1EZWA

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
347
structure length
347
Chain Sequence
AEVSFGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDWISGGRAIIGMGPGDKATFDKMGLPFPCKIPIWNPEAEDEVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVKARSIQGSDIPFYMGAQGPIMLKTAGEIANGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEATKIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIGKGDFGTAIGLVDEDMIEAFSIAGDPDTVVDKIEELLKAGVTQVVVGSPIGPDKEKAIELVGQEVIPHFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
total genus 128
structure length 347
sequence length 347
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1ezwA00
1LUCA 2I7GA 5AECA 1NQKA 1NFPA 1XKJA 1FVPA 3B9NA 3B4YA 1F07A 4J2PA 5LXEA 3B9OA 1BSLA 3FGCA 5DQPA 1LUCB 3FGCB 3SDOA 2B81A 3RAOA 1TVLA 1BRLA 4US5D 3C8NA 1M41A 1RHCA 1BRLB 1Z69A 4UWMA 1EZWA 1YW1A 4US5A
chains in the Genus database with same CATH superfamily
1QBBA 1V77A 1U5VA 4Q7NA 2E6FA 4JIIX 3ICJA 3BANA 4FNRA 3NUKA 3IUHA 3MP5A 4MNKA 1MRQA 1R3VA 3WY1A 4FIQA 1JQXA 3WX7A 3F2CA 5HUPA 3CMGA 4Z2GA 3RM8A 1JCLA 2J88A 4MB1A 1DKWA 4E3VA 1PAMA 1AZ2A 3LENA 4O54A 4C6PA 4UTHA 2OJPA 1T41A 1HP5A 2WCSA 3LPFA 3ZYZA 1HJXA 3NOEA 3EX2A 1X38A 2AKZA 1XG3A 1MXSA 3LRMA 4O4VA 1YHTA 3VIGA 2WNZA 4S3AA 1EOMA 1PX8A 4M5PA 4H9MA 3W7GA 1FHVA 3QY8A 1JCMP 5FJTA 3UY7A 4H3DA 1TR9A 1EBHA 3VDBA 2DZXA 3VKJA 1GOOA 2PWFA 4DJFA 2J7EA 1LRTA 3IGSA 1OIMA 5E0CA 4IG2B 2E9MA 1ME7A 4J3ZA 4J3XA 4ZZ9A 3L2LA 9RUBA 1XH2A 1XFBA 4I6VA 4OQVA 1EP3A 3SAZA 1W1B1 5HNTA 6XIAA 3H55A 2Y63A 4AXKA 5J5RA 4J3UA 4H9UA 3OLIA 1VJSA 4LUSB 5KETA 1YADA 2HVOA 4AC1X 3WJZA 2V3GA 1GONA 2Z6IA 2XH4A 3QR0A 3NOYA 1E6QM 1V8EA 4DEFA 2QCEA 5CSSA 3S8HA 3N11A 4HU4A 3SADA 1UPMB 3AUOA 4YNGA 3SI9A 4S3DA 2RFGA 2PI6A 1EC8A 3N04A 4L64A 4L7ZA 4MPQA 3GXMA 1XYMA 4L6OA 1TVNA 2VO5A 4XD6A 1MUMA 5CGTA 4C5YA 3G6MA 1NF7A 2Y24A 1H3GA 1L6FA 1E0VA 3L2MA 3QZ6A 4R53A 2Z0IA 3WSUA 3OEXA 3HQ1A 1ZCCA 4X22A 2A0NA 3IIXA 4EPEC 1IXOA 2ZRZA 3PF3A 4NNCA 5JH2A 1DPMA 4F2TA 4G7EB 2C16A 2WNQA 1Z3NA 5IRPA 4RLIA 3SQSA 1B31A 4LYKA 1ONXA 4HBKA 4WOZA 3JW7A 1WDQA 3UVAA 2XN2A 2X0YA 3LV6A 1AMKA 3DKLA 3GBDA 2JK2A 2UY2A 3SO7A 1EJSC 3GYCA 3GVGA 3GM8A 4QDMA 4KBXA 3W7JA 4Q3MA 1W0MA 5ABGA 1XRTA 4WRHA 3EWWA 3GTIA 3N6JA 4IFRA 4KWSA 2WSKA 3WNPA 2YXXA 1CGWA 3MMTA 1I1XA 4IPIA 4H9VA 4CNSA 4O57A 3OGVA 1KFCA 4HD5A 2CLPA 3PUEA 4GQ0A 2XUCA 1CXEA 4PEKA 4KS0A 1XLGA 4LW7A 3P0WA 5D8WA 2RUSA 1W3HA 1OT1A 4QTGA 3I3BA 5L6UA 2D24A 3M0MA 2C14A 2YDSA 4LPCA 5HMSA 2A3HA 3UPBA 4L9YA 3NQFA 1M68A 3RM4A 3L4UA 4D6FA 2AGKA 2XIBA 3W85A 2OEJA 2QW5A 1K1DA 3DZ1A 3W75A 5TNVA 4PMVA 4LBRA 4J4KA 2OWWA 1FWBC 3IUIA 2V82A 4FOJA 2FPYA 3DXIA 4B3LA 2G3MA 4WXYA 3SCRA 2TSYA 2XGZA 1EEPA 3G1VA 1E9LA 3NQMA 4XG1A 2OLHA 5MHBA 4NX0A 4MKNA 3KXQA 3N9KA 3GW3A 3E0LA 4JHMA 3PZTA 4JTUA 3WLSA 3WDIA 4WY0B 3W86A 2ZX5A 4F2BA 1AW1A 5FD0A 3B03A 1A5BA 2VUYA 1YKWA 4C1NA 3WK3A 3URQA 4FXFA 1DL3A 3SJ3A 3VNIA 1SW3A 1O60A 3H26A 4JNZA 3UCQA 4C91A 4GPNA 1MVYA 3VNMA 3YPIA 3MI2A 4TU1A 1ZHAA 2HVNA 1H0GA 1OG0A 4RL3A 4JIHA 3C0SA 4LRSA 3W71A 2XHYA 3NURA 2OSWA 5AVNA 4HMEA 1S2UA 3R0UA 2PRHA 1W3TA 5LSMA 2NUXA 1NQ6A 1M7OA 3KWXA 4AVFA 4DF2A 3P6LA 3WF3A 5JQ9A 4CNNA 2PFHA 2WWCA 3OGSA 2XWDA 3QQ1A 4R7WA 1QI5A 4QLJA 1ZZMA 1BRLA 1X98A 1C8YA 1HT6A 5D32A 1M1BA 1F7BA 5A95A 5C9RA 3WCZA 4JTEA 1FKWA 4NIRA 4DO4A 4YN5A 2GSEA 1GQLA 4JTFA 2EAWA 1E6PA 2GUUA 3FKKA 4QSFA 5FJJA 1EEXA 4TV6A 1EPVA 4E6MA 1O7AA 1LUCA 3SRFA 3PP7A 5CZSA 3FJLA 2Z27A 3W1PA 1AVAA 3S1GA 4FALA 3ELFA 1KFLA 1KBLA 3NEVA 3PJWA 4YHEA 1PWLA 3EOUA 4J1OA 5FJRA 3QC0A 1X96A 1XLFA 2REQB 4YTRA 2E5CA 3CUHA 1QI0A 2PBOA 5HUOA 4TMCA 2ZUMA 4E8GA 1THFD 1XBVA 3CZKA 3U7BA 2WC7A 1XUZA 5BU6A 3N2CA 2GGHA 2C19A 1NOWA 1YX1A 4FNQA 3DFSA 2E3ZA 4KIEA 1ONWA 4P7OA 3TTSA 1Q7MA 5C7HA 1OZQA 2Y89A 4F3HA 1UR4A 2BOEX 4HMCA 4Z1CA 3TONA 4TX8A 2TRSA 4YWIA 3MKCA 2YFOA 1FWEC 2GWGA 1BWLA 3VCRA 3E96A 4WK9A 1F05A 3GTFA 1SZFA 1W1IE 3CTLA 3IACA 4E2VA 3BAIA 1HTIA 4NZ5A 4K6AA 1RA5A 3WLOA 4HYWA 3S2JA 5D04C 1REQB 5H1WA 2DZAA 4N02A 5EBUA 4EWJA 1A3WA 1JF6A 3BMXA 3N1AA 1JRCA 1VAHA 1G5AA 4QG8A 5CKSA 3PTMA 5FF3A 3DHUA 2YYTA 1TPDA 2VFDA 3ITTA 3GHRA 2QNEA 1KKOA 4MADA 1UP2A 1I75A 4HJWA 5TD4A 2J75A 1UZ4A 3FAXA 4EVZA 5KZ6A 5EMLA 3H4GA 3VC5A 4GUFA 2RDUA 5F7UA 2AMGA 2GGJA 2DSZA 2BOGX 2XIOA 4M56A 5JXQA 4ES4A 4DZ5A 4LY8A 3BGJA 1KTNA 1Q6RA 4REQB 2QDHA 1EJTC 3P14A 4NJIA 1R9ZA 3AZRA 1YXDA 3TIMA 5A6MA 2NQHA 3B8TA 4PL1A 4RNFA 1DWIM 3W2KA 3MYPA 4FF7A 4ZTXA 3FIGA 5D8ZA 3VOJA 4BQ4A 3A3XA 1GOWA 3GDKA 3SIZA 5DXYA 2BGQA 4NJKA 4CU6A 7XIMA 3HG3A 3H8AA 5K2ZA 1LLOA 4NAEA 1KB3A 4QITA 2VEIA 3S9IA 4OZOA 3PBGA 3WD2A 4B5SA 1R9XA 2WZEA 5A8MA 5T26A 1OG6A 2G3IA 2TAAA 1RK6A 1HQTA 4FX8A 3IGUA 1T0OA 4P5UA 3FLUA 4D8LA 4HGXA 4Z08A 4PCNA 4FNPA 3TXVA 4I8YA 2PU1A 2V67A 4Q4KA 1U33A 3STPA 5AC6A 1Q6GA 1AQ0A 2WVVA 1KFWA 2AL2B 2GUBA 3I6TA 3IARA 3CIVA 4GZJA 2ZVIA 3DFQA 2X09A 2YCLA 4GI6A 3VIPA 1WP6A 1JZ2A 4K36A 4PODA 4DNMA 1A4MA 3CQJA 2EPNA 4YPJA 4LWWA 2ZUSA 5BOFA 3QZEA 3ABRA 5LGZA 3HN3A 3TEVA 4UQ9A 5ABTA 4JCMA 4LB4A 5FF2A 1I4NA 4GI8A 2QGHA 4JIPA 3HMJG 3QMTA 5EMJA 1K3UA 2E67A 