1EZWA

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
347
structure length
347
Chain Sequence
AEVSFGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDWISGGRAIIGMGPGDKATFDKMGLPFPCKIPIWNPEAEDEVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVKARSIQGSDIPFYMGAQGPIMLKTAGEIANGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEATKIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIGKGDFGTAIGLVDEDMIEAFSIAGDPDTVVDKIEELLKAGVTQVVVGSPIGPDKEKAIELVGQEVIPHFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
total genus 128
structure length 347
sequence length 347
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1ezwA00
3B9NA 1F07A 4UWMA 1NQKA 1EZWA 2I7GA 4US5D 1BRLB 1TVLA 5LXEA 1LUCA 3FGCA 1BRLA 5DQPA 4US5A 1YW1A 3B4YA 3RAOA 3C8NA 1LUCB 3FGCB 4J2PA 2B81A 1RHCA 3SDOA 1NFPA 1XKJA 5AECA 1Z69A 1M41A 1FVPA 3B9OA 1BSLA
chains in the Genus database with same CATH superfamily
3GHTA 1U22A 3KBVA 1S3HA 5A6KA 3PANA 3S1UA 3IAPA 3L2IA 2AQWA 3AIVA 4IWWA 4HHMA 1R3SA 2W6RA 3LHZA 1HTIA 1H7WA 3ZWSA 4W8BA 4UTTA 4R53A 2NUXA 1UH3A 4DM2A 1GHRA 3IUDA 3WKZA 2A3CA 1MYRA 2FVLA 3T0BA 3W1LA 3VCRA 3W7PA 3CHEA 2VO5A 3TAKA 3PBGA 2ZZ1A 4Q3MA 2G4FA 2J24A 4JQ4A 1SFSA 4Y9AA 4J2PA 3WSUA 4HIBA 1EUNA 4A05A 5E0FA 4A21A 2PWUA 1XIGA 3MKCA 3W70A 1MQQA 3ORWA 3AJ7A 3PVFA 1Z9AA 2H9AB 1CGUA 4TVUA 4LV4A 2FHCA 1UQZA 1CIUA 1T8XA 5FD0A 3HV9A 1PUDA 1V6WA 3BLDA 3POHA 1UWSA 1TELA 3A4WA 5FSEC 3WO8A 1J2BA 5GNZA 4JD4A 4IMGA 4N6FA 3H4GA 1BKSA 3PZ9A 4JTKA 3SQLA 3VIOA 4W7UA 1UD2A 4IX2A 5LGXA 5I6SA 4FHAA 3GZ3A 2QUVA 3AS3A 3ENLA 2WMKA 5CSUA 2XIMA 5AC6A 1ZUAX 2ZKMX 4XAYA 3TONA 3WF2A 3AQUA 4TVCA 3TLLA 3AS1A 3O6CA 2C0AA 3BW4A 3CV1A 1X97A 1T7LA 3UESA 3VDHA 1QWGA 2WXDM 4LVBA 1I1WA 3EMZA 2ZTJA 3NO1A 4NNBA 3PJXA 1O94A 1HKMA 3OA5A 4ZR8A 1D2KA 2HNEA 1QPRA 2OKOA 2CLEA 3UJ2A 2CCRA 2XGIA 1ML1A 1XLGA 1H1ZA 1P5BA 1XBYA 4R9OA 3HFTA 3LEPA 4IIDA 4NF7A 2QV4A 3SN1A 3URQA 4TUFA 2XH4A 3B9EA 2YJQA 1CGWA 3QKZA 1O1ZA 3EAUA 2WPBA 3BAKA 2R1MA 1RCOB 2E1DA 2E68A 1LM1A 4AZBA 3ABZA 4AZIA 1QT1A 4DB7A 3P5YA 1TCMA 4IQDA 3L65A 4H6EA 4MNJA 3W0KA 1SSGA 2XGZA 3NJ3A 3E2VA 1K7XA 2O55A 5AB3A 3CWNA 2JQXA 4JTHA 2Q3OA 2E1WA 1EGMA 4QLLA 3TIMA 2V2CA 3L0GA 3P5ZA 3VIIA 4MMWA 6XIMA 3N6QA 3NQCA 4DO7A 5FAGA 3PB0A 1W91A 2V3DA 4AY8A 1EQPA 4YMZA 4OWGA 4WDUA 3WDHA 1WNOA 3TZFA 4PA8A 3SRKA 4A2RA 2OGYA 1PO9A 1XSKA 4AZCA 1LLZA 3IIXA 3BDKA 4ZQRA 3VD4A 2XWEA 3KWSA 4O53A 1F3XA 1BVWA 1SPQA 1S5VA 4XKYB 3W7NA 1ME8A 1KR1A 1WZLA 2YL5A 3BAXA 3N6HA 3UJSA 4XSLA 4XTDA 2YGYA 2WO5A 3ITTA 1US2A 1JF5A 1QXLA 3W2KA 2VELA 1UOZA 1U5VA 3ZVIA 1R86A 3MC5A 1EXPA 3PZTA 4L56A 4B5TA 1PYMA 3A3HA 1W3KA 5HMSA 1WZMA 4GD0A 4GQ0A 3WEMA 4QR6A 2Y61A 3CL8A 4BY3A 2IKGA 4M6PA 3Q2DA 4FMVA 1REQB 4Q8QA 1BD0A 2OZ8A 1R3RA 1NFBA 2A7PA 1YW1A 4IIHA 1Q13A 4A3RA 1R7AA 4HZ6A 2VC7A 2FZDA 5LYRA 4OOUA 4O1EA 3IK4A 1XPYA 2C16A 5FF0A 3S2NA 1BXBA 3IV8A 3M0YA 5EFFA 4BI5A 4N02A 3CV6A 2WKGA 1O68A 4DJFA 2PRLA 3ITYA 1V93A 4W4QA 4AY7A 5D8ZA 3ITCA 4K36A 3UZYA 4N9BA 1WAUA 4GG9A 1CGXA 3WQFA 3ARYA 1QWKA 2R91A 4CU6A 3ZLHA 3GFZA 3LK6A 3VGGA 3L4XA 3POCA 4NAEB 3ABXA 3TYEA 3CC1A 4HBKA 4NP7A 2KAUC 4F40A 1KFKA 3CQJA 2Z1KA 1Q6LA 2V82A 2YA2A 3BG3A 4QS6A 3KL0A 3OPSA 3AMKA 3IGSA 1J0KA 2ZZ7A 4GY0A 2OYKA 3CTLA 1YHTA 3FDKA 1ZQ5A 1OC6A 4IFKB 5CJNA 1M68A 2ZWZA 1H0IA 1SZFA 5BXRA 3EWXA 1BYDA 1K1DA 4Q7NA 1WV2A 2V9DA 2W4XA 3AU2A 4WKHA 4UTTC 1YPXA 1SM9A 1YNYA 1EHAA 3P82A 3WK2A 1JZ7A 4GQQA 2NLYA 3JUGA 1TJ0A 4CNSA 4RPPA 3NL3A 3TVAA 1W8GA 3E38A 2GDVA 4NRSA 2J7BA 4JN7A 1R8LA 5BRBA 5F7UA 4K8EA 2WMFA 3DG3A 4M7TA 5F1VA 1TCDA 3LD5A 1DWIM 1I8JA 1YXYA 4TO8A 2E6YA 1YRRA 2NX1A 3TTEA 2IPFA 3GY1A 4KGLA 3L4VA 3QPEA 2ISSA 2YCLB 1EIXA 3E12A 3GVRA 4NJHA 1CLXA 5A5WA 3TW6A 2ATMA 2ZTKA 3NCOA 3SSZA 3H2FA 2EO7A 4PC8A 4B2DD 4UWMA 3T07A 2YSWA 4LAKA 1JI2A 3TSBA 3UWQA 4P7RA 3CASA 3ICJA 1VYPX 3C5QA 2ZRUA 4GIEA 3ABRA 2GSHA 3PC0A 1LCOA 1K9DA 2ACUA 3R89A 1PIFA 5HULA 3OLDA 2JK2A 2R1NA 4L1XA 3RU8X 3WJZA 1EJXC 3ID7A 4K2SA 1E1FA 2ZQ0A 3MTWA 4IGMA 1OG6A 3MI2A 1RVGA 2QULA 1JNDA 4ZOAA 3SRFA 3NQFA 2CKRA 4ONVA 3BPWA 4PH6A 3UG5A 3DHPA 1NFGA 5AYBA 3WZ0E 4J3SA 1GQNA 1EPXA 2PDNA 5HWJA 5F2LA 1VHNA 3G3MA 3N6JA 2GVGA 5HJYA 4PEKA 1P0KA 3LXAA 3UVAA 5AZ0A 4NZ1A 3BAWA 1FWGC 1VFHA 1KM0A 2C15A 2YLAA 3ONBA 4S38A 4JIQA 1BXCA 1S1PA 3OOQA 4GE8A 4JTLA 5HMDA 4JTUA 2G95A 1B9ZA 4H04A 1G9HA 3SRHA 1QW7A 4XO7A 1W3TA 3EMQA 1QHOA 2VGGA 3TYAA 7ENLA 1ZZMA 2XZ7A 3WLMA 5LNVA 2NQZA 1VJZA 2G3FA 2FLIA 3FA4A 3GXTA 4UQBA 1AZ1A 1IWAA 2OLSA 2B7NA 3OQEA 3WN6A 1XGEA 2WSKA 3O07A 4WY0B 4RE4A 3THAA 1GOOA 1R0MA 1DBTA 1HO4A 3V7PA 3GG8A 4L7ZA 3NZ1A 2Z7KA 1DKWA 3RILA 3B9DA 4CNPA 3H2OA 2JIEA 2TAAA 3GIPA 5JBFA 4JYEA 2WHJA 2HE8A 1BTCA 1H7OA 3OZYA 3VZXA 4P5UA 4C1LA 1OC5A 2ZUMA 1L6SA 3QMSA 1B3VA 1TV8A 4CVUA 3URNA 3CWOX 4MDPA 1CI1A 1HKWA 1KCKA 4HOZA 1Q6FA 4JQ3A 4C1NB 4PR4A 1YYAA 4PMXA 3P2VA 1XR2A 3INPA 1IYXA 4HN4A 2TODA 4MUPA 4HNOA 4OIFA 2A21A 4M81A 4AQLA 4XD3A 4QS5A 4ZXLA 1UA7A 1MXGA 1IV8A 1EYEA 3QN3A 2OG9A 1Y5WA 4I6KA 4YCPA 3NQ7A 4QXIA 3CQHA 4OT7A 1YDYA 4HHHA 4AZHA 4GUGA 3KVLA 4XTIA 3IAQA 3NDOA 4ATLA 4WY0F 1E9LA 4IGHA 