 1C91A 2EF9A 2IW0A 3UA4A 2FMNA 4FX8A 1XCWA 4UZUA 4RNFA 2PD9A 3SO7A 4LWWA 4DYKA 2I9UA 3WDQA 1G1YA 4L9YA 4AHPA 2Y5EA 2XWEA 2VYOA 3L4WA 5EMKA 5H1WA 3R79A 2D69A 2ZUNA 2VX4A 4RDWA 4XQ6A 1VB9A 2WBKA 1R9ZA 2X09A 3LV6A 4ONVA 5AHMA 4JTKA 1FWRA 1PTGA 1PYFA 3QKZA 3VIPA 1H61A 3DDMA 3KX6A 2Y63A 1LQ2A 1A47A 2HVNA 4GVIA 4JFUA 2V5CA 4J3WA 3UF9A 3F5JA 3QLDA 1M1BA 1YBQA 1I8JA 1XD1A 3FYOA 4LF2A 4W8LA 5EL1A 3QLLA 3DCPA 1RAKA 3R0UA 5A8MA 4OKDA 5E9XA 1EDGA 1HTIA 3E5PA 4ZOEA 3M16A 1QWKA 3BK0A 1XX1A 1OZMA 1X7FA 1E4IA 1FDJA 3WQGA 4NYUA 1Z6KA 2VC9A 1LL7A 1OFRA 8XIMA 5C9RA 2TPSA 1AQ0A 2HXTA 3U48A 5E6YA 3LS9A 1YNPA 4HB7A 2PTWA 3WKZA 1JGMA 3H8AA 4CN4A 1WYIA 3AO0A 3MSYA 1VS1A 1F2JA 1R9XA 4JTTA 2X05A 4LUTB 3Q58A 1IWAA 1QBAA 1RR2A 3D0CA 4O52A 3R89A 5D4YA 3T0TA 3C52A 1A3XA 3KRUA 5F2GA 2CBUA 2Z2AA 1REQB 4AYSA 5LHFA 1W3LA 2UY5A 4LUTA 2WMIB 3ZVIA 3BG3A 3S83A 3FHAA 5ABTA 3E0FA 4PRWA 2ATMA 3E0IA 1ME7A 5CPTA 1HF6A 1RV8A 2YFNA 3T4CA 4J3TA 3UT0A 4QE1A 1CZ1A 3LK6A 3MCOA 3GY1A 3DZ1A 3LMZA 2PD5A 3MO7A 1KC7A 4RE4A 4AXKA 1QVBA 4FPSA 3GH4A 3JR2A 2QAPA 3NL3A 4EWND 1UPMB 2QJGA 4I7UA 2YBTA 1C9WA 1OYBA 1KM5A 2VENA 4D8AA 3L4YA 3FXYA 4G9PA 5KZDA 4R7WA 4MVAA 3UG3A 2WOQA 3TZFA 3UBPC 4NY2A 3KOXA 3WNNA 3VNKA 1LM1A 4DBWA 4KESA 1M7OA 3TWAA 2V0TA 1VYRA 4F4RA 2RFGA 1PWLA 3AS0A 3EOOA 3PUDA 4MLRA 1JCYA 5FEZA 1N82A 4H7VA 3WNLA 4RCXA 1XF0A 4PSRA 2HPMA 1ISZA 2C6QA 3I3BA 2BXYA 3ZLGA 2VCBA 4H1ZA 1BVWA 5K9CA 2ZBTA 1PAMA 3QEZA 1XQLA 3L4UA 3RM8A 3WCZA 3UWZA 4R33A 1NM9A 1KFJA 4O1CA 3W7KA 3OLIA 4DELA 3NQ7A 4JIIX 1FHVA 4JNMA 4JTHA 2NXHA 3EWZA 5L6UA 3M7WA 2WNNA 4WUIA 4Q4QA 1NWTA 2JFEX 3CLMA 3MMUA 4M29A 3C0QA 2UWFA 3PB0A 2A2IA 5FEPA 2QCLA 3G1XA 3FLUA 1E0UA 5D04C 5FL1A 3IK4A 4LUJA 4GJIA 4M82A 1I0DA 3UXIA 4FXRA 1RA0A 1TUXA 2BVDA 4IGHA 2QCEA 4JD4A 3TTSA 1UR8A 2ZZ5A 3P8IA 1FHLA 2VRQA 5C9ZA 1H7WA 1EP3A 1UWIA 4AAJA 3BANA 3E2VA 1GOXA 1TIWA 1FWDC 1PCWA 2XIJA 1W54A 2G3MA 4QISA 3KL3A 3N19B 4H4IA 4E0CA 1KV5A 1GQNA 1L2QA 4BI7A 2GFTA 4JQ1A 4QROA 1KBBA 4IFKB 3P6LA 1JZ2A 1H0IA 3B97A 3SQSA 2TYSA 3GNDA 3AXXA 1E70M 3V0TA 3RX4A 1CENA 4E8GA 4K6AA 2VZOA 3IVUA 3LGGA 5M03A 4LYRA 4JTQA 3VO0A 4HCLA 5EGRA 5LIYX 3O06A 6XIMA 1R2RA 4TTUA 2NQ5A 3EWUA 3VMOA 2VZVA 1SW3A 1V79A 2CBVA 1WX0A 1V0MA 3C2EA 3TAOA 3VNDA 2VR4A 3SUSA 2W63A 3ZT5A 5AKQA 1EF2A 3SRDA 3QY7A 2BOFX 5PTDA 2QLYA 3M44A 3O8AA 3KRSA 2A3LA 2X1SA 2JF6A 4GX8A 4UTKA 5I3HA 4OFCA 2G0WA 3A6OA 2E67A 3ZXWA 2J66A 1FA2A 5EMLA 1EWEA 1YDYA 1RA5A 3EDJA 1JJKA 4K37A 2FYMA 1RP9A 3R10A 1AJ0A 4JKLA 2ZVIA 5D9OA 2Z1BA 1GHSA 4S3KA 2G50A 5D9NA 1J10A 5GJMA 1GTEA 5M5DA 4EPBC 5CZ0A 3WH6A 1JXKA 2RGMA 1WXYA 4YHEA 2EHHA 3MY9A 3IUIA 4X0NA 3GWQA 3KOWA 2A3EA 4JCLA 2Y89A 1NQ6A 3N2TA 5AZ1A 1KBLA 4CVUA 3GKFA 5CH9A 3BW2A 2YCLB 5BW6A 5D8WA 1NWSA 1GVOA 1OFBA 3LI1A 1FKXA 2PCQA 5A8PA 3W07A 1FDZA 4X60A 2I5QA 2ACQA 3BW4A 2VURA 3SGGA 3LB0A 3ZMRA 4JAWA 4AD0A 3UVAA 3QOMA 4JCMA 1UIOA 2Y70A 3C3UA 4UFJA 2OYMA 4HMEA 3LXBA 2HQAA 1WOBA 2P88A 5FF4A 4UR7A 3GR7A 5E0KA 3H23A 1Y7VA 4US6A 4GYPA 4ML9A 4C6KA 1DWHM 2WPBA 3SIZA 3PZ9A 4RPQA 3RAOA 4M7SA 3BICA 3WDHA 1GPFA 3IJ7A 3VMNA 4ZO6A 1OX6A 3RRXA 2XG9A 2PEVA 1S5NA 1IGSA 3KTXA 4DO4A 3RFAA 2VDIA 4JYFA 1TB3A 5FOOA 1EC8A 1OFOA 3HFTA 2P50A 3OYZA 3REQA 3PTDA 3WFZA 1WKFA 3BSHA 4A6GA 3M5YA 5CC6A 2J77A 3PTMA 3PS7A 5G1YA 3VAVA 4X9YA 1GJPA 1XXXA 1E0VA 1QUMA 1VFMA 1U33A 3PSWA 2BHUA 2NUYA 2VDHA 5BNKA 4H9ZA 4MLJA 1JCLA 1UD2A 2QIWA 4PMJA 4XV0A 4B9ZA 4LRSA 4Y9NA 1M01A 3Q65A 4NSBA 3VNLA 5JIWA 3NURA 1YW1A 2D20A 1R0MA 2WVUA 3IV3A 4RX0A 3QF0A 2VFIA 4RXFA 1DJIA 4HJFA 1EYWA 3WD4A 3QSTA 3L7RA 4ICMA 3KHDA 3ABXA 2EKCA 1BXCA 5B80A 3PWIA 4DN1A 4UQAA 2ZUUA 3BQ6A 3M9YA 3CAQA 2Z25A 3S1UA 3CQ0A 2ICSA 3DHUA 4LUYA 1GG1A 2OWXA 3DC0A 2VGGA 1MFVA 1UBPC 4M56A 4UXDA 3RO8A 1EC9A 1XRTA 5EYWA 4N42A 3ITOA 2NLIA 1DWIM 2Z1VA 2ZE3A 4MWAB 1ZS2A 2ZRWA 1W5MA 1VHNA 1V5XA 3EDDA 2HPIA 5I6SA 4JTAA 3NCOA 5FSEC 1KB3A 2G95A 3GG1A 1AMYA 3L5AA 3OZPA 5FACA 3ZJKA 2G3JA 3ALFA 1FWEC 