1EZWA

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
347
structure length
347
Chain Sequence
AEVSFGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDWISGGRAIIGMGPGDKATFDKMGLPFPCKIPIWNPEAEDEVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVKARSIQGSDIPFYMGAQGPIMLKTAGEIANGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEATKIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIGKGDFGTAIGLVDEDMIEAFSIAGDPDTVVDKIEELLKAGVTQVVVGSPIGPDKEKAIELVGQEVIPHFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 128
structure length 347
sequence length 347
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1ezwA00
3C8NA 2B81A 3SDOA 1M41A 1RHCA 4US5A 2I7GA 4UWMA 1F07A 3B9OA 1TVLA 1BSLA 1FVPA 3FGCA 1Z69A 5LXEA 1LUCA 3B9NA 3FGCB 3B4YA 1NQKA 5DQPA 1LUCB 4US5D 1BRLA 1EZWA 1YW1A 3RAOA 1XKJA 4J2PA 1BRLB 5AECA 1NFPA
chains in the Genus database with same CATH superfamily
2I17A 1P4CA 4C6JA 1BWKA 2CU0A 2EKCA 1R6WA 2QT3A 3BXWA 2Q8ZA 1KWGA 3WQDA 3BLDA 1EJSC 3ZZ1A 1PZ3A 2B4GA 3KS6A 1M53A 4QG8A 3SO7A 4IQDA 3S1XA 2PGRA 2XIJA 3AMLA 3WBYA 1S38A 4F8XA 4Y8EA 4EOUA 3GXDA 1E1EA 2J7HA 2BASA 4I9TA 1GKRA 9XIAA 1NOWA 3C4UA 3CO4A 4LAKA 1MRQA 3FDKA 5HINA 4ERIA 3O0KA 4NILA 4GQRA 1JFHA 1XLBA 5FJUA 2NV1A 1XLAA 3S4TA 3UGRA 3W23A 2HMCA 1GT8A 1U1UA 4M7TA 5EMYA 4IQLA 4JQ4A 1A47A 3H4GA 3GW0A 3EMZA 1R30A 1YPIA 3CL6A 2VMFA 1REQA 3NVDA 5I03A 2G0WA 2CBIA 4WKAA 2GQ3A 3F03K 4UZSA 2J8FA 5D09A 1ZRQA 1QXLA 3CU2A 4N0RA 1W2PA 3W7NA 4NHVA 2E09A 3VILA 2D2OA 4AD3A 4P5UA 2PD9A 1MNZA 3CUJA 3M64A 3CK5A 1YX1A 4BQ3A 1CXEA 1A5UA 4JGDA 2PS2A 2GVLA 5CPOA 4TIMA 4JX4A 1A5NC 4C1KA 3FJNA 1EYEA 1TPEA 1UJQA 3WLLA 4UTUA 4JY9A 4CCZA 5HPCA 4Q8MA 2CLMA 4DO7A 3ZSSA 4XUYA 3ISIX 1PDYA 1OFEA 4FOUA 5KZ6A 4PR4A 1YE6A 3EX4A 4LEFA 5BYWA 3RG6A 5BXRA 2PDUA 4M82A 2VL4A 4FP1A 3W1QA 1CLXA 2Z7KA 1ENUA 3LG3A 4LNYA 1HL2A 4F0RA 5D2WA 2WO5A 4AISA 3UERA 4AY1A 3WD4A 1I60A 4UC5A 4FNRA 3WF4A 1M68A 3M46A 1ZENA 5J5RA 1ZBWA 3ZR6A 2B7OA 2E8YA 3CV7A 2YFOA 2XFRA 2QUVA 5I02A 4AEOA 3K8KA 3DOPA 1TV7A 2YDRA 5EMJA 2WK2A 5D03A 1JPHA 2D2GA 5CKSA 1FCVA 3NPVA 1UZ4A 2EJAA 4A3YA 1H7NA 2CETA 1LG1A 2WWDA 1KCLA 4IXHA 1VJZA 3MMUA 3FJLA 3ZJ8A 1SW3A 4N9BA 3NG3A 4PC8A 4UTWC 1A4LA 3IGUA 4GJJA 2NUYA 1R85A 4ZL1A 1XLGA 3NXFA 4WJ8A 2X1RA 2QUNA 5M03A 5C9UA 2ZRYA 1OF6A 3GR4A 1OF8A 4Q8PA 2V5CA 4HNTA 4OQVA 4C6EA 4OTKA 3WCZA 1XF0A 2KZHA 1A3WA 2Q3RA 4LAMA 4DWDA 1PVNA 1IWBA 5D33A 2D20A 4MADA 3QSRA 4KW2A 4V28A 3NCOA 2F6KA 3H12A 5E70A 1YPFA 3DUGA 5G2HA 3ZJ6A 3KRSA 4YCOA 2GUUA 1H7OA 1P0BA 2WNQA 1RH9A 1OX6A 3FJ4A 1W8GA 1SW7A 4I6VA 3XINA 1VH7A 2R1PA 3AS1A 3I3BA 4XKYA 4A3HA 3CAKA 3M7SA 1I0BA 3MP3A 4O1CA 1OD8A 4IMFA 3GXTA 2OZ3A 5FL0A 3V0TA 4GUGA 5GNXA 2GJNA 5FESA 3OPSA 3VNKA 5A8QA 2G4JA 3CYVA 1TWZA 1XD1A 3K1DA 4QCEA 4CNPA 3F2DA 4O13A 4JFTA 5HATA 3WLMA 3VGBA 4AZGA 1JYXA 3FHQA 1PJ9A 2WQPA 4F79A 4C91A 2NZLA 4R27A 3U6WA 4NSBA 4RR4A 3G6LA 3IK2A 1Q13A 3KX6A 3L4WA 2JFEX 3CLWA 1VRDA 5MKGB 2WQDA 2XWDA 2H90A 3S3GA 3EB2A 1W9UA 2WJDA 3KCJA 1Q8AA 3VDHA 3LCXA 1OC6A 4J2MA 4CNNA 4L7ZA 4QISA 4V1YA 5G2IA 3PJTA 4IP7A 5A5WA 3PFMA 1F2JA 4IIFA 2Z1XA 4AZIA 1HJUA 3NZGA 4GHRA 3A12A 4IGSA 1DHKA 4ILSA 3VAVA 2YPIA 4IIDA 1RD6A 6PTDA 1PB0A 3OGSA 3W7DA 2OJPA 2JKAA 2OCZA 5A2CA 4A2RA 3PZVA 1Y0EA 2CLEA 3A4XA 2WHLA 4EP8C 3MO7A 2DZXA 1O95A 2XH0A 4DO5A 1MXGA 4AY8A 2O0TA 2IW0A 3AXXA 3ALFA 1IXNA 2VRJA 3CZLA 1HO4A 2PE4A 3C2YA 4J3SA 4LH8A 3MS8A 2A7PA 3HO8A 3G1XA 1G94A 1VD6A 3ARZA 1GYLA 5TNVA 1TPFA 4D8AA 3GKFA 2FFIA 1SJCA 1LWJA 4JTAA 3LPGA 2Y8UA 1PZ1A 4W8LA 3GM8A 4GFSA 4ACYA 3L2IA 1P6WA 4NXSA 3VZZA 4Y9AA 5BXTA 4UTWA 4LVAA 1XRFA 4R85A 4R9XA 4M8UA 3UWVA 1R3WA 3TNBA 4A35A 4YPJA 3WQ4A 4U5IA 5D8WA 1NJJA 5AYXA 1D8WA 4ATDA 4RL3A 5HMEA 2WC4A 3UWEA 3QR1A 1F74A 1H63A 4W5ZA 1F4HA 2FHCA 2P1FA 3PJWA 3HJEA 2FHBA 4UOZA 3CIXA 1XSKA 2DSUA 3MT1A 3O6AA 3P2VA 4TV5A 4X2PA 5I3FA 1KFWA 3B3DA 1KXQA 3GDTA 4PCSA 2CERA 3QRHA 1B90A 5CG0A 3RAOA 4EWND 5IFPA 4JNZA 5FJPA 2D2HA 4B4FA 3V5OA 2XIMA 5C7VA 3WH8A 4ZQRA 4XZBA 4M6QA 3T07A 3CEUA 4CU7A 2GL5A 4Q4OA 2PBGA 2ZC8A 3W7CA 2ZX9A 1CXHA 1SUXA 4AW7A 3VOGA 3W26A 2J9XA 3N15A 4FA3A 1L2UA 4I9MA 5A6SA 1LQ0A 3CGTA 3BW2A 2WZMA 4DM2A 4DJED 4F66A 1LBMA 1WZLA 2GQ8A 3RLGA 1XLFA 3LQGA 1OD0A 2PU0A 1AL7A 2FZBA 3ABZA 2W62A 1VIWA 4DXKA 4C6QA 3QV6A 2QPSA 3UZXA 2WV8A 2PGWA 3A9BA 2GVYA 3WNNA 1I8JA 2WAGA 2BDQA 1QFEA 4HHHA 1HKMA 2EG7A 2A7RA 4F40A 3BUVA 2C19A 1VEPA 4M6UA 4CN1A 1UD6A 3Q58A 1XRSA 3W29A 2DVTA 1GJWA 3H23A 4JTEA 3FAXA 3L4UA 2JBMA 1JR1A 4US6A 3C3UA 3CV6A 3W70A 1MUWA 2ANUA 1BXBA 4LS2A 3UXIA 1EH9A 1HF6A 1XLJA 2EG6A 1J18A 2NQLA 3N25A 4UNIA 1PTDA 1R7AA 3LS9A 2DFAA 1PIIA 2Y0FA 1E5NA 3SB0A 4HSNA 2NVCA 4FLSA 2BY3A 4GQ0A 1KQYA 5AKQA 1NF7A 3W1AA 4QNWA 3LNMA 1OCQA 1T99A 4XVEA 4EAYA 1TE1A 4K68A 3W2NA 3FIGA 1W37A 3W7JA 4NYYA 1QCWA 3PNUA 3K8LA 3VNMA 3VNYA 1UR2A 2VCCA 5E0FA 3QPYA 1W5MA 4CEXC 4E2DA 3PPCA 4FAMA 4HNVA 4X2RA 4AG0A 3ZT6A 4EXQA 1UD5A 5A8MA 3GB6A 4F48A 1EX1A 4TTUA 4K36A 2WCGA 4JN6A 9RUBA 2RHGA 2PP3A 3EDFA 3MBFA 4GWEA 2P50A 1AH4A 3KL5A 3GDRA 3L2LA 1DWFM 2Z1WA 4HPXA 3UZ5A 3VMPA 3CQIA 3DYPA 1FXPA 3AALA 1UWAA 