3QY7A 1I60A 4LFYA 4E4FA 1XRVA 1UKPA 5DMYA 3WLLA 3RLUA 1YLVA 1C92A 1EL3A 3EDEA 1K7FA 5DXXA 1KQZA 3FN9A 4DLFA 2GL5A 2YCLA 3NOYA 4GJJA 1WUFA 4ROQA 4FA3A 1KBBA 3W74A 3QLLA 1PZ3A 1FCBA 3VIJA 1GG1A 4Y9MA 5DFAA 3BLIA 2YBVA 4DXKA 3KAOA 3STGA 1FWJC 4I90A 4O1DA 4F2BA 1Z6KA 2XSXA 5BYWA 3VMNA 3WQDA 1J0IA 1KBKA 1EBGA 1V3MA 4N0RA 4JPGA 4Z08A 4C90A 2Y6ZA 4LB3A 3N4FA 4X22A 4GBUA 2CESA 2VRJA 2PB1A 5BU9A 3L68A 3MZ2A 3QTGA 2WSQA 2IS7A 2WMIA 2CLIA 3CGTA 2BVYA 3GTIA 4N6EA 4K37A 1XKYA 4QJ4B 4H1ZA 1V3JA 3W6LA 1DORA 3LCWA 4NZ5A 4GQGA 1U5JA 2D2JA 3M0KA 5BOOA 2G96A 2VGBA 1P1XA 5FJTA 3FJNA 4Z2HA 1XIIA 5CC6A 3AIQA 3YPIA 2B31A 1E0WA 4GI9A 2INFA 1XH1A 1UP0A 4QSHA 3NZRA 2YA1A 4HU8A 3FKKA 4RW3A 3VM5A 1EGZA 4X0NA 1YTKA 5A6AA 4NI8A 4OBSA 4JCMA 3TR9A 4RNFA 4DWSC 3N2OA 1LG1A 3QPYA 3A4JA 1O12A 2CEQA 2Z28A 4QDWA 2WC7A 4ROPA 5HJLA 2DQWA 4FS9A 2WCAA 6REQA 2OWWA 2X30A 3E6EA 1LWIA 1QK2A 4GKLA 4RDWA 1M65A 3LV6A 2ACSA 4QNWA 3FKRA 5DX7A 5JH1A 1S5TA 3FDGA 4KMQA 4C6BA 4W93A 1NOFA 4XD6A 3CL7A 2PDHA 3UT0A 2D0GA 2PUZA 5I3DA 3OBAA 1OQFA 4M80A 3N25A 1XYBA 3WBEA 1RUSA 4EVZA 4JNMA 1VCGA 5CBJA 4UCGA 4PMRA 3CXOA 3MJMA 3PTMA 2RUSA 3M5XA 5LNWA 5M5DA 1Q6RA 1OJXA 5KSWA 4I9MA 5H6HA 1G94A 2FTYA 3U7BA 3EXTA 3WF4A 4RDZA 1QPNA 1J6OA 1R2TA 5BMXA 1A5MC 1SO3A 3BCDA 3TN4A 1BGAA 1YPIA 2PPGA 1E0VA 5EBAA 4WQ6A 3G18A 1IE7C 1KCZA 5G5IA 2DZSA 8TIMA 3CUZA 4E38A 3BUVA 2WYSA 2AGKA 4DN1A 5BWFA 4F0RA 1A5CA 4FSAA 1YQ2A 4JKLA 3N15A 3LN3A 1WZKA 3IIVA 3MU7A 2HPMA 1SMDA 3G5EA 2C79A 3LXBA 3SQMA 3WLKX 1JCTA 3GWQA 3ATZA 2J9YA 2QCGA 4JNYA 1HJXA 2E6AA 3E1F1 4GYKA 1R3YA 3T0TA 1GVYA 3EEZA 2VZSA 1GJWA 2WVVA 2E7FA 4F9DA 1ODZA 4ERAA 2CWNA 3ABQA 3LM7A 4C1KA 1AA1B 1XIMA 2GOUA 4HCLA 3UWYA 1A5SA 4YL2A 4FLOA 4RE0A 4PCFA 4ZOBA 2QPUA 2GVLA 4TQTA 3A64A 3S9ZA 3I7SA 1PXGA 1XSJA 2FJUB 3AUJA 1W8SA 2NT1A 3GDMA 2VDIA 4O16A 1IT8A 3ANUA 1UOKA 3GDTA 2E9BA 3G1VA 5MHBA 1S3TC 3KOFA 1D3GA 2ZX5A 3H7RA 3GNXA 2X0HA 1ZTVA 4ATDA 2BXZA 1MXDA 1SJBA 1V6XA 2DZUA 5M3WA 1VENA 2R24A 2RH9A 3FHQA 2QUMA 1W17A 1UD5A 3B4YA 3WL1A 4Z1BA 2TPSA 3GH7A 3CUXA 1HP5A 4MJ2A 1TE1A 4A8RA 3W2MA 3S5ZA 3TQKA 1X38A 1OCNA 3VOGA 4XZNX 5KZDA 5D04C 2D2OA 1VYRA 3PF3A 5C0QA 3SADA 3N2MA 3GXFA 3S42A 3R4IA 1F05A 5CZKA 2X1RA 5T8GA 1W5PA 1RV8A 5T9CE 3WLQA 3TJLA 2NXHA 3W27A 5EMUA 5GJMA 1S2UA 3LPFA 4GVGA 3NQBA 1XRTA 3QZAA 1ZBCA 3BG5A 2XU2A 3ZLFA 1H51A 4RDVA 1KXTA 1XWYA 1XP3A 4F2TA 4J9JA 2J74A 4ADTA 1PBGA 3RJXA 1UPPA 3GDBA 4WK9A 3HGJA 1AK5A 1WDDA 3S5OA 5B7YA 3WD4A 5JU6A 1KM4A 3T0CA 3VIGA 1LBMA 4EACA 6XIAA 1P7TA 1MRAA 4CQ8A 1OFBA 4R7OA 2QF8A 4GXMA 5K4XA 1D9EA 3CMGA 4IHCA 3P8JA 3C0QA 2GVYA 1YTEA 1BQGA 1PCKA 5LGZA 5CBIA 4R33A 4D6GA 2GGGA 2BASA 1JCLA 1R9YA 2BHUA 1C7TA 5EGRA 1FKXA 3DC0A 3ITGA 3O0KA 4XO6A 5CG0A 3A3WA 2A3LA 3RK8A 4DO4A 1E0UA 2CYGA 1EF2A 3PBVA 4ML4A 2BOFX 3R43A 3WQOA 4GJIA 2V5KA 1MQRA 2EG7A 3AHXA 3QQ1A 3VIKA 3BLOA 4J3UA 4HU0A 2WC3A 1WB0A 1ESWA 2WK2A 3BL3A 4G9PA 1KFCA 2QJMA 1GPWA 2QMKA 3TNOA 2Z29A 3D3AA 5A95A 3U0HA 4X0VA 4YVXA 2XDFA 3MUCA 3STEA 2HK0A 5ECVA 3TN3A 2Y2WA 3M7WA 2JBMA 4EK7A 1NH6A 4GX8A 5CAHA 3JR2A 2QCMA 2JKEA 2GUYA 1VEOA 3VKKA 1XLDA 4D8LA 2C8NA 3LGDA 3A5VA 1Z41A 4UFJA 5AKQA 2W3ZA 1AQFA 1O7AA 3RM4A 1QDSA 1W1YA 3MW7A 1F2JA 2HXUA 4W84A 1T8QA 2J7DA 2GJPA 3LZ5A 1XLFA 1FXQA 5A69A 5AC8A 4DXVA 3DU0A 1S5MA 2P50A 3EB2A 4I7UA 4M6QA 2PE4A 1KD0A 4NYYA 3BSMA 3B8IA 3VNDA 2VCBA 2E28A 5IFPA 3GDRA 1ITQA 1GPFA 1G7UA 1WPCA 5A6TC 2Y8KA 1JAKA 4QG6A 5FJRA 3QKEA 4UMAA 2VEGA 1PIGA 3NQDA 4AYSA 5DMLA 3LM3A 1TPC1 1K8XA 3A13A 4UMCA 1BWKA 2ISDA 3HG2A 4LF2A 4F0KA 1EX1A 3R8RA 1A47A 4MWAD 1JZ8A 1LOQA 2J7FA 3ARWA 1W9XA 4BI6A 4IPNB 1BF2A 4K1WA 1YBQB 6TIMA 3LXCA 3CIWA 1RR2A 2I14A 2AGTA 5AOUA 5KEZA 5KZMA 1I75A 1LRNA 1JDDA 2FMNA 1TPFA 1WA3A 3TR2A 4GRSA 4EF8A 3W7IA 5CQ1A 4LYKA 1GCYA 4PTWA 2HVOA 4LNYA 4AZ7A 4LRTA 4B5NA 4ERIA 2TMDA 2ALRA 1LDCA 1EUAA 1ISZA 5C2GA 1E9YB 4GY7A 2FFIA 3TJXA 3CQIA 2R9RA 2GDQA 5I09A 4PB4A 4QFUA 4AEEA 4RV8A 3Q58A 1ECQA 4MB1A 3C0LA 3MCMA 2ZYFA 1JPMA 1Q7QA 1KKOA 2XVLA 3N2TA 4F2UA 3K8LA 4HMNA 2PF8A 1PAMA 2BHZA 3TSDA 2Y5SA 2ZZ2A 1DJGA 2BVDA 4KFPA 4O1FA 1HVXA 4DPQA 1BTMA 3THUA 2PDCA 2O7QA 4YTSA 2YXGA 4ZEPA 1W3LA 1BYCA 2FZMA 3EX1A 3O6AA 4GZ7A 2Y70A 3MV11 1GZGA 1MUCA 3K13A 3C0JA 1E1CA 2VZVA 1A3WA 4D71A 3DEQA 2PDGA 3GHUA 1TJRA 3LRKA 3WDRA 2FYMA 5I2UA 4YTUA 4BWLA 3WJYA 2NW0A 3P81A 1J11A 3DBNA 2GJXA 3CPRA 5G1YA 4F48A 1W3HA 4J3TA 3P0WA 4A8IA 2F6XA 4FNUA 1R87A 3N11A 4RR4A 3KL3A 4AAJA 5D33A 2J88A 1MMFA 1XSIA 2XVGA 3TMLA 3ME3A 4Q4RA 3K2GA 4NU7A 3RO8A 1G4SA 3E0IA 4Q6JA 4FLQA 3OLIA 3UXLA 1L6FA 5G2WA 1UH2A 3E74A 3PAOA 2QCDB 3N3MA 4I7WA 3GXDA 3B8DA 2RJHA 3AICA 3OW1A 1ZALA 1LLOA 1E4IA 3IGHX 1FDYA 4H01A 4XAGA 4LY8A 3RX3A 3RYSA 3LHWA 1J0JA 1XH2A 3HMCA 4GYFA 4POCA 1FFRA 2PTDA 5JIWA 1NWTA 2FZNA 5C70A 3VCNA 2EPLX 3URAA 3AMDA 1XYAA 3FXYA 4O18A 3A3XA 4ZODA 1ONWA 3W38A 3JS3A 1CCWB 2XJ7A 2RDUA 1ZAJA 2QHAA 1R7OA 2BXVA 4A2SA 5CXPA 1UWUA 1QOQA 1SW3A 2ZVRA 4KRTA 1JR1A 4CNOA 4PUKA 5LIWX 2DFAA 1KXVA 3L5AA 1H5YA 1HJUA 5ABHA 1OD0A 4HN8A 4CEUC 4XZBA 1ADDA 1CXLA 4NNCA 4PULA 3RUBL 1A5AA 1IXQA 2XN1A 2CZVA 1NQ6A 1T0OA 2Q02A 3M4HA 5HAOA 