2PDNA 3REQA 4Z0SA 4B2DA 1P0KA 3GXPA 4IP5A 4A8RA 4AY8A 2PP3A 3W2LA 1FCUA 4B5TA 2XTKA 2ZE0A 3CL7A 4CLMA 3T8LA 1E6RA 1K7FA 3BE7A 1GKPA 4GYPA 1JJKA 3RRAA 3UZXA 2XFFA 4UOJA 3LCWA 3BG3A 2OZTA 4ZB2A 5C5YA 3T2PA 3FHQA 2WJFA 3L66A 1XHGA 4S2BA 5EY5A 1Q2SA 1UC4A 4PMOA 4QJ1A 3RPTA 3GHSA 4LAOA 1GTEA 4W93A 5DX7A 4N4PA 4XAZA 1T8XA 3LPGA 4KEZA 4J9JA 1W91A 1Z6KA 1HO1A 1XCXA 4QS6A 2QJMA 3UERA 4CUCA 1ISZA 1FOBA 1F6KA 4O17A 3DN5A 1OGGA 1XYZA 4P2VA 4TUFA 2ADAA 1XC4A 1KFEA 2JKEA 3EWXA 1H49A 1YBQB 2PWDA 5EBAA 3D3FA 4CNUA 4LEQA 2ACSA 2CZEA 5IBXA 3T6CA 3PJTA 5LZLA 4O0ZA 4HU8A 5A6KA 1XM3A 3CO8A 5A8GA 1KCZA 3UJSA 1GW1A 2Z4GA 3RGTA 1AQMA 5FEPA 4ZCWA 2P8BA 4Q4RA 4YYCA 4LBSA 3AXXA 1QXLA 4MWAE 3WNNA 3BUVA 3NQCA 3A9BA 2Q3OA 3NZRA 3QPZA 1RLDA 2DT1A 2X41A 1ME8A 3E1F1 3PAJA 1L6WA 4FNUA 1RQEA 3CWNA 5DCEA 4HN4A 2PZNA 3KHDA 4ZQNA 3HV9A 2QDGA 2XH0A 3POCA 5H2ZA 3GYEA 3RO6A 2YXOA 4D6HA 4KEMA 1SVDA 3N2MA 5DELA 5D2VA 3PG9A 2G8ZA 4XKYB 2JBMA 4A3RA 1RBLA 2YDAA 4QM1A 1RJRA 3TW6A 3QSRA 1XD1A 3PTKA 4NP7A 3B8UA 2DP3A 2P3EA 2YOCA 2V2CA 3LHWA 3NSXA 3W1NA 5A6LA 3GH4A 2OKOA 4NJJA 1P4CA 3FA5A 3ORWA 3IJLA 3IVUA 4QRNA 2ATMA 3SCSA 4JQ3A 4PMJA 1S5TA 2HEJA 2O55A 3LZ5A 2X1TA 3VM5A 1OGSA 2IPJA 2Q09A 3D47A 1F4AA 5HMFA 3DCPA 4IH3A 1GVFA 3OB8A 3VIOA 3AZTA 3W1RA 1L2QA 4MFDA 4KGJA 1XV8A 1R3SA 3V3WA 2OYKA 4JAWA 4K39A 1L9WA 3VD5A 5IBXC 1PDYA 3UWUA 3ABSA 7CGTA 1IGWA 2WAGA 4DY1A 3TQ0A 3KTSA 1KKRA 3VOIA 3LYEA 3V1HA 4JNYA 1GYNA 3BMVA 1UBSA 3LSCA 4RZ4A 3TYEA 3RX3A 5BOOA 4MY1A 3ZSTA 5AYIA 1CXIA 1F07A 3HV8A 1FHDA 1SZGA 2ISFA 2YB1A 1QOQA 4GBUA 4IQEA 4W89A 3G1YA 4RE2A 1JDFA 1OFDA 1OWQA 1V0LA 1B2YA 2E8YA 3AHXA 3DBPA 1V0MA 4W5UA 1PKLA 4HSNA 8TIMA 3OLEA 3FXGA 1TV8A 4U2YA 4S39A 3VA8A 3ANUA 1CIUA 4XISA 1K6WA 3FNDA 1XBZA 1TWWA 4RV8A 2BMBA 5LXXA 4HNLA 4K38A 3TYZA 1CGXA 2XVKA 1MDLA 5DCBA 1YDYA 2V68A 3E2RA 2W5FA 3LS9A 1TTPA 4UTLA 4AVNA 4AC7C 3NAVA 1WBJA 2J77A 3U4FA 3SJNA 3HM7A 2VZUA 3SCWA 3B9NA 2WNNA 5HJLA 1QPKA 4MB3A 4WGXA 1B5TA 3MUXA 1GVQA 4J27A 2Q71A 3POHA 3S2CA 1IZCA 2P8CA 2BP1A 3DHPA 1S1PA 2YA0A 5BU9A 4CNTA 4H7VA 4LV9A 2HBVA 3I7QA 7ENLA 2IKJA 2FVLA 3T7VA 4C90A 5EA9A 3IGHX 4L9ZA 1TV5A 1OK4A 2OWCA 5JIPA 2VM8A 1VR6A 5FF0A 3L4YA 4PMDA 2ZX7A 5IFPA 1UKPA 4WD0A 2ALDA 3BV7A 1GEHA 1BYDA 2J78A 4WLCA 4ZO8A 2DSWA 1J93A 3FJ4A 1NP2A 3M0IA 4C6NA 1QMLA 1W9DM 3E49A 1W2VA 3W2NA 4L4MA 5AYYA 1CGUA 5I7GA 2WSYA 5AHNA 3WQEA 2QV4A 3U8GA 1XICA 2QJHA 4KMQA 1V08A 2BX7A 1W9VA 1TMLA 4LGXA 4AW7A 3TLQA 3VOCA 3UJFA 3RFAA 1FDJA 1PHQA 4PCSA 4HK7A 3A4XA 1HKJA 3RO8A 3H23A 4AVOA 2BLEA 3BW4A 3S0CA 1QI4A 3WK1A 4Y9NA 1TMHA 5I3FA 3Q4DA 4MJMA 1UP3A 3MMUA 1FY6A 3AS1A 4GBDA 1KXQA 5C2GA 3W72A 5A6BD 3UXIA 3UR2A 3UXAA 2CBJA 1VIZA 3AWNA 4PUNA 3NQBA 1A5LC 2WCGA 4W8AA 1PYFA 2HZGA 4PMQA 1JI2A 1QK2A 3W2UA 1EHNA 3B9AA 1L6YA 3NDYA 1L8PA 4AX6A 1AW5A 3CUZA 4JKKA 4XSLA 5LIYX 4GQQA 2OQLA 2WVSA 2DT2A 2ZYFA 3GSMA 1VPQA 3WLQA 3PZMA 1XGEA 2O9TA 1VFHA 4JX4A 4O52A 4A3QA 3SUVA 1GW9A 3LMYA 2YCIX 3ITYA 4F9JA 4PTVA 1GK8A 4CN6A 3W70A 4S2CA 4O18A 3AO0A 3NO5A 4WDTA 1E70M 4GUIA 2QZRA 4IFOA 3UXDA 3KBJA 3M41A 3P0XA 3AU2A 2JEPA 1CB7B 3A6OA 2E0PA 3PBMA 4L65A 1FHUA 3EOEA 3FA3A 3KX6A 3BJSA 4A2RA 3GAYA 3LI1A 1NSJA 4S3BA 2QUTA 4YVPA 5DMNA 5H8UA 2VEGA 2V81A 1W5PA 2J74A 1X6LA 4PRRA 1JXJA 4Q4PA 3WFZA 1GWJA 1ZENA 4QR6A 4PE8A 2BOFX 3T55A 1WE5A 3B06A 3R0KA 3E5BA 3E38A 5MKGB 4KEUA 5XINA 1MZRA 2WQPA 2FZBA 3GTHA 3LM3A 2E7FA 3THAA 1HXJA 2WJZA 3LK6A 1Z69A 1GOQA 4H4IA 3DKJA 3B8IA 4PUUA 3STCA 1TV4A 3OJGA 1CT5A 4V28A 1XQKA 1XJBA 3EOOA 2OO6A 4N4QA 4Q22A 4QROA 3T0TA 2XZ9A 4G7EA 3ZJ8A 1MQRA 1X97A 4P7QA 3QQ0A 1SM9A 3RN6A 3AMKA 2NUWA 1DJXA 1K02A 4I90A 2W27A 1ZBKA 3EA2A 1VHCA 2AOSA 1RXOB 2W66A 4UFIA 3VILA 5AHLA 2ZTJA 3U6WA 1H7PA 4HOXA 4AZGA 1S5WA 4XZ9A 3RU6A 1FWAC 4FAMA 1GG0A 4H6EA 2PDUA 2J8TA 4RXGA 2R1NA 1R9YA 4UR8A 1GNXA 4M6UA 3UT0A 2J27A 4AWEA 4P8UA 3R2GA 3TQPA 4I9TA 3CAWA 2VEFA 5C0QA 1B90A 3DECA 2FDSA 3S1VA 2XM1A 2VDHA 3UFYA 3MKVA 1LDCA 1DQUA 3VE7A 3DAQA 3TC7A 3RF9A 2NQ5A 3ZJ7A 2YL6A 2PWVA 3TZNA 5CC7A 5FEZA 1R0MA 1DVJA 4CQCA 1VS1A 4I9MA 2D0FA 2B31A 1DE6A 3BG5A 2GGIA 3ARSA 5I3JA 3RAOA 2PE4A 3UYCA 2P88A 2WB5A 3NDOA 1G7UA 4FO4A 2XDFA 1FQ0A 4E5TA 3WDJA 2D0HA 3IK2A 1WZLA 4IHCA 3HG5A 5EMYA 4PUWA 4HOWA 5CSUA 1RBAA 4NXKA 4C6MA 4Y6GA 3WD4A 2CHOA 4NRRA 1GKRA 3I6RA 3IJ6A 3UG3A 5IHSA 1E1CA 3C0QA 5F4WA 3R25A 2V6AA 3OG2A 3UW6A 1YE6A 3GHTA 1UB3A 4NQ1A 1HJVA 4PUMA 4UQBA 4D6CA 3UGRA 3THUA 2NT0A 2GQ3A 1K6AA 3OBKA 1M5WA 2HQAA 2P1FA 2EJAA 1M53A 1TJ1A 2TYSA 2I7GA 4OOZA 3GKFA 5CJNA 3MWAA 3OQ8A 2GDVA 4JKMA 1E43A 1C93A 2O9PA 3E0FA 3LGGA 4DF0A 8RUCA 4LU0A 3T05A 3U57A 1Y8BA 5FJIA 3H53A 1MQQA 3BLEA 3G24A 1IR2A 2QXWA 3W7MA 1DIDA 5HQMA 2ZC8A 3M1ZA 3PJUA 4ERAA 2V5BA 4MF4A 3GRIA 1N82A 1VQTA 4QAIA 3L4WA 3T07A 4XKYA 5TAOA 1X7IA 3RDKA 5A1AA 4H9XA 5HULA 3AC0A 4M6QA 1BVNP 1VFSA 1WUEA 5AHFA 4K2SA 3WF1A 1EJ7L 1QW7A 1SMDA 3TJXA 2FLIA 1ICSA 2B0MA 1C91A 5A94A 1FX6A 4KWUA 1A0DA 2ZA2A 1J01A 4CCDA 5ECUA 1TR1A 4XO7A 3NM3A 4ZQPA 3USZA 5CPTA 4EKJA 2PLMA 2CWNA 3VDHA 1DJQA 1V3IA 3VINA 3VGDA 1QWKA 3W9ZA 2RH9A 1WQ5A 4YS1A 1EJWC 3EOSA 1E56A 4OUEA 3TSBA 1RQHA 1HKVA 