1R0MA 2R6OA 3EA2A 4MB1A 4MJ4A 1LT7A 3W4RA 2QAPA 3EB3A 4TVUA 4TX9A 1KFEA 3LQLA 3ZO9A 3NZRA 2BBFA 2HVNA 2WMJA 3M9YA 3TIMA 1HG3A 2DP3A 4NU7A 3S2NA 7XIMA 5TD4A 3WF2A 1XIFA 3F4DA 1X6NA 5LIUX 4FXSA 3THDA 1Q3NA 2OU4A 1GG0A 2X42A 1S5NA 2I1OA 2OGYA 4IIBA 1T7LA 1LL7A 2VTFA 4MJ2A 4CVWA 2P88A 1EBHA 3PZGA 2V5DA 4MZ8A 1EEPA 3R0UA 4O28A 3CHDA 4XTIA 5B7ZA 1V5XA 3W02A 4O14A 2VFEA 3QXBA 3BOFA 4A8NA 2IPGA 3GRIA 3BCJA 3GIPA 1J4EA 2GUBA 1E4NA 2JQXA 3UJ2A 3LCFA 3UD6A 2PC4A 3QPEA 4Z17A 4CGTA 3F4NA 3CWHA 3KOXA 4QJ4B 4A8IA 3P0WA 6ENLA 1S2CA 4US5A 1H60A 1A49A 3BZGA 3TROA 1J6PA 3L23A 3TNOA 3EEGA 1VRXA 3I6TA 1EO7A 3S6OA 1ADDA 3EKLA 3W73A 6ALDA 1XDMA 4XD4A 4S3AA 1EL3A 4ADUA 4KCWA 1HVXA 9CGTA 4J3WA 3TN6A 3D5HA 4BF9A 4FX7A 3B8TA 1GQIA 4V33A 4LUTB 2I56A 1WDSA 4KF1A 4AEEA 1KQZA 1VAHA 3VOJA 5FCZA 2ONEA 3G8RA 2PCEA 4PMDA 3GXNA 5AYYA 2GJXB 3AI0A 2AL1A 1AG1O 6CGTA 3NZ1A 4RDWA 1GW9A 3FK4A 4GCXA 4KWSA 4Z2KA 2CZ5A 5DRCA 3ZQ9A 3QSTA 4RV3A 4WDWA 3QF0A 5A6AA 1SPQA 4B91A 4IFRA 3FS2A 4Z2LA 1V08A 2P8BA 1KM5A 5I23A 1NARA 1AD4A 1QMLA 4AFYA 1DL3A 3WMLA 1RAKA 1KGXA 3MCOA 3URQA 1ZL1A 3MVIA 3N9KA 3SN1A 1UW9A 1DVJA 1GVFA 2QVHA 4C7DA 2PGFA 3RIKA 1M7PA 1ZB5A 4MNMA 1UKSA 1ZU8A 5FKYA 4GI4A 1BYBA 1TMQA 4PRWA 4QEEA 5IRPA 4OV9A 4PCPA 1OB0A 2ZUUA 1JQXA 4XUGA 3W7HA 4JTQA 5A6MA 4IICA 1ZBVA 3SW6A 3QC3A 3KTCA 1GORA 3GG7A 4GC4A 3PK7A 3W7KA 1YNYA 4XBJA 1K6AA 5MHBA 1P0NA 2OR2A 3M4HA 4P8VA 4UMAA 3SY1A 3TAKA 3SI9A 3FA3A 4GC3A 5LNRA 1M3UA 1JEZA 3V3WA 2WB5A 2WHJA 1VC4A 4AWUA 1Q6DA 4M51A 4WEVX 4HOZA 3RFAA 4K8EA 2VP8A 5C7HA 3TA6A 3WLNA 3WNKA 2GJRA 4RV8A 4JFUA 4Q4KA 3HPSA 2E25A 1SO6A 1F8IA 4GINA 1DJWA 4V15A 4YNGA 1EA0A 2F9RA 4HMEA 3BJFA 1WDPA 2FB2A 3WJYA 1EGVA 3QW4B 3VCNA 3VMOA 1CGUA 1KRBC 3NVTA 3VIIA 1J01A 4DBDA 2VFHA 3O2LA 1XLIA 2E5DA 1PE1A 2DZAA 5GQBA 4ZTYA 5H6HA 5LIKX 3L65A 1SFLA 4UR7A 5AHNA 3I68A 1EDGA 1EIXA 3VDCA 1R2TA 3G1YA 1V6UA 2WJFA 2J7FA 3MI3A 8CGTA 2AOSA 2V81A 2EF9A 4LX4A 4KGLA 1OG6A 1YBQA 4OUEA 3VGGA 4GA8A 3VKCA 3ZWSA 2JEPA 3SCRA 2O9TA 2X8RA 3QKZA 3O6YX 4IQJA 2V2DA 4AX6A 3NDOA 2I9EA 4PCNA 3ANYA 4TR9A 5EMLA 5G2WA 2J7GA 5A1AA 5LNWA 4ZODA 5G4HC 5A8PA 4KESA 1A5CA 4Z1CA 4J5NA 4O54A 4NKCA 2ZWZA 4DI8A 7TIMA 3L66A 5AZ1A 2FJKA 3HU7A 3C0SA 3BAIA 3R94A 4PUUA 4XZMX 1UKTA 1KM2A 2G5WA 3DXIA 4Q4MA 3BMVA 3QTGA 3CZ8A 3UP8A 3ARQA 4WKHA 3PSWA 1Q8JA 3W2JA 4JDYA 4XZNX 3T8QA 2Y70A 3S1VA 1OBAA 1VFFA 1QWGA 2C91A 1E73M 2BXVA 2XWEA 1ONRA 5JBFA 3ITVA 3OYXA 4K38A 1TJ2A 1VKFA 1I45A 3LBOA 2BSLA 1UQYA 1FWAC 4QQUA 1GCYA 4FR1A 3QY6A 4W4QA 4UFLA 1F76A 2VWSA 4UFMA 3RLHA 1T5AA 2EKGA 1GVSA 2BVYA 4CQ9A 2OLHA 1ZP4A 4K1WA 4IL2A 1FWNA 3ITCA 3GK0A 2DT3A 3FVMA 3LV6A 1XW8A 3K4AA 4MYAA 5EMKA 3H7RA 5DO8A 4S38A 1UKPA 4I9JA 1J10A 1OYCA 1FX6A 2XN2A 3RJYA 1QW9A 1H4PA 2QEZA 1UWSA 3E0LA 1BGAA 4MWAB 3LGDA 2NV9A 4N6EA 2TRSA 1H61A 3R10A 7PTDA 2GOKA 4HNOA 4S3GA 4I8DA 4DEFA 1JXKA 2ISSA 1Q6LA 3DCPA 2Z6JA 4TQTA 4RNFA 2GGIA 3IVSA 3S42A 2X40A 1UR4A 2CBVA 3PG8A 1GQNA 2VFIA 1WOBA 1J0KA 1W3LA 1VF8A 4GI8A 1G7UA 1GVYA 3SDOA 4TVCA 4KCTA 1OZQA 4LRTA 7REQB 4L6HA 5C9WA 3DERA 3LSCA 2ZCGA 4RNJA 1YKWA 4DLFA 3QLDA 4LUIA 3ZFHA 1XFCA 4IPJA 4YMZA 1FH7A 2BXZA 1IZCA 3DHDA 2VENA 2DUXA 2CW6A 1ITXA 3RM4A 1VCGA 2O9PA 4D8ZA 4ACZA 2NT0A 3AHYA 5AHEA 5HULA 4W93A 1RR2A 1SSDA 3TQPA 4GRSA 2PBOA 1UIOA 3ZLHA 2AMGA 4PTMA 2HV5A 2YCLA 4BKNA 4YJ5A 1EJWC 3R8RA 4D2JA 2JIEA 3GC5A 1KM4A 4LUJA 1EJTC 1J2BA 1Q6GA 1TPB1 2CWXA 3UQNA 1OFRA 2POTA 3MJYA 4HMCA 4UTLA 2GOUA 3PJXA 2E28A 5A8OA 3HURA 4GIEA 4IUGA 1PXGA 1X8CA 4JAWA 1ZQ5A 3RJXA 4EX4A 1SFTA 1X38A 2WLZA 2CZVA 4AD1A 1VFMA 5B7YA 4C1NB 1JNDA 3BV7A 1L0PA 2XTKA 1WPCA 5KZMA 1DWHM 2VZOA 1LOSA 1FWEC 4PBEA 4FHAA 3NFUA 4LAZA 4EF9A 2BHUA 3N2BA 3VNJA 4MGGA 1PV8A 5A6KA 2WVTA 4LGXA 1E1FA 4TX8A 1XLLA 4MNKA 1XHGA 4ERGA 5LYRA 2VEFA 1U30A 4MPQA 4MY8A 3QBUA 5ABTA 2NVAA 1HL8A 1BVNP 4H1ZA 2ZXQA 1WQ5A 3V35A 4U31A 3NPXA 4X9YA 2QQ6A 3M5ZA 4ZQOA 3TYUA 1DJXA 1K7FA 2H8XA 2H3DA 2X1SA 4JQ2A 3AXKA 2BLEA 3UCDA 1Q63A 1WKFA 2HXTA 3ZJ7A 3TCEA 2XM1A 1ZAIA 2QCGA 4DI9A 1O5XA 2GJPA 3KVKA 3OBAA 2CNCA 1TZZA 3LSBA 2A3EA 3FYOA 4XBKA 1TUXA 2Z2AA 2OQLA 3BJSA 1J5TA 1O66A 4B5VA 3NNTA 4WDXA 1OJXA 1SZFA 4QJ3B 2Z27A 2OMAA 1ECEA 4QGCA 4DWSC 3G77A 2ODOA 3QM3A 2XG9A 1WZMA 3K30A 4E8GA 4MFEA 2PMQA 4MY1A 4RCXA 2NUWA 4IPLA 3VD5A 3IUHA 4JL1A 1W9BM 1WDWA 4L4OA 3OODA 5G1YA 1JDDA 4P7QA 4W8AA 1ZAJA 3M5YA 2IPJA 4HGXA 1T8XA 1Y5WA 4GIAA 4U2ZA 3GUWA 3WDQA 4M81A 5DBTA 3WDPP 3N11A 3SY8A 1EZ2A 2GYIA 2OT0A 4PRRA 3MMTA 1G9HA 4TXEA 2XU2A 2GWGA 3P67A 4JYEA 2HK1A 3OA3A 3MUZ1 1NOUA 4EVZA 3CHCA 2V38A 4IJCA 1L9WA 3BAYA 2O4MA 3UWQA 4H00A 1MDRA 3H70A 5HBFA 4L4MA 1ME7A 5HNTA 3R5EA 1QASA 1F4AA 3QQ1A 2VZSA 1X1OA 2X2GA 1L8NA 3E96A 2QV4A 1L6WA 4A3RA 4HK7A 3BJTA 3L0NA 3L4ZA 1UP2A 4GXPA 3L2MA 4YCPA 3W2MA 1XLKA 5HR7A 3NEHA 4JHZA 2F2KA 2UY2A 1OFPA 2O9RA 5HJLA 5CC3A 2CHOA 4C5ZA 1KM3A 1Q6FA 2DW6A 3BWWA 1KKOA 1E1CA 1EKOA 4KBXA 3SIZA 4DZHA 2P3EA 2KX9A 4M29A 2R82A 4H9UA 2XINA 3EWXA 2HEJA 3ITXA 1MXDA 2IPFA 2WSQA 1E5JA 2TAAA 2VEGA 1A5OC 4ERAA 4ZQNA 3VMNA 3AXIA 1KLYA 3R0KA 1JF5A 5K4XA 5AZ0A 2UY4A 2QHAA 3FGCA 4RW5A 1GOXA 3R0DA 3VIGA 3VD4A 2PRHA 