1H1NA 1A5AA 2VHLA 3NL2A 1V02A 4MYAA 3BAYA 5BWAA 1IIHA 4LT9A 4ZSTA 2WBGA 2GJNA 4MUPA 2VUYA 4X0VA 1B3XA 4K1GA 3IIXA 1OGSA 1BYDA 1B2YA 3KVMA 4S2CA 1UW9A 3W1LA 1M68A 4GI9A 3VFCA 5CKSA 2E5CA 2DZXA 5C9UA 5I03A 3ISIX 2R94A 1XLGA 4GYFA 1R3YA 2I57A 5I09A 3OG2A 3WDPP 3NPXA 2P8BA 4V28A 4QCEA 2Y61A 3HPSA 1R8LA 1SM9A 4GA8A 4XBSA 1WUFA 1UMYA 1DIDA 4XD6A 5DANA 4XZBA 3TN3A 4HA1A 1US0A 1W9XA 2YR1A 4XWUA 1S1PA 5CPQA 1NDWA 1KCKA 4L1GA 2DZAA 4PUKA 2FHBA 2VNCA 1KLYA 2YA2A 1CPUA 4GIRA 2AKZA 2EEXA 3MJYA 3RUBL 2PDKA 4AZBA 1U5JA 2PRMA 1V0KA 3GD6A 3E2RA 4OZOA 2F38A 3A22A 4PYSA 3FYYA 3GE7A 3GX9A 5DEZA 4D6CA 1Q6EA 1XW8A 3E1F1 1E55A 1PZ1A 3IANA 4RZ6A 5T91A 1PO9A 4FEZA 4UTUA 4C91A 4DO6A 2AQWA 5IM51 2QF7A 3PWAA 3G1SA 3TJ4A 1R2SA 4AD1A 4OV9A 1FUYA 1YNYA 3IJLA 5LHEA 3UWEA 2V5JA 2NT1A 3IAQA 5GQBA 5F7UA 2OO6A 3GU1A 1ZP3A 1EIXA 2R1PA 2OSXA 3FY1A 3IAPA 4WXYA 1BAGA 5A6TC 2ZX8A 3APGA 2F61A 3GRIA 1XBXA 1V6YA 2AL1A 2EPMX 4CCEA 4IIBA 4EXQA 1HUVA 2VX5A 2QMKA 1R3RA 4A3QA 1XLLA 4QEHA 3W4RA 4N6FA 4GUHA 1PZ2A 2OEJA 4DF1A 3FGCB 5BRBA 1UA7A 2V5DA 3E38A 2E40A 3B04A 2VEGA 1L6SA 2ZZ2A 4EE9A 1T40A 5LGZA 3CEUA 3N11A 1MQQA 4UTWC 3IPWA 1TX0A 1EHNA 1VCVA 1S2TA 3PK7A 2PBGA 5FI8A 1Y65A 2DQXA 1VPXA 1GEQA 2PZNA 4P7NA 4Q8PA 1FWCC 2BWGA 4AWEA 4F2BA 1S5MA 4MDOA 2VC5A 4MG4A 4JY8A 1CGTA 3QOKA 4V2XA 1D3GA 2CLKA 1QOXA 2CZVA 1EYEA 1EJUC 4DBDA 1OT2A 3CU2A 4GABA 4LS1A 3PC0A 3VX0A 1LQ0A 1YXDA 1JVNA 2JE8A 4GI4A 5HMDA 5HUPA 1NH6A 3MUAA 4CLMA 5KSWA 1JZ8A 3TYCA 3M7SA 4LJ3A 1O4UA 2FDSA 4KRUA 1DIOA 1VF8A 4BF9A 4IPPA 2QCNA 3T0AA 4BI6A 3OPSA 3WJWA 2FLIA 3THQA 5BXTA 5D2TA 4F8XA 1SSGA 3S6DA 2Y24A 4M5PA 1V7AA 3ZJ7A 3N3TA 1C8YA 1JPMA 3VIFA 4AC7C 4POCA 4J5NA 3R11A 1XIMA 4GJ1A 4W7VA 1QCWA 1V7YA 1WDQA 3Q4DA 4E4FA 3AYVA 5KZMA 3AYSA 1RQHA 1WCGA 4OUIA 4WQ6A 2O9OA 2UV8G 1IEXA 4CQDA 4DUXA 3KL0A 3TV8A 1G4PA 3LTYA 2WMFA 1OSEA 3GXPA 4XUYA 1OFPA 3WLHA 1TV2A 1V3LA 3V75A 1KBIA 4W89A 2XVPA 4ZENA 3GU2A 2ISDA 3EWBX 2ZUTA 2IPJA 4NZFA 3WK2A 1BWKA 3PBVA 2I5GA 2ZX9A 1XL9A 2GJXA 3M4HA 2GLKA 4MWAD 1OIFA 4QE4A 4ZXLA 1QOQA 3BLEA 1TTJA 3W1PA 3ZR4A 4Q4MA 3O7UA 2ABAA 3MKCA 1LLZA 3S2JA 3WZ0E 3H2NA 5AHLA 2J75A 3W70A 1D3CA 2DH2A 3ANYA 5DXXA 3QV8A 4Q4SA 5CBBA 4FLRA 3G3DA 3N6QA 4B15A 1US3A 4OJYA 2NUWA 4CNPA 2BOEX 4FR6A 5J5RA 4GINA 4FNPA 3N34A 1AJ2A 1MSSA 3CB3A 3WH7A 3WNOA 4GBUA 2XH2A 4W8BA 4KS0A 3U2ZA 3VMPA 1EJ7L 4JIQA 4EF9A 3P60A 4LYPA 3AIQA 3HM7A 5D2WA 3R58A 5EB8A 1VPQA 1JPDX 3O15A 1KM3A 3SCVA 3VM7A 2EPHA 4Y8EA 4EANA 3E2QA 1LBFA 2I16A 3CUXA 3BAKA 4PMQA 2A4AA 3OHIA 3TA6A 4Z1CA 2QT3A 1TPDA 2XSBA 4B9YA 4EVZA 1HN1A 2V67A 1W3IA 3MMTA 3W82A 1H7XA 3MB9A 3N1AA 4S1FA 2P76A 3GTIA 4UB9A 4Q6JA 4X9SA 1BXBA 1CI1A 2UZ9A 3WBWA 3IJDA 4DJFA 1ITUA 3AZTA 2WW5A 4GVGA 4ILSA 1H60A 2C91A 2DIKA 4TUFA 2OVLA 3TN6A 3G22A 1UZDA 1G0CA 1RD6A 3FW6A 1AFSA 1YEYA 3ARUA 3VIKA 2NW0A 2VZTA 4PMDA 1FWJC 2G8ZA 3ZR5A 2NV2A 4S3BA 4DJFC 2PB1A 3F1QA 2DT3A 1ML1A 3V5OA 2NQ9A 3TU9A 1CGWA 2V82A 4AZ7A 1V08A 3W72A 3RCNA 2WMHA 3OEXA 2D0FA 4Z1AA 3JS3A 2ZX5A 3O0KA 3UFYA 3IJQA 1NQKA 3H7UA 1SFSA 2FKPA 5E93A 1OBAA 3VOIA 1EXPA 2A7RA 4ALDA 3XINA 2GOKA 1QR7A 3W1XA 3ORWA 1TV3A 4GYJA 4CGTA 3U0HA 1E40A 3T55A 3OLGA 5C8BB 3NA8A 4M8UA 4CCZA 3AQUA 4NXSA 4W86A 3LZ5A 4NG3A 2FFIA 1I0BA 2OEMA 3BQ5A 4Q32A 2Y7EA 1HJUA 2E6YA 3JU2A 4JQAA 4JQ3A 2YPIA 1ZLPA 1WBHA 4UTTA 2PDFA 3G1RA 4OOUA 2RDXA 4QJ4B 3M0JA 1TZ9A 3BPWA 3TJIA 4B5VA 3OBKA 2O56A 1EB3A 3T2OA 4WGHA 4AUBA 3IK2A 1PKYA 1EJVC 3NGFA 4U4MA 1BFNA 1C90A 3T6CA 2Y7FA 4GH3A 1HZYA 1AW5A 3NAVA 1SO5A 3KE0A 1EJRC 2EG8A 4QJ3B 4AXNA 2CWXA 1Q6QA 1OFDA 2ZRYA 4PCPA 1BEUA 3G1DA 3ZZ1A 1OC7A 1IXQA 4GQBA 2D0GA 1FWBC 4CEXC 1UUMA 4DI8A 1FBAA 3EA2A 3OG3A 4B5XA 4QDMA 5LIWX 4HK5A 3HURA 2P3EA 4MM1A 1Q6LA 3UPMA 3W83A 3IARA 2REQB 4AEFA 4MNLA 3EKGA 2ZUVA 3MI3A 3I4KA 2QVHA 3DENA 4KFOA 2YDQA 3HO8A 2Y8UA 2BGQA 1K8CA 2Q01A 3A3HA 5CJ5A 1EF3A 3U9IA 4AY1A 5DXYA 1UZHA 3TW9A 4C6PA 2C79A 2FVLA 1VJIA 1GVQA 2WZHA 4PTXA 1T41A 4Y7EA 1XIJA 3HQPA 