1A5OC 2VCAA 3LUTA 4J3VA 3GNOA 1FWWA 3WQ5A 1IF2A 3AZSA 1XPYA 1J6OA 3AIEA 1JUEA 5LIWX 1E5NA 1RY0A 2PDGA 4QJ5B 3E0VA 3CV1A 2I5GA 1JPIA 4X2RA 3QYQA 4QIUA 1J4EA 3TXZA 1O12A 1VFFA 3URBA 4C6IA 3H12A 2W79A 1KW1A 4RDWA 5LYRA 2WMFA 3ZSSA 1JZ8A 3QEZA 1UUMA 3FYYA 1JZ6A 1QNQA 2QUNA 2BY2A 3LCLA 4NASA 4HPHA 3AS2A 1OC5A 1V6XA 4GVIA 4DM2A 5D2XA 1WOBA 2VEMA 1LUCB 3BW3A 5AOUA 4DJDA 3K5XA 1TCMA 1WPCA 4I7WA 3Q45A 1TFVA 3R10A 4K37A 3RHGA 1EX5A 3NR0A 3V75A 4RJEA 2CITA 4BS0A 5D30A 1G69A 3WH6A 4DPQA 2B7NA 3BGGA 3VM7A 3TKFA 2QIWA 2WMIA 3DFTA 5F1UA 4QAWA 2A3LA 1KWKA 2WZHA 2CNCA 4GQRA 4AH7A 2ZRVA 2OYMA 6ENLA 4K1WA 4AHPA 1DJYA 4DBSA 5A8NA 3NSNA 4QBXA 1CXHA 3S2LA 4WX2A 3KRBA 3CZLA 3BTNA 4NU7A 4K8EA 2DZTA 1S3TC 2OXNA 3H70A 3GVWA 4HKPA 5REQB 3CMFA 4AZ7A 1UIOA 4DN1A 2WVTA 5D4YA 3UZYA 4IXHA 3QXBA 1F6YA 4X0NA 1WB0A 4LXFA 3HGRA 5C2CA 4XWUA 1OBAA 2BY0A 4Y9MA 1J79A 2FB2A 4PMUA 3GY1A 1O5KA 4B15A 1YDNA 3TW7A 5GNXA 3VGEA 5I09A 1UA3A 2ZZ2A 3P80A 1SR9A 3FDGA 3OLDA 5B7ZA 2NUYA 1X1ZA 2BVTA 3Q37A 3W4RA 4B4FA 3L67A 2J7BA 5M03A 1C7SA 3BARA 3W7OA 4R3UA 2EPHA 3EDDA 1XBXA 2QGYA 3PM6A 4DNHA 1LJYA 5E6ZA 3RITA 2VDGA 4LEFA 1H7NA 2A21A 4BI5A 3HQOA 3NCOA 2Z7GA 1XLBA 3G1FA 4ZO9A 3WUBA 5FEWA 4KW2A 1OINA 3ITGA 1D3GA 1EQPA 1F3EA 3ZZ1A 4IIHA 3ZR5A 4A3HA 2NLIA 4U3CA 3IIZA 1QUMA 4JQ2A 4UR7A 3M5VA 1T6MA 5K4XA 3NQDA 1KTCA 1WV2A 3LU2A 1V7YA 4GXPA 1UROA 1J5SA 3AROA 1N7KA 1OX5A 5FOOA 5IFTA 4MAZA 1UASA 5ABFB 2WHMA 5CC6A 3ES7A 3PUOA 2FJUB 3OZMA 3QQWA 1ML1A 1RA0A 4L4OA 2HPIA 1QR7A 2R1PA 3AIWA 3MJMA 2YZ5A 1WDWA 1XCWA 2PTXA 5JBEA 4DJFC 1DOSA 4JL2A 2DVXA 3G3MA 2P3ZA 1HJUA 3NQ6A 3AALA 2WQDA 1PS9A 1FH7A 1O66A 3GC5A 3TNBA 3G5EA 3OGRA 2A5HA 4PTNA 3GX9A 5FJOA 1SR0A 2HK1A 2VFIA 5DY3A 1Y5WA 1PHWA 5BWFA 2D3LA 2W9MA 2WO5A 1VBHA 3W74A 5A2AA 5C70A 3GDBA 2WMGA 5BYWA 4UQAA 2HWGA 3C6CA 2H90A 3F4WA 4EAMA 3ZIZA 1SUXA 1WZMA 2F6UA 5FA5A 3A24A 3PTDA 3MBDA 1HJWA 2R6OA 1RY8A 4EANA 3UZJA 3W07A 4GJIA 3SN1A 1F6PA 3L2IA 2CESA 3EXTA 2V2DA 1ZBCA 1CLVA 3OYXA 4H8NA 3AJXA 3FYPA 1NM9A 3F1QA 2QQ6A 3MZ2A 3PUGA 1Z8AA 1TTIA 3ARRA 4NZFA 3LCXA 1W3JA 1LT8A 6TAAA 3O6YX 5AN7A 4GACA 2EG6A 3SFWA 3SFKA 3CB3A 3RPDA 1QHPA 4DLFA 2BG5A 8XIMA 4GCXA 4J35A 4WJEA 3W02A 1M3UA 5IHRA 2ZC1A 2YA1A 4GYPC 1ADSA 3VZXA 1ITXA 4KCUA 3EZ4A 1H63A 2ZXBA 4DXKA 2ICSA 4LS0A 1SO5A 3GTXA 4K8GA 1HF6A 1QVBA 2FJKA 2PCEA 4AIBA 1XR2A 3WDHA 4CVWA 3FOKA 2WC4A 4UTMA 3TQVA 1YNQA 4HTBA 3S9ZA 2WKGA 1FRBA 4JDBA 3EWUA 9XIMA 3CC1A 5LNUA 5FESA 3ZVHB 1GQJA 1XLIA 1UD3A 3CH0A 3FX4A 3TYDA 1RALA 1NWTA 3TWAA 3SUWA 4F48A 3APYA 1YDVA 1H7WA 5CC3A 1LBFA 4MZYA 7TIMA 3UJRA 3UZ5A 3K8MA 5C6MA 3ABQA 2GVGA 2FHBA 2G4FA 2V9DA 4PTXA 1R85A 3ISIX 5BRBA 3VUSA 3CIXA 2DUAA 1IEXA 2WK2A 4P8VA 1XSKA 2MANA 1ITQA 4DXVA 2ZUVA 4LUTA 5EGRA 3U4AA 1KFKA 1AL8A 3NEHA 3AXMA 3P7YA 1I1WA 3I4EA 3WQDA 3DI1A 3GD6A 3GHUA 1C8VA 5DFAA 2VQUA 2WM1A 4GZ7A 3G0SA 2GQ9A 3MBFA 2A85A 3GXIA 4NHVA 3MQTA 3HTWA 1DIOA 3W26A 1TYGA 4H6RA 3BPWA 4ML4A 4QGCA 3U2EA 3NYZA 2WOQA 4HK6A 2VT0A 1BHGA 1IYXA 4XV0A 1EDTA 2B7PA 4RE3A 4PMZA 1PWMA 4TTUA 3N9SA 4L9XA 4FPSA 1DJNA 4JTLA 3LRKA 1JUBA 3W87A 1W1ZA 4GQBA 1PIFA 5DEZA 3C86A 3SUTA 1EWEA 2PDLA 2DDXA 3O63A 1DE5A 1WKEA 1VJZA 2H3BA 3KP1A 4GUGA 3CGTA 4XD5A 3ZLFA 2PLJA 4WJXA 1G1YA 4GK8A 4UR9A 3WQ6A 1TPH1 3QR1A 3DFPA 3HQPA 3TH6A 5A2CA 1PX3A 3FSUA 4E38A 4XVEA 3A12A 4LB3A 3I4KA 1UOZA 2ZDRA 1Q6EA 1GTHA 1NDVA 3BCDA 5E1QA 3AOFA 4NY2A 2CHNA 1H1NA 1MFVA 1J0KA 1ESWA 3KBVA 1IWPA 1R3RA 2PGWA 2NQ9A 1V3LA 4ZOAA 1PEZA 1U1HA 2A6NA 3LMZA 5FKYA 3WF2A 2J66A 2E5DA 3L0KA 5DQPA 3RYSA 3DYOA 1J96A 3C2YA 4GRSA 2QJNA 3DC8A 1VPYA 3CUFA 4TR9A 1NDWA 2PS2A 3W1XA 3K8LA 3OW1A 2H3DA 2A1YA 5A6BA 3K4WA 4CCZA 2QDEA 4RK8A 1D3CA 3KRZA 1WAUA 2XGBA 4G2DA 3IJ7A 4B92A 2NQJA 4LS2A 4C6JA 4ADUA 4WSJA 4OUIA 2VDIA 1RVKA 2Q8XA 1L6GA 2OCZA 3GBEA 5A5WA 5H91A 1QW8A 2VEKA 4D72A 4V2XA 4BQ3A 3QGKC 4BA0A 5LNSA 4GY7A 3STFA 2BHYA 3M0LA 1O5RA 1QBAA 2PDCA 3PZIA 3V35A 3W7HA 3UU0A 4N42A 3BQ6A 4BEUA 1XRSA 4S3FA 5I03A 3QVQA 1J0IA 4HMNA 1TV7A 3HIJA 1NF0A 4D9PA 4HVXA 5FIPA 1IQ8A 1FWRA 1JFXA 3BCFA 4H00A 2Y7EA 3BLLA 4WDUA 3SN0A 1A3XA 3E0IA 3MUAA 1NVMA 4W8BA 1TZZA 2I17A 1W9XA 1EC9A 2WNWA 3WMCA 1TPWA 1H51A 5HBFA 3FHAA 4LVAA 4FNTA 4JTGA 3LLXA 5JH1A 4BR1A 1C92A 2BVDA 1OT2A 1K77A 5FL1A 2DW6A 5HNRA 3FJ6A 2CC0A 4AX7A 1G01A 1VP5A 4IJRA 3KP0A 3CEPA 5M17A 4FP1A 3W28A 1DXEA 3S6TA 1PVNA 2CZFA 1V5XA 2ZDSA 2VCBA 3QGVA 1TE6A 1V3HA 2VGGA 1FWIC 3WLLA 2BGSA 4GY1A 1E72M 1KTBA 4IT1A 4A4AA 1E3ZA 4IJCA 2WSRA 4ZQOA 3PZVA 1J2BA 1GOMA 5CAKA 1X39A 3TYCA 2ZXAA 5LKYA 3AXKA 3IIVA 2GVLA 4B5VA 1PZ0A 4IIBA 1NP0A 5HWMA 1DJWA 4E3TA 2D23A 3W53A 1P6CA 1SSDA 4LAZA 2PB1A 4R9XA 3W1AA 2O4MA 1H61A 4HPGA 5AC5A 2BSLA 2DGAA 3TUUA 1LP6A 2W63A 3UWQA 3OG3A 2V5KA 4HNUA 3CZJA 3D0CA 5DCDA 4JR5A 5HOSA 2R24A 3TYUA 1GYLA 3MC5A 5JVLA 3VFLA 3IVSA 1BF2A 4XTIA 4E4UA 1GHSA 2I9EA 3W7LA 2Z00A 4DJED 3RLUA 4PB4A 4MFEA 2QULA 2OPJA 4BY3A 2F2KA 2OEMA 2EF9A 4J3TA 4ICMA 3EPOA 1FUYA 2Z1KA 4JQ1A 5HINA 1KXTA 1MEIA 3EDKA 4PRTA 3H4WA 1J6PA 2D22A 2QCCA 1T8QA 2CLKA 1HP4A 3T08A 3GUWA 3K8KA 2WMIB 2FH6A 4I8DA 3D6NA 4GG9A 1G4TA 3TNOA 4GIRA 3W1UA 4GVHA 3MSDA 4M0XA 3D5HA 