4DWSA 4FLRA 5G1TA 2UY2A 4INFA 5C9XA 3IJLA 2FPVA 2PRHA 4WKFA 4UQDA 3FYYA 3W7DA 1UJQA 2PDBA 1EJWC 2INZA 1Q6CA 2VEMA 2QDGA 3BZJA 3URBA 3SJ3A 4HSNA 2VR2A 2XH0A 3KLLA 5BWAA 3NZQA 3FSTA 4PBGA 3VC5A 2TRSA 1S38A 2PU1A 2C7FA 1ADSA 3ITLA 1KGXA 1TKKA 1HKIA 4Y2WA 1JGMA 3TTOA 4AC1X 3LMYA 2EEXA 3PUGA 3PG8A 2DQXA 2WBGA 2IKJA 2EF9A 4MKVA 4CU7A 3VOHA 3C2OA 4TIMA 2ATSA 2OFJA 3UWVA 1QNQA 4EXQA 5RUBA 4NYUA 3ZT6A 2WJZA 3AOFA 1KBLA 3OHMB 1GG0A 1JI1A 4WD0A 2C1GA 4OHQA 3MYOA 2FIQA 1YE4A 1JYVA 3VKCA 2DSUA 4CGTA 2PWVA 2Y7DA 4XWUA 3IJDA 3MSRA 3W7GA 1XBXA 3W9ZA 1VBHA 2E6FA 2X2GA 4YWSA 4KCUA 3WH5A 1VBRA 2D24A 5I23A 4PE8A 4B5WA 3M7SA 4MVAA 3IJ8A 2DP3A 3C2RA 3W1UA 4XVDA 4LUSB 4D2JA 1RJRA 3P62A 3WF1A 4LANA 1YIXA 3RITA 5LIYX 4KT2A 4G1KA 1U1UA 4MADA 2RDWA 2Z7GA 4UQAA 2DGAA 1H63A 3FLUA 3LY0A 5HINA 5FEZA 2XM2A 1JZ5A 3IUIA 1OCJA 1W1ZA 2BGSA 1LWJA 5I3GA 2YL8A 4D72A 1NU5A 1VFLA 3SY1A 2DPEA 3GG1A 3NL6A 2YCIX 4FXJA 2Z2UA 1Z3NA 3NNTA 4ICNA 1N8IA 3GHRA 1R2SA 1W5MA 4JN8A 2PU0A 3ZLGA 4XKYA 4LWWA 3UWEA 3VU2A 2O7SA 3TW9A 3BLKA 3VUPA 1EJSC 4UR9A 2ZX6A 2IQ0A 1IHIA 1OC7A 3N2CA 4G8TA 3WNPA 2Z1VA 2NLIA 3WF0A 3CU2A 3QZ6A 2OT1A 4UOZA 3PPCA 1X6UA 2VFEA 2O56A 4AWTA 4MKNA 1DIOA 1TQXA 2X7WA 5F4SA 3CS2A 3L7RA 1GOQA 1K9TA 3BE7A 4NJJA 1GVQA 3GG7A 1W1PA 1UWRA 2YLLA 4O15A 4GIRA 2VEPA 4I5UA 5CGMA 1OX6A 4LVDA 2G41A 1LG2A 4NAFA 4J35A 2DY3A 1GOIA 3N9KA 2W63A 3HN3A 3OG2A 3VZYA 1DIKA 3EWUA 1P43A 1XLBA 4C6MA 1E15A 1CB7B 5FSDC 1S2WA 3L0NA 3BQ6A 1VQTA 4OUIA 1ZCCA 4LF1A 3BMXA 4ECLA 2PA6A 3IUHA 5TIMA 3T6CA 1GOXA 3CO8A 1UIPA 3QGVA 1AL8A 2XGBA 2LLEA 1H41A 4XIMA 1Q63A 1QW9A 5BRPA 2D20A 3MDUA 2DW6A 1XRFA 2RHGA 4ZQMA 2OCZA 4JDYA 1GVIA 1H7PA 3VXGA 1VIWA 1S5WA 4DUOA 3W25A 3BARA 7TAAA 1YTDA 2BSLA 1XW8A 3C2VA 1CTNA 4O4VA 5EMJA 1S2AA 4L5ZA 2I7GA 5CZSA 3T8LA 3MP4A 5DMNA 3W87A 1LBFA 2NXIA 1AJZA 1V0LA 3ZR6A 3H12A 1HKKA 3GK0A 4GNVA 1E43A 3CHDA 1DQXA 3JU2A 3CHCA 2ZX7A 3LSCA 2BY3A 2ABBA 4FIRA 3WQ6A 4B16A 5G2HA 3VGBA 2WKJA 3LI0A 3WMCA 1I2RA 3SJNA 3TW7A 1AW1A 4ZFCA 1IWPA 3RXZA 1H60A 2ACRA 2OMAA 4ZQPA 5I77A 1CLVA 3MSGA 1J79A 4IPIA 4QX4A 2OYMA 3WH6A 2WANA 4AVFA 1JCNA 4A35A 3HQ1A 1X1NA 3ZSSA 2VC9A 3FXGA 2WVSA 1UJPA 2YW4A 3MQTA 3PZVA 3NR0A 3NPVA 2OZ3A 1X6LA 4Z1DA 2XSBA 4CQ9A 2ZBTA 1F8MA 1MNSA 3R1ZA 2Q3RA 2G3MA 1D3CA 4GFIA 4RL3A 4CQCA 1V3IA 1PV8A 1RQHA 1IR2A 5I3FA 2ZADA 1F6KA 1ZAIA 3L9CA 2F61A 1M3UA 2XISA 3HG5A 2HJPA 5KINA 3R8GA 4Q8WA 3VGDA 4O0ZA 1NDYA 4MAZA 2YCJA 3USZA 1OGBA 3TLQA 1G69A 3NYZA 2OQHA 3NDZA 3SI9A 1C8QA 5DLCA 4GVFA 3TYCA 5CJMA 4AU0A 4Q7BA 4K68A 4Y96A 1OFQA 3C6CA 5I24A 3W37A 3IGXA 3UERA 4JFWA 1XDLA 7REQB 2J78A 1Q4WA 4DYKA 4JOMA 3SZ8A 4QQ3A 4YWIA 4TX6A 3NYDA 1TMHA 1SFJA 3L67A 3GE7A 2D0HA 1GKPA 4ILSA 3S47A 3S9YA 4RPQA 4V15A 3LTPA 3LCGA 2IPGA 5JIPA 1JZ4A 1H61A 4AVOA 2CERA 4UOJA 1QO5A 4M3PA 3VIHA 3AIEA 1S39A 5IM51 3WDPP 3AWNA 1FWIC 1VLWA 3GQYA 3WUFA 3VOCA 4Z42C 4B91A 4GUHA 3G8EA 4P7OA 3N13A 1RLDA 4FIQA 4ML9A 3UZZA 4A3UA 3WY1A 1QI0A 4HTYA 4G1NA 1JXJA 5LXXA 5FF3A 4DJDC 3JZEA 5FJIA 3P14A 4K3ZA 3O05A 2VUNA 3OP2A 1ICQA 4I5RA 3F4WA 3K1GA 3UEQA 3U5YA 3BANA 2Y0FA 3SY5A 1IEWA 3CMFA 3V0TA 2VVNA 1ICPA 1FH9A 1PYFA 4JX4A 5G4WA 4HK6A 1PTAA 4UUIA 3VKAA 2DT2A 1IQ8A 4XZWA 1JD7A 5GJNA 5A3HA 5MF5A 1EH9A 4LVFA 1VFSA 2G8ZA 5FI8A 4B92A 3W1MA 4LBSA 4Z1CA 4B3KA 2Z27A 3PWGA 4F0SA 3JZUA 3MPGA 3B8UA 3QV8A 4NY2A 1VKFA 3DX5A 4D1JA 4S3KA 4QSFA 4NIRA 1VJSA 1CDGA 4LUTA 1U1JA 3C56A 4ZXOA 3GNRA 1F6PA 1JAEA 4HOXA 3T55A 4GIYA 3B97A 4IFOA 5HMFA 5C9RA 1PKYA 2GJLA 3W83A 1WUEA 4LU0A 1K8ZA 5JBEA 2W79A 1QBAA 1SJAA 1J0YA 3STFA 4HU3A 3R11A 4GNKB 1GORA 1ZNNA 4OFCA 4Z0SA 4J28A 1Q6GA 3UFYA 5HNTA 2E5BA 4IP4A 4IQJA 3QV7A 2E09A 3AYSA 3G1AA 4MLRA 3GBDA 2WCGA 3RLGA 3W7HA 3TXVA 1NOUA 1X98A 2FZ8A 2BFGA 3N4EA 3S3GA 2J66A 4S3DA 3SM0A 2D1ZA 2AOSA 1TYGA 2NWRA 3VNKA 3L4UA 4O13A 1HL2A 3FK4A 2J6VA 1YADA 1T99A 4Q8VA 3OU8A 4UFMA 1UWTA 2RFGA 2PLKA 5C9UA 2ZRXA 3ZVHA 1JDEA 3NQEA 1S2VA 4J4KA 3TROA 2PP1A 5DEZA 4LVGA 2FPTA 2YDAA 1KTCA 1PKMA 4UQEA 1XHGA 2YXXA 3WMSA 3SCSA 1GQIA 2J7CA 1UR3M 5HPOA 4S2BA 3N2BA 3S5YA 5FEWA 3MUAA 5DQPA 3GM8A 4F0HA 1UR9A 3HB9A 2CFFA 3AYTA 3FFSA 4C6IA 1M1BA 4KF1A 5DCDA 4A3HA 1MEWA 3I6TA 4YIWA 4KFOA 5IDZA 1UPMB 3PZUA 3A6OA 1IEVA 3T1GA 2Y4SA 5HBFA 2HWGA 3CEPA 3VO0A 5H91A 1WP6A 3WH9A 1PZ1A 1CT5A 3ZXWA 2R14A 1I0BA 2HV5A 1GYLA 1JZ3A 1ADOA 1LLWA 1G7VA 4JZ5A 1TA3A 5BMWA 2PDFA 2PD9A 1R47A 3VE7A 3RGTA 6REQB 3EWYA 4QDMA 4MTVA 4HTBA 2VXNA 4IGNA 4OQVA 1VEPA 5A8PA 3R0UA 1VHCA 3O3RA 5B80A 3IVTA 4GC3A 4N4QA 3DKJA 3IS4A 4LUTB 4JBRA 1ZJAA 2V3GA 1TWSA 4S1FA 4QM1A 4DVOA 4B5SA 3N9SA 4IIEA 3WLJA 1QR7A 2W66A 4I9TA 1ECEA 1MO0A 3BGAA 3OYXA 4LV9A 4AIUA 3WLSA 3WBXA 5CCZA 3PAJA 5EKYA 3WK3A 3HG4A 3ITVA 1XH0A 5KETA 2YOCA 1J5SA 3WX7A 4EE9A 2D3NA 3AU6A 4PTDA 3SEPA 5J8LA 3WJXA 3UBPC 4LC8A 3T9PA 1EGVA 2QCDA 1EZ2A 1Z8AA 4AX6A 5D2VA 5JUVA 4ALDA 2ESCA 3MO4A 2RAGA 5C2CA 2X41A 2GWGA 1KRMA 3O2LA 3QTPA 2ZZ6A 4ADUA 4Z17A 1QNSA 1XC4A 3A22A 4B9ZA 1MWOA 3UGRA 4X61A 4HYRA 4MY8A 2B4GA 1SVDA 5FF7A 2BS9A 3M0MA 4PMZA 4W86A 4AD3A 4O11A 1TTPA 5AC7A 4MAVA 3OLEA 3CIXA 3TTYA 3I10A 3N9RA 5LNRA 3WNLA 1XC6A 4AXNA 4JAWA 1MW0A 3PR2A 