4X3ZA 2Z1SA 1TVNA 1RBOB 4A8RA 1DJGA 1XD0A 4BZYA 2OSWA 3UYCA 2AQVA 2NXIA 3WBXA 1CX9A 1B4EA 3LSBA 5F4XA 2BVWA 3CS2A 4QQ3A 3A13A 5GVJA 3N17A 3ARPA 3HPXA 1UR1A 3NO5A 2DDXA 1E6QM 2ASHA 3VD5A 5B7ZA 5DFAA 4K68A 1OEPA 5CG7A 4MDPA 5C70A 1NFGA 3ZLFA 3ZVHA 4Q4OA 2RUSA 1NDVA 2CZDA 1MVYA 1ZAIA 5L9FA 1F8MA 3CNYA 1KQZA 1H63A 4BF5A 2XN2A 5E1QA 4S38A 3B9OA 1KXVA 4DNHA 2WMKA 3WQCA 4MKVA 1CTNA 1HJVA 3ABRA 1M53A 2PFHA 4NI8A 2INFA 3QW3A 2OYLA 2EG6A 1JUKA 5LNWA 4CD8A 2YL8A 3LUTA 3OO2A 3N3MA 4YYFA 1K8YA 3EXTA 5K9DA 4NU7A 4L64A 3VXGA 1B1YA 1GONA 3A5VA 3W7GA 3STCA 1J0HA 4OTKA 4C7GA 2OYKA 1ISWA 2QPUA 2C16A 4QAIA 4O0KA 1IXPA 1JYNA 3TH6A 2W62A 3WJSA 2HROA 3TR2A 3ATYA 3OOQA 4DY1A 3CHVA 3K1GA 3BAXA 4ZQPA 5HQEA 3H22A 3QC0A 4MFEA 3FN9A 3SQLA 1RD5A 4N2YA 1E9IA 2ZDSA 1GJWA 2X0SA 4NL1A 2YYTA 3QYQA 3CWNA 3OIXA 2BOGX 1D3HA 1DKWA 3NZGA 4JEQA 2EPNA 3AALA 1F6YA 1W2VA 4MB5A 4NZ1A 3F2BA 1Y8BA 1TVPA 2ZFAA 4E38A 1SO4A 4NNAA 2HXUA 3GK0A 1D7KA 1VFUA 1YTEA 3I3DA 1B3OA 3GVWA 4Q8OA 3TEVA 4NJKA 3TROA 1TELA 3SRHA 3RJYA 4HHHA 3G1FA 4W87A 1VIZA 3CZJA 4GZIA 1TO3A 1JPKA 3LU2A 4I3GA 3NFUA 4IZGA 4PMYA 3HG4A 3GB6A 4TO8A 3S5YA 5D02A 1R85A 1MDRA 4PEKA 1QFEA 3NOEA 3MVTA 3KS5A 1I1WA 1YADA 2XVLA 2JALA 3QHMA 1JULA 1Q13A 1UJPA 3WLNA 3UEQA 4QNEA 1HJWA 2PLMA 2QJJA 3R7MA 1HO1A 3DFTA 1XCXA 3UWVA 3SUUA 4DYEA 3UJFA 4H04A 4W7UA 3THAA 4Q8TA 4J40A 4RE2A 1TWIA 1CECA 5C54A 1OB0A 2C15A 1VCFA 4AIEA 1XLJA 2QDDA 3F4VA 5C0QA 2C1GA 2YB4A 2CZ5A 1XRVA 1LRNA 4LY8A 2Q09A 1E1CB 3LGEA 3UZYA 3TC7A 1TRIA 3SDOA 1MW0A 4IHCA 4YCOA 2J8GA 4JDBA 2FZNA 4P7RA 3GFYA 4LYKA 4ZQCA 1E6NA 3OGSA 3NDZA 4C65A 4CNUA 4N9BA 4CQAA 3P14A 3QV6A 3NO3A 3IJIA 4M6PA 3UXLA 5K9XA 3W7PA 2J62A 3L0GA 4DAFA 3NM3A 1E51A 3AU6A 2PZ0A 3BJFA 4AVFA 1V3HA 1HIZA 1CIUA 1XC4A 7PTDA 2WVTA 4NHVA 4H41A 4AIOA 3T0DA 3W7RA 1JRBA 1EOKA 1VENA 4UFHA 1SW0A 4GIYA 3IIZA 2MUCA 2ZA1A 4J7RA 1E4MM 2WZEA 4KH2A 4FP1A 1DJYA 1DE6A 1PIIA 4PE8A 1NDZA 2IUZA 3KS6A 1J18A 3R1ZA 4I5UA 4NNBA 3PG8A 1XWYA 3RR4A 3T8LA 1ECEA 1F3TA 3NQ6A 3HB9A 2JQXA 1NOUA 3CM4A 5EMMA 2VOTA 3RPMA 3IJ8A 3FOKA 2PDXA 1JI1A 3T8QA 4US5D 2JIEA 1EZWA 3UNTA 1K9TA 3TA9A 1P4CA 1SZRA 4Z2GA 4OU1A 2XGBA 3ITVA 4HTBA 1F6KA 2VT0A 4GZEA 1PZ3A 3JVAA 3TX9A 4GQRA 3GSMA 2I14A 5K3VA 2GSJA 5A1AA 3VD4A 3N6JA 6REQB 3E96A 4ZE4A 5CBJA 2TODA 2OX1A 3DFYA 2XIMA 5JUVA 4K8EA 5JBDA 4FNSA 4RDVA 1G9HA 1OHLA 3DAQA 3G0UA 4DWSB 3TYDA 2DSUA 4XAYA 3QN3A 1A3HA 2A3CA 3IIOA 3OU8A 4A3HA 3SCNA 3SCUA 4Q8MA 5JBFA 3TSDA 3HG3A 1TYGA 4IGSA 1NEYA 3LZ3A 3GXFA 3M0ZA 6REQA 4C1NB 2FPTA 1IF2A 3B8WA 3QQ1A 4BR1A 1F7BA 2PTDA 1LLWA 4IJCA 4C6OA 2DP3A 4PZVA 4GZJA 1EHAA 3BGGA 5LA1A 4ZBCA 1O5QA 3I6EA 1QI4A 4HK6A 1SO3A 2V5KA 1NP2A 3RCMA 2FTYA 2Z1WA 1OYCA 1B9ZA 3B9NA 4FHAA 3FVMA 1I75A 3RYSA 4MNJA 1XPYA 3OGRA 1CEOA 2CLEA 4AIUA 4LNYA 4DBSA 1CT5A 1AL7A 4O4VA 2GVJA 3V5FA 1POJA 2ZRUA 3UZJA 3VGDA 2YCKX 1E15A 3BMVA 3GR8A 4NRRA 3KOYA 5IDZA 3UWUA 3ZLHA 4XIAA 1X39A 2CBJA 4REQA 1MUWA 2R1NA 3MYOA 1THFD 3A9BA 1R3QA 5AC5A 4EACA 1JYWA 3AS3A 3DYPA 4Z1DA 2Q8XA 3KOZA 1W9BM 4KBXA 1ZB5A 3KDOA 1IT8A 4HZ8A 1KGWA 3W01A 4N7QA 4H8HA 3INPA 1KGXA 4WDXA 1Y5VA 1QPRA 4I6VA 4WKAA 4Z2KA 5CSRA 5G4HC 3M43A 1DORA 1WKEA 1MUMA 3W7MA 4E5TA 4AZGA 3VYLA 1M65A 1TMQA 1VBGA 1VGAA 4AZCA 1V8EA 3EX1A 5HK4A 3PBMA 2FZ9A 3VKCA 4ZVJA 1P6WA 2DUXA 4LY4A 3KEHA 5DCBA 1N8FA 3A4JA 3M0LA 1R30A 4UMAA 2HBVA 4I9AA 1NWRA 1HJSA 1WOAA 2YGYA 5LA0A 4FNTA 4R34A 5E9AA 1KM2A 1G7UA 3WL0A 3M1ZA 3KTCA 1JF6A 4RR4A 4EK7A 4U33A 4AB4A 3CH0A 4AF0B 4EIVA 3AWNA 1O5KA 4NP7A 3G77A 3L5MA 3S47A 4J27A 3HIJA 1TPEA 3KFTA 2OWWA 1T8QA 5JH2A 1OGBA 2RDWA 2OELA 8TIMA 2NLYA 1RPKA 5F4SA 3AJXA 2J8TA 2GYIA 4O10A 3C56A 1XR2A 3M46A 1H49A 1W31A 3L2MA 2WM0A 2AAMA 2YX0A 1LUCA 1A53A 5LKYA 3H4WA 5LXEA 3C2RA 4JQ2A 1FKWA 4D1IA 4EF8A 3LHTA 4AF0A 1L6YA 5HWJA 3PTQA 4HKPA 3WQ8A 8XIAA 3W7IA 1QNSA 3DOPA 3LM3A 2HVMA 4PEEA 3UPWA 1UA3A 1AK5A 2DIJA 1X1OA 4BCEA 4ZTYA 4JY9A 3W1RA 4ES4A 4XAPA 2ZTJA 3BMXA 2FGLA 2BSLA 2DVXA 1V4YA 3O9NA 