2QIWA 1SU5A 2XIQA 4GYPC 4EACA 1EYWA 4B5TA 3MYOA 5F7UA 3EXSA 1BF2A 5CXPA 3TQKA 5I2UA 4IWWA 1ZUAX 1AW1A 1ZAHA 2VXNA 3CB8A 2Z4GA 1QI3A 2GVGA 4MUZA 3W6LA 4HCHA 3WF1A 1H7WA 5AC4A 2J8TA 1J12A 3WBAA 1I9CB 2VR5A 1EDTA 3UJEA 3HQNA 1E55A 1RK6A 4JY8A 1GNXA 4FB7A 3MZ2A 3IIOA 4YTUA 2F84A 3B4YA 3SCVA 4HHMA 3NL2A 5E9XA 2QV5A 3RCNA 1WO2A 2GGGA 4S3JA 1M9HA 1XLEA 4AZ7A 4D9PA 4QR6A 4PUMA 5D2YA 3MQTA 4L4PA 3L67A 1MWOA 4ONVA 2ZZ7A 4PUDA 2DSWA 2CXGA 3QZEA 3LTYA 2VFGA 3MWCA 3NEVA 3LLXA 4DWSA 1K02A 3W7IA 2EG8A 2A79A 4GQBA 1R3TA 1IEWA 1DJNA 4KT2A 1ITUA 1I1WA 4QLKA 1N8IA 4MKNA 3D6NA 2O56A 2BX7A 2QF8A 3S83A 4NZ5A 2TSYA 3AMGA 4XV0A 4KETA 1WDDA 2J9ZA 2PZ0A 7A3HA 2J62A 3W84A 4R88A 4JIHA 5CGQA 4DLMA 2OYLA 1VBHA 1A5LC 3E9AA 3N6QA 4L64A 4GY7A 3CQHA 2BGSA 2WHMA 1IGWA 4CQDA 1VLWA 1E9ZB 1GW1A 1NSJA 1LOQA 3AHZA 1OVDA 3P14A 1LG2A 1ML1A 4BA0A 4D6DA 2WCAA 5I3KA 3HZ3A 2Y2WA 1US3A 5CC6A 1XBYA 2FTPA 3L7RA 3E0FA 4NT0A 1J93A 1JYVA 2YA2A 4QFUA 1UASA 3B8IA 2FYMA 3FCPA 3N04A 1C8QA 4GY0A 1AODA 1O7AA 2HSAA 5HWMA 2ZTKA 2P76A 2XYLA 2J6XA 2ZX6A 4RZ4A 2WWCA 4DUWA 8A3HA 2O9OA 4YIWA 3P7YA 1W1TA 2CEQA 4MY9A 4MAZA 1F6KA 5CPTA 4FF5A 1TRIA 3PPHA 3NZQA 1VZWA 1PX4A 3W71A 3ZS4A 2PPGA 3WUFA 3RX2A 2C7FA 4KFNA 1JZ6A 1D3HA 1OCJA 4CNOA 3LPOA 4MB4A 4L9YA 3W6YA 4X0VA 3TDFA 1IT7A 3HV9A 1X1ZA 1MW3A 2RJHA 1E56A 3TSBA 4CQCA 3HOJA 4NNAA 1IEVA 5CAHA 3ARVA 2IKJA 1NDVA 1Z9AA 5T9BG 3TR9A 3SGZA 3A5FA 1VHNA 4HN4A 1XG4A 4QS6A 3NL6A 1DIOA 5AY7A 3VOHA 3T2PA 1GVIA 3G1HA 3CUXA 4DJFD 2CFFA 3PBVA 1UUMA 4UCGA 2PDGA 3VGFA 1B4EA 1V3KA 4GYPA 2GK1B 3M16A 2ZA2A 1JDAA 1YW1A 3P61A 2J6VA 2CLFA 8TIMA 4L9ZA 4R53A 3GZAA 4Y2WA 4B2DD 1TV3A 2FQIA 5F2IA 4EXBA 3E2RA 4QG9A 1ZBKA 3KAOA 5D38A 3KBMA 4JTGA 4TMBA 5HQMA 2C14A 4M80A 4WOZA 4JL2A 3PUGA 2QUUA 3ZR5A 3W22A 4EXAA 2R9RA 3S8HA 2J77A 2YB1A 4HSOA 2R1LA 2GDQA 5HNRA 4W86A 4RJEA 5FA5A 4KKXA 1YRRA 2DV0A 4G7EA 4D6FA 3B0UX 1DV7A 1B30A 2IXVA 5JH2A 1RQHA 3WQPA 1XCFA 3DFQA 2HRWA 1QRQA 2WVVB 4H7VA 2AMXA 4B5UA 1GPWA 3G1AA 3EKGA 5DQPA 4XIMA 3CUIA 1VCFA 2FTWA 2A1YA 1LOLA 3MZNA 4AHPA 1K03A 4AZCB 5CZSA 1OX5A 2I5QA 1EUNA 3AIQA 2MANA 1GPFA 2VDIA 3VK5A 1YDVA 2ABBA 3M0LA 1U5HA 1S2UA 4J3VA 1JUKA 2XJ7A 3B9NA 3P0XA 1G69A 3SR7A 3NYDA 2YCEA 1NIUA 3E12A 4F2UA 3W1UA 1A4MA 1TREA 3W25A 1Y5VA 1XC6A 2VFFA 3LHTA 2B7NA 4ZB0A 3PZNA 2WC7A 3VZYA 3LY0A 2EQDA 2BVTA 3AIWA 1HT6A 2ALDA 1QUMA 1JVNA 1KRAC 5HMFA 1SW0A 4G8TA 4LU0A 3C2EA 3N2TA 3W6MA 2VVNA 5DY3A 1V8EA 3KBJA 4C1LA 3TJIA 1PIFA 3UG4A 1QI4A 1EWEA 4H8HA 4JNYA 3NR0A 1HJWA 3SUWA 3LHWA 2E6DA 4UTJA 4XBSA 1UR3M 5G4EA 5RUBA 3ABXA 3G2GA 2O7SA 3PZUA 1TQJA 1LTDA 4ZOCA 3S5NA 2Z1KA 4GY1A 1GOKA 1IQ8A 1NQKA 3H21A 3V75A 3PTMA 5I3IA 4C6CA 1W2VA 2CXEA 3L12A 3MHUA 2VZTA 1TZ9A 4GK8A 5TF0A 4K7VA 1GJPA 2D0HA 4URIA 2VQTA 4AY7A 3OJGA 4EANA 3LD5A 3WELA 2DH2A 3K46A 3PFRA 1XH1A 2NXIA 2FH6A 1H50A 2QS8A 4PUEA 4IPNB 3ZMRA 1A50A 4PH6A 2GVJA 2YXOA 1SMAA 5D02A 4M0XA 4F0KA 2OKOA 3FDGA 3A23A 3G8EA 3SADA 1T8QA 3ABOA 2Q09A 4EAMA 3DI0A 3KDOA 3SCPA 1TV4A 5BU6A 3ELFA 2DORA 3PUDA 4YTTA 3QQ0A 2JKEA 3IWPA 3JU2A 4HZ7A 1CLKA 2DU2A 2OX1A 3NPUA 3AIRA 4U10A 3LPFA 3GU1A 1LL6A 3LRKA 2NX1A 5EBUA 3KP0A 1CDGA 1FHVA 3VUSA 1WE5A 2PGEA 3GTHA 2NQ5A 3KP1A 4HU0A 3DN5A 3AYSA 1QPNA 3QHMA 2ISVA 3B0XA 3RO8A 4YL2A 4EKJA 1MXSA 2C13A 4GISA 1ZZMA 3XIMA 1XD0A 1F6YA 3MVTA 2C1HA 2V9DA 3L5AA 1IIHA 1XIBA 3WLOA 2J47A 1ZJIA 3OOQA 2HBVA 5EKYA 1X6LA 4AZ6A 2FLIA 4XQ6A 3BQ6A 1GOOA 4F0LA 3UCQA 3W1RA 1B3WA 4GJIA 2HE8A 1JPDX 1K8XA 4UTMA 4GUHA 3CV2A 1REQB 4UNKA 3K4WA 4NL1A 2FVMA 1NP0A 3P8JA 1W0MA 1I75A 4WRHA 1YE4A 5FEPA 3EPMA 5K7JA 1TVLA 4AF0A 2PA6A 4QBXA 2REQA 4HNUA 4RZ6A 1FWJC 1GYMA 1VHCA 3CQ0A 3VOCA 1DJIA 1UZDA 2WKLA 4M6VA 1BKSA 1G67A 5D9PA 1UOKA 4D6IA 3C2OA 1AJ2A 4KERA 1CTNA 1LF1A 1M5WA 1E6QM 1HIZA 1UOZA 2NQ9A 3K13A 2VC5A 2DW7A 4EK7A 1VQTA 3U2EA 2YDSA 3NQ6A 3EBVA 4CN6A 5J5DA 1Q45A 3RU6A 2VOMA 1S2VA 3MW7A 4LVFA 4W87A 4NXKA 1YNQA 4HK6A 4LV9A 4CQ8A 1UIPA 1RVKA 2PLKA 5CQ1A 3FNDA 2E68A 5F1UA 2OWCA 5CSUA 5AN7A 3TFCA 2W6RA 1KXTA 4Q7IA 1XCXA 1CXKA 1MQRA 2YYUA 1LBFA 3R6IA 1HW6A 3LV5A 3V5CA 1UQZA 5E0KA 1W1A1 4LF1A 4O1EA 3THAA 4CQAA 5HPOA 4IL0A 2D73A 5EB8A 4NJJA 1WZKA 4ZO8A 4D71A 1RZMA 3GR7A 5F4SA 3TJ4A 1NM9A 3VINA 4DZIA 1C8XA 3W3OA 3UR8A 4GNJA 5HDRA 1CW2A 4B5WA 1RCOB 3FVDA 3CTLA 1H7PA 3WH7A 2YZRA 3ITOA 1TB3A 3FSUA 4Z1DA 2V6AA 3U5YA 1FY6A 3RF9A 2V67A 4DRSA 2YW3A 1GONA 2QPXA 1XM3A 3D0CA 5AHIA 3APTA 2RUSA 1R9XA 4KS0A 5GVJA 3AFBA 1VYPX 5ECVA 2YL8A 3M0YA 3W2UA 2I5IA 5F4XA 4MNJA 3IAQA 3KOWA 3KOZA 3TYZA 4Z1BA 1K8YA 3QEZA 1QK0A 3CHEA 1B9ZA 2GUYA 5CJMA 3NYZA 4UIOA 3S9IA 4W88A 2FPVA 1NH6A 5C54A 4WSJA 2L5HA 1NFGA 3VCCA 3GNDA 2Z2UA 3O6DA 4DXXA 5CC7A 5BMWA 1HKIA 2YLLA 5GJMA 3ARYA 3P84A 4IOTA 4HMNA 3HIJA 4GPNA 5AECA 3ZM8A 3IJ6A 1XYCA 2PTWA 3TOYA 1A5KC 1WUFA 1FWCC 1TPDA 1JRCA 1P5BA 2WKGA 3BLEA 3NURA 1R8LA 5FF2A 4KEZA 3MB9A 3G1FA 1W3NA 4MLJA 1K70A 3KM8A 5EFDA 4L1WA 4UNLA 3G24A 4O8AA 3ITGA 1SO5A 1R2RA 1T0OA 2H9AA 4GNVA 4H2CA 1OINA 3LZ5A 3GXMA 4JTTA 2B7PA 4RZBA 1H11A 3UR5A 3TXZA 3G1SA 1U5JA 1Z3NA 1TE6A 2GQAA 5U7SA 3ALGA 3INPA 2EO7A 5CZ0A 1EJUC 4OIFA 2GSEA 4RDVA 3REQA 1E51A 2VD8A 