1UR8A 3NM1A 3G2GA 4RV3A 3KS5A 3ANVA 1VENA 2EPLX 2WKLA 3B97A 4ML9A 4H8HA 1W3NA 5CC5A 2EHHA 1CW2A 3RX4A 1GHRA 4LUIA 1MEWA 3B40A 3URNA 3W0KA 4KWVA 4LYRA 2Z26A 1F3WA 4QX4A 3KE0A 1XPGA 1FFRA 3GAKA 3GC2A 4FS9A 3CQKA 2I9UA 1REQA 1S5VA 4ZE5A 1LL7A 5M1TA 4WY0F 1EIBA 2XFYA 3DH7A 4AB4A 4IP7A 3AIRA 1BG9A 3CS2A 2YLLA 1KR1A 1JDEA 3D3AA 2RHGA 5ABHA 2YKKA 2XM2A 3LPOA 1J2WA 1E0XA 4IJBA 1HVQA 5HNNA 1YMYA 1K8CA 2IPWA 4GKTA 4PFHA 4Q4MA 1IIGA 1Y5VA 2Z2AA 2YL5A 1ISVA 1V51A 1OC6A 2G4JA 3CWHA 3B8VA 3NFUA 2Y5EA 4W7VA 5JUVA 2YBUA 1P0BA 5H6HA 1Q7QA 4GVGA 4O15A 1UD2A 3N6HA 2QS8A 4GC4A 4CD6A 4FOKA 3EMZA 4ZSTA 1KBIA 3CZEA 3ARWA 5CEWA 3F7JA 4C1NB 1NARA 5XIMA 3PTQA 3GZAA 4U31A 1UWIA 3CYJA 1VFLA 3KHJA 3KCOA 5D9OA 1L0PA 4I7UA 3S5OA 2RKXA 3W82A 4Q8QA 3RCYA 4GC3A 3BAYA 4JTRA 4ONVA 2HMCA 4C65A 4DBWA 4JHZA 1CGYA 4NZ3A 3WLKX 5JMUA 4HIBA 2G95A 4INFA 2GFTA 3EEZA 2AGTA 3L65A 1DWGM 3BJTA 3GU1A 4L61A 2C1HA 3IIPA 1GPWA 1RVGA 3P82A 1Z89A 4NZ4A 1XI3A 3T4WA 3PZNA 4ALDA 1VF8A 1MFUA 5CSRA 1KLZA 1GZ1A 3SCNA 3E3HA 5A6TC 1NFGA 1MNSA 5CCZA 4K3ZA 3DG3A 1ZJIA 3MDUA 3MSYA 2NLYA 1W37A 4IM4A 1ZU8A 1TPFA 1LYXA 3TYAA 1J5TA 3O05A 1MQPA 4AWSA 4UZSA 1HIZA 5BMWA 4O11A 3QSTA 2HDJA 1JYNA 4HSHA 5CH9A 5T91A 1GQKA 4OKDA 1X1NA 2DSVA 1B3VA 2WPGA 4H7CA 2XIQA 1AK5A 4UIOA 5GPRA 2ZUTA 3INPA 1V6TA 3L4VA 4UXDA 2XH2A 3FKRA 3N34A 4QS5A 1TQXA 3CQHA 4L4PA 3W7KA 1G67A 1MRAA 1RPXA 5BROA 1ZUAX 1Q6FA 5BMXA 2Y7DA 2A2IA 4LF1A 4V27A 2ZRYA 4JTAA 2Q8ZA 1O5XA 1SZRA 3T81A 3DHDA 3THQA 3DESA 5A6AA 1PTGA 4IPNB 5M5DA 3R79A 1P0DA 4QFUA 2X1UA 1GUVA 1LTDA 1NIUA 1JYVA 4LFYA 3CMJA 1NU5A 2PWHA 3TP4A 3U5YA 1NQKA 1EJVC 1EHAA 3TVAA 1Q6CA 3HPAA 1EC7A 1S2TA 4R27A 2HJPA 3WFLA 1BSLA 4IG2A 4Z17A 2INFA 2V3FA 4QP0A 1B3WA 3QLLA 3BOLA 4EXAA 2FGLA 3QV9A 2YYUA 1KCLA 3HG4A 2AQWA 3MUCA 4LCSA 3JR2A 2J6XA 4M51A 1F3XA 2FGBA 1DJGA 3COTA 2FIQA 4W9TA 3DEQA 3C0LA 1LLWA 2A7NA 5CPMA 2DW7A 1Q13A 3LXBA 2GJPA 1IT8A 3I65A 2REQA 3TU9A 3GE7A 3L7RA 1LG1A 1XLLA 3TX9A 5LHFA 5LIKX 4UTWA 1UH2A 4OECA 4O10A 3I7SA 2SFPA 4G9PA 2EG8A 1VH7A 3QR3A 1TA3A 4XZBA 4B2DD 4GY0A 3SY8A 2QCGA 2VHLA 2O56A 4V1YA 1MNZA 2FH8A 1O1ZA 4ZB0A 5HAOA 3KS6A 4I7VA 4F66A 3PBUA 4RNJA 2QV5A 4ORIA 1NELA 3CNYA 4L6DA 1A5UA 4KPLA 3PWAA 2XN0A 4F0HA 3J7HA 1KV5A 5L9FA 1N2VA 3KZSA 4FLQA 3HFYA 1LL4A 3W6YA 3RJXA 2C8NA 1NFPA 1HJSA 1Q4NX 3SCPA 1FCBA 4Y96A 3STGA 1MUWA 1UQZA 1KM1A 2Y8VA 3B0PA 3NDZA 1U30A 4XO6A 2PF8A 3BSHA 2ZRWA 3W2MA 4D6IA 3NZ1A 2INEA 1HL8A 1QNRA 3WEMA 3DX5A 2QAFA 2DORA 1BLIA 1V02A 4RW3A 3CT7A 4N9BA 1VYRA 5H8MA 1V3JA 3CIWA 2JF7A 4C6DA 1XW8A 4IQJA 2Q01A 3LA4A 1IEWA 3EKGA 3FGCA 2CWXA 4NJGA 1YRRA 3UG5A 1D8WA 1P7TB 5CPLA 1RAKA 4UFJA 2WHJA 5T9CE 3STEA 1W5MA 3LERA 1B4EA 3DGBA 3M7SA 1ITCA 1EFZA 2CXEA 2PWEA 2Z6JA 5FSDC 4Q32A 4W7WA 4YVXA 4EF9A 4GX9A 3L21A 2HS6A 4BF5A 4D71A 2YCKX 1H5YA 4QDPA 4B5XA 3SRDA 1I2PA 1XF0A 2NX9A 1H60A 1OCBA 4F0SA 3VABA 3HO8A 3FV9A 1SJCA 4MNLA 1R38A 4CD4A 1C8XA 2QF7A 1EYEA 2QPUA 1BQGA 1K9EA 2RGLA 2VCCA 1T5AA 2GL5A 2O9RA 3QMSA 1WDPA 1Q3NA 3RCNA 1KC7A 5C71A 1DXFA 5AC8A 1YIXA 1PX4A 2ZE3A 1OK6A 2OSYA 3LLDA 1VBUA 4AG0A 2AL1A 2E28A 3M46A 1SGJA 3KVJA 1SW7A 4C60A 2WZIA 3GFYA 4XBJA 2AQVA 3ARPA 1UBPC 3W7DA 4O53A 3U2OA 3EWYA 4RDYA 1D2KA 4PSRA 3WH8A 3SUSA 2PPGA 1DIEA 1AODA 3BMWA 1AFSA 3L0NA 4HPJA 1UMYA 2W6RA 2ACRA 3TR2A 1QWGA 1QFEA 3A3WA 1O4UA 4TO8A 4UTFA 2DZUA 3NL6A 4Z2HA 1A5NC 3W6MA 4W5ZA 4KIRA 4NT0A 2XVPA 4ZO7A 4GUJA 4F40A 5DANA 4J28A 5EMUA 2PEVA 2VZOA 1R30A 5DT5A 3EX3A 3JRKA 5DXXA 2VWTA 2GGEA 1XFCA 1B3OA 4CCCA 1CYGA 1EJXC 4OBTA 3GC4A 1EP1A 1XKYA 2F6XA 3DBNA 3MYOA 4LVBA 2QPSA 5FAGA 1TZ9A 1XIMA 4EX4A 4O0KA 1V4YA 3QY7A 3WQ4A 1WO2A 1FWHC 4Y9PA 3RG6A 3GG0A 2X8RA 4DAIA 1Q65A 2C3ZA 3EA3A 2QDDA 3G22A 3NA8A 4PBEA 3P74A 1J11A 2ZRXA 5HMDA 2WCAA 4XKMA 4HQVA 3OBEA 3T44A 3NPUA 4GYJA 3VCNA 1O68A 3UNTA 1GVYA 2XFWA 5F1VA 4MIMA 4RDVA 3WMLA 5BCAA 1AQFA 4ADTA 4GYKA 1TZ7A 1UH4A 4DZHA 5XIAA 4GNJA 2PUZA 3WQOA 3VOFA 4JTDA 1GVIA 3ME3A 2Q02A 5GNZA 2G3FA 1R2TA 1V0NA 1GCYA 1PZ2A 3EGJA 2V3DA 4GNKB 3VD7A 1XWYA 4UWMA 3MU7A 1WKFA 3SIMA 3CL6A 1EIXA 4AEFA 1VFUA 4LSBA 2FQIA 1TWZA 4S38A 2QT3A 4PC8A 4AQLA 3UYIA 3T1GA 3TJLA 2VZSA 4LTSA 2X16A 4R5EA 4AYSA 2WPBA 5E9AA 3WNOA 2A3EA 1U1UA 3VMOA 5G2IA 1GVOA 3M0JA 3IVTA 4H2CA 3WLMA 4CU7A 2P0OA 2X7WA 3WN6A 3PBYA 4JGDA 3WBAA 2QJJA 3R0DA 4HNOA 3S6DA 3CHCA 3A23A 1ZP4A 1PZ3A 2WM0A 4E4FA 2OG9A 3PY2A 4XZLX 1JF5A 1XGDA 2FGZA 4LRTA 4PB3A 3WLTA 1DIKA 3H24A 3GDLA 3M47A 4AEEA 1K8XA 3TQKA 2IQDA 4LALA 4TX9A 1C7TA 3GS6A 4BHYA 3UPMA 1JGMA 2QLYA 5KTLA 1TWDA 2CLLA 4IFKA 3AI0A 4DZAA 1UKOA 1EL3A 1OF8A 3S6OA 2Y5JA 2FFIA 2ZX9A 4E8DA 2I14A 2PGFA 3GU9A 3GKAA 1HW6A 4N6EA 4IMFA 4MY8A 3W24A 4D2JA 3ITXA 3AUJA 4UFLA 1E51A 3EAUA 3UF9A 1W1YA 2OSXA 3ATYA 4NNAA 1NAL1 4NI8A 4DWDA 1WKDA 1W1TA 2VFFA 4OV9A 3AAMA 4YJ5A 1FXPA 1WBHA 4CQ9A 4PTDA 4BFAA 1XX1A 2V3EA 3U9IA 3ANYA 3LGEA 5FL0A 4H6QA 3ZOAA 2OKTA 3B05A 1UKQA 4XAGA 2OGYA 5ABEA 4DO7A 4QLLA 3RUBL 1L2UA 1J10A 1TJ0A 4HA1A 4EE9A 4XAFA 1V6WA 2O0TA 4UTTC 3E12A 3S1WA 3DFHA 1FHLA 4BQ2A 4B9ZA 5EMMA 1T96A 2XU2A 4M1RA 3SURA 1OY0A 2R1KA 4YTTA 5AC4A 3WJYA 1NWSA 2HRWA 2DZVA 5SWUA 3S47A 4DUOA 