1PZ0A 3FV9A 3AUOA 1BSIA 2PDIA 4Q8WA 4LEFA 2ZZ6A 5DMYA 3C61A 1MYRA 5ABGA 1MQRA 2EPLX 4YWIA 2Z1KA 4DO5A 1XUZA 3AROA 3PTKA 3TTQA 1ZAJA 3C6CA 1SJBA 5K4XA 1IEVA 1DVJA 4B5UA 3RR1A 1YHTA 2WCAA 3WK3A 1XLBA 3TW7A 4LQ1A 3USZA 4A35A 3LYEA 1TFVA 2GGEA 4DPPA 3GTFA 3NQ8A 1A5LC 1FCBA 3P93A 1ZAHA 1PB0A 4IUOA 3RM9A 4ZOCA 2C13A 2WJDA 1A5CA 4IPNB 4PCNA 2DY3A 2RH9A 1W32A 3VGFA 3K8LA 1P0DA 1FP9A 3ATZA 3GUWA 4GG9A 1DJNA 1AH0A 3NSMA 3E5BA 4FI4A 1IXOA 2DT0A 3WG6A 1WQ5A 2CHRA 2WHLA 1AVAA 5LYRA 3CHFA 2Y4SA 3SN0A 3VOHA 1AZ2A 2A1YA 2QUVA 3RXZA 2RDUA 3H4GA 4QDWA 2JK2A 4WLCA 3M64A 4KRZA 5A8GA 3AZSA 4IJRA 2OZTA 3GVVA 1R7OA 2QV5A 5I5RA 1W6TA 1X96A 1RPXA 2INEA 2CYGA 1RY8A 3MP4A 2G97A 5AYIA 2KX9A 2OQLA 4CVWA 2DJLA 3LX9A 3MSDA 1VC4A 3UW6A 4JX4A 3M0YA 3KBNA 4HN4A 3RF9A 3PZUA 1KCXA 4DWSD 3DHFA 2ZADA 3VGBA 3N9RA 3T05A 3TVAA 4Q8UA 5REQA 3NG3A 3TTEA 3AYTA 2PLKA 4YTSA 1VFFA 4MZYA 1RCQA 1XLKA 2JBMA 3PY2A 3HFYA 1SGJA 4AC1X 4XX6A 3T2QA 5FJIA 3VM5A 4ZZ9A 3A64A 2B31A 1G94A 4O1AA 3PUGA 4D6JA 1HP5A 3VOJA 5AFDA 3EEGA 1N7KA 3OQ8A 3BO9A 4U10A 1EDQA 1WKYA 2CHOA 4QLJA 3S4TA 4PC8A 3AXIA 2IMRA 3NQGA 1QNOA 4GY7A 1AJZA 5H8UA 3SCRA 1LL6A 3G1HA 3UY8A 4P7OA 4AMAA 1GYMA 2J7DA 1KFKA 3NNTA 2PDPA 4I6KA 2BB0A 4KWVA 3HGJA 2E68A 2V81A 1QI2A 3IIPA 3QR1A 2WHMA 5XIMA 5CJMA 4QS6A 3W22A 3MUIA 5AN7A 3S9IA 2NVAA 1XIDA 1PXGA 1QNQA 4HJWA 3P67A 4HNNA 4G7FA 1FH8A 4WDUA 2VI0A 1Z44A 1PWMA 3QY8A 4KCTA 2XFRA 2Y1HA 2ZX6A 4GXPA 3W2KA 2HS6A 4B5TA 4R7JA 2YKKA 1TWSA 4GOAA 5CGTA 4C90A 3CJPA 7ODCA 3M0HA 3A3WA 2VP8A 5IRPA 5BU9A 2HZGA 3LRLA 4HNTA 3WUEA 5I3DA 4CD4A 5CC3A 3MBDA 3LGDA 5JMUA 3B4YA 4XAZA 1H3GA 3SRKA 3DHDA 3V35A 2MANA 5LSMA 2OXNA 5HULA 1ADDA 3B8VA 5T26A 1E4NA 4PUUA 1CDGA 4PGLA 4F0LA 3GW3A 5RUBA 1L0PA 4IQEA 1PBGA 2PLJA 5A6KA 3I6TA 4I5RA 1YX1A 3SUVA 1YMYA 3OQEA 3L0KA 1ZENA 2J27A 1YPFA 9RUBA 4NT0A 3SCPA 1AD1A 3NQVA 5G5IA 4KWUA 1CXLA 1ONEA 4D6DA 1CLKA 4QCFA 3TFCA 4KETA 1EIBA 4WY0A 1VFSA 4LYQA 3PZVA 3CB8A 4H2CA 4PMNA 1QBBA 2Z29A 2D0HA 2DSWA 4IJBA 4QHRA 4ML4A 3KWXA 1JCJA 3ARZA 1K4GA 3OBEA 3S5ZA 1RVGA 3KAOA 2VEFA 3QPZA 3Q37A 1TTPA 1E3XA 3PBYA 2J6VA 2WQDA 3P8JA 3SADA 4M6VA 2J9YA 1TV8A 3LLFA 3SN1A 4AY7A 1BTMA 2GSHA 3GG0A 3TP4A 1T8XA 4IMAA 1P1MA 5AVNA 2BZNA 4B3ZA 3B8UA 2BHYA 3S5OA 3GNXA 1TV7A 1R5YA 2DUAA 3U2OA 2X30A 3V5CA 2WPGA 1GOOA 3R6IA 3Q67A 3AHZA 4ERAA 3E0WA 4NX5A 3OVPA 3ZR6A 3NWRA 4QSFA 2NVDA 5A2AA 1FWTA 3KM8A 4GACA 1WDPA 2FHCA 3GKAA 1FWFC 1IWPA 1JPIA 3UJ2A 4ADUA 4Y8FA 3USBA 3SSZA 4HSNA 2VWSA 3MPGA 3MUCA 2EPOA 1CNVA 4HYRA 4LF1A 4FLOA 3W6MA 2XISA 3AHTA 3T0BA 1SFLA 1LOQA 2V2CA 5A8QA 1KO0A 3CO4A 1DIKA 2O7SA 5FEXA 1BG9A 3SRFA 3CBWA 4TVDA 4MYXA 1ZL1A 2WCSA 3VVGA 4PA8A 3XIMA 1ISYA 3M5XA 3ARSA 1TV4A 1K03A 4AH7A 3NPWA 3IGSA 1S2VA 3FIGA 3FHQA 1HT6A 1GVYA 4L4LA 1SFJA 2DQWA 4LCQA 4BJHA 3UG4A 1GGOA 2PP1A 4GPNA 3VNJA 1T6MA 4AIBA 2OG9A 3H12A 1XLCA 2W9MA 3LHWA 2GVGA 4L1WA 3W7LA 1UKTA 2GWNA 4LS2A 3VC5A 1F74A 1YPXA 3HTWA 3ITXA 2PF0A 4XAGA 1F07A 1ADOA 4C6LA 3CUGA 1MEWA 1F9CA 3VFLA 3QR3A 1E0XA 4GQ0A 1XV8A 1H5VA 3SCTA 4JGDA 4QNWA 1HXJA 3BE7A 3VKDA 4TTGA 2DZVA 2HK1A 2PSNA 2FTPA 1ME8A 5MKGA 1YLVA 2MNRA 2CZEA 5F1VA 3TOPA 4CN6A 2ISFA 2VRJA 2XVKA 2ISVA 1P7TB 2W0UA 3S6OA 2WLZA 1T0OA 3CV2A 5FEWA 2BDQA 1XLHA 1JFXA 2BXZA 3N18A 1VFHA 3RPTA 3GXTA 2B7OA 1LRQA 4XIMA 4HMCA 1XINA 4LGXA 4JYEA 4RDZA 4AWUA 3AMLA 1UIPA 4YIWA 3LLXA 1J0KA 5I3FA 2J4GA 1ZP4A 4DIAA 3QC3A 4B2DD 3UR8A 4OUEA 1JF5A 4G1KA 2Z6JA 3CUHA 3COTA 3QPEA 1TWZA 3ARWA 3UG8A 4KCVA 1ZU8A 4FIQA 4QAWA 5E0CA 2E25A 4LCRA 2W79A 4ZODA 1JCNA 3KTSA 3W88A 1SJCA 1U1UA 1DWGM 3QRHA 2XYLA 1EX5A 3W2UA 1PSCA 3LDVA 2QCFA 5KEZA 3PZMA 1TJ1A 1R86A 2NZLA 3NQMA 2C14A 1X6NA 3NTYA 1LF1A 3UXAA 1GJUA 4ICCX 1HFBA 3RLHA 2FMOA 3B0UX 3I7RA 2HTMA 1VRXA 2P53A 5D2YA 3TCSA 3KRZA 4CU7A 4CQBA 4HIBA 3HZ3A 4FSAA 1YXYA 2PDLA 1DHPA 1OK6A 4EOUA 5CAKA 1P0KA 2QAFA 7ENLA 4LAUA 4DJDD 1ITCA 4NI3A 1FTXA 3Q2DA 2IXVA 3GH5A 1RCOB 2WSYA 1XIBA 1EPXA 3VTRA 3PJUA 4CNTA 4ICNA 4IGNA 