1EZWA

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
347
structure length
347
Chain Sequence
b'AEVSFGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDWISGGRAIIGMGPGDKATFDKMGLPFPCKIPIWNPEAEDEVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVKARSIQGSDIPFYMGAQGPIMLKTAGEIANGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEATKIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIGKGDFGTAIGLVDEDMIEAFSIAGDPDTVVDKIEELLKAGVTQVVVGSPIGPDKEKAIELVGQEVIPHFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 128
structure length 347
sequence length 347
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1ezwA00
1LUCB 2I7GA 1NFPA 3RAOA 1BRLB 1LUCA 5DQPA 3B9OA 1M41A 1XKJA 1EZWA 5LXEA 1BRLA 3B4YA 1NQKA 3FGCB 1TVLA 5AECA 4US5D 1RHCA 3FGCA 1Z69A 1BSLA 4UWMA 1YW1A 4J2PA 3C8NA 2B81A 3SDOA 1FVPA 4US5A 1F07A 3B9NA
chains in the Genus database with same CATH superfamily
1RR2A 1W1B1 3MI3A 3VNYA 2Y70A 1GVFA 3O63A 2G3FA 2W79A 5IFTA 4L1WA 3S2JA 3GNPA 2NQLA 4N6EA 1RPKA 1OFDA 3QTGA 1WA3A 3S0CA 4XTIA 4CQ9A 4IF2A 3QKZA 2A85A 5FEPA 2Y7FA 3GG8A 1W91A 4JQ4A 4XVDA 4GJIA 4C1NB 2EPLX 1F73A 1BXBA 1US0A 4XD6A 4CVUA 4ZTXA 3M0MA 2H6RA 3VNJA 1GZ1A 1DQWA 1F76A 1XH2A 2BOFX 3R89A 3RJXA 1OD0A 4GX9A 3MDWA 2GVYA 4YHEA 1B57A 1QI3A 2QDDA 1QMLA 3W28A 2NWSA 5E09A 1A0EA 3V1PA 4EPKA 3W82A 1KCZA 4BKNA 1TPB1 3GM8A 4E4PA 3KOYA 2WB5A 4S3GA 3F4DA 1CB7B 5KINA 3PJUA 3CZLA 2YFNA 3GHSA 6TAAA 2Z1SA 4MIMA 1Q66A 3R8RA 1N7KA 3NJ3A 2OLHA 2C1IA 2VKZG 1H7XA 4QHRA 4IMDA 2ZUMA 2ZZ3A 4LF1A 3WH6A 3TWAA 3K4AA 5FA5A 3THUA 3K46A 3PSVA 2HZGA 4AD4A 2DT0A 4FOUA 1TVLA 2R24A 1JYNA 1L6FA 1A53A 3NTYA 1V08A 1XLFA 1GQNA 2PBGA 1S1RA 3UXIA 4LNCA 4F2BA 2PDFA 4XD4A 5EMUA 4NHVA 3GVVA 4NYUA 3APTA 4PUJA 3CUJA 4Q7NA 2PA6A 1TRIA 2EF9A 1UOKA 2WQPA 4UIOA 4X22A 3LGGA 1S39A 1VZWA 4L61A 3BANA 5A6JA 3ZWSA 3TA9A 4LBUA 4DJDA 1BWKA 5ECVA 1RCOB 