1PTAA 4C6LA 1PL9A 1YBQA 4AEOA 3SUUA 2OB3A 4JS3A 4DJDC 1OFAA 4UTIA 5B7YA 1FTXA 4CEXC 1ZCOA 5DT7A 3W22A 1CEOA 4H9ZA 4UFKA 3S3GA 3NPXA 4IGMA 3QTGA 2D73A 2E4TA 1OABA 4C1LA 2OR2A 2PSNA 1CZ1A 3C0JA 1C3FA 4NVTA 3WBYA 1IXQA 4D1IA 2J6VA 4XD4A 5EFDA 4GO8A 1D9EA 5A2BA 4AD3A 1KGUA 3VK5A 2BS9A 5G1TA 1I2OA 1UWAA 5CXPA 4JL1A 1F8MA 1Q63A 1RD5A 4MWAD 2QVHA 4GNVA 1D8CA 3RJYA 2PDKA 2VX5A 1E6XM 3H7VA 1V3MA 1E1FA 2NV9A 4MLJA 4UNKA 4RX0A 3NWRA 2PA6A 3L5LA 4HPXA 2O92A 4UFHA 2VP8A 2X1SA 2UZ9A 2NQZA 4Q33A 3VZZA 4PCTA 4HSOA 3FEMA 1GVSA 2IKIA 4AISA 3LCGA 4QISA 2C71A 1KRAC 3TN5A 3TAKA 1FWJC 1KBJA 2WVVB 5CQ1A 5HMEA 5I07A 1POJA 2F38A 4NAFB 2I56A 3HJEA 3WLPA 4NYUA 2BY1A 3IAQA 3CAVA 1XLCA 2EKGA 3SW6A 3SCTA 4ZTYA 5I79A 2FZMA 3S9YA 3IIOA 4KRTA 3P8JA 3BAJA 4AFYA 4MPKA 3GO2A 1UPPA 1R3QA 1XLHA 1UKTA 4US5D 1LRQA 1OVDA 1Z7AA 3VDGA 4JYFA 5AHEA 5FF7A 4GIAA 2HS8A 3I6EA 2OLSA 2Y70A 4CD7A 4MAVA 4BF7A 1X8CA 2CLEA 3OU8A 4GXMA 4DZIA 4JTIA 2ON3A 1H7OA 3T2OA 3UWVA 2XVLA 4KQNA 1QHZA 4LCQA 3CT2A 3QFWA 5U4NA 2QYGA 3KBMA 4G7FA 5I6SA 3UR7A 5CZKA 3O16A 4C5ZA 3DHFA 3IANA 1K4HA 1M6JA 5LHEA 1NWUA 3EWZA 2ZXQA 1W8SA 3EX6A 3OPSA 4GH1A 1OFPA 3RM9A 3W1MA 4PMNA 3LY0A 2HNEA 1JEZA 3K4AA 2IUZA 4UTJA 1TKKA 1KCKA 3WMBA 1TSIA 1M9HA 5BWAA 3B8SA 4H2HA 3FDKA 2NV2A 2IPFA 4GX8A 2CLMA 1W9UA 3MTWA 3GZ3A 3PR2A 3A64A 1MMFA 3HGOA 1FCVA 2PDFA 1UIPA 1VJIA 2X1RA 1IEQA 1EWDA 1EXPA 2WMKA 2X1IA 1XYFA 1XYAA 3LV5A 5DY2A 3EA1A 3N29A 1G6CA 2WMHA 5ECVA 2VL4A 3VCCA 3PWGA 3LGDA 3GIPA 3LEPA 4UNIA 1PV8A 3TJ4A 2YB4A 2EG7A 2XJ7A 2BBFA 3MO7A 3M6DA 6PTDA 1CPUA 1Q8AA 4PCFA 4AWTA 1OGBA 1Y0EA 2NT1A 2PDWA 7REQA 5C9WA 1SO4A 2ZX8A 2PP0A 4WSKA 1X8FA 4I5RA 4PL2A 3GFXA 5LA2A 4A35A 2X30A 4NL1A 5CPQA 3L23A 1BWVA 2ATSA 4MOZA 3TW9A 3GDTA 1LCOA 3PN8A 4IIFA 3R8GA 1RR2A 4GIYA 4IZGA 5TQLA 3RPMA 3S2NA 3HOJA 2CZVA 4PRWA 2VTFA 2X2GA 3V0TA 4ZQRA 2OFJA 4EXQA 1G0CA 1KRMA 1AMYA 2O7SA 3MT1A 1VBGA 5HXMA 3TAOA 3GTNA 1A0CA 5GJNA 3PZQA 2I1OA 3SCOA 4ZA0A 2CZDA 1XLAA 3UA4A 4H9YA 4OOUA 2L5HA 3DYPA 2E8ZA 1A49A 3W00A 1UG6A 3CHEA 2DU2A 4Z2KA 4BZYA 3G18A 2E5BA 1XLEA 3EDJA 2OOGA 3V7PA 2PD5A 2H8XA 5KZDA 5PTDA 4PULA 2XFRA 1KNWA 3B9OA 2NQLA 3CO4A 1R8LA 3FJNA 1LORA 1SMAA 5A6JA 2PDPA 3DYMA 4FR1A 1UP0A 1XLDA 2DJLA 1R6WA 2ZZ3A 1P6WA 1YXCA 4M81A 4BI6A 2ALRA 3ONBA 4ZR8A 4HHPA 1M7XA 2H6RA 4C7DA 4UMCA 1PCKA 4BCEA 1GJUA 3KWSA 4RR4A 4GCAA 1XLJA 1JAEA 4WSHA 1RJPA 3WDQA 1EBGA 3WK0A 2YW4A 4F79A 3OZYA 3L12A 5KMYA 1TWIA 2FZ8A 2QAPA 5EKYA 3UY8A 3GU2A 4NZCA 1NWRA 4MZ8A 3FVMA 4XK2A 5ABFA 1OCQA 3EEGA 4C1KA 1KGWA 3LHTA 3V36A 1JUKA 3R1ZA 1UW9A 1ZAHA 5M2FX 1ZGDA 1TJRA 2XPKA 1OD0A 1A5KC 5LNVA 2RDTA 3W88A 4DUWA 1WKYA 3VI2A 2FMOA 3WZ0E 1SSGA 2FZDA 4Z1YA 3O9NA 3QHOA 4JFVA 1U83A 3LHYA 4H8UA 4LNCA 3C5QA 3BG9A 1X1OA 1XINA 4N9EA 3BH4A 1MXDA 1ME9A 1OFQA 3OA5A 4MLRA 3W23A 3QOMA 2Z28A 1IWAA 3CUGA 1EUNA 1QW9A 1HG3A 5AYBA 4FI4A 3EXRA 1I9CB 2GDQA 3AFBA 4O13A 1K70A 4KRUA 1EA0A 3C2FA 1BYCA 2JALA 4PYSA 3CEUA 2OQHA 2X2YA 4GXWA 2WZMA 2J9ZA 2WSQA 1SQ7A 4U2ZA 2VOTA 4OWGA 4B3ZA 4S3GA 2OT0A 3ARYA 1TCDA 3W38A 1HVXA 1B30A 4GZIA 1S38A 4F0RA 3EB3A 3DFYA 3M5ZA 1JD7A 3C2RA 5CZTA 4KH2A 3MDWA 3MUY1 4Q8PA 5IDIA 4TTGA 5LA0A 2J79A 4AY7A 2J8FA 3R8RA 3E74A 3L0GA 3O6DA 4ZFCA 4AMCA 4C6CA 2YL8A 7ODCA 1H09A 4HNNA 3CB8A 2ACQA 4MMWA 4JICA 3IJDA 4I3GA 2E9LA 3WDRA 4S23A 4DM1A 4IGNA 3UXLA 1E0UA 2GDUA 3EXSA 2RAGA 2PTDA 1CTNA 3C8NA 1UCWA 4B5WA 3SGUA 3W27A 1QO5A 3MCMA 1H2JA 1P48A 2DH2A 4RXFA 5K9CA 4EAYA 3UQNA 4PUJA 2GJRA 1B9BA 1GQNA 2IQTA 3AHVA 4IX2A 3S5ZA 2X0SA 3WFAA 4GH3A 2DZBA 4KFOA 1ZL1A 3ZXWA 1PKMA 3RXZA 4AD0A 4FNSA 4OGZA 1I60A 4M24A 1AJZA 3WO8A 2BHZA 3A5VA 4U10A 3ZVHA 2E09A 1BYBA 1TX0A 1J12A 3PFRA 1H7RA 3PPCA 5D9NA 4Q8UA 3CQIA 3JU2A 1PCWA 4IIEA 3H2MA 3IAPA 3ERPA 4ILSA 3K46A 2EO7A 2H9AA 1AW2A 1E15A 2DIEA 3M0YA 4UTTA 2J24A 5BRPA 4G1NA 4DUXA 3F4VA 4B91A 4JY9A 3TFXA 4N7QA 2QCLA 3DU0A 3BICA 4BK9A 1QDSA 5EU9A 3HMCA 4DHGA 3PK7A 5TBOA 3ENLA 4LVDA 4YXGA 5BZAA 4WR3A 1VCFA 1EDQA 3DC0A 2WYSA 2BFGA 2ZX6A 1SW0A 1VYPX 2JFEX 4H19A 4H01A 4XZWA 2WW5A 2ZTKA 3AU6A 1E6ZA 1HUVA 4ZSUA 3APGA 1E4NA 3FYOA 4HK5A 3PHAA 3FA4A 3LNPA 2JGQA 2F61A 2FHCA 3DOPA 3M16A 5AKQA 1GORA 1FCQA 4MDPA 2C79A 2YFNA 5HNUA 2DT3A 3NTYA 3VOGA 1R3WA 1XBYA 1YW1A 5DMMA 2J8GA 2GJXA 5G5IA 3MUIA 3LBOA 2QUVA 4RE4A 2CKSA 5DLCA 2QEZA 3B4YA 2WV8A 4JN7A 4P7RA 1M01A 1LQ0A 1WDSA 4O1FA 3UCDA 2X42A 1DWJM 3MV11 2C91A 2OTDA 1VGAA 2YSWA 2C0AA 1E9ZB 3QPEA 4GI4A 4P61A 2BODX 3CHDA 2DZSA 2CHRA 3ZR6A 3EPMA 3O6AA 4FXRA 4QDWA 4E0CA 3TK7A 3DGRA 4UQCA 4LUYA 5FJPA 1OFOA 1LG2A 2PZ0A 5HK4A 4IOTA 2FZ9A 3MA8A 3I68A 4C6QA 3WQGA 2INZA 1HKWA 3MCOA 1UKSA 3UJEA 3BLKA 2NXGA 4PH6A 4Q4QA 4DPPA 1V02E 4MJ2A 1K8YA 4JX5A 1SYTA 2J7CA 1H0IA 8A3HA 4LH8A 5CLTA 4Z1BA 3CL8A 4HHLA 2PWUA 3M0HA 4UB9A 4GVFA 1JPHA 3U5UA 1CECA 3VD9A 1VEOA 1B0IA 3N3MA 3KOFA 2VFGA 3BC9A 4X0VA 1PKNA 4OFCA 4DXXA 4IICA 2V63A 3QV6A 8CGTA 4EPKA 5FSEC 5MF5A 4IF2A 1E1CB 1SU5A 5GNYA 5F2IA 3EOLA 3EYPA 2Y5SA 3WNKA 3AWOA 2CBVA 1A53A 3ZVIA 3ARXA 5TF0A 2ZZ5A 4ZVJA 5F2MA 3WH5A 1CXFA 4DVOA 4X63A 2ZUWA 2UY4A 1YPFA 4NYYA 1DQWA 4IISA 3BV4A 1UR3M 4GOAA 3N2TA 1ZJAA 4A21A 1TWSA 2E1WA 