4HNCA 3RIKA 4GQGA 1UWTA 3VOGA 4AHOA 4JOMA 4BEQA 3A24A 2VTFA 3QSRA 2AAAA 4DXVA 2DT1A 8CGTA 2UY3A 5D30A 4Q4KA 3AXKA 5FCZA 5EMUA 3QR0A 1B31A 3OIHA 4CNOA 2G3NA 3UERA 3WQDA 1IYXA 3UZZA 2DJXA 4PB5A 3RU6A 4DM2A 5FIPA 4C6FA 1XH2A 4LUIA 1DJQA 4IIFA 5K4ZA 3HF3A 2PWFA 2V63A 4HTYA 3W02A 3WY1A 2EJ1A 1OINA 3BGJA 3UYIA 1VQTA 4EPKA 3CYJA 4JQ4A 1RBAA 4TV5A 1ZBKA 4UTIA 4Q7NA 2DW7A 1HNYA 3WK1A 3EOSA 4DWDA 1EP1A 3VX1A 1CBGA 1IEWA 4O0QA 2WNQA 3GAKA 3EZ4A 4NKCA 1YNQA 2XGIA 4H9TA 4P7LA 4GWEA 2PP0A 4QX4A 3GZAA 1RQBA 3F4NA 3WF4A 4AZ6A 2AGTA 3AFBA 2A6NA 1X8CA 3G2GA 2VD8A 1A4LA 4JX5A 4RDYA 3MVIA 4LVDA 1W1A1 4NAEA 3W00A 1XIGA 1MMFA 4UC5A 3N2MA 3WMLA 1SZGA 4OGZA 5I24A 3KRBA 1K7EA 3DFNA 5IBXA 4A3YA 1EEPA 2E9MA 1BLIA 5HDRA 3PPHA 3W0KA 3NZPA 4AEEA 2QCDB 3ZT6A 2CLIA 1F73A 3RRAA 3P0XA 4JFWA 3KBJA 3ECQA 1O60A 1NELA 4PMOA 3H53A 3H2CA 4D6GA 2RDTA 3R13A 4GFSA 4LX4A 3GW0A 1B3YA 3EXSA 1K77A 3AIBA 4HA0A 2UY4A 5EFFA 3THUA 5LNRA 4PN2A 5IDIA 5IHRA 2ZIDA 2BMBA 3A3XA 3UZWA 4E4UA 3WQ4A 2OZ0A 1SFTA 1G5AA 3EOEA 3CH9A 1O1ZA 1W2PA 1EEXA 3DFSA 3OZMA 1UASA 1GW1A 3GHUA 1ISXA 4TR9A 4UTFA 2QZRA 3SURA 1ICSA 4TVCA 2AQOA 1Z89A 3WLIA 3N29A 7REQB 1Z69A 5DRIA 4WY0F 3CXOA 3WK0A 3N2OA 1CXFA 2WJZA 1NY1A 2WANA 2KZHA 1VKFA 2X1IA 2FZ8A 1DWFM 2CLPA 1N2VA 3HJEA 2C8NA 2DZTA 3W2JA 5HANA 2X7WA 5HNTA 2PTYA 2IPFA 1JAEA 3SY8A 1H50A 1FVPA 5U7SA 1E56A 1JD9A 1CXHA 4C6NA 5I23A 3W27A 3L0NA 3NO1A 4HVXA 2ZRXA 1HP4A 1I2OA 3URQA 3W23A 4AW7A 3S6TA 1JCXA 2YXGA 1AUSL 2QR6A 4RV3A 2NSXA 1HJQA 1NSJA 3DFQA 1E73M 4LTSA 3WNKA 4Q22A 2ZXQA 2E6AA 3ONBA 4DLFA 3EOUA 4ZO9A 5CZSA 2CKRA 3KLLA 4MJ4A 3T2PA 1J6OA 3W76A 1ELSA 1XM3A 4KCUA 2W61A 4NXKA 3WF0A 3HU7A 3OBAA 1TQXA 3MBFA 1DL3A 4H6EA 3KDNA 1Q7MA 2D1ZA 3PPGA 2WKLA 1HKWA 4KWOA 5H2ZA 1EPVA 4LBUA 2GGGA 3BSGA 2GGHA 1FXPA 4DLMA 1Z32X 2VX7A 4DXXA 2GQ8A 1GOKA 3S9YA 4WOZA 3O0FA 5LA2A 5FA5A 2G4JA 3EKLA 1U1JA 3NEHA 4G56A 3STGA 5JVLA 4IICA 1EWDA 3TWBA 2VDGA 1BRLB 5BMXA 3DI0A 4PR4A 3QTGA 1V6UA 2XGZA 3BZJA 1RALA 2OR2A 3ALGA 1AL8A 4X63A 4TIMA 3M07A 2GQAA 1DIEA 4DO7A 3I3EA 2W92A 3B8IA 3BZGA 1DWAM 3WN6A 2BHZA 4FXSA 1J11A 2E5DA 1BF6A 1S46A 1E5JA 4FO4A 4FNUA 4QLKA 1K6WA 1W8SA 1KRMA 1UH3A 5C6MA 4E2DA 6ALDA 3QZEA 3UD6A 2ZXAA 3AI0A 2Z28A 2ADAA 5LNVA 3LCIA 3WLTA 3RLGA 4A8NA 4F2UA 2WSQA 3W73A 5A8NA 1A5UA 3TSMA 2Q3OA 1ZSXA 3ITCA 3M0XA 2JF7A 4QR6A 3U2CA 2V9DA 1C7SA 3C8FA 2PLCA 4MNKA 4BWLA 3ONCA 3HQNA 3W84A 4IX2A 2QHAA 1OF6A 3FSUA 3UGRA 5JH1A 3NL6A 4H9XA 3ZS4A 2J6XA 1GTHA 1GOIA 3GDTA 3HBLA 5E6ZA 4Z1BA 3WENA 3VI2A 1RLDA 5BXSA 1TUFA 1A5NC 1CB2A 5ABEA 1H7NA 5AC6A 4RZ5A 4L61A 5LIUX 4AZIA 1BKSA 1Q85A 1IR1A 3W6YA 3KOFA 2H9AB 2GVYA 1IIGA 1TE1A 3RG6A 1CW2A 1J79A 2C0AA 4XZ9A 3WYZA 1QMLA 3D6NA 2EXOA 1XQKA 3TTYA 2Q71A 1KFCA 1W91A 4U31A 2VOMA 4EWJA 3R0KA 3VKAA 4CUCA 1SZEA 3FXGA 5F1UA 2J8FA 4AVOA 4WX2A 3P3BA 2G3IA 4UFLA 4OBRA 1ICQA 2DV0A 1QRQA 3PJWA 1REQA 3CZ8A 3NQFA 1XISA 4O16A 5HJYA 1RZMA 5A8OA 4NJIA 2ZCGA 2PWGA 2WMIA 5F2MA 4J35A 4F9DA 4PTWA 3W7CA 2WJFA 1OX4B 3NZRA 4QG8A 1D9EA 3K5XA 1S2CA 1A5OC 3R12A 1K6AA 1G4SA 1K9DA 3VGHA 1BD0A 2D23A 4P8WA 4U5IA 1RJQA 3U4FA 3OZOA 1OWQA 2YSWA 1US2A 3W74A 1H5YA 1RQEA 3LENA 3M47A 3WQVA 5HJXA 1NDYA 3PAOA 6TIMA 4FOJA 4UFIA 3N9KA 3H2EA 2YW4A 4CU6A 1WDSA 1RJPA 5E5CA 4MB3A 2WNWA 2L5HA 2DZBA 4S3AA 4CCCA 1RK6A 1XSJA 3UWYA 5FJPA 2FVKA 4KW2A 4V1XA 3FDGA 1AW2A 1WXJA 4G6CA 1H0GA 5AY7A 3SEPA 3ZWSA 1YYAA 4IMGA 1A5SA 1NAL1 3DYMA 3PUEA 1WAUA 1XLIA 4XO6A 3UZ5A 2ZWZA 2UY2A 3RLUA 5BOFA 5G4EA 3WLOA 2HE8A 2VJXA 2HWGA 4XZHA 1AA1B 3C86A 3QMSA 1K70A 3G18A 3S5NA 2CLFA 1SQ7A 2QJIA 2E0PA 2J9ZA 1F8IA 2YDSA 4E8DA 3WQ5A 1CXIA 1TIMA 1LWHA 3CHDA 4M19A 1VH7A 9CGTA 3HOJA 1K8XA 1RXOB 3WFLA 1F3XA 2NV9A 2ABBA 4F0RA 1P43A 3VPLA 1DWJM 5D2XA 1XFCA 3T9PA 3APYA 2A7NA 3MCNA 5FD0A 2OU4A 4QDPA 2XZ7A 3IACA 3UCQA 3ABOA 3IWPA 3K30A 4LBSA 5A6JA 1XYFA 3PFRA 1C29A 4AZHA 4F66A 1X38A 3ARYA 4CQ9A 1UD5A 3VIHA 3VABA 3W1UA 3BDKA 4JNZA 1W5QA 3L2IA 3RM4A 2R9RA 4C1KA 4O17A 1KTCA 