1UD4A 5F7UA 4AD2A 3QFWA 4BI6A 2WVUA 3PG8A 3GW3A 3ORWA 3H23A 1VEPA 4IH3A 4IHCA 2GL5A 2D20A 2P88A 2QPSA 3E0VA 1P6BA 1EC8A 3ABZA 4M6UA 1F61A 3MSYA 2UWFA 3OPSA 1U1HA 4ZFCA 3VOCA 4V2XA 1Q13A 3RU6A 5LXXA 3MT1A 1BQCA 2J8GA 4RW5A 1XI3A 5AECA 2VJXA 4OIFA 3IIZA 3Q67A 3N6JA 4OECA 4US5A 2I9EA 1OZMA 3BV7A 4GZ7A 4LAUA 4IMGA 4C6CA 4PULA 4GUIA 3NFUA 2IKJA 2VFGA 2ZZ4A 1M41A 4UUIA 3CMGA 1QPRA 5CGMA 3N9KA 1QNVA 2XIIA 3T08A 2V6AA 3P60A 4GUJA 4GYFA 1F6PA 3UNDA 2V3EA 2Z1WA 4CCZA 1CW2A 3DC8A 4M6VA 3U8GA 2TPSA 5AZ1A 1XUUA 4Z1DA 2GDUA 1E6SM 2G3NA 1K7XA 4JTIA 1ALDA 5IBXA 1BFNA 3W37A 1EJXC 3N2MA 5JBDA 3SUTA 4UNLA 3GU9A 1XBYA 3GTXA 1MRQA 4GD0A 2W6RA 1GKQA 2IKIA 2V38A 4KWVA 3UG5A 4U5KA 4GZJA 3SADA 5IHRA 3Q94A 2OEJA 2WHMA 2JALA 1X8CA 1I4NA 2NX3A 4HU4A 1GQJA 2WZMA 3HQOA 3CBWA 2ACQA 1ZNNA 3G18A 2XGIA 5D04C 3ALFA 2ISSA 2NV9A 3VC5A 4LUTB 4Q33A 4MY9A 1DJHA 1IXQA 3USBA 1JL8A 1DVJA 2CZFA 3DG6A 4P8VA 5A6LA 4P7LA 1SFJA 2HWGA 5BWFA 1DBTA 1ZP4A 3QZEA 3NO1A 4EWND 4WD0A 3VIHA 1IEQA 2WNNA 3HF3A 2DSVA 4HMDA 3TV8A 4H6QA 2I7GA 2GQ3A 1G4TA 1E71M 4FXJA 4EF9A 3MJMA 3V5FA 4WGHA 1REQB 3TFXA 1V7YA 2DVXA 1MWOA 3WMSA 3VZYA 3WF1A 5A5WA 3KM8A 2FVLA 4RDWA 3VZXA 1O1HA 4YXGA 4M3PA 1DOSA 2FTYA 2ZWZA 5I23A 1OK4A 3MS8A 3WEOA 3CAKA 3AS1A 5JXQA 1IIHA 2OKOA 2CITA 3W2MA 1U33A 5L9FA 1X8FA 4MF4A 1K4HA 1XYBA 1EH9A 1W5MA 4CQCA 3R0KA 4ZODA 1T96A 1LG2A 3GB6A 5I0DA 1ZL1A 1ITUA 2WHKA 5HK4A 1KRBC 1Q6CA 1VB9A 1WKFA 3W1PA 4JCLA 3N11A 1I60A 4V28A 1S5NA 3GS6A 1PDZA 1FWFC 3UJ2A 2FMNA 4UTWC 2AGTA 3MCNA 1KGXA 3KS5A 4AZ6A 2R14A 3ZJ7A 8TIMA 2NXIA 4DF2A 3OO2A 4S39A 1LBMA 3NYDA 1JIBA 4WSHA 2VDHA 4G7EA 2XH4A 3WQ5A 4AFYA 2GVJA 2CLOA 1DIEA 3PZQA 5HDRA 3GDBA 2O9PA 3OA5A 2FGZA 1V02A 4IPNB 3MMUA 1CCWB 1YQ2A 3VU2A 1I0DA 2GYIA 2J7GA 3W4RA 5LIXX 1BLIA 2IMRA 3PJXA 4NJJA 4R88A 3VFCA 3ZLHA 2D69A 1W32A 1CGVA 4F9JA 2ZICA 5I06A 3GHUA 3KHJA 1QO2A 2D22A 2F7FA 3DGRA 