1QNVA 3TWAA 1FDJA 2NWSA 2E5CA 5I79A 3MDWA 1L6YA 3PZQA 3A3WA 2W66A 3W28A 4FSAA 1JF6A 4I8YA 1CLVA 4HMDA 1NFBA 2ISFA 2VCAA 4PL2A 4DAFA 3NSNA 3RLUA 1DEDA 1LRTA 3WNLA 5BWFA 4YXGA 3MKKA 1DJZA 3BSGA 1J0ZA 4IFOA 5T91A 4U3AA 4GFIA 3KHJA 4S3BA 1AVAA 3WO8A 4BR1A 1SR9A 1TUFA 4GOAA 3PS7A 1RCQA 4NI8A 3FEMA 1DTUA 1TVNA 3ITYA 4JYDA 3L5MA 4HYVA 4ATWA 4N9EA 3SZ8A 2DZVA 1TJRA 1OIFA 5I3HA 4NYUA 1ITCA 4B3LA 4C6MA 2QULA 3ABSA 1K4GA 3TU9A 5MKGA 1EFZA 1J9YA 1YPXA 3TLQA 3SIMA 5I09A 5JBEA 4UWMA 4O0ZA 4UTKA 3M0KA 6A3HA 1W8SA 3FHAA 4O18A 2E7FA 5F4WA 1TO3A 2PDFA 4WD0A 4WX2A 3CJPA 4F9JA 5CPNA 1E6PA 5HMDA 2ZUMA 4HTBA 4HCLA 4V27A 2WMIA 3M0HA 4QE4A 4QX4A 3W82A 2IKIA 3PWGA 4IXXA 3WUGA 2DZSA 3IEBA 2WANA 4Z2HA 3MO4A 4I6KA 3KEHA 1OG0A 1OQFA 1UA3A 4BI5A 4NQ1A 5L9FA 3STCA 1EP3A 2V5LA 3FAWA 3MI6A 4L9XA 5FEWA 1SYTA 3QR0A 2J4GA 5FF7A 1OC7A 1EJ7L 1KBKA 4IH3A 4A2SA 2VZVA 4IGMA 5DCDA 1AQMA 3BARA 4ZO6A 4UFIA 2PP0A 3TE9A 3Q4DA 1LP6A 3GVRA 1KBJA 3CUHA 3BGJA 1WXJA 3S1GA 4YVVA 4QXIA 3TP4A 2QJHA 3VU2A 4E2VA 4FZIA 4DYKA 1VLIA 1TVPA 1GOIA 3VDBA 1HKJA 4DBEA 4K39A 2G3NA 2BOEX 4E3VA 1GUVA 1W91A 1XL9A 3G0UA 1TWDA 5DELA 1G4SA 3GTIA 1F3EA 1TCDA 1VR6A 3DI1A 4QEHA 2ZFAA 3A3XA 4R5EA 2VEKA 3ZXWA 5LNSA 3T0AA 3ANUA 1FP9A 4Q6XA 4CU6A 2OX4A 1AW5A 3GQYA 1EGMA 2O7QA 4HJWA 1XDJA 4YS1A 3VKAA 1IEXA 4O53A 3NQGA 4WXYA 1J8VA 4BS0A 5A2BA 3AMDA 4BJHA 1H09A 2ZWYA 3THUA 4L1XA 3OLGA 1B3OA 3UZWA 4JTHA 2OQYA 3B06A 4UR9A 2A6NA 1E40A 3BCFA 3PSVA 1JGIA 4AHOA 1R47A 2ZKMX 4DM1A 2DSZA 3MV01 5KEZA 2J25A 2HNHA 2GSHA 1LZOA 3QR3A 3DFSA 1FCBA 5DMNA 1OX4A 1WNOA 1AZ2A 5EGRA 1A53A 3LA4A 3BW3A 3HV8A 1DHPA 3KTSA 3MUY1 2F38A 1IHIA 1XPYA 1EQCA 3H4WA 4F9DA 4ZFMA 1FKXA 2DIKA 5CPMA 4J3UA 3W83A 2IPWA 2DZWA 4JR5A 4FLOA 4L5ZA 3F5LA 1WA3A 3V36A 4HJFA 5GJNA 3PJUA 3FA4A 4J35A 4DBSA 3QMSA 4HA3A 1V3HA 2PURA 2PI6A 4HB7A 4DB7A 3CAWA 1JUEA 4A29A 4C6LA 4XKMA 4PZVA 1UC4A 2Z00A 3JUGA 3KDNA 3TTQA 4JKKA 4GXWA 3WD0A 3WFLA 4DJDD 4XZHA 1EXPA 4LYPA 4PMQA 3GVWA 3UW6A 1V02A 5FJTA 4FX8A 1UZ1A 1AH3A 1E43A 2XIIA 3DHUA 5KSWA 4YHGA 3O06A 4KEMA 4R7WA 1H51A 2A5HA 3MTWA 3DECA 4RE4A 5HWNA 1ISXA 1BG4A 3FW6A 5TBOA 2E5BA 2RDXA 2YIHA 2XVLA 3PG9A 4OBSA 1XGEA 4F2TA 5KMYA 1HGWA 2VGIA 2YDAA 4AMAA 4C6KA 4A4AA 1X96A 3CMGA 4C65A 3VOIA 1QHOA 2NLIA 1IR1A 1DQUA 3U7BA 3QGAC 1QNOA 1LUCA 1G5AA 3TSMA 3PBMA 3HPZA 5D2XA 3LRLA 1JCJA 4GGHA 1SR0A 2PWGA 4KIEA 2TODA 4ZQPA 3UZJA 4Y96A 1W9VA 4PA8A 2PLJA 4AWTA 2YBVA 2FJUB 1FCQA 5LGZA 4HP5A 1BRLA 4FXJA 1OFOA 1ICPA 1UWQA 3PBWA 3W85A 3BANA 1MZHA 1XJBA 4OU1A 1DQXA 3OVPA 2UBPC 3GLCA 3NIYA 1G6CA 4GH3A 3BH4A 2D1ZA 1Y8BA 2WM0A 1XBXA 4GH1A 1XC4A 2YYTA 3ARPA 4E3TA 2BV9A 3TOPA 1J0YA 1VJSA 4S2CA 3HB9A 1F8MA 2V5JA 4U5KA 1W1ZA 4JIRA 3PM6A 4LB4A 4ML4A 3NAVA 4B90A 4BCEA 2W67A 4PN2A 4B5NA 1PEZA 2DJLA 3MJMA 2YL6A 1E4MM 3PANA 1GOWA 1O12A 2Y5JA 3UVAA 3U3HA 5CSSA 3CO8A 4OZOA 1JCYA 4LANA 3W24A 5I06A 4IMGA 3WD2A 4NX5A 1CGYA 2RKXA 4B5SA 1JIBA 3OZOA 3KFTA 1MQPA 1F3WA 2INFA 4FNSA 1K9FA 1NWTA 3VXGA 1FVPA 3VIMA 5LA0A 4UQ9A 3I10A 1I2OA 3U2OA 3BAKA 3VPLA 1ONEA 3HN3A 1Q6EA 5JMUA 2AGKA 5IDZA 1QHPA 3BTNA 2AQWA 1XQLA 3RDKA 3MCNA 3HGJA 1I2NA 2QDHA 1FDZA 4JIEA 1UKQA 4O4VA 4GYKA 4LRSA 1KA9F 1TKKA 2HPIA 3U48A 3UGVA 3SM0A 3F4CA 2D69A 1WV2A 2GDUA 4Q4SA 3JW7A 4XVDA 2GZXA 4TO8A 3I3DA 3GIQA 4WGHA 1E6XM 4MNLA 2X7VA 5A6BA 2JF6A 8RUCA 4NRRA 4JN8A 1JGMA 1H0GA 3ATYA 4CU8A 5HXMA 4PTXA 3MHGA 1ZJAA 2QCMA 1E71M 1EUAA 3W74A 1FHUA 2OOFA 2POZA 1FFRA 3SCUA 3AYVA 1P0KA 4LC8A 3WH6A 4G5DA 3G22A 4X22A 2W27A 3EWDA 1X7FA 4CEUC 3UXKA 2ZE3A 3SCTA 5I77A 3WJSA 3N34A 1UBPC 3E49A 3W72A 5I78A 4Q22A 4NVTA 2V5KA 1FDYA 1V0NA 4C7FA 3LXBA 1QK2A 2X30A 2PODA 1V02E 3OYZA 2WSRA 3ABRA 3EOUA 5CAKA 2OEKA 3ARUA 4DPQA 4X9SA 3QQWA 3D46A 5A8NA 4NAFA 1MO0A 3N2MA 4WLCA 4WUIA 2WXDM 1KO0A 4CCEA 3AXHA 3WFZA 5DCEA 3P5YA 1XIIA 5JQ9A 2GWNA 1FUYA 3KLKA 3KOYA 2FTYA 3QV7A 1BEUA 3BLPX 1C8VA 3RCMA 5C5YA 4DF0A 3OIHA 3GXFA 1TJ1A 2NX9A 5C71A 5BOEA 1D3GA 3SRKA 3STPA 2V0TA 1XI3A 3TFXA 1PTAA 2A3AA 3S9ZA 3O16A 1QO2A 5GPRA 1TMLA 4QAIA 1TPWA 4HOWA 3M5XA 2FFCA 4NZ4A 1FWIC 2PEVA 1K7EA 1JFXA 4JCLA 4LALA 3LXCA 3QFWA 1Z32X 2VD9A 3A6OA 2W4XA 3SCWA 3LB0A 3TW6A 4Z0JA 4OOUA 2VGBA 3IK4A 4TV6A 1MW1A 1Q66A 4QJ1A 1CT5A 5KITA 2PDWA 4KIRA 1SSGA 2F6XA 5CZKA 3TMLA 5E1QA 3DFPA 3FY1A 4PUNA 3S0CA 3EWWA 5I00A 3L68A 4O17A 3GSMA 1W1PA 3OLEA 1FTXA 1NU5A 2D22A 3NA8A 3EOLA 5PTDA 4IP4A 3NGFA 4QIUA 1YBQB 3Q37A 3NOYA 2JK2A 4Q4QA 3I4KA 3OLIA 4HT3A 1YEYA 1H5YA 4OBRA 3R8GA 3NDZA 3BLIA 4JTFA 2X2YA 3QW3A 1NP2A 2HPMA 1VBJA 2MUCA 2YGYA 3W1MA 4OFCA 3GD6A 3U57A 1XLDA 5JVLA 2J7CA 2ZZ2A 1EP2A 4IG2A 3GXIA 2Y7DA 3KE0A 2QJNA 3TYBA 2WNWA 1MEHA 1NAL1 4DXVA 5LA1A 3Q2DA 1W1B1 4MM1A 2IQ0A 2FZ9A 2VT0A 3CZGA 5I07A 3VYLA 1XUZA 1IEQA 1R3YA 4IFKA 2P8CA 1FWSA 2VELA 2XIBA 2ZA3A 1PWMA 1HQTA 2JALA 2ZDSA 2JGYA 5GJPA 3LGEA 2VGFA 1L6GA 4O0KA 5HUOA 1SO3A 3DFOA 4L80A 1S39A 5CSYA 5BW6A 1DXEA 4AZBA 4M6PA 5CGTA 3STFA 3STEA 3EKZA 4L56A 3M41A 4A05A 4HYRA 4ORMA 3KRBA 2G3FA 3NQCA 4L1GA 4NIRA 3TJXA 5H2ZA 3NM3A 2CHRA 2BZNA 2VDGA 3FA5A 4IM4A 4XG1A 3RK8A 1Q6QA 1UUOA 3C8NA 2B81A 4GVFA 2OSYA 3L4VA 1YDYA 1M41A 3H7UA 3KBNA 4JBRA 