1JDDA 2A79A 4MYXA 1JPMA 6REQA 1JCNA 3S83A 1B9ZA 3URAA 3QZAA 4LAMA 5DO8A 2NVCA 2J62A 1XRVA 2YX0A 4OT7A 4YTSA 2LLEA 2DSUA 4D8AA 1RQBA 1CGVA 1KXHA 3P93A 1D3HA 1E6NA 4EPBC 4CD5A 4DO5A 2XINA 3F5LA 3WJXA 3RRXA 1SZNA 4GYFA 5EMKA 4MNJA 5I77A 1OJXA 2B7OA 3QF0A 2HXUA 3N17A 3L68A 1XLMA 1KM5A 3VTRA 4P8XA 5D33A 1W1A1 4LY4A 3R8HA 3WUGA 2PDBA 3P2VA 4H7ZA 2ONEA 1KQYA 2WHKA 4RNHA 3TMLA 4KT2A 1D7KA 3BAWA 3Q65A 2H9AB 3NO1A 5CJMA 1HGWA 4GKLA 3LRLA 2BXZA 3I10A 3C4UA 3AIUA 1B57A 1OYCA 1TV2A 4NKCA 1QNPA 3WNLA 1F3TA 2PDXA 3GNXA 4L80A 3S1UA 3ONCA 4JD4A 4IP4A 3FGCB 3KDNA 3WNMA 1CCWB 1W32A 2VI0A 2EEXA 1BKHA 3N3TA 1E4LA 1B3XA 4M3PA 2ZIDA 4DYJA 2HNHA 1P1MA 1FH8A 3LTPA 1CENA 1V79A 1W9PA 4WKAA 3SBFA 3CV2A 1XC6A 4PMRA 2ZZ7A 2F7FA 1OQFA 4O12A 1Z32X 2WLZA 5AY7A 5AHMA 3NPWA 5DRCA 4CD8A 3KRSA 3W7IA 2XGIA 4JYEA 5LNRA 1H1ZA 4IL2A 1XDMA 4XVDA 3LB0A 1BTMA 2QCDB 2PDJA 2FB3A 4GZEA 3N4FA 1QHOA 1KXVA 1QNSA 4C6OA 3S42A 3M44A 3NVTA 3R6IA 4DJDD 2WMJA 4PUKA 3HJZA 2V69A 5KZMA 2ZWYA 4QNEA 1F5ZA 4JYDA 3IJ8A 3ARTA 3OZOA 5FEXA 4JFWA 2YIHA 4LQ1A 3M0ZA 3ZT5A 4HCHA 2BTMA 3AS3A 4GFIA 3BO9A 1PB0A 1R47A 3H7UA 1DP0A 2A3CA 4X3ZA 3R43A 5AECA 4AZBA 2VJXA 4D1JA 3CLMA 3W1TA 2W61A 1IGSA 2PD9A 3QOKA 2X0HA 1BEUA 4KKXA 5HR7A 1QTWA 3N18A 4WDXA 2PF0A 3TTOA 4QNWA 3AXIA 4K68A 3ALGA 3ITOA 3ARVA 1XQLA 2CU0A 3KOZA 4ROQA 5JU6A 2PBGA 3VGFA 4ZXOA 4O16A 2UY5A 4CGTA 5I24A 3CUJA 5HWJA 1MWOA 2PGEA 1AH4A 4JTHA 1YNYA 2D3NA 2O7QA 1U22A 4KEVA 1LWJA 1XYBA 3GNDA 1F9CA 3UWWA 3L5MA 4UOQA 3MY9A 1QI3A 3TE9A 2GLKA 1JCJA 1H1YA 3WEZA 3VDCA 1NDYA 3E6EA 1NOFA 5HPOA 3ZJ6A 1ALDA 3FXYA 4MB5A 1EF2A 1R2RA 3I3EA 2NSXA 2V30A 3I7RA 4DJEA 4TV5A 3UJ2A 2YBTA 3TC3A 3V1PA 3NL2A 5RUBA 3RK8A 1E6SM 1W17A 1A5CA 2D20A 4A2SA 3M0KA 3W7PA 1UD4A 4S1FA 2VRJA 4UTWC 1ZQ5A 3PZOA 5BXSA 4M82A 3H2EA 3W7NA 1B1YA 3WF0A 1HKIA 1XL9A 5I5RA 4JNMA 2C15A 4GA8A 2Z1BA 2J47A 3GXDA 2DH3A 4W85A 5CLWA 3LX9A 4D6JA 3DG6A 3EX1A 2XIMA 1ELSA 4PEEA 1HO4A 3IRDA 3CH9A 1V3KA 4US5A 1UOKA 4RZ5A 1YPXA 2GOKA 4DF1A 1N8IA 3O06A 3HFTA 4ORMA 4CNPA 1ZS2A 4QE1A 4WXZA 2VC5A 3Q67A 2PAJA 3PVFA 4WUIA 2DIJA 1EXBA 4UUIA 1GJWA 1CLKA 4CVUA 1E0WA 3AHTA 1G4PA 4U3AA 4F9DA 3MP3A 4IFKB 1H5VA 4U5KA 5HQLA 1AJ2A 2ZRUA 3P67A 1M7JA 3IRSA 4P7NA 1SFJA 2G3NA 4DUVA 1XSJA 1TRDA 3U3HA 1WYIA 3BZJA 4KWWA 1M7PA 3FW6A 1JI1A 4TIMA 3V16A 1ZRQA 3K2GA 3A3HA 1RUSA 5KEZA 1JZ5A 1YXYA 4HB7A 4DJEC 1HZYA 2HROA 1U5JA 3N4EA 3WKZA 1PTDA 4IPLA 1ZBWA 4PN2A 3TJIA 4MUZA 3LXCA 4FR6A 5D2WA 5E6YA 4HA4A 3AICA 5AYXA 3CZGA 4JTCA 4E2OA 4ACYA 4A3YA 4M7SA 1G7VA 4CQ8A 3P8IA 4JY8A 3TCEA 3LHUA 3T0DA 3UWZA 2EQDA 1UWSA 4RKAA 1SFSA 1KRBC 2ABBA 1EO7A 4GIEA 2OOFA 4LUSA 4YWSA 2JF6A 3A47A 3CM4A 1KCXA 2FMNA 2XH7A 2BVWA 4OTKA 3CUXA 1VRDA 1UZHA 3HPXA 1H7XA 4ZENA 5E9XA 2BGNE 4FX7A 3KOYA 4H1ZA 1ENUA 1ICQA 1EX1A 3JUGA 4ZOEA 4H04A 4BJHA 2Y4SA 1FWCC 2J4GA 4M29A 1GZJA 3ZS4A 1L6SA 1TELA 3VD3A 1NDZA 2WXDM 2JIEA 1LQ2A 4HU0A 2J7GA 4K7YA 1ISXA 4DWSD 4BEQA 5IOBA 1VC4A 5CSYA 3ZMRA 3WL1A 3WEOA 2QCHA 3PUDA 2ZUUA 2R1LA 2O4QA 3V5OA 2KZHA 2OT1A 1XIGA 4IIDA 3B4UA 2GJNA 1A0EA 5CAHA 4NF7A 4O1CA 2GWNA 2YPIA 1QASA 3TYBA 2GSJA 3GNPA 5HWNA 3AXHA 2ZZ4A 2J13A 2WANA 4ZO6A 2D2JA 5G4WA 1ONEA 1TPC1 2I57A 3SQLA 1MW0A 2ZA1A 4ERGA 2KX9A 1G94A 1TX2A 3ABZA 3QV8A 1IR1A 3Q58A 3AISA 3VIHA 4Y9AA 4ECLA 4AMAA 1DYSA 4W7UA 3B0VC 4AYGA 2QVNA 3CUIA 1E40A 1A50A 3CASA 2AMXA 5GJPA 4OE7A 4DBEA 3K4DA 5T9BG 2NW0A 3XINA 1RK5A 4IPJA 4B9YA 4WIWA 1RP9A 2NZLA 1GKQA 2YJQA 1OEPA 5G4EA 3N2XA 3NSMA 1LT7A 3USBA 5LNWA 4Q8VA 2HCVA 5KZEA 4Z2JA 3WMSA 2HK0A 5DRIA 1P0EA 3SQMA 3WBXA 3QKEA 5HJXA 1HL2A 2Y2WA 1JFHA 1SJBA 1HN1A 1E0TA 3UCCA 1PSCA 1JYXA 3O2LA 2FTWA 1EZWA 3O0KA 4IGSA 4BI7A 1BXBA 1QO2A 1ZJHA 1MW2A 4A8LA 2E40A 3VIIA 3KAOA 1TUXA 2VUNA 3G8RA 1U2YA 4IQLA 4ZXLA 4XZHA 3PG8A 2X05A 2HPMA 5B80A 3GXFA 1QJWA 3WLJA 4O1EA 1OCNA 1W8GA 1VBRA 3B0XA 1BGGA 3OIHA 3PNUA 3WH7A 4K1GA 2VX4A 3KL0A 3NQVA 4E2DA 3TV8A 3KEHA 1MXGA 2FTPA 1EUAA 4J2MA 1XH1A 1DWFM 3MPGA 3NQEA 2P5NA 3CXOA 2P10A 1A4LA 2V5JA 1PXGA 3KL3A 3L9CA 1CX9A 2GVYA 4UC5A 2VOMA 3NXLA 4CU8A 1FKXA 4GABA 5A6SA 2HVMA 4M7TA 1J0JA 2GK1A 4W87A 3HG2A 1V03A 5CPNA 5BRQA 5J04A 2WZTA 4W88A 2BV9A 5C9ZA 1FDZA 3WQVA 2WSPA 1OIFA 2VWSA 3ECQA 2NVAA 3VAVA 4NZ1A 3L5AA 2Y1HA 2E25A 3VD4A 3EPNA 1F8IA 4YL2A 2QCMA 1EDGA 1YLVA 1SO6A 1W31A 1KBKA 1BSIA 1EPXA 1MYRA 3GVRA 2W3ZA 5AZ0A 2QCFA 4HYVA 1E9IA 2P53A 1XG4A 2F2HA 4UQDA 2FVKA 4AIOA 3A4AA 1EF3A 4Q6XA 4HOZA 3VGGA 5HJYA 3PS7A 4X60A 3BLDA 4MWAC 3M0VA 3B8WA 3W37A 3UGVA 3KOWA 4I9AA 1LM1A 3DIPA 1R86A 4CN4A 1EQCA 3CPRA 3TTYA 1HKMA 3FS2A 2RJHA 1OF6A 4TXEA 3M4HA 1TTJA 3MV01 3LLFA 3VO0A 4O8RA 3G77A 4RPPA 4H6KA 4MWAB 7PTDA 1S2AA 5CBBA 2WVUA 1CWYA 2VX6A 5DBTA 1FXQA 1AG1O 3BOXA 2QUUA 4FB7A 4FOUA 1NFBA 2NVDA 2ZA3A 1K8ZA 1BVWA 3OQEA 1GT8A 1GOKA 1T99A 3THCA 5BW6A 1J18A 2E6AA 3KTXA 4U28A 3H2NA 3ZWTA 1BKSA 3R4IA 1B54A 2VZTA 2ZKMX 3EKLA 3W76A 3CYVA 3M43A 3N12A 2OZ3A 3QC3A 5CG7A 4HZMA 1OFRA 4V15A 4ROPA 3SECA 5LA1A 2GQAA 2C1GA 3LPPA 1A5AA 1JNEA 5FCZA 3IWPA 2Q3RA 2V38A 3LBMA 1C9WA 4XZIA 1H62A 4R88A 2YBVA 3VFCA 1FVPA 5A8QA 1DORA 2CIPA 3SY5A 1BQCA 5D09A 2VC6A 5K9XA 4C7GA 3P5ZA 3RU8X 