3WUGA 1UCWA 3O6DA 5AC4A 1H1ZA 1MW3A 3WUFA 5LNUA 3ABZA 4IIEA 4CCDA 3G6MA 1ZJIA 1UPPA 4W9TA 1UJQA 1YDOA 4NNCA 4HSOA 3W2MA 3UCDA 1EOMA 4LOCA 3LNPA 4R3UA 1UBSA 3CT7A 1JI2A 4ATWA 1SMAA 4TQTA 3G1AA 4GUFA 3UU0A 5A6LA 5I06A 3OA5A 1SPQA 3A23A 4MAZA 5I78A 4DAIA 3W7JA 5JU6A 2VC6A 3R8GA 1ECQA 1KRBC 1TZZA 4FX7A 2V5BA 1K9FA 1PX3A 3SB0A 2G96A 2FJKA 1V02E 2GL5A 2Y62A 3SI9A 4WDWA 2Y6ZA 3EMZA 4IISA 1B3ZA 2BY3A 4IFKA 4O1DA 3LQGA 4GXMA 4JTEA 4JKKA 1L8NA 4H7CA 1W1YA 2PCEA 2YDAA 1LWIA 1EBGA 2V5LA 3VUSA 2Z7KA 1BG4A 1QI0A 1FWAC 5EU9A 2PDWA 2XINA 3B0VC 2HNEA 3TXZA 4GC3A 4A2SA 3RCYA 5BCAA 1L6GA 2NQZA 4IL0A 2Q3RA 2YLLA 1W3JA 4JTSA 4LC6A 3EAUA 4N4PA 4E6MA 4QM1A 4L56A 4M7TA 4PUJA 4B5SA 1QATA 3EWWA 3U5YA 1LL4A 4ATLA 2NXGA 2E4TA 5A95A 1JUBA 4N9EA 3JRKA 1JZ4A 3CLWA 1VFLA 2E6FA 3ES8A 3QPYA 1AH4A 1CXEA 3B0YA 3NGJA 3A12A 3C0JA 3AHYA 3EOLA 3W24A 1ZHAA 5HNNA 2EKGA 1O1HA 3NQDA 3GG7A 2VVSA 1T7LA 2YZRA 2J88A 5IFPA 1JG9A 3B9AA 4C5ZA 1Z9AA 1NFPA 3N15A 4TX6A 3JUGA 1R6WA 1EGZA 2C3ZA 2V3FA 3B06A 3BCFA 1J5SA 1P0EA 1OCQA 1UP0A 1KBJA 1QU4A 1S3HA 3ZOAA 2Q8ZA 2VKZG 1G67A 3LCHA 2ZZ7A 1JXJA 3GDBA 1W3TA 4RK8A 1V51A 1AD4A 2NWSA 2LLEA 2HBXA 4JN6A 2YCLA 4O57A 1LQAA 5G4WA 3VNYA 2ZWYA 4ZR8A 1JZ3A 4YU1A 4DZ5A 1BYAA 2W27A 2X1UA 1LOSA 3AOFA 1U1HA 2O0TA 4NUWA 2JGYA 5A6AA 2AGKA 3WIJA 1E0WA 1GEHA 1OC5A 1P48A 3RNDA 4OECA 3NZ1A 1E71M 1Q6CA 2PODA 5FJTA 2VFFA 1BWVA 1XYCA 2WSKA 2VEPA 3NOYA 1IT0A 3NEVA 4XKYB 1V93A 5I02A 5CZJA 1HVQA 1M6JA 3QY6A 2E8ZA 4GYPC 3CGTA 1B90A 1AH3A 3RGTA 2QCHA 3D3AA 1VBHA 4ROQA 4GUIA 3M41A 2PDNA 2EQDA 3EDEA 3L5LA 4IT1A 5EBAA 1LZOA 4O1BA 3ES7A 3MZ2A 1BHGA 2VFGA 1O5XA 3CT2A 3AS2A 1QT1A 2J9XA 3WQOA 2Z26A 4Z42C 2O4MA 2WSRA 3S2CA 4J2PA 5DMMA 3YPIA 3W3OA 2WM1A 3W7QA 3SIMA 1PTAA 1WXZA 1NOFA 4AX7A 3AAMA 5DBTA 4LCSA 1QXLA 1KXTA 5ABHA 3QBUA 4NAFB 4CNSA 1SYTA 1GOQA 3BG9A 1FRBA 2XIQA 4WR3A 1Q65A 2ZX7A 3DFOA 4GGHA 4C7FA 3N4EA 2F6KA 3QMTA 2I17A 3R0DA 3ABSA 3IIVA 3PAJA 3C5QA 1TR1A 5CEWA 4PTMA 1MEHA 4MMWA 2POZA 1XKJA 4XD4A 4GVFA 4ZA0A 4DVOA 3G0XA 4HN8A 1QK2A 1GKPA 3P5ZA 4K8GA 3QYSA 3NDOA 1Y5XA 2ZRZA 4DUVA 3BLOA 4HYVA 1UG6A 4MJ2A 1X8FA 4QJ5B 3VNIA 3NQ2A 1FH7A 5A69A 1EL3A 4MWAA 4G7EB 2VMFA 4GYKA 5HA7A 3A47A 1GZ1A 1P0BA 2YBVA 5CGQA 5FKYA 4FIRA 2D73A 5D03A 4CN1A 2V69A 1OZQA 1QO2A 1RHCA 3SJ3A 2V3GA 1UUQA 1JR1A 4G7EA 1BPLB 2Z6IA 3MJMA 3CQIA 4MUZA 5AHFA 3W7HA 1P5BA 3HQOA 4HU3A 1M41A 4OVXA 2F2KA 3T07A 4ADSA 4DM1A 1Q45A 5KINA 4UNLA 7CGTA 2G3FA 4AFYA 5CBIA 2VEIA 1B57A 1XIHA 4R85A 1U5VA 4QE5A 1VHCA 5BMWA 1MFUA 1EFZA 3CK5A 4ZQRA 4KGJA 2IQDA 4WGXA 5IFTA 1ZGDA 3STFA 1H4PA 2QJMA 1PX8A 4FS9A 3VD9A 3CV6A 3FCPA 3AU2A 2Z4GA 2XM2A 1PIFA 3KBWA 1TPVA 2WC3A 4UOZA 2QEZA 3MDUA 4JX6A 4TXEA 3CTTA 4WK9A 5CPOA 1TPFA 1TTQA 3TE9A 4XB3A 2I1OA 4L1XA 1SJDA 3BOXA 2DZWA 1IZKA 5BZAA 1GQLA 3PANA 3AIEA 3N4FA 3O16A 2QUMA 4LVBA 4FF7A 1P0NA 3B9DA 4JTCA 1NIUA 1ODUA 2UBPC 3S9ZA 3S2NA 4J1OA 4O53A 3QHOA 4MOZA 2OOFA 3OYXA 1K8ZA 2FGBA 1Q2SA 4DJEA 1B3WA 1SSDA 3O3RA 2H90A 3LN3A 3LG3A 2AL2B 1HL2A 3IUHA 3URNA 4O54A 1VBRA 2YOCA 4KMQA 4C6IA 1TREA 1C9DA 3EX3A 1CXKA 1UH2A 5HWMA 4RE0A 4BFAA 3BAWA 3JW7A 1G4TA 3ZT7A 2O9TA 5KZ6A 3DN5A 4A8IA 3T78A 3VE9A 4OHQA 2NWRA 1OX5A 4MKSA 4UUIA 4Q4RA 2YL6A 4KFNA 4S3EA 2GPTA 3MTWA 2GQ3A 1N55A 2AL2A 4QIUA 4IQLA 4KEVA 2Z27A 3LCLA 4BQ3A 4K3ZA 3UJSA 3GIPA 2VZSA 3FGCA 3SCWA 3O2LA 3ANVA 4YTTA 3F2DA 3P82A 3PR2A 3L21A 3MI2A 4GGBA 5KZEA 3PG9A 3N2BA 3MV01 2EBNA 4NJJA 4ZB2A 2WK2A 1F4HA 4Y6GA 2OLSA 4H6QA 5FAGA 1IZCA 2CLLA 3OLDA 3O05A 5EFDA 1XBZA 1DV7A 4GMEA 1K7FA 5I2UA 5JBEA 3CASA 1FP8A 1JDAA 1JNEA 3FAWA 5IHSA 3DG7A 4XD5A 1UC4A 1YXCA 2ZA3A 1XG3A 4LC8A 3BC9A 4PTNA 3L23A 4XAFA 2X1RA 1E9ZB 5HPOA 1DXEA 4MPQA 4G2DA 5FSDC 4DEFA 4AEOA 2FIQA 1RUSA 4GE8A 1TPUA 4INFA 2PGRA 4BKNA 2WJEA 3UPBA 3WH5A 2OX4A 1VFOA 3DEQA 1JZ6A 1JCTA 3SR7A 2E7FA 4PSPA 1E6PA 5C71A 1OC6A 3M0KA 5CC7A 3EWYA 4IF2A 4LV9A 4TOQA 3QHNA 4DYJA 3S1GA 4ZB5A 2D3NA 4EXBA 1W5NA 3GHRA 3C2YA 5FF3A 4H01A 2FZDA 5CPLA 