1JZ2A 1TCMA 3GHSA 1Z89A 1XIDA 3SGGA 3URBA 4BF7A 7TAAA 4N9DA 5DN1A 4BZYA 4L6DA 2X1TA 3HPFA 2YXXA 3K1GA 2FIQA 1BQGA 3NOEA 1G1YA 3TQVA 4IIEA 1WP6A 3V7PA 4ATLA 5XINA 2V69A 3I4EA 1S5WA 2H3BA 3RU8X 2BHZA 4DYJA 1QW7A 4TU1A 2NXGA 4JFSA 2OOGA 3WENA 3GW3A 1KFBA 3DYMA 1KV8A 2NX3A 1YHTA 1US2A 3QVQA 3BPWA 4PTDA 1GVRA 2VURA 3TLLA 4HQVA 1CXIA 3KOFA 3NQFA 1HJXA 2NV2A 4LY4A 1W9PA 1WCGA 3HG3A 1GG1A 3HQ1A 1AQHA 2Y62A 1QPKA 4FR6A 2QJIA 3KRUA 2EXOA 3ERPA 2XN0A 4LF2A 1AQFA 4PULA 1CGWA 1XYBA 5I5RA 2FPTA 1VPXA 4CQBA 5DRIA 2RAGA 4E8CA 2PD5A 4KQNA 2PDQA 4ACZB 5FJJA 3BLFA 2OPJA 1WUEA 3WD1A 4DAIA 4GD0A 1MW0A 4PUKA 5J04A 2PLMA 4O8RA 1S46A 2YCLB 2I5GA 5C70A 4IISA 4AXNA 1DXFA 3PHAA 2D2JA 1KTCA 3M44A 2W9MA 4QS5A 2DDXA 1YNPA 1UR9A 4IIGA 5CZJA 4HSHA 1YXCA 3MANA 3SRHA 4WHBA 2C1GA 3EDJA 1B54A 1LL4A 4H83A 4JTUA 3PTQA 1TA3B 1OK4A 2E40A 4JTKA 2PDCA 5FEXA 3SURA 3QY7A 3AU6A 5C6MA 5AB3A 4G6CA 3IUIA 1A80A 3E2QA 2HCVA 1SJDA 5AYZA 1S5MA 3A24A 1GOMA 2ZTJA 3NM1A 1QI0A 3GZ3A 3I7QA 1XYMA 2RDWA 5FOOA 4NUWA 4K37A 1ZCCA 3P60A 4W7UA 1J0IA 5A3HA 4R9OA 3KW3A 4IX2A 4FALA 1OWQA 4H6KA 3T08A 1LJYA 2FGZA 3O15A 1V6YA 2JE8A 3QYSA 1RQEA 2F8QA 1R2SA 4U28A 4XX6A 4LCSA 3EZ4A 3VIFA 3FKKA 3RR1A 1I2QA 1R86A 1H0IA 4K6AA 4PMXA 3VNIA 4WCJA 1FQ0A 4YLWA 3UA4A 3CHFA 2VUNA 3ARWA 4Z2GA 1VEOA 4OWGA 1K8CA 5EMUA 3AC0A 3RPDA 1HJQA 3HPAA 5LXXA 1PHQA 4ZE5A 3K8MA 3H7VA 5BRQA 4C1NA 2VEPA 4F0HA 1KFLA 1Q4NX 1BVZA 1S3TC 3OZPA 1UWRA 2CBJA 2QGYA 5TAOA 1HX0A 4I7UA 5K9DA 3M0VA 1CGTA 2YBUA 2F6UA 1U1HA 1QHZA 3AJ7A 2VYOA 2ZRXA 2VWTA 2Y8VA 3T2OA 1TTPA 3CUGA 2AGTA 4KH2A 3OHMB 4H6RA 3TX9A 2I16A 4KFOA 1POKA 3CZJA 3GDKA 1BG9A 2PDJA 3UR7A 2CLOA 1UR1A 2JGQA 4LTSA 4RE3A 4FIRA 4NNBA 1E15A 4PL1A 4HHLA 3M0IA 3L5LA 1CECA 4L4LA 5BXPA 5FJOA 5BNKA 1QI2A 3PC0A 2CLKA 3UESA 2QMKA 3GNXA 1F61A 3OBEA 3L0KA 2OO6A 3ARTA 1UKOA 3FXGA 4FXRA 1X97A 3NO3A 4WSHA 2GQ9A 3OA5A 3O9NA 1ZGDA 1E1CB 2PC8A 2YA1A 4V2XA 4ZB2A 4A8RA 1ZY9A 4BQ5A 4FNTA 1GJUA 2OEMA 2FGBA 4IP5A 4O1AA 3GS6A 4J3XA 3OP2A 4GXMA 1NDZA 1NVMA 3CS2A 4OUIA 2CC0A 1FWRA 1PYMA 3APGA 4N9CA 1HKWA 2Z28A 4HTYA 3LCLA 4LAUA 5E6YA 4J3ZA 3FGCB 1LWHA 3OVRA 3W7MA 3AZSA 1NWRA 3VM7A 2CZEA 3W87A 2DT1A 1C7SA 2B7QA 3E6EA 3U9IA 2DT2A 3W75A 3FYPA 3W7LA 2J9YA 4ZQCA 5REQA 4ZR8A 3M07A 3WBWA 1PKLA 4UR8A 2QJMA 3C0QA 3RM8A 2WZTA 3H8AA 3W07A 1XV8A 4L6OA 2CESA 3R79A 4LUSA 1W3JA 5CG7A 3TCSA 1TTIA 2HTMA 3S1UA 4GUJA 3IPWA 4OV4A 3K2GA 2FHFA 4H9MA 1XIEA 3UA3A 5CJNA 4E6MA 1MFUA 4Q8TA 2R1MA 1V0MA 4MHBA 2WM1A 4M19A 3DKJA 1KB3A 1V93A 2WSKA 3FX4A 3LBCA 2INZA 2Y7EA 3GWQA 3O7UA 4GIYA 2ZZ3A 4ICNA 1ZNNA 3WYZA 2PFHA 3EWCA 3LLFA 4NY2A 1FWFC 3AROA 2V5BA 2WCSA 4G1KA 5IDIA 2E1DA 1WDQA 3UWUA 3TMQA 2OZ0A 4NJIA 1VEMA 2J74A 4DWSB 1JPMA 1P0EA 4KWWA 3AAMA 1OYAA 3UBPC 1R87A 4A3UA 2ZE0A 5LSMA 2XZ9A 4TVDA 3T42A 2PRLA 4NF7A 1V79A 2ATSA 3G5EA 1JDEA 1UUQA 1HFBA 4GGBA 4GO8A 4UQCA 2G3JA 4UFJA 4JTDA 1XQKA 3E0IA 4NAEA 1C9DA 3RNDA 2FZNA 3VD3A 2SFPA 1XH0A 4IJRA 2WMGA 3D3AA 2PWHA 1WKEA 3VM5A 4I90A 1H5VA 1S5VA 3BZJA 1G0CA 3GKAA 4H7ZA 3WLIA 3LUTA 4UQBA 4AX7A 2WNZA 2F7FA 3WQGA 3WD3A 4QROA 1XINA 1MUMA 3W1PA 4XAGA 1NWUA 2CIPA 3MDUA 3BOXA 5F2MA 1O1ZA 3VE9A 1L6SA 1M01A 4P7NA 2PDIA 4JICA 3C2FA 3LM3A 4ALDA 4XZWA 1ME8A 2D3NA 1RBLA 4R7JA 5FL1A 4Y6GA 3VDGA 2UY5A 2Y89A 3RCYA 1UC5A 4PMYA 1F07A 1RXOB 1JL8A 3W1NA 1YTDA 1BSIA 1E4LA 3R13A 3TW7A 3ZR4A 2J7BA 5M3WA 2XSXA 1BQCA 3POHA 4HZMA 4YWSA 3H53A 3KS5A 4MWAD 1Z6KA 4QQ3A 4CD8A 3E0VA 4LVBA 1CB7B 1MSSA 5M5DA 3DEQA 1KM0A 2OG9A 4H8UA 1PWLA 2Q8XA 4HZ8A 1XS2A 1ODZA 1BTCA 1JRBA 5H8PA 4XD5A 3T81A 1C93A 5JUVA 3U4FA 2DH3A 2C0AA 4E4FA 2NQHA 4MTVA 4LJ3A 3NQ8A 1CPUA 2YW4A 2Y61A 1RBOB 2VCBA 1AMYA 1EOMA 1UP0A 4XIAA 5D30A 3CH0A 3E74A 4N4PA 2A4AA 3GAYA 2PDHA 2PAJA 3PPFA 2R14A 1Q6OA 2CKRA 4XZIA 5F2GA 3GDBA 3LYEA 4AZ5A 4PMJA 4D6CA 4H2HA 5D9NA 4MKVA 2Y8KA 4KWUA 1RJQA 4O1DA 2D0FA 3WH9A 3ARSA 3KWXA 3BLLA 4E0CA 1TJPA 2FZDA 3WH5A 1XR2A 1RY8A 1E0TA 2G3MA 1DKWA 1AH0A 5T9CE 2XDFA 3WKZA 5C2CA 3NQMA 3B9OA 2FH8A 1UP3A 2ZYFA 4A3QA 4O19A 4KMQA 2JKPA 2HROA 1W56A 3GIYA 5AFDA 3PZMA 3G18A 4LVDA 4Q8OA 1XH2A 1XIMA 2OZTA 3PZIA 3FKRA 3P82A 2RDTA 4N4QA 4D6EA 3P80A 2BY2A 3PB0A 2IQTA 1TR9A 4G7EB 3AHTA 2DZBA 3WMBA 2ZOXA 4X0NA 2E0PA 3CC1A 1BFNA 4KGJA 2Q02A 2G8ZA 4M5PA 4PB4A 1AW2A 3WIJA 1PTGA 4YU1A 1L6FA 4C6DA 1GEHA 2A0NA 2J27A 3RRXA 3IIPA 3ZT5A 3M43A 1EOKA 3H2FA 1PCWA 2Y4SA 2VDHA 4LWWA 3GHTA 3DYOA 1Y7VA 4HPJA 3UJRA 5U4NA 2QYGA 1TMHA 4KEUA 3WDRA 1DWGM 1OCBA 1TWIA 3HGOA 3R89A 1EPXA 3DIPA 1H1NA 1OT2A 1E9IA 3WQVA 1QJWA 2VRQA 3WN6A 5D2VA 3O07A 2IQDA 1V6TA 2PWDA 4NZ1A 3SRDA 3NQEA 2RH9A 4JZ5A 1AFSA 4JHMA 2DT0A 1GYNA 1NQ6A 3IV3A 2Q71A 1Y5XA 2QNEA 3BGGA 3RO6A 4LB3A 3C0JA 3BG9A 4E8DA 4R33A 4YVXA 1UD2A 5BOFA 4GI9A 1K3UA 5HNNA 3UG3A 3QC0A 1VS1A 4OHQA 3W1LA 2PU1A 3OVQA 1JI2A 3OEXA 3BL3A 1W1IE 1O1HA 2V68A 1ADSA 1GQKA 1X39A 3VIHA 2QVNA 4R34A 4ORIA 4JFVA 2GGEA 4GZ7A 1PZ2A 1GTEA 2NW0A 4AU0A 2DZPA 5E5CA 2DSVA 3MKCA 3QOKA 4Q33A 4DJFC 2J7DA 1OADA 3RR4A 3GTXA 3N4FA 4C6NA 3OGRA 1TYGA 4JTIA 3MV11 1DQWA 3RHGA 2TPSA 4P61A 3V1PA 3GXPA 1QOQA 4XB3A 1B57A 1PYFA 3U2ZA 2ASHA 1G4EA 3B0VC 4QAWA 3O05A 5L6UA 5E6ZA 