5EFFA 1Q6OA 2DPEA 5CPSA 3DI0A 2IS7A 5J8LA 4KWOA 1H11A 4TVCA 3T9PA 4Q4SA 1TPVA 3CHVA 5KSWA 2GGGA 2OGJA 5DBUA 4IL0A 2UV8G 3NL5A 4TVDA 4ZFMA 2I5QA 4HTYA 5C55A 3ZT7A 4O8AA 1IZKA 1WXYA 3K1GA 4DWSC 4QHRA 4F2UA 2DVTA 1XIEA 4WEVX 4PGLA 3QPYA 4NG3A 4WY0A 3CBWA 3EX4A 3A21A 2VZVA 4F0KA 2CBIA 3BAXA 4Z0JA 3WDPP 4KGLA 4Q6JA 1ONRA 3VXGA 3OO2A 2DT0A 2MNRA 4X61A 1TPEA 1QT1A 3UZWA 3ZLHA 1BGAA 1S39A 4C6EA 4CN1A 3PSWA 4EF8A 5C54A 4AIEA 3NYDA 1S2VA 3GW0A 3GG7A 1JAKA 4TMBA 1TIMA 3EKZA 2ZXDA 4AZ5A 3F4CA 3TN3A 4GJ1A 1KD0A 1OX4B 3WH9A 1UD6A 3NXFA 4DIAA 3QKZA 3ZJKA 2CFFA 3IV8A 3QH2A 1CBGA 3FSTA 1Q4WA 2Z25A 3VKDA 2YL9A 4J2PA 2CBUA 4ZEPA 5EYWA 3NPVA 1VZWA 3SZ8A 1BF6A 3QY6A 5HQEA 5BXPA 3QM3A 1OX4A 2ISWA 4PFMA 1DBTA 3BOFA 5D9MA 3BW2A 5F4SA 2X7VA 1K9TA 1QCWA 2J7DA 5EL1A 5FF4A 3F2DA 1JULA 1TG7A 4AD1A 2ZUNA 4LT9A 2R14A 3LZ3A 4L1GA 2PCQA 4QEHA 1SO3A 1A5SA 3SR7A 3R89A 5A8PA 3OA3A 1ODUA 1UWUA 1MI3A 4M1BA 4OBSA 2C6QA 2Y61A 4DYEA 4YCOA 3LOTA 1A47A 1VCVA 1Q66A 4I5UA 1KA9F 4DX3A 1PIGA 3AYSA 3GR7A 1VCGA 2W92A 3N9RA 4LV4A 1LWIA 1W9BM 3IS4A 3CAKA 3W7CA 2J9YA 1Q85A 1UWQA 3ITVA 3QMRA 3O0FA 1P6BA 5T8GA 4WJ8A 3JVAA 4JDYA 1J0YA 4FXSA 1UR9A 1W56A 2DSKA 4AF0A 1JDAA 1RJQA 2XWEA 3THDA 2Z7KA 3GXTA 1W5NA 1IXNA 1IEVA 3E2QA 1KRCC 3N15A 3BLPX 3BK0A 1F73A 2BNJA 4UBPC 1XKJA 2G97A 2BVYA 5KINA 4A22A 3GIQA 4Y8EA 4LANA 3CLWA 1R5YA 3OBAA 1XIFA 3TN6A 3LD5A 1VPXA 1N55A 2Z24A 3AQUA 2R8WA 1J0ZA 4IXXA 3W81A 3UR8A 1E1EA 3O6CA 3EB4A 1QPQA 4YCPA 2W62A 1YTDA 3GWQA 4MJZA 2POZA 3P62A 4QCFA 3R11A 3HU7A 4S3KA 3OODA 4YYFA 4FF5A 3UWEA 1Q45A 1S2CA 1KM2A 2JIWA 3C52A 2P0IA 1W2PA 4QEEA 1R7OA 4H83A 2DZPA 3TFCA 3M5XA 3AHZA 4IQDA 4U5IA 4PUDA 4D6DA 3PPGA 1N8FA 1Q8JA 4AZIA 3RMEA 4FX6M 1LBLA 1ZFJA 1LF1A 4O0QA 2XVGA 4HZ6A 4YTUA 3SGZA 2EGZA 2QMJA 3W6LA 2G0WA 3BWWA 4PMYA 3GIYA 2J25A 1SJAA 1ZSXA 6TIMA 3VUPA 4IUGA 1R2SA 2QMKA 2QJIA 1DJIA 4GINA 3H21A 2HE5A 3MANA 3N25A 4B5UA 4ZQMA 3T40A 4V33A 3T4CA 1E3XA 1FWTA 1K03A 3RLHA 3UESA 3UWYA 4O1BA 1KR0A 2QCDA 3WLRA 3TA9A 3W84A 3H2AA 3P61A 3G1XA 1B4KA 3CPGA 1FWNA 1ZLPA 1MDRA 5FAJA 3TR9A 2W67A 4L1WA 4W86A 2MUCA 4HCLA 2VVNA 2GJLA 1ZAJA 4HMDA 1JZ7A 4XZNX 4L56A 5LIXX 4I6KA 1EOKA 1OX6A 3CZ8A 2FDMA 4YTQA 4DWSB 2C18A 3E02A 1LZOA 3MHGA 2GK1B 3NQGA 2DFAA 1QI2A 2ZFAA 3GLCA 3UA3A 3C2OA 4MZ1A 1GVRA 1QOXA 2BZNA 3BURA 2EKCA 5AYZA 4IMEA 1FWSA 3UBPC 2OELA 3KBNA 3LCIA 1XH0A 4O19A 1O6IA 3MMDA 1EH9A 4DB7A 1DJZA 4IIGA 2EJ1A 4ENLA 3W83A 4OV4A 1UQYA 4XIAA 2ASHA 4G6CA 3EMCA 4UNLA 3TROA 2R1MA 3W2JA 4Q7BA 3SCUA 5E0KA 1DWAM 6A3HA 1LRNA 1YQ2A 2WWDA 4PMXA 3W3OA 3PZ9A 3ATZA 4JN8A 4J5NA 4JFSA 4R7JA 2JEQA 1SFLA 4XQ6A 2GYIA 4RCXA 3RIKA 4V1XA 2ZCGA 1XSIA 1JIBA 1ZNNA 4N0RA 1QAPA 4O28A 5FACA 4NRSA 4L6HA 4WDWA 3IV3A 2PTYA 2V8ZA 1BRLB 4NXSA 5D02A 1UHVA 3B9EA 3W7EA 1X6UA 1EB3A 4ACZB 3GNNA 1Q2RA 4GLEA 4KFPA 3MB9A 3KRUA 2IMRA 3M07A 3APTA 2YCLB 4MKVA 2EBNA 1AD4A 1J9YA 1NTHA 3PBVA 2H8ZA 3EDEA 4L5ZA 3REQB 2Z29A 1DHKA 1BYAA 4G8TA 3WQPA 3QFEA 1VLWA 4GISA 4IMAA 4GWEA 1ZALA 4ERIA 5I00A 2PWGA 4NX5A 1VIWA 1PZ1A 2CZ5A 3VKAA 1QPOA 4AWUA 3TZFA 3B0YA 1G4SA 1JCTA 3QGAC 1EGMA 1S46A 4DRSA 5J5DA 3FCPA 3V0UA 2BWGA 3A4JA 1WNOA 4MDOA 3C3NA 4P8WA 2DY3A 3NO3A 4B5NA 3S46A 1VFTA 3P60A 3ARQA 1K4GA 1ZJBA 1VRXA 2A3AA 1RD6A 2J9XA 4O14A 3QW4B 4XUGA 4JX6A 2G37A 2F6KA 2I5IA 2QR6A 2Q6ZA 4Q4OA 1U1JA 4X9SA 4K7VA 1TPB1 4HZ7A 4R85A 4FSAA 4XSMA 4MJ4A 5E5CA 2JKPA 5BNKA 1ZB5A 2XYLA 2Z1VA 1UR2A 1HJQA 3O1NA 3M0XA 1IZJA 1C90A 3QRHA 3DUGA 1XISA 1FWDC 1TMQA 3UR5A 3MHFA 1ZBVA 5E70A 4UCGA 2JGYA 4Q8WA 1FP8A 3OHMB 4EP8C 3KBWA 4JIEA 1KWGA 1QPNA 1UJPA 2POTA 4NUWA 2G41A 1DTNA 4ICCX 2UY3A 4J3WA 1UR0A 3K13A 2BY3A 4N9CA 1SFTA 4KESA 1S2WA 1BFNA 4CQBA 4MM1A 1PIIA 4UZUA 3F2BA 4ZB5A 1E4MM 3IJ9A 3GDMA 5DMLA 1P5BA 4QCEA 1IT0A 4PBGA 2PLCA 1UZ1A 5CBJA 1QPRA 3S4TA 1JPKA 5GQBA 4AD5A 1JZ4A 3E2VA 3GUGA 2NX3A 1TV3A 3KCJA 2QIIA 2GQ8A 1JR1A 4EK7A 3K30A 1IIHA 3FN9A 3PULA 1L8NA 4BF9A 1EJUC 4JCLA 3M7WA 3B9DA 3S1XA 3QHMA 3T42A 5E09A 3CAQA 1CXKA 3JZUA 4DWSA 2VMFA 5IXEA 3W01A 2Z1SA 2HBXA 1A3HA 3U7VA 2ANUA 4NZJA 4AHQA 3ABOA 3VMNA 5I3GA 3H7RA 3HA1A 3H54A 4HP5A 1KO0A 3OVPA 3AYVA 3VNKA 2YXGA 3SRKA 2PURA 5BXRA 1X6NA 3SEPA 1QNVA 3C2EA 2VENA 3C61A 2VYOA 5TIMA 2GPTA 1NY1A 2ZZ6A 2HV5A 1WXZA 3C8FA 1PE1A 3PJXA 4PSPA 3BL3A 2OZ0A 1GEQA 3MVTA 2PLKA 5D37A 4FHAA 3EWCA 4KCWA 3B0UX 4IWWA 4O1DA 3A13A 4FK9A 4WCJA 1A80A 2BXVA 4DBUA 1US2A 1TO3A 3P3BA 2ISDA 1BXNA 3C56A 4GJJA 3MW7A 3KTCA 5JBFA 3LM7A 2PMQA 3KVLA 2NXHA 3LG3A 3WQ8A 1TUFA 2VEPA 1XYCA 4QJ4B 3MHUA 3SM0A 1XDLA 3UD6A 2R82A 3N13A 1XS2A 2W4XA 3ZR4A 3QBUA 4UOZA 4CCEA 4F8XA 5I3KA 1TA3B 1A5MC 2JKAA 2E6YA 3PC0A 3QTPA 3W1LA 4PB5A 4F0MA 2P76A 3OHIA 1KFBA 3KFTA 4UCFA 1JZ3A 4QG9A 3RR4A 3VGHA 4L4LA 2Y88A 1F76A 3N6QA 6REQB 2IKHA 3AMLA 2CERA 3QLDA 4G56A 1DHPA 1K7XA 3UNDA 5LGXA 1XXXA 5FJUA 1EZ2A 2WJEA 1LOSA 2IXUA 4FEZA 2PDYA 2Z1XA 1YE4A 1XIBA 2G5WA 2YGYA 3B3DA 2EPMX 1TQJA 4LBUA 1KQZA 4HYRA 3QW3A 4YLWA 4PA8A 3NJ3A 2A7PA 2CYGA 2ZBTA 4LF2A 1YTKA 3MSRA 4A8IA 4XB3A 5CG0A 2PC8A 3PZGA 4QQ3A 3LTYA 4NAEB 3BJFA 5I3HA 4U4MA 1JRBA 1CLXA 1XRFA 3LHVA 5I0DA 1UZDA 4ATDA 1RCOB 4N6FA 4LJ3A 3L4XA 3NQ7A 3V0SA 