4GGBA 1TPB1 1A5OC 3ZJ7A 4E4UA 3SUUA 3W7LA 2QJJA 3UWUA 2O9RA 1UROA 1A49A 2PAJA 1Q8JA 4JFTA 3W1AA 4I5XA 1UG6A 2ASHA 4R3UA 3TWAA 4MYAA 3F5JA 3MCNA 4XK2A 3ZVHB 3U4AA 2ZXBA 1TQJA 2BGQA 3W28A 1HZYA 3IJ9A 4HSHA 4WOQA 2CBVA 1T40A 3ZYZA 2E4TA 4JYDA 1WKDA 2CBJA 2D73A 1GNXA 4X60A 4DZAA 1C7SA 4ZQNA 1QI5A 5D9NA 1VD6A 1J4EA 4A3QA 1B90A 3H6OA 1GZJA 1Y0EA 1E4MM 3ZO9A 2YX0A 1NTHA 3EBVA 4RW5A 3WLTA 4GQBA 3N17A 5LA2A 3SCQA 1JYNA 4S23A 1OIFA 2QGHA 4S3BA 2BX7A 4KEUA 1MQPA 1H7NA 3MO7A 1SW0A 2TSYA 4KEVA 2RGMA 4H2HA 5H1WA 2GDUA 3EEGA 1MDRA 4KIEA 1F8IA 3FY1A 1UZ1A 3SECA 5E5CA 1A0DA 4PBFA 1G4PA 1CXEA 3D0CA 3VILA 4LALA 3HBLA 4I8YA 5H8MA 2PWHA 3D46A 3LDVA 3NTYA 4S3FA 1C9WA 3UGVA 1QUMA 4XZ9A 4DZ5A 3NQGA 2OLHA 3E3HA 1OZQA 3AXHA 2O92A 3GUWA 4P2VA 2Y1HA 4OGZA 1MZRA 3DFNA 4MFDA 3MUZ1 3DI0A 4NUWA 4AISA 2Q6ZA 4GWEA 5EA9A 1GW9A 2WMHA 3PWAA 2OQLA 4D6HA 3NQAA 4P7QA 1KFBA 3AIRA 1HG3A 1GEHA 1WXJA 2GWNA 2PWFA 5ABEA 4XZIA 1HN1A 1OCQA 2WKLA 3BTNA 3OVQA 4MB3A 3PZIA 4IPJA 3V35A 3H7UA 4V28A 1WXZA 2QYGA 5C8BB 3E0LA 2ZDRA 3ZR4A 1L2QA 4AB4A 2QF7A 4J7RA 1KBIA 1VP5A 1Y5VA 4GC4A 3DOPA 4C6KA 2BBFA 3CHVA 3SCUA 1O5KA 1QI4A 5EMYA 4I9JA 3C0SA 1D8CA 1GVSA 2PD5A 3NVTA 5CGTA 3R8HA 4HNCA 3SFWA 2VZUA 3AALA 3S1XA 2DZWA 3IIOA 3DC8A 1HUVA 1NY1A 2NV1A 1GUVA 4YHEA 3CUJA 3SUSA 3TC6A 1J8VA 5C54A 3VFCA 1I0DA 3RM8A 1RY0A 1PX3A 1A0EA 3H8AA 3T40A 1LT8A 2OOGA 1A5LC 3S5NA 1OFOA 3MJYA 2CLFA 1BAGA 4OJYA 4PTMA 2OEMA 2IXVA 5EL1A 2QVNA 2IPWA 2ON3A 3W7EA 1WBJA 4N9EA 3XISA 3EX4A 4QLJA 2WJDA 2ZFAA 4UFHA 1C9DA 2YCEA 4YPJA 5REQA 5XINA 3CYJA 1UZ4A 3TH6A 1TPH1 3WQEA 2GUBA 2NUYA 2NQLA 1XFBA 3GNNA 3CAKA 3LCHA 4HD5A 2NVDA 4XBKA 1H50A 1GONA 1OABA 3E2QA 3KOXA 3W85A 3ITOA 1WE5A 3LRLA 3IRSA 4WKAA 3U3HA 4D8ZA 4US5A 2XFRA 3CB8A 1P0EA 3DFOA 1W9DM 5BXSA 4S3GA 4UTLA 5E9XA 4WSHA 4B5VA 3LV5A 3QMRA 4EPBC 2V3EA 1V0MA 1ZRQA 3UR5A 4AVNA 3OZPA 4GGHA 1PZ0A 4W87A 4C6DA 3CEUA 3ZR5A 4HCHA 3T7VA 3CUHA 8RUCA 2OGJA 1NAL1 3VFLA 4R85A 4V1XA 1C90A 4OBTA 4PCSA 3I3DA 1TV2A 3WIJA 1CGTA 4ZENA 1SGJA 3L21A 1F76A 5D4YA 5LA1A 3W76A 5C55A 4H8HA 2C91A 1E5NA 3CM4A 3IIZA 4GUIA 4DRSA 1P0DA 3LCFA 1X8FA 1EEPA 2PBOA 2WNQA 1K8CA 1XLLA 3PNUA 3OLGA 4O50A 1E56A 3U48A 4O54A 5FAJA 4DBDA 4F8XA 2ZCGA 4IL0A 1SJCA 3KVJA 2P88A 1M01A 3M07A 4GI6A 3T78A 2E3ZA 1RA5A 3TA9A 3CL6A 3VOIA 3UU0A 3UWZA 1DHKA 4Y8FA 1LROA 3EWBX 4PFMA 3KBMA 3OZOA 3L66A 3KDOA 2OPJA 5A8GA 4TMBA 3QR1A 4H8VA 4A6GA 1ME7A 1Q7ZA 4MLJA 3LLXA 4LCRA 3VCCA 1GQKA 1VLIA 4TV5A 1JFHA 3HF3A 3VNLA 3GG0A 1ZLPA 4XG1A 1WOBA 3KRZA 4PRRA 1BYBA 2VCAA 1T96A 3L4TA 5HANA 2ICSA 2XIOA 4NASA 1B5TA 2OKTA 3BAYA 1PTDA 2DH2A 2VQUA 1XIHA 2XFWA 3G2GA 1W9UA 4R5EA 4BWLC 3LS9A 2GQ9A 4J5NA 3VABA 5D03A 4L65A 2HMCA 1OADA 2B81A 4QQUA 1EDGA 3CYVA 4Z0JA 9RUBA 2P3ZA 5CBBA 2OX1A 5TBOA 4F66A 3ZJ8A 4Z2LA 2A6NA 3PNZA 3NURA 2V68A 3TP4A 1OBAA 1IT7A 1L9WA 2P0OA 4WZHA 4QTGA 1FUYA 2JGQA 4QJ3B 3I6EA 1PX4A 4J1OA 2GFTA 2V5BA 3UW6A 5AVNA 4MWAC 3UA3A 5IBXA 3KTSA 1TX2A 3OQ8A 1IR1A 2BHYA 3BLLA 3D6NA 1THFD 4O4WA 2E77A 4J3VA 4QJ5B 1JIBA 4MNKA 1RSCA 4GLEA 3PS7A 5PTDA 1KA9F 2Z1SA 1LT7A 4BZYA 1JD9A 4JHMA 5FEXA 2CLMA 1RY8A 3FGCA 3B8WA 4CQDA 5LNUA 5K9DA 2ALDA 4H7ZA 3S6OA 4P7NA 1D8WA 4WR3A 2QPSA 1P48A 1EC8A 3HM7A 1FWTA 5I3JA 4DJFC 4JN6A 3EPNA 1CENA 3AYRA 5DCBA 2CXGA 3STCA 2WZMA 1HJVA 4R7WA 5IBXC 1D7KA 4XUGA 3ARZA 4NQ1A 2G3JA 3MMWA 2DZPA 3LA4A 2H3DA 3PTDA 4KW2A 1AH3A 4ZSUA 2OEJA 3A21A 4I3GA 3FJ6A 1G4EA 4KESA 3S5SA 2W61A 1XG4A 3NQVA 1UD8A 3UWWA 3VNYA 2ZRWA 1R5YA 3GZAA 4OBRA 5G4EA 3BMVA 2QLYA 1SZNA 1ZL1A 5IHRA 1PHQA 1UCWA 4TU1A 2V5DA 4L4MA 4A22A 3VDBA 1QI3A 3VKJA 4MF4A 3WMLA 1MW1A 1XLKA 4C6LA 1VEMA 5BXTA 1QNVA 4JHOA 3GKFA 2VDGA 1YDNA 3WLHA 4BCEA 1P0BA 1J9YA 1F3TA 1A5BA 4JIRA 4Q8MA 3RMEA 1UIOA 1CXIA 2YW3A 4LPCA 4GQRA 1HIZA 1HQTA 3LTSA 3LCIA 2IPJA 1HXJA 4M82A 2YBUA 2ZRVA 1QPOA 2V5LA 2VHLA 2W9MA 1NQKA 2G50A 1OG0A 3KCLA 2OODA 3F1QA 3WLRA 5HK4A 3ARUA 4GVHA 3MP5A 1I2OA 3M0ZA 2FHBA 3M6DA 1PTGA 1TTIA 4MSSA 3BWWA 3GBEA 5XIAA 1EB3A 3STPA 2NX3A 3ZOAA 4FXSA 3GIQA 3PFRA 5J04A 3S2CA 1W6TA 1FH7A 3NGFA 4DI9A 1DL3A 5E0KA 2F84A 4GYPC 3PN8A 1RPXA 3VGFA 2JFEX 3U2ZA 2ZRYA 2AQVA 2ZC8A 3UJRA 2J9XA 5CJ5A 1BQCA 2DJLA 1GTEA 5G4HC 4ICCX 3H4XA 4ZCWA 3E5PA 4IFKA 4W9TA 3W2UA 5DRCA 5E09A 2IW0A 2QJNA 4WEVX 4X2PA 3CAQA 1IWBA 3G0XA 5K9XA 4OU1A 3GTFA 4DZHA 1EJVC 3U8GA 4NZJA 4JTEA 2WWCA 4J40A 1OB0A 4NSBA 3HQOA 3ZSTA 1DOSA 5AVHA 3PTKA 2FZBA 4G6CA 2JF7A 4NL1A 1QK0A 4IISA 4QE4A 3W84A 4M6UA 1DWFM 5GVJA 4AD2A 1V02E 2CIPA 1VAHA 5C71A 4BF5A 1N8WA 1PB0A 1ENUA 3NDYA 5DY2A 1XX1A 1XLIA 2G37A 3KZPA 1TG7A 1GVEA 4DXXA 4Q8UA 1OF8A 3CNYA 2QEZA 3TN5A 2ODOA 3QW4B 1A50A 2C13A 3N12A 2ZIDA 2PC4A 2F7FA 1TJ1A 5FL0A 1UP2A 3VX0A 4K8HA 2P8BA 1WKEA 3AI0A 4JIEA 3D47A 2GYIA 5FOOA 4FX7A 4AFYA 2HS8A 1W1VA 1Z7AA 3R0KA 4Y9NA 1TIMA 3TWBA 4OV4A 1POJA 2AKMA 1LTDA 3G0SA 1LF1A 1LL4A 4O28A 3RR4A 2VYOA 1JCMP 4JQAA 2QVHA 3RJYA 1ZBKA 3BW3A 5CZTA 4CD8A 5FJJA 4I6VA 4XKMA 2PP0A 5AHLA 2WLYA 4U5IA 5ABGA 1NF0A 4AIOA 4XB3A 4L9XA 1NDZA 3VZZA 1M7OA 3QRHA 2J7GA 4RZ4A 2C1HA 1C91A 3DG7A 4OVXA 3RM9A 4L1GA 2PC8A 4Q4MA 4CLMA 1Q6QA 2X0SA 3CMJA 3WUGA 3P3BA 4Y8EA 4DF0A 2WV8A 