2ZUVA 1IE7C 1JD7A 4ADSA 4GKTA 4NNCA 1TPUA 2Z29A 3VIKA 2CZFA 4R3UA 1LLOA 1LCOA 5EA9A 1Q2RA 3Q45A 3TUUA 3IGXA 3DU0A 2E6AA 4FLQA 2Q01A 3ZVHA 1SJBA 2C6QA 3BSMA 2QCDA 2OSXA 2VEMA 3UVIA 3EDEA 2IMRA 2XFYA 1I2PA 2OT1A 1OM0A 3R8HA 3XISA 1W3HA 4I3GA 3WNOA 3VOFA 1LROA 5KZDA 4ADTA 5LIWX 3MBDA 4RUBA 3LCWA 4XK2A 1JDCA 3WL0A 4PMUA 3CMJA 3V0SA 1GZGA 3BK0A 2HVOA 1ESWA 1FFQA 3OO2A 3WNMA 4O52A 1GZ1A 4FEZA 4MUPA 2BFGA 3WMSA 3WLQA 3DH7A 3CXOA 5CSRA 2C71A 2ON3A 4HD5A 5D2TA 1WZAA 1A0CA 1KWKA 1E6SM 2WLYA 1CX9A 3FLUA 3SCOA 3EPOA 4B16A 1M65A 1IT0A 2QCHA 1XPGA 1KFCA 1EF2A 3EX6A 3TTEA 1XXXA 1PKNA 2XM2A 3GDLA 3QHOA 1X7IA 1JG9A 2PDMA 3QZAA 1R9YA 1BYAA 1GQLA 4JOMA 3SUSA 2DIEA 4AF0B 2REQB 3HGRA 3QKEA 4AWSA 3MWAA 1QOXA 3T4CA 1AQ0A 3L9CA 4HU8A 4H04A 5CBBA 1R9ZA 4E38A 5LGXA 1U33A 1HGYA 4GI6A 4JTLA 5D04C 2A6LA 4ASTA 1VPQA 4WZHA 1NWSA 3WK0A 4NJKA 4AVNA 3MYPA 3AO0A 1RLCL 1U83A 2A3LA 2IKHA 4A22A 1YXDA 3U2CA 4ES4A 1Q6RA 1SVDA 5BU9A 2QDDA 3Q94A 4DBWA 2AQOA 3DFNA 1SJAA 3ONBA 1MQQA 3EOOA 3T0CA 1QNRA 3OB8A 2YCKX 4AC7C 1KXHA 1RD5A 3TK7A 3PB2A 4S23A 1OYBA 1WKYA 5HAOA 1EA9C 3N14A 4GVHA 1XYLA 2P3ZA 1K9DA 4XAPA 3G1DA 2OQHA 1OSEA 4JIIX 1JULA 2W79A 4XISA 1P7TA 2FDSA 4UOQA 3VC6A 3B05A 2VC7A 1K9TA 1DJGA 4M3PA 3R11A 3LEPA 1KBLA 4IF2A 2X7WA 3BAXA 5BRPA 2ZBTA 4J4KA 1D3CA 2X05A 4CUCA 2RFGA 2CCRA 3WEMA 5DLCA 3KXQA 1WXZA 1KCZA 3VA8A 1X8FA 4ZOAA 5DF0A 3LTSA 3B03A 4PSPA 4QDMA 4DJFA 3UWYA 3CM4A 4OVXA 3IVUA 1PS9A 1EC8A 1FA2A 4AYSA 2DZUA 4YTRA 1MZRA 1EC7A 1J5SA 3GNRA 3GBDA 2PUZA 4LOCA 1V3IA 2OO0A 5JXQA 4HYWA 9XIMA 3UXDA 1E9YB 1IZKA 1BWLA 3IARA 4ZGYA 3TA9A 1ONXA 4EPEC 4OT7A 1VIZA 4B2DA 1GVQA 5ECUA 3AJXA 1E9LA 4EPDC 3GUGA 3DFHA 1QVBA 3AYTA 4CVUA 1LT8A 3N18A 3ZSTA 4JPGA 1HUVA 2WKJA 3G1VA 3C3NA 1ONWA 1RLDA 1W1VA 2UZ9A 3ZIZA 1C29A 4DN1A 1EGZA 1C3FA 4RNHA 4WIWA 5CPQA 1F5ZA 4CN4A 3DG7A 3KVMA 4JN7A 1IZJA 3O6CA 2DQWA 2DY3A 1QT1A 1BPLB 1JPIA 3C86A 3W9ZA 4WY0A 3UR2A 2PWVA 1JZ5A 3QY8A 3D3FA 4LCQA 4UB9A 4KWVA 6TAAA 2NWRA 4CD6A 2YLAA 4L61A 3PUOA 2GVEA 4Z0SA 3TONA 2RGLA 1ME9A 4TX6A 4ZQMA 3QJAA 1C91A 5J8LA 4JKLA 3S47A 4PUWA 2H9AB 1CGXA 4ZA0A 3N2XA 2OODA 4B15A 1B1YA 3DC0A 4LVGA 5AOUA 1FWTA 1CI1A 1OGBA 2PLCA 3DG3A 5LIXX 1ICSA 4F0SA 1CENA 4C6BA 4MOZA 1UHVA 2WW5A 3REQB 3SEPA 3WFAA 4D6JA 4PTNA 4F2BA 3LU2A 4R7OA 1PL9A 3EWZA 1NTHA 2PTZA 3ZYZA 3MUCA 1GOQA 4E4PA 3BURA 4W8BA 1XUUA 3OQ8A 1DIKA 4QDWA 1GEQA 2B0MA 1J96A 1KFJA 3W88A 1J11A 2Z2BA 3IVTA 3P8IA 7CGTA 3VD9A 3WJZA 1AA1B 1SZRA 2EEXA 5CCZA 4TMCA 1XFBA 2C79A 3HMCA 5ABEA 4Q8NA 2C8NA 3COTA 2ZVIA 1VP5A 1T40A 5D32A 4ZEPA 2QCCA 1DPMA 1I6NA 5BROA 4ZOBA 2GPTA 3CT7A 1HP5A 4U2YA 3AOFA 1KBBA 3BVJA 3S5OA 4FXFA 2XGBA 3A4JA 3ID7A 4ZE4A 1CB2A 5DY2A 3G3MA 1HXJA 5IHSA 5I3JA 5FI8A 1T41A 4KFPA 3AUJA 1I2RA 1P43A 2BVDA 1Z42A 2CKSA 2WMIB 4D1IA 1UZHA 4AVOA 4QM1A 3B04A 1K1DA 3TN4A 1BGGA 1O94A 4NASA 5F1VA 3AS0A 4YTQA 3IJIA 1Q2SA 1GQJA 2E6YA 4C60A 4W85A 2HXUA 3A13A 5DMYA 5C9ZA 1BXCA 1EPVA 3TR2A 3UZYA 4GACA 2QF7A 5A6BD 3G0XA 1DWJM 2DZTA 2PDXA 2G50A 3B8UA 4QJ5B 3DBPA 1R7OA 3SSJA 1ZBCA 3GG8A 1YDOA 2HWGA 4FO4A 3T6CA 4GCAA 1DE5A 3I3EA 4OBTA 1JAKA 1XYAA 2PWEA 1D2KA 3RYSA 3SY5A 3VFCA 3SFWA 2E9BA 4FOKA 1BF6A 4AMCA 3VD7A 2OKTA 2PB1A 3SQMA 4FX6M 2V63A 2V30A 1TX0A 3V4BA 4RXFA 4IT1A 1VB9A 4A21A 3PN8A 3OU8A 2GDVA 3SQSA 1BSLA 3C6CA 4PUJA 4AUBA 2JIWA 4C6IA 3QOMA 1XP3A 2H6RA 3M47A 2QPUA 3PAOA 3WX7A 3TC6A 2PDNA 1VBUA 4YYFA 2ZZ1A 5GNZA 1P1MA 1E6NA 3O8AA 4AHQA 4GVIA 3RMJA 4EWJA 3U0HA 4XO7A 3O3RA 1KXVA 3EB4A 3GAKA 2J78A 4N7QA 4UTIA 3D47A 5I3DA 4Q8UA 3U8GA 4GZIA 1EJXC 2ZZ4A 4ROPA 4QSHA 3NQ7A 2VHLA 1LQ2A 4GE8A 3IIZA 1OX4B 1BTMA 1ISYA 3PTDA 3UEQA 3C56A 5I24A 1RALA 3ZLGA 4WSKA 1HO1A 1UWIA 2PRMA 3TC3A 4DUOA 3HM7A 3KTXA 3A47A 4I5UA 3NTYA 1XYZA 2DVXA 5HANA 1J0JA 3QFEA 3RUBL 4V1XA 4FNPA 1OEPA 3VKBA 3EA1A 2P53A 4RLIA 1XSJA 2ZUTA 1F9CA 4EPBC 1KCXA 4Y9OA 1EZWA 1YDNA 1VJIA 3AZRA 3R2GA 3CASA 3LXAA 2W91A 2FB3A 3VKKA 3B9EA 4X60A 3LLDA 2XUCA 4XSLA 2PCQA 5LXEA 4PMVA 1RPXA 4CNSA 4NZJA 1DWAM 4WGXA 2X16A 4C5YA 2Y88A 2WC3A 5BCAA 2VUYA 4KPLA 1XG3A 1W5NA 2BP1A 3TH6A 3GVVA 4AIEA 5A2AA 3BG5A 1ODUA 2NQJA 5DX7A 4D8LA 1Q7MA 4DQWA 1P6BA 4ENLA 4CD4A 5JIPA 3I65A 2WPGA 3NZPA 1KGWA 1W6TA 3W27A 3A3HA 5C8BB 3MA8A 5JBDA 3WUEA 3GVQA 1X6UA 2PTDA 1UYQA 3CHVA 3PPGA 3TWBA 4BEQA 3SGUA 4LS1A 3QN3A 3N2OA 1T6MA 1OT1A 1LUCB 3PVFA 2HE5A 3II1A 4PFHA 1EEXA 2IXUA 4MAVA 3WLHA 2FMOA 4LFYA 2ZQ0A 2ACUA 1I1XA 1TTQA 2DPEA 2GLKA 1PZ0A 3GO2A 1E72M 4YVPA 1F05A 3LNPA 3UT0A 5T8GA 5SWUA 1US0A 4CCCA 2R24A 1VFSA 1RPKA 2VNCA 1RP8A 1BRLB 2I57A 1A0EA 2KAUC 2OVLA 3CPRA 2X41A 2ZC1A 4GVGA 4PTWA 5CBIA 4YN5A 2Q8LA 1GWJA 3N2CA 3LDVA 2ZICA 5FEZA 4JEJA 4E4UA 2C18A 2AAMA 3S2JA 2ZRUA 1MYRA 4F3HA 3AHXA 4P2VA 2AL2A 3GHUA 3IGHX 1E70M 1UH2A 3S46A 1XISA 3A4WA 3ITLA 4NG3A 2PDLA 4X63A 2E77A 2FVKA 2HK0A 3UPBA 1MI3A 1UR8A 2FGLA 1OIMA 4HA0A 3W7RA 3TJLA 4OKDA 5TIMA 5D9OA 4XAFA 4S3KA 4AC1X 2XSAA 3I6RA 3TAOA 4X61A 4PBGA 3NQVA 1KR0A 2XHYA 1RA0A 1J79A 1DIDA 1TZ7A 2OXNA 2HZGA 4B92A 1U2YA 1XGZA 2FZMA 2YSWA 2VR4A 3MUAA 3TKFA 4AD0A 4LYKA 5ABFA 3VGEA 3HGSA 1CXFA 3IACA 4LCRA 7ENLA 2C3ZA 3NSMA 3ME3A 4XAYA 1M7XA 1W1YA 