4JHMA 1EJSC 4RE3A 5HQLA 1E3ZA 2WKGA 3UESA 5D8ZA 1IWBA 4IXXA 1UWUA 1XGDA 1DQUA 1EZ2A 4K38A 4WSKA 1Z8AA 2RJGA 1NVMA 4CD6A 4MF4A 3O07A 1D7FA 2QPXA 3N13A 5DX7A 3UA3A 1BGGA 3DFHA 3UXKA 5C9WA 4N02A 4NX0A 3HJZA 3N9SA 3SFKA 4J3XA 1KTBA 2O4QA 3QMRA 4GD0A 3R8HA 1WZMA 4AU0A 1WV2A 5BYWA 4OWGA 3VCCA 1QO5A 1SU5A 2C7FA 2R14A 2PWEA 5BOEA 1PEZA 3F03K 3CL7A 3I68A 1ZUAX 3IGXA 4HQVA 1FX6A 1KFEA 5A2CA 1DQXA 3TYEA 2HSAA 4H3DA 2HK0A 4JR5A 4W5ZA 3HPZA 5KETA 9XIMA 3AWOA 1BYCA 4Q8QA 4N9CA 4YVPA 3QW4B 2A85A 1TR9A 1V03A 4BF7A 1IT7A 3NR0A 4IIHA 4AYGA 1Q6DA 4P8VA 2IKIA 1VCGA 3TQ0A 1I2QA 3VKJA 3CC1A 4FA3A 4AY8A 5DCDA 1J12A 3EPNA 2CPUA 3E6EA 2PDCA 4WHBA 1F3WA 4A4AA 1KGUA 2QVNA 4PUMA 4PMXA 3TNBA 1W9UA 1E4LA 2ODOA 1WO2A 1BVZA 5FJJA 5E70A 1G4EA 1O6IA 3D47A 4FXJA 4UCFA 1H62A 1R46A 1H51A 3FVDA 2PAJA 1J2WA 4KWSA 1UQYA 3C4UA 3LBMA 3G1VA 2FQIA 1Y0EA 2XHYA 2GUYA 3CAWA 4L4PA 5MF5A 2TSYA 1YE4A 3LPOA 3W26A 5C7VA 5G1MA 5HJLA 3TTOA 4S23A 4LAMA 3GFXA 3W1MA 1AODA 4E2VA 1S38A 2A0NA 4BQ2A 1AMKA 1XG4A 3GNRA 4DUOA 3S1VA 1HKMA 1CGVA 3ITLA 3UWWA 3C0LA 4Q3MA 5E0FA 3LQLA 4QEEA 4GKLA 5GPRA 1C7TA 1U22A 3T09A 3VZYA 4XSLA 2ALDA 4O8AA 3OZYA 4L6OA 4Y2WA 4BQ5A 3TIMA 4GUJA 3S1XA 4HOZA 1UZ1A 1E9LA 4BY3A 2QKFA 1X6LA 1YE6A 3BV4A 4FNQA 1RK5A 5GNXA 4DJED 1H7PA 2V2DA 2DVUA 1XIIA 2I5IA 5DQPA 2BV9A 3PUOA 4MADA 2TAAA 4JTIA 4LSBA 4O14A 1YBQB 2EPKX 4JTGA 3IEBA 3MI6A 3EWCA 1Q6OA 3DBNA 5DN1A 3F5LA 1U2YA 4IX0A 5A3HA 2Q6ZA 2GOUA 2YDRA 1MXDA 2G37A 3DH7A 1TJPA 1W0MA 3EWDA 1DBTA 4MPKA 2HE5A 4S3JA 3V1PA 5SWUA 2YLAA 3PZQA 3F4WA 3SBFA 1MZHA 3GVQA 3PN8A 3IJ6A 2X8RA 1FWSA 2D2GA 1UKSA 2HMCA 3E02A 3CZGA 4MKNA 3WX7A 3WQ6A 1FXQA 1EO7A 3L4XA 1KWKA 1GORA 4YN5A 1RCXB 4ZB0A 1XPGA 1EUNA 1Q3NA 1QNPA 1UROA 1BSLA 3RMJA 1XLMA 2I56A 3CTLA 1EH9A 3LV5A 1PJ9A 4D8ZA 2PTXA 5CLWA 3MO4A 3LPGA 4OOZA 4UTTC 1A5BA 1X7IA 1W3KA 2WCGA 5T8GA 1XDMA 1S39A 1GQIA 3RJXA 2PMQA 3AXMA 1UD4A 3LSCA 1KBKA 3HA1A 2E6DA 5D2VA 2J47A 4ZL1A 5AYXA 4FMVA 3II1A 3WMSA 6A3HA 2Z7GA 1I1XA 4HP5A 4IP4A 3EEZA 2EGZA 5DBUA 1DJXA 5FF7A 4L65A 5BWFA 2C0HA 1JDFA 4UTMA 3GXIA 4DZAA 3FSTA 3SAZA 3PNZA 1A0EA 5AYZA 4ATDA 1EGVA 3PB2A 2REQA 1J8VA 4YVVA 2DSZA 1XKYA 3UGVA 3BLIA 3GBDA 4NZ4A 1UWAA 4UTLA 4TMCA 4Y9MA 4US5A 3CZKA 5EMYA 2Z2UA 1PDYA 3HN3A 3G3MA 1VEPA 3TJLA 4UOJA 5G2WA 2I7GA 4OT7A 1PX4A 4JN7A 2HDJA 3HGRA 1W9PA 3UR5A 1QPKA 3B05A 4J28A 3OGVA 1GWJA 3VDCA 2R1MA 4YTRA 2PWDA 3W87A 1RY0A 3S2LA 2V3EA 4XTDA 4L6HA 4HZ7A 4M6QA 4UR9A 5IOBA 3SFWA 1SVDA 3W2LA 1S2WA 2Y88A 1LWJA 3W37A 2OO0A 1JRCA 1TKKA 3FS2A 1XH1A 4J4KA 4KEUA 3WJZA 2YCEA 1GVSA 3UNDA 3CZEA 3TC3A 4FK9A 3P2VA 4BS0A 4RW3A 3QVQA 1TZ7A 4HU0A 2QUNA 4PFMA 5KMYA 3CWHA 1GQJA 1XYLA 4S3FA 4GLEA 3AMCA 2BY1A 3KL5A 3LY0A 4KQNA 4BEUA 3PZNA 3UCCA 2WC4A 1MXSA 3L68A 3MANA 4YLWA 3WLLA 3W75A 1W1B1 3WEMA 1G6CA 4MAVA 3S3GA 1H09A 2B4GA 3SUWA 4L7ZA 3TC6A 4H9MA 1MRQA 5MHBA 1QTWA 3GIQA 5CZTA 4X2RA 2PGFA 4I7WA 1VP5A 3WEZA 1T5AA 2YXOA 4UCGA 3CQKA 1LORA 3BURA 3ZYZA 1BYBA 3GTNA 3FEMA 3BGAA 4MJZA 3RILA 2NV1A 3QKEA 2RHGA 3VE7A 3BCDA 1MW2A 2QPSA 4I7VA 2XIBA 3H55A 4WSJA 1KKRA 1YKWA 4JFVA 3WBAA 2GGIA 4MY1A 2CCRA 1UH4A 4AD2A 2POTA 1NU5A 1Q5MA 3ARTA 4ORIA 1ZQ5A 4PB3A 1EJTC 3UJEA 3GAYA 1XYAA 5FF2A 3UETA 4XSMA 3STEA 2WZTA 5B7YA 1KRAC 1JD7A 5LXXA 4J3VA 1PYMA 2CIPA 4W8AA 5C2CA 3QGVA 1PCKA 2VX6A 2O9PA 5HWNA 1R3VA 4PUDA 1O7AA 2XSXA 3URBA 3AIWA 3O1NA 5EKYA 1VYPX 4LAOA 3WD2A 1LTDA 5M2FX 3GDMA 3L67A 5LZLA 1V6XA 1UR0A 4XBJA 1F4AA 2QJHA 4JS3A 4NF7A 4S3DA 3MU7A 2W66A 2QF8A 1PTDA 1TJRA 3R2GA 2Y5SA 3A21A 4LEQA 3GVRA 3U6WA 1EC7A 3GTXA 3LCWA 3TW6A 4ZMGA 4ERIA 3HV8A 1LT8A 1C8VA 4MZ1A 1V6WA 4HA3A 3NVDA 1QASA 4ZFCA 4LXFA 1MRAA 1EQCA 3CUFA 2BODX 1FHDA 1Q4NX 4LV4A 4F3HA 3VGEA 1LP6A 1RH9A 3O6CA 3FJLA 3WLKX 1X97A 1V0LA 3SGZA 3E3HA 4WJEA 4Q8NA 1ZNNA 4UIOA 4ZCWA 3K8KA 2OZ8A 1QW9A 1UD6A 4C6DA 1K1DA 1TQJA 1E1CA 3I6RA 4BHYA 4V1YA 3P7YA 4HGXA 1TTIA 1VJSA 6ENLA 2ALRA 2CW6A 2J7FA 3PZTA 2F6UA 2DVTA 4TMBA 3VA8A 4HK7A 2CHNA 2XVGA 3NYZA 2CLMA 