3APTA 5BW6A 1W1A1 3UNTA 2G5WA 3B9AA 3AC0A 4BQ5A 1E72M 2VEKA 2WNNA 3EKGA 2ZZ3A 4J27A 3QSRA 2PTXA 4HPNA 3AHVA 3B8VA 3MWAA 1BXNA 4UQ9A 5CLTA 3UYCA 4IQLA 1E1CB 4RE3A 2I9EA 1JUEA 4LCSA 3B0VC 3H54A 1I4NA 1SW7A 2J25A 1Q6OA 3VIMA 2X05A 4P61A 1NELA 2J27A 2Z26A 4H00A 3A9IA 1XM3A 1TTQA 4KCWA 2ZZ4A 4QITA 1Z42A 4E4PA 3VUSA 4FK9A 4XAZA 1ITUA 4B5UA 4MZ1A 3EDDA 4J2MA 4OKDA 1QASA 1JJKA 1MFUA 2HISA 4JIPA 1CB2A 1JPKA 3CB3A 3E2RA 4EWND 3S6TA 1DJYA 5LNSA 4GHRA 2QAFA 2WHLA 3M1ZA 3GVVA 1VCFA 3G1RA 5F2MA 4Y9OA 4YTRA 1FHDA 5I07A 3GYCA 4HK5A 1TPVA 3VINA 1JDAA 1V02A 1XLMA 4QE5A 1SZRA 1V4YA 2XH7A 2CHOA 4MB4A 2OU4A 3COTA 2NWSA 4IT1A 1TVNA 1FRBA 3WUBA 2P53A 3C61A 1EXBA 1S2TA 1E6NA 3RHGA 2QR6A 5FCZA 3TYDA 9XIMA 5ABTA 3HTWA 3AO0A 4UFIA 1TPUA 1O66A 2UWFA 3T2PA 2BLEA 3PJWA 2DT3A 2DDXA 5DF0A 1KM3A 5E1QA 4IF2A 3TFCA 1YNPA 1Y65A 4O57A 2D3LA 2G0WA 3UQNA 4AHOA 2DUAA 1U83A 3WDQA 5T26A 1OVDA 2GGIA 4S3JA 2INEA 3A23A 1S5NA 3SW6A 3KZSA 4DO6A 4WY0A 1ALDA 1TE6A 3R0DA 1HX0A 2PDUA 4Y90A 3T8QA 1J12A 1YDVA 2VI0A 2E8YA 3AAMA 1K3UA 5TD4A 1O5RA 2QUNA 3R25A 3G3DA 5FJUA 4M1BA 1BSLA 2I5IA 3H4WA 3IJIA 1FWNA 4JGDA 1SSDA 1P6CA 4IXXA 1OX5A 1NP2A 4PBEA 1KRAC 1XIFA 3QC3A 3CQ0A 1C93A 4YYFA 4LB4A 1RQEA 2X42A 4NNAA 2CBIA 4BA0A 2X8RA 3RR1A 1U30A 1QNPA 3P67A 3C2FA 4QG9A 1LWHA 1OYBA 1FA2A 2J4GA 3R7MA 4C65A 4HJWA 4ZO8A 2R1KA 3AMLA 3REQA 1B30A 2QCNA 2XYLA 3G6LA 1OWQA 3AWOA 4KERA 3RPTA 2BG5A 4LJ3A 2VUYA 3VMPA 2OB3A 4FNTA 2VGFA 4MY1A 1GOWA 2POZA 3NM3A 4JHZA 2VD8A 2WSPA 1SFLA 1ZCOA 3KTCA 2E6DA 2JGYA 4UTFA 3UR7A 3ISIX 4A8LA 3WENA 1RP8A 4B3ZA 1WDSA 3W01A 4IMFA 2DT1A 1LL6A 1ICSA 3KX6A 3HQNA 2OO0A 4YJ5A 1BHGA 1TJ2A 2EGZA 1G5AA 4H19A 3P84A 3GH5A 4I8DA 1PCWA 2ACQA 4FLSA 4QIUA 3KS6A 3ALGA 5AN7A 3GTNA 5IOBA 4ZBCA 2VWSA 1QRQA 1VGAA 2GQ8A 2HZGA 4LAZA 1KR0A 5CZ0A 1M03A 2QMJA 1HW6A 3CIVA 1XDJA 2C18A 4JTIA 4TXEA 4WJXA 1ITCA 1SZGA 4YU1A 3FJLA 3NQ8A 3KBWA 3DESA 2DSZA 3GU2A 4JL1A 2VRKA 3HPSA 2VURA 5JMUA 2QV5A 3QR3A 3FYOA 3U6WA 1M7XA 1TB3A 1OT2A 4MPQA 3DGBA 5K4ZA 4PMDA 3ITXA 2DEPA 1TSIA 2BVTA 4BHYA 1X6NA 2BY1A 4PMNA 4IICA 3LTYA 1Z48A 4RZ6A 1TV4A 5IFTA 3KLKA 2BP1A 1ZJIA 2YDQA 4ZO6A 1TMQA 5A6LA 1LJYA 3BW2A 3MSDA 1K70A 5CC7A 2DH3A 2A2IA 4JYFA 2ANUA 4AF0A 1E73M 2B7PA 3EWDA 4CU8A 2FDSA 3C8NA 1CXHA 4JFSA 1WXYA 3PB2A 3UXAA 4QISA 1KM1A 4NILA 3B9OA 1CBGA 4X2RA 2V0TA 2PF0A 2QUUA 1RCQA 3M9YA 3QLDA 1B3OA 5EU9A 3G1YA 5F2IA 1AQ0A 4GA8A 2XFYA 1NOWA 1K6WA 5I79A 4CN4A 4MJZA 1HFBA 2FTPA 1FWRA 1FVPA 4UC5A 1V3LA 3LB0A 3GNPA 3LHVA 4S3AA 3PJTA 4S39A 4H9XA 1HJSA 4BEUA 1SZEA 5HUPA 2WVVB 1FQ0A 1UR8A 1KCLA 2VT0A 3DIPA 4KBXA 1SO5A 4FAMA 3LLDA 2HDJA 2Y63A 2GUUA 1TR1A 2CZ5A 1XD0A 2OZTA 3EA3A 3KS5A 5AYYA 1BG4A 1JNEA 4RCXA 1U33A 2MNRA 5LSMA 4BKNA 1KV8A 5BOEA 2UY4A 3QQWA 3RMJA 4N2YA 4PCNA 2XIIA 1VRXA 3L23A 2D23A 2W67A 3SIMA 2PGFA 2FGZA 3V36A 1PEZA 1RALA 1EO7A 1H62A 3QGAC 3GR4A 1SO4A 2DVXA 4PFHA 4DJEA 1VBGA 1NDVA 4DY1A 1D3HA 4Z2JA 4H4IA 1Q65A 3W7QA 2Z2BA 3W22A 3P80A 2Z25A 5FF2A 4ZMGA 1R3WA 1ISXA 3VIPA 2VZOA 1MW3A 4MJ4A 1K8YA 2ZUWA 3R79A 4HMCA 5KZEA 1J0ZA 1G67A 2FZ9A 4Q4QA 1EDQA 2A3HA 3SDOA 4OUEA 2JEPA 3K8MA 3LLFA 3C4UA 2H6RA 3GR8A 3WYZA 3QR0A 2CC0A 4HNUA 3PBMA 4GACA 3PZMA 1MUMA 4GUFA 4FR6A 3WQ4A 1VFTA 1HT6A 4M29A 3BLEA 1LQ2A 2WM0A 3LCXA 3S1VA 5DELA 2A1YA 4BI7A 1XLAA 4JXCA 2EXOA 4WDXA 3WEOA 1J18A 2EAWA 3RRAA 4MPKA 4GH1A 3SRDA 1MI3A 1QU4A 3NOEA 3EPOA 3RX2A 5F1UA 5H2ZA 1RK6A 4ZQOA 1TR9A 5JVLA 4M6VA 4OECA 1CNVA 3OZMA 3WQWA 4H8UA 4XZHA 4TX8A 5HNUA 4O1BA 2HBXA 4B9YA 3SCOA 3W7OA 3DDMA 4ZGYA 5L9FA 2AKZA 3GSMA 1R85A 5IDIA 5CPOA 2C19A 4Z1YA 3TSMA 4M7SA 4PN2A 5TNVA 1RPKA 4MIMA 4KWWA 5DT7A 2E0PA 2IKHA 1GOMA 4LUJA 3Q4DA 1ODUA 1XIBA 4JY9A 4WVXA 4JKKA 2VR5A 5BZAA 4PSRA 1MUWA 4LEFA 4XQ6A 3T08A 3RF9A 3T09A 1C8XA 4HGXA 2DUXA 2BMBA 5D02A 2PLMA 4HVXA 1S2CA 1OZMA 2IXUA 3CZEA 1F4AA 1E71M 2O4QA 4NKCA 3S4TA 4JKMA 2IQTA 2F38A 4LCQA 2EHHA 3II1A 1GHSA 1GW1A 1JQXA 3THQA 4FALA 3SCPA 3F4CA 4DBWA 1EO5A 2IKIA 3QQ0A 1US0A 1KLYA 3MT1A 4DYJA 3ZFHA 4CCEA 1CXFA 2VR4A 3ATYA 2QIIA 3QHOA 2L5HA 5I0DA 2PI6A 2QCFA 3DECA 1XGDA 2XG9A 4LEQA 4GX9A 2AMXA 1M5WA 5D38A 4RNJA 5ECUA 3UY7A 2QCEA 1XG3A 2Z1BA 1YE6A 4O0KA 4X9SA 1IT0A 1AG1O 1FY6A 1A4LA 1REQA 3IGUA 3O06A 3W73A 1F73A 3AZSA 5C9ZA 2A7RA 3H2CA 2J6XA 3HA1A 1O4UA 1F3EA 4ZTXA 1TA3B 1R3VA 1UD6A 5AC5A 1R9ZA 3TC3A 1K02A 4AZ6A 1G4TA 4G5DA 1OEPA 4JTRA 4FX6M 2EPNA 3SY8A 1KTNA 3SUTA 1MW2A 4CD7A 3N04A 4H8NA 2A3AA 2BY2A 3AS0A 3T81A 4UTKA 1V0KA 3LQLA 5HR7A 5KMYA 1FWDC 2WVUA 4RDYA 1GJPA 5EMMA 4UR8A 3OEXA 1ZB5A 4KWSA 3S1WA 3GR7A 3GFXA 5F2GA 4Y9PA 3E02A 1FHUA 4MNMA 5LHFA 3V16A 1XV8A 3MBDA 4FXFA 1FP9A 3OTRA 1HP4A 3BICA 7XIMA 4K39A 4WGXA 2F6UA 3PHAA 4W5UA 1R3QA 4QBXA 3S83A 1OFDA 1TRIA 2PZNA 1QJWA 5JXQA 5E6YA 1LRQA 1RLCL 4UTWA 3NEHA 5J5RA 3CH0A 3WQCA 2NZLA 1N2VA 1OGSA 3UXDA 5HMEA 4XD4A 3RPDA 4WLCA 3GTHA 2ZOXA 1YX1A 2BTMA 4QJ1A 2YZRA 1UD3A 1DIDA 3QY8A 4B4FA 3WQVA 4M1RA 3LRMA 1UUQA 3LZ3A 1YEYA 1CGYA 4D9PA 3KUMA 1A0CA 1WDQA 2FKPA 2DVTA 3WDIA 2ONEA 3OHIA 3I3EA 3V3WA 3BSGA 5D32A 1OYAA 3SGUA 4FI4A 2P0IA 3EPMA 3KW3A 9CGTA 2DSVA 4M24A 3HQPA 5E6ZA 5KZ6A 3EDFA 4PUJA 3TJIA 2G3IA 4DUVA 