2FPYA 1MFVA 3GH7A 3UY8A 3B4UA 3BG3A 3EMCA 3FJ6A 5K9XA 3S6TA 1JCTA 1R5YA 2PTYA 3HG4A 3PWAA 3JS3A 3W76A 4J28A 4PB5A 1B31A 2ZX5A 3WLKX 2BB0A 3W7EA 3N12A 2G95A 2OYMA 4G7FA 3FOKA 2QDEA 1B4KA 4DJDC 3HFTA 3OLDA 4D6GA 4ML9A 4KRTA 3WL1A 5HJYA 1V03A 5I0DA 5CC5A 4DNHA 1WOAA 1HKKA 4F4RA 5FSEC 1UMLA 4REQA 4UQAA 2ZZ6A 3F4VA 3DESA 4H8VA 3WNPA 2CLIA 3P81A 1PO9A 1UWTA 2WZEA 4DF1A 5DANA 5G1TA 1ISVA 1YTKA 4B9YA 1VFTA 3VNDA 3HQPA 2NUXA 3IIVA 3N17A 4EPKA 1S2WA 1XLHA 1VBRA 3QMTA 1K7XA 4GJ1A 4YYCA 3WLRA 3VC5A 3WLSA 3T44A 1W17A 4HNLA 1Z7AA 3WK2A 3T2QA 1IIGA 5DXXA 1C9WA 3BSHA 4YTSA 1Q65A 3H55A 4GABA 4NAFB 3N3TA 1ADOA 3PWIA 1QBAA 4CCDA 5CBJA 3WQ6A 1N2VA 1V0LA 1QO5A 1XKYA 1ZCOA 8XIAA 1G4PA 2BODX 5H1WA 1FWBC 2A2IA 3IS4A 3KL3A 4INFA 3WMCA 2Y7GA 3W01A 4BI7A 3AIEA 1CEOA 3B9AA 3HG2A 4WKFA 3NQDA 1H1YA 2W61A 3NDYA 6REQA 4PE8A 3LCIA 2D24A 3OZYA 3TV8A 3S5ZA 2W92A 5D9MA 1OHLA 2UWFA 1R3RA 3UNDA 3AIBA 5AVHA 4B3KA 3K5XA 3B97A 3O63A 2VOTA 5C9RA 1TQXA 2E67A 3UFYA 3JRKA 4G56A 2J88A 4Y9PA 4IUOA 1IR2A 4K8HA 3KBSA 4K3ZA 3ICJA 4GX8A 3OVGA 4W9TA 3RM9A 2Z25A 1J6OA 3BMWA 1YMYA 3H26A 1GVOA 3MPGA 1OFQA 1TWWA 2OZ8A 1NEYA 4LYRA 3G0SA 1W3KA 4H8NA 4M24A 4J2PA 1XICA 4AIUA 4UMCA 2CYGA 3GH4A 3M5VA 4P7OA 3GHRA 2QKFA 4JX6A 1J2WA 5CEWA 2OEJA 4LEQA 3BO9A 2XIOA 5I3GA 4WOQA 3W7GA 4U4MA 4PCFA 1WB0A 2YXGA 4AB4A 3UNTA 3LRMA 1B3ZA 1K9EA 1B0IA 3JZEA 4FIQA 2Q3OA 3W1XA 2QMJA 4IJBA 1XRVA 2VR2A 3VFLA 4PODA 3AQUA 2PTXA 1E0VA 4E5TA 1V4YA 4W7WA 3CPGA 3GYCA 3EWBX 4PMRA 1W5OA 5HK4A 4QLJA 4H9TA 3N6HA 1NDWA 4IG2B 4H9XA 2EJ1A 1FCUA 4GYJA 1B9BA 5TQLA 2GJLA 5CZTA 2YL9A 4HZ6A 4DZAA 3J7HA 4PMZA 3B40A 3VABA 4OECA 4DJDA 3LMYA 4RZ5A 4ZZ9A 2BG5A 2VKZG 3PZ9A 2J79A 1IYXA 1P48A 2E4TA 1ALDA 4IFKB 2HS8A 4NJHA 3E5PA 1ZPTA 3B8DA 4K1GA 3GBEA 1KRCC 3IIXA 5AYBA 3NWRA 1A5AA 3F4WA 1BVWA 3UWWA 5EL1A 2XGIA 2QUMA 2G4FA 3DG6A 3HJZA 3W7QA 1JUBA 2BS9A 2WVUA 2I9UA 2ALRA 1SMDA 4CNUA 4E2BA 1J0HA 4WY0F 7ODCA 2ZXBA 3PZTA 3VTRA 3A64A 3Q65A 3UPMA 3C8FA 1VPYA 3S9YA 4NJGA 2WPBA 4DY1A 1JAEA 2R91A 1PKYA 1ZJHA 4JXCA 3WEOA 2VGGA 2PF0A 2I14A 3ZT7A 3R12A 1A5SA 2F2HA 3DDMA 3QV8A 1XLCA 3BW4A 3C52A 2PF8A 4I5RA 1BLIA 2YDQA 1S2AA 2ACSA 3AICA 3S1WA 4HA4A 1LORA 4QE5A 3WQCA 3CQKA 5EY5A 4P7RA 1UMYA 4E2OA 1E4IA 1DP0A 1N7KA 3H6OA 4AYGA 5HWJA 3LENA 4AEFA 1OFBA 4DUVA 3F7JA 2XFWA 2X0SA 1F7BA 4XKYB 1O5KA 2FVLA 1O68A 3SSZA 1E3XA 1TFVA 2OELA 4P8UA 2QLYA 3EEZA 3WK3A 1A5BA 3UG5A 4J9JA 1PBGA 4DO6A 1V3MA 3CNYA 4K2SA 2MNRA 4ZFCA 4IPPA 2EPNA 4MB5A 1MNSA 4XSMA 5D05A 1AMKA 2NSXA 2YX0A 4LPCA 1RK5A 3T4WA 3DHPA 1EWDA 4NZFA 2O92A 3GNPA 1XRTA 3HA1A 1FOBA 3KLLA 2D0GA 4LYQA 1PDZA 1WYIA 1W3TA 2QGHA 3VKDA 3IJ9A 3ATZA 4O57A 1HJVA 4JNMA 3EAUA 3VDAA 3SRFA 2V2CA 4UFHA 1Y65A 5ABHA 3URAA 2ABAA 1UPMB 3O0FA 4Q6JA 3WZ0E 1AZ1A 3GX9A 1TG7A 4TUFA 4F0MA 4AQLA 4WJXA 3ARXA 1BKHA 3M0JA 3CL7A 4QCFA 3EA3A 1FH8A 1FH9A 2R1NA 1ZSXA 3B8WA 4UMBA 1TELA 2A21A 2A3HA 3QLLA 1OC5A 1QOPA 4UQEA 1HP4A 1FBAA 5IOBA 4CD5A 1M7OA 3LGGA 4Y90A 4O15A 3AS2A 1GHRA 1S2TA 4WF7A 1W3IA 3MY9A 3TQ0A 1YIXA 1XIHA 3DAQA 5K9CA 3FYYA 1IWPA 4HHPA 4I7WA 3PBUA 2QCEA 3EWUA 2HDJA 4MVAA 1I4NA 4UXDA 2GGJA 5C2GA 4PBFA 1QTWA 4B5XA 3IJLA 5H91A 5E0CA 1HN1A 3LTPA 1T96A 2C16A 3N3MA 5AHMA 4XAZA 3EGJA 4WDUA 4Q4RA 5XIMA 4US5D 5A95A 2WSYA 1R38A 5M1TA 4Z1AA 2IS7A 4MG4A 1UB3A 4H9VA 3GE7A 4H9ZA 3USZA 3CH9A 4LXFA 3T0BA 1EHAA 4MMWA 1ZLPA 2ZRVA 3VUPA 1TA3A 2ZXAA 3NXLA 3UY7A 2ESCA 1PX3A 3GFXA 1W54A 3V18A 3ABQA 1FP8A 5HUPA 4DO4A 3LX9A 3H2NA 2PDKA 1VGAA 3K4DA 4XZ9A 1QW8A 3VIPA 3ONCA 3BAWA 3WG6A 3DGRA 2B31A 3UPWA 4Z1YA 4DF2A 2XVPA 1HZYA 2QCNA 2OTDA 4MF4A 1N8WA 3WUBA 1QI5A 1VBGA 1XSIA 1EP1A 1KD0A 4O50A 5DXYA 2YL5A 3SUTA 1V3LA 3A9IA 3MSGA 4RE0A 3WJWA 5HA7A 2WMHA 3C0LA 3PZOA 1RJPA 1S3HA 3P62A 1ZTVA 1KBIA 2CLPA 2C0HA 1CWYA 5HOSA 1QR7A 4ROQA 1FHDA 3CWOX 5FF4A 1PX8A 3EDDA 3IV8A 3USBA 1UH3A 4WDTA 3SFKA 1M1BA 2VM8A 3NJ3A 1F3TA 3KRZA 3CV1A 4DZ5A 4QRNA 3DENA 2YCIX 2A3CA 4XD6A 3ITTA 2FDMA 3U7VA 4M1RA 3ZLFA 3N4AA 4PTVA 3TYAA 1B2YA 5IHRA 1B3VA 3AIVA 1S5TA 1ISZA 5F2LA 4LW7A 4QNEA 2VVSA 1RVGA 1V6XA 3NQBA 3V16A 2WMFA 5I7GA 4ZXOA 1OFAA 5K2ZA 4RE2A 4GKLA 4QHRA 3ARRA 1P1XA 3LHUA 3JR2A 2BY0A 3UXAA 4AVFA 2PDBA 2PDYA 1RSCA 1WDRA 1TPH1 5BMXA 5DT7A 1ITQA 5CPLA 2W0UA 4RPPA 1E0WA 1V77A 1DTNA 3TYDA 4GQGA 4IGHA 1V6VA 4DIAA 2OSWA 5AC5A 3OG2A 4LUYA 2HBXA 4FI4A 4PRTA 5REQB 1KGUA 1TWSA 3EPNA 1EJRC 1UD4A 3AZTA 2BOGX 3FFSA 1WKDA 1I0DA 1P6CA 2QCLA 1PPIA 1M03A 4S3DA 3AXMA 4LUSB 5LHEA 1DXIA 1E3ZA 3FV9A 3WQFA 4JTSA 4CLMA 3SJNA 3O1NA 4DBUA 1TTJA 5A6LA 2OB3A 4BFAA 5BXSA 2CZDA 1X1NA 1GTHA 1LLWA 1FKWA 5HMSA 3DHFA 3QH2A 4H6QA 3TYEA 4OJYA 3WDHA 1O5RA 2VO5A 4ZVJA 3P3BA 2HVMA 4XD3A 3LOTA 4PEKA 4MDPA 1R3SA 2HNEA 3RPMA 4C6PA 4UFKA 1AL8A 4QLLA 4UBPC 2ZUSA 3N73A 5H8MA 5BOOA 1KM6A 4NZCA 1PKMA 1DWIM 3H2OA 3RPTA 3W0KA 1KRMA 1LM1A 5AHFA 1BXNA 1R3QA 3LZ3A 1PUDA 4GX9A 1RHCA 3GNNA 3T40A 3CZKA 3T7VA 1CIUA 1XIJA 2XVKA 2V3GA 4ECLA 3CUZA 4ZSTA 1QATA 1UROA 4MLRA 4GQQA 4HA1A 3M6DA 4NAEB 2XVGA 3GR8A 4KRUA 2G37A 1TPC1 4J1OA 2E8ZA 2DSKA 4PSRA 3CYJA 3M0ZA 2R94A 2Y6ZA 2G97A 3CEPA 1E6RA 4XTDA 1RV8A 4EE9A 1JI1A 1EJVC 2BHYA 3FEQA 3PUEA 1ZS2A 