4UFKA 3HGOA 2YIHA 5CSYA 5EBUA 4H6KA 2OOGA 3ABQA 4XK2A 3MC5A 4S3CA 2FB2A 3NIYA 4AISA 2X0HA 1POKA 1QPOA 1ITQA 1J01A 4A05A 1DP0A 4HCHA 1AQFA 3LA4A 4V15A 1R47A 2XFWA 2WZMA 2DPEA 3ELFA 3S46A 1PL9A 4RZBA 4KRTA 3N6HA 3NPUA 4EPDC 3O63A 1TMLA 1S5VA 3IRDA 3RLVA 3F2CA 1NP0A 5GJNA 4IXHA 5I7GA 3IJ9A 4EKJA 3LBOA 2GVLA 4NIRA 2IPGA 1WZAA 1SO6A 2QGHA 2Y8KA 2IKHA 2ISWA 2CLOA 2PDQA 4E3VA 1F5ZA 4H6RA 1KM6A 5FJRA 3RX2A 3VGGA 1XYBA 3GO2A 1IHIA 3QQWA 3KVKA 3W1AA 1ZCCA 2H6RA 2A5HA 1G69A 4H2HA 4MFDA 2BG5A 2DT2A 3REQB 1TRDA 4O0ZA 1VAHA 1YQ2A 1ZBVA 2VXNA 2YA1A 2OB3A 1OYAA 5TNVA 1D8WA 3RHGA 2G4FA 3LRKA 2GJRA 4AD5A 3IVSA 1HQTA 4KGLA 4R9XA 2NVCA 4ZQMA 3AISA 1OG0A 1ENUA 1JIBA 2WWCA 1B54A 2H8ZA 3LHZA 1E5NA 1EGMA 3IS4A 4JTUA 1O95A 2WC7A 4LU0A 2ZZ4A 3S42A 1JPHA 3W7EA 5BU6A 4L80A 3LCFA 3BLKA 3WELA 2FPVA 1TJ2A 4GI6A 5C5YA 3GNNA 4C1LA 3DG6A 4DWSA 1C8QA 1JEZA 4KKXA 4HHMA 1QHOA 3L4TA 4IH3A 3VZXA 4XZLX 3WH8A 4S39A 4LBRA 4C1NA 3LD5A 4C6BA 4O8RA 4ZSUA 3LI0A 2C18A 4HNUA 3P5YA 2X1TA 4JZ5A 3SY5A 1WUEA 4JL2A 2FGZA 1TV5A 5GNZA 4DWSC 1JCMP 1YTDA 2IKGA 1J0IA 2NX1A 5ECUA 2P1FA 1XH0A 2V30A 3NQBA 3W1NA 3VIMA 3D5HA 4I8YA 2ZICA 4JTLA 3WNPA 2PGEA 1B4KA 3NPVA 3NQEA 2G5WA 3MUY1 3TQVA 2B7QA 3T40A 3WMBA 4HZ6A 2WAGA 4CQCA 4M24A 3CPUA 2IQ0A 3WFAA 1FOBA 4Y9AA 4FAMA 2J74A 3ID7A 1PKNA 4HHPA 2ATSA 4I90A 5AZ0A 3GC2A 2GK1B 1XLDA 2Y8VA 2EJAA 3A4AA 3E49A 3MUXA 4PODA 3TMQA 3WQWA 1LDCA 4GIAA 4WVXA 4AG0A 4FZIA 1UP2A 1KV8A 2OPJA 3GHTA 4B92A 3HGSA 4H9VA 4Z1YA 3MKKA 4WEVX 2ZVRA 1W1TA 4KWWA 4KT2A 4K8HA 5CGMA 3PJTA 2GK1A 1VZWA 3POCA 3AMGA 4P8UA 3AIRA 4QS5A 1W9VA 2W5FA 3W6LA 4G5DA 4PBEA 1ZBCA 4BI5A 5HR7A 3FDKA 1V3JA 2DZUA 1DPMA 1H7OA 2SFPA 4H19A 1KQYA 5DMLA 1KM0A 2ZXBA 1XIEA 1PKMA 4IMFA 2HISA 4W84A 3WD0A 1D8CA 4JKMA 4LVAA 4XZNX 2PUZA 4TVUA 2PURA 3TK7A 1HGWA 3GNOA 2YCJA 3CUIA 3WD1A 1MUCA 2VCCA 4U2YA 1V77A 2INZA 1TPWA 3EB3A 2WKJA 5AYYA 5CCZA 1QAPA 3MHGA 3T0CA 3U4AA 4ECLA 1EUAA 4XZIA 3M0VA 3W53A 3EB2A 4D6FA 3SN4A 3GDRA 3ANUA 5EMJA 3HQ1A 4UTHA 4D1JA 2CXGA 1ZTVA 3CMGA 4PTDA 4O1FA 4IQJA 2ZUSA 1CWYA 3EPMA 3ENLA 3W1QA 3V16A 4X61A 3LPFA 3VILA 1XSKA 2GJPA 1JDCA 3GXDA 2GJLA 4HNLA 2PPGA 3KBVA 4NJHA 5CPNA 4IP7A 5G2IA 3S1WA 1Y5WA 2DGAA 4UTWA 3CZLA 4NZJA 4ZE5A 1KW1A 4OBTA 4OBSA 3ZFHA 2Y85A 2BXVA 4YVXA 1GT8A 4P8XA 4PUNA 4YS1A 5EA9A 5J5DA 5AVHA 3TKFA 3MYPA 1A49A 2R8WA 4IUGA 4AX6A 2QNEA 1FQ0A 3D3FA 4F40A 3KUMA 2X7VA 3MHUA 4D6IA 3UXDA 3A4WA 3KVLA 2D3LA 2CU0A 1HGYA 1M7XA 3GNPA 3AZRA 4JHZA 3CV7A 2BS9A 1XHGA 6PTDA 2OKOA 3SZ8A 3CQJA 3W85A 5IXEA 5U4NA 2YYUA 1CCWB 1I2RA 4XO7A 2VVNA 3KW3A 2OZ3A 4HU4A 3V0SA 3N2XA 2YCIX 2E1WA 4YTQA 1CYGA 1VPYA 1MZRA 2GZXA 3B40A 3VIJA 2CESA 1LJYA 2HEJA 1A4MA 5G1TA 1GOWA 1OY0A 3T7VA 1J0YA 4RXGA 2YZ5A 3EXRA 6XIAA 3EPOA 4RL3A 3WUBA 1XYMA 3ARQA 3D46A 2JKEA 2GUUA 4S3GA 4ZOBA 4PTVA 3VDBA 4R53A 2VGBA 5H8MA 4PBFA 4MY9A 1MNZA 1UKOA 1GVIA 3KBSA 1KR1A 3O6AA 1Z48A 1XRFA 4PRRA 3M0MA 2FZMA 3T1GA 2R6OA 2OQHA 3CHEA 1UR3M 3UR2A 1SR0A 4HMDA 1OM0A 4R27A 3AIVA 1OK4A 3OTRA 2E5BA 3W2NA 4IGMA 4NZ5A 2XPKA 1S5WA 3TONA 3CUJA 1DYSA 5I3KA 2C1HA 4ZQNA 1SZFA 1V6TA 3MUZ1 3NYDA 2BVYA 5M1TA 1QPQA 3MS8A 2CEQA 1S1RA 4DF0A 4PL2A 4GI8A 1TCDA 4ZQOA 2PDJA 2DZPA 3MP5A 4JXCA 3WLRA 4C6MA 3BWWA 3URAA 3CPRA 4CD5A 5CPSA 3SCSA 4DZIA 2QMJA 4EAYA 1W37A 2GJXB 4WJ8A 3THDA 4GKTA 4UOQA 3FJ4A 5BROA 1V3KA 4LB3A 3U57A 5M3WA 2DH3A 3IGUA 3UVIA 4GH1A 3VDGA 4B2DA 1GK8A 2OKTA 1F6PA 3TYUA 3FFSA 4QG9A 1Z42A 1ZALA 3DC8A 3P61A 5EY5A 1X6UA 1FHUA 4PH6A 3BG5A 1RVKA 2W67A 4WF7A 3LMYA 2VQTA 2Y7DA 4DBEA 1UOKA 5HNUA 4FLQA 1IV8A 4HNOA 1CLVA 4H9UA 1GHRA 2XM1A 3J7HA 3ZSSA 3GH7A 1DTUA 2TMDA 3B8SA 1KFWA 3QZ6A 2Y7GA 4MIMA 2H3DA 2AKMA 1B5TA 1TA3B 2DSVA 5BRQA 1P6BA 3G8EA 1HJXA 1SMDA 2VRKA 3FKKA 3HV9A 1NTHA 1TVLA 2QDHA 1JAKA 4PUEA 4YCPA 1JGIA 4DJDA 4PCSA 1HVXA 3CAVA 3VZZA 1X98A 2GUBA 2F7FA 3PJXA 4HCDA 1TA3A 4E8CA 3HPAA 4QP0A 1AG1O 2A79A 3WSUA 1JYVA 2HNHA 3TR9A 4E3TA 1XBVA 2Q02A 2A7PA 4DUWA 1D2KA 1EDTA 5XINA 4H8UA 4YTUA