3BQ5A 1FCQA 1GVOA 4XIAA 2BWGA 4LYPA 2FGLA 5DCEA 3GTXA 3MVTA 5T91A 1XLEA 2VOMA 3OJGA 1B4KA 1RHCA 4LW7A 5I7GA 1AODA 4ACYA 1HKJA 2VJXA 1V7AA 1KM6A 5CEWA 1WCGA 3PFMA 3TOPA 4DZIA 2A0NA 1PVNA 1A5KC 1BRLA 1G6CA 1OM0A 3O15A 3QC0A 2CBUA 1XD1A 4TV6A 1WDPA 1QOXA 2VDHA 4MWAB 2QUTA 2V67A 2V38A 3EKZA 3WBAA 5CPMA 3SCWA 4C6PA 1EDTA 1E6QM 3MHGA 2WHKA 3MSYA 4XV0A 4DJFD 4PUUA 1XLCA 8A3HA 4TTGA 4CUCA 2CNCA 2X7VA 3OVGA 2C14A 4NJGA 1V6UA 3TYUA 4L4OA 1UMLA 3WELA 4QDPA 3BJFA 1IEIA 1H0GA 2R82A 3GHSA 3GNDA 2J13A 2Q8LA 1KWKA 2GOKA 1MEIA 2I5GA 3W53A 2WZIA 4AHQA 5EB8A 2GGHA 1UW9A 1W2PA 2NQ9A 1V08A 3I4EA 4JTAA 3ARRA 2YBTA 4NHVA 2EQDA 2Y89A 3N4AA 3EGJA 3QHNA 1XQLA 1Q7MA 4EPEC 3CPGA 4LUYA 4NAFB 2VGIA 2V8ZA 1UUMA 3L2LA 2YYTA 3R5EA 5HA7A 2EPKX 3DCPA 1P7TB 4C7FA 3FVDA 1AMKA 2FQIA 2R1LA 1H09A 4QNEA 2ZZ5A 2QJGA 3ALFA 3OGVA 4EXBA 3VX1A 4YTQA 2HXTA 2VEIA 3LGEA 3AROA 4U3AA 4LOCA 3QFWA 1B3YA 3GW0A 5GNYA 1AD1A 5HQLA 3V4BA 3SO7A 1XYFA 3CZJA 3N2XA 5C7VA 3MMDA 1KFJA 5HDRA 3SAZA 3SUVA 2XSAA 4F3HA 2GZXA 2VOTA 3V0SA 2V2DA 3AHTA 3WLPA 1O95A 3CV2A 4ZO9A 3H26A 1O60A 2YB4A 2BOGX 2EPMX 1OFRA 4GOAA 3VDCA 1EF3A 1WZAA 1QMLA 3ARTA 4GKTA 4HA0A 1O1HA 1EOMA 1PKLA 4H2CA 1A4MA 1EJRC 4QEEA 4WCJA 4CCZA 3MY9A 3NPUA 3ANYA 3Q67A 4FZIA 4LBUA 3AMCA 3EOOA 1I2QA 4GZJA 1EFZA 1WBHA 2V30A 1RBOB 1IGWA 1OFPA 4UZUA 1G01A 1Q45A 4WDTA 3QBUA 1XINA 3SCNA 4FNPA 4LYRA 2DIJA 3GXPA 3CZGA 3UZXA 3ANVA 5K3VA 2C0HA 1U1HA 4K1GA 2EJ1A 3A12A 3WEZA 2HCVA 3W72A 3AIWA 5EMKA 2Y7EA 1JDFA 3GAYA 1JQVA 4YCOA 2PDQA 4NAEA 1B3ZA 3ZM8A 3M6YA 4XD5A 2HROA 1PX8A 1JCXA 1W37A 3FAXA 4H41A 2J8TA 4AY1A 3W88A 2REQA 4DIAA 2CZEA 3WH8A 1TVLA 4DWSD 1V79A 1LUCB 2DSWA 3PJUA 3TQVA 4KIRA 2ZUSA 4UCFA 3DAQA 7CGTA 1Q5MA 4UOQA 1UH4A 1Q66A 1VYSX 3R58A 2YL6A 3S8HA 2W91A 2E8ZA 2EJAA 1GGOA 4H6RA 3DYOA 1AMYA 1FCUA 4A8NA 3M64A 2P3EA 3THCA 2WWDA 1TWIA 2Y88A 1ZY9A 1FP8A 4F0LA 3L4YA 1XS2A 1E9ZB 3MA8A 3RCYA 5BROA 2OZ0A 3Q37A 1EJ7L 3FYPA 1JYWA 1JCJA 2QQ6A 2WAGA 3I7RA 3PPFA 4IMCA 4PGLA 3W00A 2Z24A 4OTKA 4E8GA 3AYVA 5EMLA 3MBFA 1RZMA 4Q4SA 4D6JA 5FACA 3VOFA 2XIQA 4DBEA 4WF7A 2XN0A 1E5JA 3AZRA 1W54A 3OIHA 3VNJA 1YKWA 4Q33A 4EIVA 3QEZA 2Y85A 4RUBA 1ZGDA 4AZCB 4QCEA 3LBCA 4MNLA 2C6QA 2WQPA 4DAFA 1Q2RA 1R9XA 4WXYA 3F4DA 4GZEA 3WQPA 1FFQA 3VNIA 1VPXA 3AJXA 2QKFA 4P8XA 3FAWA 1US3A 2OLAA 1KXHA 4PRWA 3KOWA 2POTA 1A3HA 2XINA 3A9BA 2BZNA 1KFWA 3UA4A 3TYBA 3LU2A 3LNPA 4CN1A 4BQ2A 1HJQA 2VVSA 3P74A 4L61A 1N82A 5DO8A 2I17A 1PZ2A 1WDWA 1UR2A 2RJGA 1BF6A 4LGXA 4MDOA 4NZ4A 1X7FA 4HZMA 4BF7A 3BCJA 3KOYA 3TZNA 3VD3A 1TMLA 1FHLA 1LOSA 3TJ4A 3N73A 4FEZA 1KTBA 3M46A 1E6ZA 4GO8A 1CLKA 3AS2A 3KTXA 3OODA 4LS2A 1BYAA 1TV7A 4HKPA 1QOPA 4IP5A 4IIFA 4HA4A 3IK2A 1OY0A 5EYWA 3UPWA 1C8VA 5FJPA 1J01A 3QMTA 3DENA 3UY8A 4IJCA 1K9EA 5BCAA 4PTVA 4FF7A 2IQDA 1W0MA 1JUBA 2OJPA 3LGGA 2XPKA 3N14A 2V6AA 1JGIA 1JPDX 1QTWA 2Z6IA 1AQHA 2Y7FA 4HNNA 2CHNA 1IF2A 4GZIA 1SMAA 3KFTA 5A6MA 3C2EA 4M51A 1Z69A 3EB3A 5L6UA 2A5HA 2OX4A 1UUOA 2QS8A 1W3IA 2GQ3A 4RXFA 4Q8NA 3W6MA 3HJZA 1W5QA 1XIJA 3W7JA 3TNBA 1B3XA 5AYZA 4RV3A 2ZA3A 3IV3A 3VD9A 5DN1A 3C86A 4IX0A 1P6BA 2OVLA 4MWAA 2HS6A 3QM3A 3IJ6A 4HU4A 2Y5EA 3IARA 2NT0A 2WJFA 3LI1A 3C2YA 4WSJA 2QDEA 4JQ1A 4Y7EA 1EC7A 2I16A 4H7VA 2DIKA 3UPMA 1M41A 3HPAA 3DI1A 4NRRA 4L6OA 2EPHA 2P5NA 2ISWA 4S3CA 1E0TA 3M0JA 3SURA 3TK7A 3BURA 1E3ZA 2VFGA 1JZ6A 3P8IA 3GAKA 4AZGA 1Q85A 5D30A 3HIJA 3OGRA 3WLOA 5I3KA 3QYQA 3O8AA 7REQA 1JL8A 4XZLX 1UWIA 1NDWA 2WPGA 2R94A 2VD9A 1K7EA 4O8AA 1H5VA 3KDNA 5I3IA 5HNRA 2GLKA 5I03A 3HURA 4JFVA 1UKSA 2VWTA 4PMJA 4ZE4A 2P8CA 5CH9A 4YVPA 3NIYA 5A6JA 1XIEA 4XSMA 3H22A 1XCWA 2E25A 1K6AA 2A3BA 2WZHA 2CPUA 1GWJA 5SWUA 2D22A 3QF0A 2GGJA 5A6BD 1NARA 2OWCA 1EKOA 3GIYA 2NQJA 1JF6A 3W23A 4E2BA 3W6YA 4DUXA 2A7NA 3GDKA 3DG6A 4GH3A 3SGZA 3UG3A 5FESA 2NX9A 4V27A 2ZRZA 1EIBA 4IIBA 4R7JA 5AHFA 1M7PA 3EZ4A 1ZS2A 1JXKA 4AIEA 3FV9A 1JRCA 3RO6A 4JTQA 3UZJA 4AWEA 1L8NA 5U4NA 3NGJA 1L6WA 4AMCA 3TDFA 2PDLA 2WHMA 2NV9A 3FS2A 1XYCA 5D8WA 3SFKA 4HHPA 1LQAA 1EJUC 1Q6DA 2BDQA 1KLZA 4HA1A 2CLHA 4IL2A 1K9FA 4KEMA 4R27A 4H9YA 3UR2A 3CT2A 4ACZA 1HGWA 3MKKA 4E2OA 3NEVA 3EXRA 2AL2A 3DH7A 3EB4A 3W2JA 3DFQA 3VGHA 2YXOA 3W7CA 3G1DA 3ZWTA 1BG9A 1R46A 5HWMA 1IZJA 2IMRA 1PKNA 5CG7A 4GBDA 1V8EA 2Q71A 4Q7IA 4ZO7A 1FHVA 5IXEA 3FNDA 5CC3A 1KV5A 4UIOA 4LSBA 4JTTA 5FIPA 1EWDA 4AD1A 1KKRA 5D9PA 3PUDA 4YN5A 4BK9A 2ZX8A 1JEZA 2EKGA 1FWSA 1UR1A 1XUZA 4NJKA 2PDKA 3XINA 1GK8A 3PWIA 3K46A 2ISVA 3RLVA 4JCLA 3SCRA 3TQ0A 2WSRA 4ZVJA 3R2GA 3FIGA 5REQB 4AD0A 3ARXA 1EP3A 5H8PA 4BQ3A 3BK0A 3LPGA 3PPHA 4KKXA 1L8PA 3RIKA 1I2NA 4BF9A 4KGJA 2VEFA 2ZUUA 2QW5A 1R3TA 1Z89A 2DZBA 4Z2GA 4C1NA 3O6YX 3LSBA 3A24A 3EOEA 5T9BG 2V5JA 3TUUA 2WW5A 3B04A 5LA0A 1XCXA 1VF8A 1AL7A 1VFUA 3TCEA 2QIWA 4Q6XA 5HQEA 5HR6A 4WDWA 4LNCA 3CWHA 2XZ9A 6PTDA 2XVNA 2XWDA 1XPGA 1A80A 1UP3A 2NV2A 1W1TA 4AYGA 4GJ1A 3Q65A 2BGNE 3MYPA 3RNDA 4D6CA 4AEFA 1GQLA 1UZDA 2PSNA 4HOWA 3GKAA 4WJEA 3OVPA 1TREA 1JRBA 4LBRA 1DQUA 3CJPA 1Q8AA 5CSRA 4U28A 3I6RA 4M56A 4AC7C 1E3XA 1J10A 4JEJA 3EOSA 1QO2A 2JIWA 4UB9A 3N19B 2ZA1A 1QHPA 3REQB 4JL2A 2X1UA 1DTNA 5E0CA 3L5LA 1ZENA 4TX9A 