2C15A 3RN6A 3SECA 2WVSA 4BI6A 1RA5A 1Z8AA 4WXZA 1PIGA 2VQUA 4TOQA 3TN5A 4ZTXA 2D23A 6XIMA 5JU6A 1TIWA 1VENA 1WX0A 1XYFA 1E6ZA 4P8XA 3C2RA 3IGSA 1G01A 1D7KA 4DJEC 3SCQA 2P0OA 2BGQA 4H01A 4IX0A 4JD4A 3CT2A 1GKPA 4JFWA 2QUTA 3OBKA 4JDBA 2J8GA 3P6LA 3S2CA 4WVXA 3EX1A 1DJYA 4H6EA 3V0UA 1VYRA 2YCJA 1ZP3A 1IEIA 3LBMA 4WJEA 3GH5A 1JCMP 3RLVA 2DVUA 1L8PA 5FAJA 2YBTA 2PP1A 1SO4A 1DJHA 3E3HA 3R4IA 3PTKA 3PBGA 4PMOA 3IANA 1XIGA 2R8WA 2ZA1A 1U5VA 4S1FA 2V3FA 2XISA 3MSDA 4YHEA 1AJZA 2CWNA 3WF3A 1L2QA 4D1JA 3UYIA 1V0KA 5LZLA 3DKLA 1KCKA 3PNZA 4N2YA 1PSCA 3HFYA 3MCMA 3CIWA 1XKJA 3N9RA 4K7YA 3TZNA 5EFFA 3BAJA 4Q8VA 4FF7A 1FWDC 1MW2A 2YZ5A 3GYEA 4O1BA 4ZOEA 5DMMA 4O10A 5FAGA 5FF3A 3HMJG 5M17A 2QR6A 3IAPA 1FWWA 3UETA 4H3DA 3L21A 1AD1A 3WLTA 3LHZA 4MJMA 1WBHA 5EPDA 4Y9MA 3W7OA 4GBDA 3KCLA 3HTWA 3EOEA 3W38A 4Q3MA 1VYSX 2OWXA 1DIEA 2VEIA 3RILA 1WAWA 3NSXA 3UU0A 3H4XA 2X0HA 3VX0A 3OTRA 3V5FA 3LPPA 3SQLA 4KRZA 5FD0A 1F6PA 1SZEA 2X1UA 3DFTA 4G1NA 1TPVA 2W5FA 2XFFA 3VVGA 4RNIA 4A6GA 5A6TC 3E1F1 4KCUA 5BZAA 5HQLA 1U1JA 4GZEA 3AISA 1W31A 3F5KA 3QMRA 3JVAA 4IHCA 3U4AA 4RW3A 3C5QA 3T0TA 2VFDA 1O60A 3KHDA 4TTGA 1UG6A 4BWLC 3H22A 1TR1A 1DOSA 3M6YA 5BWAA 3QGVA 3N9SA 2DGAA 4NRSA 3BLOA 4M1BA 2E9MA 4JX5A 3S2MA 1EO5A 5FJIA 4LUTA 3MC5A 1HL9A 1JYWA 3MMWA 3OHIA 4MPKA 4PYSA 4DNMA 2A7NA 4K8GA 2GJXA 1P0DA 4J3TA 1KLZA 3T05A 1OABA 4J7RA 4UCFA 1M7JA 2Y5SA 3CQJA 2OLSA 3CAVA 3YPIA 1LDCA 4EF8A 3SN0A 3RMEA 2VC9A 4IGNA 3GVGA 2RJGA 1NOFA 3EYPA 1HKVA 3EXRA 4PB3A 1ELSA 1JPKA 4IIHA 3VNZA 2Z6IA 1S1RA 3LCGA 2GFTA 5LA2A 1KNWA 2X1IA 3L0GA 4GIRA 1JZ4A 4DELA 1CCWB 2ZUWA 4JYFA 3DZ1A 2CPUA 1KW1A 1Z41A 4Q4PA 3BE7A 4P7LA 2BMBA 2VX7A 1D7FA 1FXQA 4MJZA 4JQAA 2Y24A 4DJEA 5DEZA 4HNNA 3CWNA 4OOZA 3AYRA 3ES7A 2WZIA 3C61A 4IMDA 4NI3A 1QPRA 5HQEA 4Y9NA 4IMEA 3AUOA 4QP0A 3QTPA 1VCVA 4MWAC 4UQDA 5IM51 2QIIA 4Z2IA 4DVOA 4AD2A 2WHKA 3OQEA 3S5YA 4XWUA 3KUMA 3THCA 1N8FA 1IXOA 2XH7A 3TZFA 2QXWA 3B0YA 5ENLA 2RDUA 2UV8G 3PULA 3TEVA 4B3ZA 3MP4A 4NZ3A 2ZIDA 3APYA 3P5ZA 3EWYA 5A69A 3S5SA 2QJGA 3MI2A 1CBGA 3UJFA 4G9PA 4UOJA 1LRQA 4O1FA 3HQOA 3TTYA 5KZEA 3POCA 4QTGA 3OG3A 2WSPA 5FSDC 2ZRWA 1KC7A 3N13A 3CL8A 1JDFA 4S3CA 4MZYA 1K6WA 1XX1A 3WBEA 1M04A 2AKZA 3PR2A 1H7RA 3NL3A 1VFUA 4C7GA 2YA0A 3ZVHB 1Q7ZA 2ICSA 4BK9A 5T26A 2E9LA 1DBTA 2QCDB 1VFHA 1GK8A 1THFD 4HBKA 4JKMA 4PFMA 1POJA 4LC6A 3NPWA 1W9DM 1JZ3A 1V7AA 1WBJA 3RGTA 4UZUA 1CGVA 3LK6A 5MF5A 1AJ0A 5EU9A 3N6JA 2DIJA 3Q67A 1QNQA 4BWLA 1VFOA 1IF2A 2PZNA 1H2JA 3L4YA 4HK5A 2P5NA 2XVNA 1H1ZA 4IPIA 2YOCA 2VX6A 4S3FA 2EPOA 2OGJA 3LN3A 5FF0A 4GUFA 2ZADA 2Z1SA 3TN3A 5EMMA 4LY8A 4PCTA 3RX3A 1EB3A 1KR1A 4W5UA 1GKQA 4AIOA 5K3VA 3WDIA 3VGHA 1NY1A 2XN1A 4MFDA 4HPNA 1EDQA 3TTOA 2ZVRA 2D3LA 5K4ZA 3MHFA 3M1ZA 1JZ8A 4FK9A 2EPMX 4PGLA 1XBZA 3NQAA 3CIVA 3UYCA 3TC7A 3T78A 3A5VA 3UCCA 2QDGA 4UTTC 2ZDRA 5HNUA 3KWSA 3NO5A 4LQ1A 4JCMA 2J24A 2WJEA 1PCKA 4DHGA 2G41A 1F73A 1QNPA 1PAMA 4D6HA 5DBUA 4LBRA 1NELA 4O12A 4S2BA 1SGJA 2NSOA 1UCWA 3LCHA 3MU7A 5E09A 5LIYX 2EHHA 2VJXA 1SM9A 3UWZA 4DX3A 3BLKA 2AAAA 4DWSD 3FN9A 4JS3A 4HOXA 3VZXA 3CZEA 2G96A 4HIBA 2AKMA 2W3ZA 4N6FA 4MWAA 3OIXA 2TMDA 4Z2JA 1LWIA 3CTTA 5BRBA 1P7TB 2BGNE 4HVXA 4QE1A 1FRBA 3CPUA 5D8ZA 4JQ3A 3LI1A 1MVYA 5IBXC 2VRKA 3WF0A 4C6FA 1R46A 1JJKA 3S6DA 3T9PA 3VNLA 6TIMA 5G4WA 1DJQA 3W1TA 4IZGA 2EPLX 2JEQA 1OGGA 2LLEA 7REQA 3SN4A 1UD8A 1XGDA 3VX1A 2V8ZA 1ISWA 1DE6A 3EX3A 2Y1HA 3E0WA 1LYXA 3IRDA 4WK9A 1TX2A 3RITA 4UTHA 3P74A 3QPZA 4N42A 5FIPA 5FACA 5GNYA 4OGZA 4DPPA 2BXYA 4RDYA 2V3DA 5IFTA 5LNVA 1RCXB 2EGZA 2PSNA 1JCXA 3W7PA 3QV9A 2BOFX 2Y85A 2YJQA 3RX4A 4RX0A 4CNTA 4RXGA 4GG9A 2AQVA 3OW1A 2ZUNA 4BF5A 4FNQA 1H41A 4O4WA 1OGSA 2OLAA 3F5JA 1UBSA 3SJ3A 1JYNA 1JD9A 4H4IA 2BNJA 5CPSA 3H2MA 4WY0B 4FNUA 2XPKA 3W81A 2BWGA 3FSTA 4H9YA 3WLJA 3UG8A 1NF0A 1JCNA 3UXLA 1PHWA 2QJJA 2Z1VA 3A21A 1GVEA 2TYSA 1BYCA 3H54A 4MKSA 3PP7A 3W2LA 4N02A 5LKYA 3QGKC 1TJ0A 3G1RA 4G2DA 3QZ6A 6XIAA 1MUCA 2W63A 3URNA 1B3XA 1EIBA 4DUXA 4WQ6A 2X09A 1A5MC 5JH1A 1RP9A 4OE7A 2FZ8A 2YR1A 4Z08A 1O5QA 4GLEA 4LAOA 2A85A 5D37A 4HPGA 3HBLA 3ZWTA 2ATMA 1TV8A 4JEQA 4J40A 1YYAA 4UTTA 4MB3A 1OFDA 2DUZA 3BOLA 1H49A 3DC8A 2Z24A 3KVLA 3TW9A 4Q8QA 3R7MA 4GO9A 4LS0A 3LHVA 2YFNA 3A22A 3FXYA 1GHSA 1EQPA 4U3CA 3EXTA 1K8ZA 3M0MA 2GGHA 4JIPA 1MEWA 4LT9A 3BV4A 2ACQA 4GYFA 5C0QA 3BC9A 4MSSA 2GSJA 4QG6A 1BD0A 1WAUA 3IJ8A 2DQXA 5A8GA 1HJSA 3GC4A 3OGVA 3AMKA 5HR6A 4CD7A 3C2VA 4GZJA 1K77A 3QYQA 5G1MA 3ANVA 2V82A 1AK5A 3WQOA 3DX5A 4L65A 1V3JA 2WNNA 3IRSA 2CBUA 5IBXA 4H41A 3IUDA 3ENLA 2VZUA 1E0UA 3SUVA 2FMNA 2E1WA 1H62A 4U33A 3L4XA 4MWAE 4QDPA 4JQ1A 2WMKA 2XH2A 3WBXA 4YWIA 5C2XA 3SBFA 3B0PA 4HN8A 4AIBA 2XGZA 3G3DA 4POCA 1LLZA 4ZENA 2Z1BA 2BVWA 1HVQA 1M6JA 5AVNA 4ZB5A 3R43A 5CGMA 2UY3A 1TRDA 1OCNA 2E6FA 3CAQA 2EBNA 4I9AA 2BY1A 3N4EA 1LBLA 5I6SA 5C9XA 2OYKA 3HG5A 3ORWA 3ECQA 1QAPA 4I7VA 4QSFA 5LNUA 4JTJA 3BGAA 4JTRA 2QW5A 1K4HA 5HJXA 1U22A 2OFJA 2P0IA 4FS9A 4XZLX 1Z44A 2WJZA 2ZRZA 4MDOA 2J13A 3TSDA 3STGA 1DORA 1SFJA 3H24A 4BHYA 1O6IA 4KEVA 3BQ5A 2XH4A 4ZBCA 5KTLA 2X0YA 1MRAA 4GBUA 5LHFA 2YB4A 5E93A 1YXYA 3MUXA 2IKGA