3VNDA 2D2HA 2XG9A 3ARZA 4GGBA 3H2CA 2HXTA 2ZOXA 5I02A 4XZMX 3GNRA 4OIFA 3M6YA 3G1HA 4MGGA 4JOMA 5REQA 4JN6A 2YZRA 1AH3A 1KM4A 3T0CA 2QUMA 3WJWA 3EDFA 2VXNA 1Y65A 1JVNA 3LSBA 3VVGA 1ISYA 2IKGA 3WENA 2BDQA 1W3IA 2FTYA 4REQA 3QN3A 4GD0A 4MUPA 4HA3A 1VHNA 2OVLA 2E1DA 2KAUC 3LHZA 1TVLA 1MSSA 3VKBA 3PPHA 3V4BA 3SB0A 3LCHA 4M6PA 4KF1A 3W7RA 3F5JA 3WQCA 2QJGA 3IEBA 5JBDA 1IWBA 3GVQA 3VKKA 2OLAA 4Y7EA 3VDAA 2ZQ0A 1BWKA 3F03K 2EXOA 4Z42C 3CU2A 3VPLA 4GI9A 5BXTA 3H2OA 2G96A 3RNDA 5K7JA 1QNOA 4ZL1A 3PSVA 3GVVA 4GGHA 1ZPTA 3NGJA 4Y8FA 1VB9A 3W73A 4AIUA 4OJYA 5LIUX 4LYPA 4LYQA 1GOIA 3N19B 1W5QA 3NNTA 3PNZA 1BAGA 4UMAA 3VOHA 5A3HA 3G1DA 1S3HA 4ASTA 3UETA 2IXVA 3R58A 3S2MA 2AKMA 1W1PA 1GZGA 2XZ7A 1FBAA 3H2FA 3U2CA 4BWLC 1W1VA 1WCGA 3CPUA 1UJQA 1UYQA 3WUEA 5E0FA 4WZHA 1QK0A 4TX6A 1C8QA 3OVGA 7REQB 1LLZA 3A9IA 3KUMA 4MSSA 4RW5A 1LOLA 2V5CA 3OOQA 5H8PA 4MWAA 2FPTA 3DDMA 2TODA 1US3A 4FIRA 2PP1A 2VELA 3OLGA 2GVJA 2B81A 2PTZA 1LBMA 3GR4A 1W3LA 4DO6A 4CEUC 1EGVA 3WLNA 3KL5A 4IMDA 4AD4A 5AC7A 2Z1WA 5A69A 1NOUA 4QXIA 3EBVA 1F74A 1HX0A 3ABXA 4N2YA 3IJIA 3TDFA 3HZ3A 4A6GA 2EPOA 2BXYA 1Q6QA 1POKA 2QHAA 3MKKA 3ES8A 2GSHA 1Q7ZA 2WKJA 3NGFA 3TA6A 4HJFA 3KVMA 5AHIA 2C1IA 5KITA 2ABAA 2CLOA 2OX1A 1RP8A 1ADDA 4OHQA 2DUXA 3FAWA 5I3IA 4EWND 2NXIA 4TQTA 2PRMA 4R34A 1OCJA 3VKCA 2DZWA 1RCQA 3MS8A 4E4PA 1PKYA 5AB3A 2VNCA 4IPPA 4DYKA 1JYWA 1XP3A 4Q8MA 5IDZA 3ITLA 2D1ZA 3A4WA 2O9OA 4J7RA 3UG8A 4KCVA 3RR1A 3LQGA 3WG6A 5HA7A 4ZBCA 3WJSA 1YDOA 2GVEA 3UPWA 1GPFA 1H4PA 3MSGA 2OX4A 2IW0A 1ZY9A 1JPDX 1G4EA 1P43A 1JCXA 1BG4A 4WF7A 1QRQA 1WA3A 4RUBA 2CW6A 1R87A 1LOQA 3ZLGA 4UQEA 5HATA 4L1XA 1NEYA 4JEJA 1HFBA 2FZNA 2NSOA 1V0KA 2WBKA 2FYMA 2PDQA 3I3DA 2D2GA 1AZ1A 1IEIA 1GJPA 1Z42A 1U5HA 3SSZA 1CDGA 9XIAA 5M3WA 5CGQA 4QSHA 4B4HA 1UWTA 3SCQA 1QU4A 5DMYA 2PU0A 2WLYA 3G6LA 1XIIA 3WLIA 4OU1A 5I78A 1HGYA 1NH6A 1OD8A 4DQWA 3QHNA 4AXNA 1UD8A 2V2HA 4F0LA 3ALFA 2GJXB 3MJYA 5C2XA 1TIWA 3QJAA 4M6VA 1JL8A 2ISSA 4YHGA 1LROA 4JXCA 3TOYA 2XIJA 4YU1A 3HPFA 2D2OA 1SJDA 4WVXA 3DERA 2QF8A 1EGZA 1O94A 2OO0A 4Y90A 3OIXA 4FA3A 4HHMA 2BB0A 1K9FA 3RLVA 2RGMA 3II1A 3FY1A 2DVUA 4FLSA 4FZIA 1AL7A 1D7FA 1M04A 1YEYA 2UWFA 3ID7A 3K1DA 2OYLA 3V5FA 3NG3A 4JKLA 3TTEA 3VX0A 3HGJA 1MZHA 2XSAA 4Z2IA 4R7OA 4Y9OA 2HSAA 2E6DA 4UTKA 2CLIA 3WYZA 2VGBA 3TSMA 1KGXA 3NQ2A 4S3CA 4IX0A 1EKOA 2JE8A 4XX6A 4PBFA 4PCPA 4D8ZA 3JS3A 4HT3A 3VIFA 3HF3A 3R5EA 2E68A 1OSEA 4GHRA 3AIBA 3EWDA 3IUDA 3IPWA 4MTVA 2NV1A 3ITCA 2TMDA 4O1AA 4AZCB 1WOAA 5U7SA 3G1AA 3WBEA 3BGAA 4LVGA 4DJFD 5K3VA 3M64A 2Y6ZA 4XTDA 3GB6A 6XIMA 2E9BA 1VFMA 2ODOA 3BLOA 4Q7IA 5D05A 5AFDA 1WAWA 2Z2UA 1OADA 1GG1A 3P5YA 1JD9A 3GG8A 4DELA 4LC8A 3H22A 3MO4A 3EWBX 3MWCA 3R7MA 5IM51 4URIA 1FWFC 4RDZA 3AMCA 4W84A 2VVSA 1UWRA 5G4HC 1RZMA 4B90A 4CKQA 1WXJA 4PZVA 3U48A 4M19A 4AD2A 3HB9A 3VNYA 3IK4A 3Q2DA 1W54A 5DN1A 1K7EA 3KZPA 4AY1A 3EMQA 2DQXA 2NWSA 5F2LA 1CXLA 1TJ2A 2TPSA 3LN3A 2PGRA 4C7FA 4EIVA 3C3UA 2AL2A 2Y62A 1KBBA 2A3BA 4FLRA 4HCDA 2AAMA 3WD0A 5C9XA 1XD0A 3GH7A 2HTMA 4MY9A 1GGOA 4MB4A 3WELA 3MMWA 4WGHA 4QLKA 2HE8A 3B04A 1W5OA 1DQXA 4PTWA 1XIJA 1ISWA 4KETA 4JFUA 3SGGA 1JXKA 1MO0A 7A3HA 4A29A 2ESCA 4EOUA 1I8JA 4JPGA 1BXCA 4ZMGA 3G1SA 4GQGA 4NAFA 4US6A 2VRQA 1M41A 4LCRA 2CXGA 3MZNA 4BKNA 5I06A 2RJGA 2XSBA 3AS0A 3LXAA 4Q8TA 4S3JA 5D9PA 3WIJA 1XCFA 3GDRA 3GH5A 1O5QA 4UMBA 1PJ9A 4HZ8A 1AQHA 3CWOX 4Q8NA 4ADSA 4DAFA 3T8QA 2Y7FA 2OZ8A 2OODA 9CGTA 4XAYA 4JTSA 2C0HA 1OM0A 1VFOA 3E0WA 5CJ5A 3ZWSA 3ZQ9A 1YYAA 3H6OA 1I0DA 1CGTA 2Y85A 3UEQA 5K9DA 6CGTA 4CQAA 4H8VA 2ZWZA 5EPDA 1EO5A 5C8BB 4HN8A 4I5XA 4JHOA 2G50A 4POCA 4M8UA 3KDOA 2VFEA 1WDRA 2VD8A 2DJXA 3BLFA 4R9OA 4HNVA 2F8QA 1PUDA 1K9DA 3TOPA 1I2NA 1OC7A 4IUOA 5GJMA 4A05A 1PDZA 4TOQA 3UZZA 3LDVA 3TTQA 4WQ6A 1JDCA 1E73M 1E4IA 1XYLA 2VD9A 4AU0A 3W1QA 3T0BA 1DWHM 4JTTA 3G8EA 3AYRA 3C2VA 1OFEA 2XVNA 2WBGA 3KM8A 3HURA 3O8AA 5CZ0A 3N2BA 3MUZ1 3W7QA 4NJHA 4HU3A 4DBDA 3WQFA 1IV8A 4BQ5A 4O50A 5F2GA 4HHHA 3L4TA 2UBPC 1BPLB 2EPKX 4IMCA 4H9TA 3V18A 2PTWA 3VIKA 1IHIA 1UD5A 4NNBA 2QCNA 1WX0A 2Y8KA 3HBLA 4UTUA 1GVEA 1NJJA 2XIIA 3VIJA 4MVAA 1IXPA 1VKFA 1Z41A 1F4HA 1T7LA 3SRHA 3KCLA 3OTRA 4OBRA 4LUTB 5CPOA 3FK4A 3WUFA 4Y2WA 1FH9A 1BVZA 3G0UA 3XISA 2V0TA 3TLLA 1CI1A 4RZBA 1RHCA 1FWGC 4QE4A 3RILA 2ISVA 3QV7A 5D03A 4HPNA 2I16A 4MKSA 4LOCA 4MG4A 1JNDA 1IT7A 3NIYA 4G1KA 1ECQA 2GOUA 2C7FA 4X2PA 1KLYA 1X7FA 7TAAA 3VZYA 4AZCA 3N14A 3GQYA 2D69A 1Z48A 3CHFA 2V5DA 1TJPA 2R91A 1OYBA 1TVPA 2VKZG 3WQWA 2ZZ1A 1LWHA 4QQUA 4EACA 2Q8LA 1JQVA 2RDXA 2PDIA 4AUBA 3DFNA 3N73A 4HNCA 1ZAIA 8XIAA 4BWLA 3PB0A 1VLIA 3WLHA 2GZXA 3KOXA 3KW3A 1GYMA 2PC4A 4C6KA 3N4AA 2FVMA 4EXBA 3WF4A 2YDQA 1T40A 4RZ6A 2CETA 1P7TA 4WKFA 1O95A 3CV6A 3FEQA 3BSMA 3VE9A 3ARUA 1JCYA 3E2SA 1RV8A 4ZOBA 4NILA 4W8LA 5CZJA 4XUYA 1CNVA 2V5LA 4B16A 2PRLA 3SSJA 2PDMA 4U33A 1XLKA 1AA1B 3VIMA 1ECEA 3RCMA 3O15A 4CNOA 4XBSA 2VR4A 3S5SA 3VMPA 1RSCA 1TE1A 3BQ5A 1Z44A 4GE8A 4LC6A 3PFMA 2AQOA 5AVHA 1M03A 3FVDA 3SN4A 2B7QA 3G1RA 3ZFHA 4ATLA 2XISA 4IGHA 4KFNA 1OHLA 5G1YA 1G9HA 3VNZA 4XAPA 3WD3A 1YNPA 4I9JA 1IE7C 2A4AA 1KM6A 1F61A 1B3ZA