4NZ3A 6CGTA 2HBVA 4CCCA 2CXEA 4H9MA 2JALA 3W7KA 1OX4B 1E70M 2YB1A 1W3JA 1W56A 3SBFA 1BKHA 1UC4A 4CD6A 2Z0IA 1AD4A 2AL1A 3KRSA 2QZRA 4W8AA 1XIDA 1PE1A 4JNZA 1VBUA 3MMTA 1PDZA 3O1NA 5IHSA 1BGGA 3M0VA 3VDAA 2OSYA 4AG0A 3USBA 4MUZA 1ZP3A 2QT3A 4K8GA 4C6OA 4MY9A 6TAAA 5AZ1A 3PTQA 3BXWA 3PSVA 3DUGA 2YZ5A 4BQ4A 3NQMA 3GC4A 5MKGB 3I4KA 4ZA0A 5CGQA 3VI2A 1GVRA 3NQ6A 3RFAA 1QPQA 3WD3A 2GK1A 1H49A 1RP9A 5AHMA 1HGYA 3K4AA 4XAPA 4DJDD 4LT9A 3B8SA 5CPSA 4O0QA 3LCLA 4JX5A 2UBPC 1RJQA 3NQ2A 3EXSA 3M41A 4EKJA 2PZ0A 4IM4A 4IJRA 4KCVA 1E55A 4MWAE 3VKBA 1UASA 5GPRA 1GYMA 1QHZA 5IRPA 2XH2A 3VVGA 1SO6A 1M9HA 3H55A 4EPKA 2E9LA 3I65A 4A4AA 5BOFA 3H2MA 3UZ5A 4PZVA 2Y24A 1ZBVA 4MZ8A 2J79A 4ZOEA 3WFZA 4G2DA 1UR0A 1NJJA 4U10A 9XIAA 4P8WA 3W1RA 3W3OA 3VPLA 1K77A 3KVKA 3TEVA 1BLIA 3PSWA 2VTFA 4REQA 3UXKA 2I9UA 3GH4A 3UF9A 4WHBA 3ES7A 4WOZA 3GC2A 1NP0A 4DELA 1J93A 3ERPA 4HQVA 2H8XA 2VFDA 4KQNA 3RLHA 4ORIA 2DW7A 4N4PA 4BS0A 4KEZA 3L5MA 5HOSA 3B03A 1ZPTA 4PCPA 3K30A 4L9YA 1UHVA 2QPXA 4IMAA 2GJXB 1IZKA 2VZTA 2X16A 4RZ5A 3W26A 2Z00A 4DJDA 1IXOA 3ZJKA 4CNUA 1WOAA 3XIMA 2DV0A 2ISFA 1XLHA 5MKGA 1EEXA 5DMMA 1Y8BA 2OYLA 1WYIA 1I9CB 4TOQA 4DI8A 3NO5A 1PSCA 2IUZA 3AFBA 2MANA 4LS1A 1C3FA 3NSNA 1LP6A 1UBSA 1VBJA 1LQ0A 4HMEA 1KGWA 1LZOA 4C6EA 1F61A 1Z44A 2EBNA 3MB9A 1L6GA 2WQDA 5I06A 3E0FA 3KL5A 3AXXA 4ZSTA 4D6DA 4ZZ9A 1DJIA 3CLMA 3TFXA 2FB2A 1EX5A 2R6OA 3VAVA 2WMGA 2FH6A 4LX4A 3NZPA 4ATWA 3B06A 4YTTA 3VA8A 3GXMA 4XZMX 1PS9A 4C5ZA 2PWDA 2XTKA 2YR1A 3GVWA 1DXEA 3EWCA 3K4WA 2DVUA 2EG8A 3T2QA 2VX6A 1W5OA 4QAIA 5KTLA 3BC9A 3A5FA 3CBWA 2GVEA 3QPZA 3F5LA 3UYIA 3BJSA 1XICA 1H2JA 2P10A 4IH3A 1K4HA 1YXDA 1E1EA 4AWUA 1IXNA 4IXHA 4WUIA 1B57A 3DFHA 1V5XA 3IJ7A 4Q8PA 1YDOA 4IG2A 5D2WA 1I6NA 1KW1A 1OSEA 4L6HA 4HPHA 3LPOA 1N8FA 4P8VA 4DEFA 4DJED 3R94A 5G2IA 3IIPA 4PMQA 1BVZA 2WBKA 4LYQA 3TN6A 1XL9A 1GKQA 1E4NA 2WCSA 3PG9A 3D5HA 4LTSA 1FKWA 1FWBC 5GNXA 4JTDA 2PCQA 1QBBA 4C7GA 1JUKA 5U7SA 2FVMA 1FTXA 3G8RA 3MWCA 4C6JA 2ZXQA 4FP1A 1IIHA 1UR4A 4H6KA 1K4GA 1FXPA 5TF0A 4R9XA 3L2MA 3P7YA 3W07A 2XVPA 3DXIA 2Q01A 4GI4A 1BVNP 3AHYA 4YS1A 1V6YA 1VFOA 3T4WA 3GU1A 2Z1XA 3IEBA 4N7QA 4O12A 3AZTA 1W9BM 1AH0A 1JG9A 3WDJA 1KWGA 2P1FA 6ENLA 3CTTA 3N3TA 3AUOA 3BGGA 3SCTA 3WJSA 1CXKA 3KE0A 2ZE3A 4LXFA 2AAAA 4DM1A 3NPWA 3O6DA 4U5KA 3P0XA 3GO2A 1PDYA 2ZA2A 3HPFA 1SU5A 4CQAA 4U2ZA 1H7XA 5LIXX 4Q4PA 5C5YA 3ZIZA 2X0YA 1RH9A 4E0CA 4IFRA 2RDXA 3VD7A 3BV4A 3K5XA 3B9NA 3WCZA 4KWUA 1YMYA 3VKDA 4NXKA 5AYXA 2HVMA 5FF4A 4K7YA 3WBWA 1AW5A 3MVIA 2Z4GA 2H3BA 3UG4A 5C7HA 3NSXA 1JULA 3WJWA 3S9IA 4LAOA 4REQB 1A53A 5ABFB 1GYNA 5LKYA 1DP0A 1W3NA 5LIKX 2ADAA 1MZHA 2NSXA 5F4WA 5HQMA 4UQCA 4DQWA 3BGJA 3BV7A 3THDA 1GVFA 4C6QA 3BOXA 5DBTA 4UXDA 4K7VA 1W31A 3GD6A 4RLIA 4HYWA 3NVDA 4HHLA 1P0NA 2J9ZA 3K4DA 3NG3A 2PMQA 3ELFA 4KRZA 4MYXA 4RXGA 3NSMA 4GCAA 1XBZA 1R2RA 4HNLA 2PDYA 2AAMA 4UBPC 4LAMA 3NXFA 2VKZG 3WNNA 2NVCA 3TTSA 2FB3A 1UA3A 3SSJA 4ZB2A 3G77A 3KBNA 5A1AA 2ABAA 3U5UA 5A2AA 2REQB 4PUMA 2V3FA 1CPUA 4AXKA 4EP8C 3UZWA 5D9OA 4S2CA 2BVWA 4HP5A 1KM2A 3QGKC 4EF9A 3T0DA 1H1YA 3I3BA 5AY7A 1WKYA 1HO1A 1GQJA 2PLJA 2HEJA 2ZXAA 3M0LA 2FPYA 4CQBA 3W82A 2ZC1A 1DE5A 3WQ5A 1MDLA 4GMEA 1A5UA 3EDJA 1TO3A 4TVDA 4L9ZA 4HZ8A 4H9TA 1EP2A 3V5OA 2RDTA 4C60A 1FDZA 1DEDA 3EOUA 3L4ZA 5C2XA 1V0NA 2CLKA 1BWLA 3S2JA 1FWCC 3CK5A 1GKRA 1LYXA 1KGUA 4I9AA 5HNNA 3U2OA 4GYPA 5AHNA 3IANA 4GK8A 4AH7A 3H2NA 4H9VA 1SFTA 4WSKA 1DVJA 1X7IA 1S1RA 5JH2A 4W5ZA 2V63A 4RX0A 1XUUA 2GJRA 1E0XA 1NF7A 3BAIA 3BSHA 4QHRA 1B31A 4TMCA 3F03K 3RRXA 1B0IA 1EJTC 2H8ZA 1FCVA 2PGWA 2KX9A 1WQ5A 3EA2A 1UZHA 4L6DA 4E2VA 3KRBA 1OD8A 1YBQA 1XDMA 2CKSA 4GO9A 2VMFA 3BLPX 4LS0A 3U4FA 2UZ9A 4B5XA 1V3HA 4PUNA 5LXEA 4Q8TA 1TFVA 3GW3A 3P61A 2B0MA 3CLWA 4MZYA 1EQCA 2F8QA 3W7RA 2XN2A 4NZFA 3FVMA 2W92A 3C3NA 4NJIA 6ALDA 4IZGA 5CPLA 1G1YA 3G6MA 4XX6A 5HPCA 3ARPA 1PJ9A 1TZ9A 1Y5XA 3EDKA 4PEEA 4JTSA 4ADSA 4XVEA 4BEQA 2B7QA 4ENLA 2I1OA 1HL9A 1MNZA 4NVTA 2Z6JA 4L80A 1B4EA 2UY3A 3ZJ6A 5LHEA 3DERA 1ZFJA 5LIUX 4B15A 3UJEA 1T41A 3PBUA 4JFUA 3WK1A 1IEXA 4RZBA 1RBLA 2UY5A 1RAKA 1R6WA 4JQ2A 3SIZA 2AL2B 3MV01 5DANA 2D0FA 3ABSA 4PB5A 2ZE0A 1QATA 3QHMA 3GXNA 1I1XA 2NSOA 3UD6A 4W7WA 1TJPA 2BOEX 3OG3A 2EPOA 3VC6A 2GVJA 3V5FA 4JTGA 4AWSA 2HVNA 2ZDSA 3ZT7A 4JTJA 1R38A 3OIXA 1H3GA 3FA3A 3KWXA 1KNWA 1AJ2A 3QV6A 4DF2A 4AUBA 3VNMA 2OELA 3GS6A 1WAWA 3HU7A 2JKPA 7ODCA 2EKCA 1UYQA 4UTIA 2E9MA 1M6JA 1PIIA 3BOFA 4IPLA 1V6VA 2Z2AA 2BV9A 1BWVA 4NI3A 3IVSA 1HNYA 2GPTA 5D09A 4FXRA 1EC9A 3S1GA 8XIMA 3B8TA 4KFNA 2J7HA 1XRSA 1XXXA 2Y8UA 4PMYA 4G7EB 5BNKA 3BMWA 2F9RA 1N7KA 3GVQA 1PHWA 2R8WA 1TZ7A 1WX0A 1Q2SA 2VENA 2OT0A 4IMEA 2W27A 4FNSA 1JPHA 4FF5A 4WGHA 2I57A 4PB3A 3R13A 3IWPA 4GXWA 1J0HA 3UETA 1C29A 1ME9A 3WLIA 3QYSA 4W7VA 2VC5A 1B3WA 3QH2A 3CZLA 4NXSA 1XQKA 3MI6A 4EX4A 2ZWYA 2FHFA 2WM1A 1X8CA 1W1IE 3W1TA 3W71A 3T0AA 3GRIA 2ZUTA 3VK5A 2O9TA 3TTQA 4QG8A 3HPXA 4MHBA 3UXIA 1RQBA 2XFFA 3CHFA 1FWAC 2HTMA 3GFYA 4DWDA 4F9JA 5CPQA 1EA0A 3N1AA 1IZCA 4MM1A 1X39A 2ZUVA 1POKA 3DHUA 5I02A 2DU2A 5ENLA 2A6LA 4G56A 4JX6A 4ZTYA 1K03A 2UV8G 1E9IA 3FHAA 1XBVA 3FW6A 3JVAA 3W2NA 3IJQA 1BFNA 1JZ2A 1ITXA 1VZWA 1QAPA 3NO3A 2OEKA 1NEYA 3TE9A 2D2HA 3BOLA 1KRBC 2CITA 1WKFA 2WZTA 3BO9A 3RN6A 1TV3A 2HPIA 1JFXA 5K7JA 1OYCA 3T4CA 3SN0A 3G22A 3KCOA 4OOZA 4BJHA 2FH8A 1MXSA 1BRLB 4GISA 3W1NA 4C91A 5C6MA 1UQYA 1TPWA 4QE1A 3V5CA 1TIWA 2V5CA 4WXZA 3TC7A 4HCDA 3HZ3A 1KQYA 4H9ZA 3ES8A 2J62A 2WNZA 4NT0A 3B0PA 4W88A 2GSEA 1QFEA 3JRKA 3V75A 3M16A 1EWEA 4UFLA 3ECQA 3S6DA 3HO8A 2VP8A 3RCNA 1IIGA 1DJHA 3DHFA 4P7LA 3SGGA 1KXQA 2PFHA 1DWAM 5M03A 1KO0A 3B0YA 2J77A 3FA5A 4H6QA 4IPPA 4ZL1A 1OINA 2W0UA 3H21A 4OE7A 3WLNA 1P1MA 2O9OA 4U3CA 4DX3A 4B90A 3NL5A 1YNQA 3HPZA 4GI8A 4DPPA 3H70A 2X1IA 1AZ2A 3WFAA 1UWQA 2QCHA 3WFLA 2ZX9A 2RGLA 3OA3A 3HGSA 4L4PA 2J75A 1E6SM 2QCCA 4IIGA 3MHFA 2D2GA 1EA9C 3VIFA 1FDJA 3DFPA 2D69A 2PCEA 4CNNA 4D6FA 4GIAA 2XHYA 4CEXC 3RCMA 1CWYA 3AISA 3SUWA 4XBSA 1DHPA 1BEUA 3A47A 1QNOA 1RD6A 1UD4A 2QGYA 4MOZA 3PM6A 1L6YA 1DJWA 3HJEA 5GJPA 1CECA 3PZQA 3CPUA 3QFEA 4H83A 5EPDA 3WD2A 4AZ5A 3TOYA 4O17A 3QXBA 1MSSA 3QJAA 3PUOA 2DJXA 3EA1A 4PMUA 5CSYA 3GNOA 3GX9A 3M43A 1T5AA 5K9CA 1CZ1A 2PEVA 3WL0A 3KEHA 1SQ7A 3OB8A 4V1YA 5HWNA 4N42A 3DYPA 3B05A 4CVWA 2VFHA 4ZE5A 2OOFA 4QAWA 2CHRA 2WJEA 1L2UA 3V18A 3J7HA 3CAWA 4IJBA 4CN6A 1U5HA 4E5TA 5CZJA 4FOUA 5JBDA 3M0HA 3ABOA 3KOZA 1DQWA 2R1PA 2PGEA 1GZ1A 3WQGA 2BB0A 3TYZA 1NWUA 3U2EA 1TWWA 3SCVA 4D6EA 1JPIA 4UTJA 1AW2A 3PULA 4QROA 5TQLA 2PDIA 2H90A 3WNMA 1F5ZA 3FGCB 3T42A 3LERA 5AHIA 1H4PA 1LRTA 3E96A 4Q8OA 3L12A 3MS8A 1W2VA 4ORMA 3SB0A 2J47A 2B7OA 4IOTA 3UJFA 3ARVA 4HMDA 3TCSA 4AF0B 2XM1A 3OYZA 2CWXA 3MKVA 1C8YA 4JDBA 4KWVA 2Y7GA 2WVTA 2SFPA 3ARQA 1E40A 1LL7A 3RG6A 2JE8A 4LUSA 2PRMA 4TR9A 5E93A 3APGA 4FPSA 2FGBA 1SUXA 1LBLA 4AHPA 4XISA 3HG3A 5XIMA 4W8LA 1Y7VA 4L1WA 1ONXA 4R34A 2OR2A 3QZEA 2F2HA 1GTHA 3DGRA 3U7VA 3P6LA 3LQGA 3RU6A 1M53A 3OVRA 3DFTA 1X1OA 3QY6A 4UTWC 1TTJA 3NUKA 3HGOA 4U31A 1J6PA 5A8NA 1F6YA 1NM9A 3CUFA 3QW3A 1EYWA 1ZP4A 1OCBA 4EAYA 1E4LA 1MRQA 4PRTA 1VCVA 1KBJA 2W5FA 1EPVA 4KS0A 1D7FA 4CD5A 4J3ZA 4WRHA 1VFFA 2XIBA 4HPGA 4PSPA 4LRSA 3BH4A 3HFYA 3FOKA 4EANA 4MGGA 2PS2A 1VB9A 3LHTA 3UPBA 2TYSA 4PUEA 2YL9A 2V81A 4QEHA 4PCTA 4F79A 1YPFA 1ZBWA 4CKQA 1BSIA 1OFAA 2YCKX 4QP0A 4LUIA 3KM8A 4CCDA 4P8UA 1H7RA 3WD1A 2F6KA 2ZUNA 2PDXA 4IUOA 5M17A 3G24A 3F2DA 2FDMA 3U9IA 3R12A 3FEMA 2ZXDA 3B3DA 1XJBA 3UR8A 1Z32X 4HZ7A 4EPDC 3FSUA 2PURA 1B54A 1V7YA 1QPKA 3KBJA 2YDSA 3EWWA 3EX2A 1FBAA 4PL1A 2DORA 2PDPA 3F5KA 1FX6A 2O4MA 2C71A 3I68A 3S46A 3PZGA 3LG3A 3M0XA 3U2CA 5DT5A 1R30A 3W81A 3MUIA 1NWSA 3WMBA 2DSKA 4K38A 4GY1A 5D05A 5D2YA 1CGVA 2XVKA 1E6XM 4DUWA 5JQ9A 5AC4A 5HXMA 4C5YA 4LY4A 4O1AA 4XUYA 5HUOA 1V51A 1L0PA 1XGZA 5CLWA 2JKAA 4MJMA 4MKSA 4IP7A 4RE2A 1E6RA 2QDHA 3M5VA 1HF6A 1GOKA 3EX3A 1VR6A 4J3WA 4PUWA 3SR7A 4MG4A 4YXGA 1V03A 1OF6A 3AXIA 3TV8A 2C1IA 3GDLA 2P76A 4JTFA 2G97A 1KB3A 3BVJA 1EP1A 3EWZA 5C9WA 1FWHC 2XIJA 2VFIA 1DJZA 2WMJA 3O7UA 1TPEA 4PMOA 1EZWA 1QW8A 3KBSA 1QVBA 2WOQA 3V0UA 3GUGA 1JVNA 2CZFA 1ONRA 1ZHAA 2OWXA 3G1FA 1DJQA 1DXFA 2VX4A 3VTRA 2Q8XA 4HA3A 4GYJA 3S2LA 5BU6A 3M47A 1AH4A 4ZB0A 1KCXA 1GJUA 1Q3NA 2KZHA 4GVIA 4L64A 5A8QA 1JCYA 1UKOA 3DZ1A 3ONCA 2GGEA 1BPLB 2CLLA 5GQBA 3W2LA 3CUGA 2QJHA 4GUJA 3RAOA 3TKFA 4LAUA 4JY8A 4M8UA 3N34A 1TVPA 4PL2A 4IUGA 1NWRA 4QLKA 3LX9A 4AD5A 1F7BA 1IXPA 4U2YA 3ZZ1A 4IGSA 4FR1A 5D37A 4LH8A 2YIHA 4FNQA 3TU9A 1RK5A 4DLMA 2F2KA 2PGRA 4A3YA 4KRUA 5CPTA 2QXWA 1Q6EA 1TWZA 3CH9A 3LOTA 1ZU8A 3CZKA 1P6WA 4UTHA 4HT3A 2QAPA 3QSTA 1ISWA 1NSJA 2DUZA 2CZDA 4M19A 1OK6A 2OSXA 4E6MA 3KP1A 3LNMA 2WNWA 2CETA 3GXIA 3KCJA 1PPIA 1UC5A 1B1YA 3OBEA 1G0CA 1OX4A 3L0KA 4QCFA 3FCPA 4HPXA 5I00A 3EOLA 2HRWA 1EBHA 4OZOA 2X1SA 1AVAA 2YDRA 2YYUA 4E8DA 3DHDA 4TTUA 3KVMA 3AMGA 3C52A 4LVAA 3BJTA 5A6BA 3P60A 3PK7A 5CPNA 3MZNA 4K6AA 4RJEA 2AQOA 4DJEC 3L4WA 1JYXA 3NFUA 4ZFMA 4E2DA 2I56A 4DNMA 2QNEA 3BCFA 1UB3A 5EBUA 3NL2A 1AUSL 3C3UA 5I3HA 1W32A 1FOBA 4GFSA 2I5QA 3WH7A 4M0XA 4X63A 1RXOB 2OTDA 3W29A 3TMQA 3KRUA 3QVQA 1EHNA 1PWLA 1UKQA 4DAIA 2PDWA 3IACA 1HL8A 1W5NA 3KHJA 3QV9A 3H7VA 2PLCA 3K8KA 3T05A 3B0XA 3RDKA 4LC6A 5HJXA 8CGTA 3KP0A 4KWOA 3GU9A 3EX6A 4RNHA 1RBAA 2QDDA 4A29A 4NX0A 1HKVA 1AJ0A 4BR1A 5J5DA 1UMYA 4JEQA 3GYEA 4YHGA 1FWFC 3NPXA 4KPLA 2WMIB 4H7CA 1VIZA 5M2FX 1GEQA 2NUWA 4LQ1A 3F4VA 2AMGA 4YYCA 2BNJA 4QRNA 3IRDA 4ES4A 3EMCA 2VC6A 3W1PA 2JF6A 4WJ8A 3TX9A 3AXKA 1DWHM 4AEOA 2VQTA 2VFFA 4E8CA 3UNDA 4AD4A 3BG9A 3P93A 4JS3A 1OIMA 2E67A 1H11A 1TZZA 4PTXA 4XBJA 3W24A 3PPGA 3GC5A 1DPMA 3MUY1 5I5RA 3R10A 1RD5A 5DBUA 1NFPA 7PTDA 1TRDA 4Q4KA 1P4CA 4U4MA 3WG6A 1XF0A 3E9AA 1W9PA 4FO4A 4D1IA 2FFCA 1JDCA 3WNOA 1DTUA 7A3HA 1N55A 3MHUA 4GNJA 4PYSA 5K2ZA 5A8OA 5FJOA 1RVKA 2CLOA 4JTCA 3E49A 1U2YA 5FKYA 1GT8A 2VX5A 3E2SA 4YLWA 3CZ8A 4URIA 3A4AA 3U57A 3E0VA 4I7VA 1TWDA 2HSAA 2FJKA 3GVGA 4KH2A 4XAFA 2VRQA 3AXMA 2ZVIA 4HB7A 4B4HA 6A3HA 2PTWA 4RKAA 3Q94A 1ELSA 3DYMA 4GCXA 1W9VA 3G1XA 3HGRA 3UCCA 4FOJA 5BRQA 4QGCA 2C3ZA 3MMUA 3BLFA 4UNLA 1SR9A 2JEQA 4ICMA 1CX9A 1XCFA 3DFSA 1ZAHA 3H2EA 2E40A 3GLCA 4US5D 3MI3A 1W1B1 3HOJA 3VD5A 5EFDA 3DKLA 4O1CA 1TUFA 5LZLA 4F4RA 3EKLA 3BZGA 5KITA 1Q4NX 2Z1WA 1XI3A 1F07A