1G01A 4D8AA 1KXHA 2YDQA 2XPKA 3TN4A 4IQEA 1GJPA 2J7HA 3T0CA 2SFPA 1A5AA 4OFCA 3EEZA 3CAVA 4K39A 3A6OA 1E70M 4KGLA 3MZ2A 5AZ0A 5FJPA 1P0NA 4WUIA 3RF9A 2HISA 3B3DA 5DMMA 4BQ3A 4Q32A 2CLKA 4C6BA 2ZRUA 3TN5A 3WBAA 3D0CA 1UKPA 4NZJA 1NVMA 4CNPA 4R33A 1TE6A 1SZEA 2VEGA 3WIJA 4KFPA 1FCBA 5CZTA 2OWXA 1L8PA 1UA7A 3VGHA 3W27A 4CCDA 4D71A 2Z28A 5EPDA 3P82A 3UZWA 5G5IA 3OOQA 2ZUSA 4FXSA 3GU1A 1CGWA 5DQPA 3B9OA 5PTDA 3QC0A 1OT2A 1AVAA 4HA0A 4PRTA 5AYYA 4DZAA 4A8NA 3DFHA 4X2RA 5IDZA 2QCGA 4ES4A 3LK6A 1OCJA 3MZNA 3RLVA 2OFJA 4MGGA 1PTAA 4GQRA 2PTZA 3TKFA 4H8UA 5G4WA 5JH1A 2YCIX 1IXNA 3HMJG 2XH2A 1V3LA 4HK7A 2FPVA 5HJLA 4NRRA 4QFUA 2YGYA 3TTSA 4H7VA 4UNIA 3BWWA 5I3GA 4O15A 3CLMA 1K8YA 3N6HA 4NU7A 4RPQA 2OPJA 1ONEA 2Q71A 2QCLA 3ZMRA 2WMIB 1UKQA 2P8BA 3QC3A 2ZXQA 1FDJA 1WOBA 1KRCC 1MW3A 5EU9A 3QR1A 3OG3A 1K8XA 3WDPP 3W07A 4QBXA 2ACRA 1LRQA 4PE8A 3DKLA 2Q6ZA 3H21A 3W2NA 2H90A 1LZOA 1VJZA 4NG3A 2Y8VA 2OWWA 3N17A 4NQ1A 4LS0A 2OX4A 3EDDA 1UWTA 4ZOAA 1J0HA 3OU8A 4H9VA 2VEIA 3G1YA 4ZMGA 1XDLA 4EANA 1B5TA 3VNKA 2BX7A 3UY8A 3PTMA 3CIVA 3TZFA 1FWEC 3NUKA 1QPNA 2ZZ2A 3QN3A 3PJWA 1P5BA 4IIEA 4OVXA 4FP1A 3UETA 3QW3A 3L2LA 1QPQA 3ZT7A 4DN1A 3TSMA 4E8DA 3WCZA 2FPTA 1GKPA 3PBYA 3S6TA 1GG0A 3QQ1A 4UR9A 1KRMA 2AL2A 4FHAA 3GNRA 1W1PA 3MCMA 5EMLA 4M80A 4HZ8A 2ZXBA 5TD4A 1B3VA 3Q45A 3DDMA 4LX4A 3S3GA 4J3VA 1QHPA 3S5ZA 4FI4A 1C7TA 4XZMX 3CZ8A 4O19A 1OFOA 4I7WA 1ZBKA 3NQ2A 3PG9A 4LRTA 4JY9A 3JZEA 3TC7A 1FWWA 1MMFA 2V67A 1KBJA 4EX4A 2WBGA 1VF8A 1J0IA 4XZWA 3DYMA 1QHOA 4AX6A 2F61A 2DPEA 1P1MA 2I14A 4ZSTA 3F2DA 4R7OA 3B8IA 1YBQA 3HQ1A 4B4FA 2ONEA 1ISVA 1LROA 4NAEA 1H0IA 3HU7A 3ZJKA 4GABA 2UV8G 2GSJA 1O66A 1GG1A 4JTDA 5HUOA 2OYMA 3WD3A 5BMWA 4EKJA 1BGGA 1VFUA 1V6UA 3P80A 3VO0A 1ONRA 3AHTA 3KBWA 4C7FA 1HF6A 1JNEA 3NGFA 1E56A 2DZXA 3W29A 5AYIA 1A0DA 1EP1A 3W1QA 4RXFA 5LXEA 1JPKA 2WPBA 4DBDA 4DZHA 1XYAA 3NQVA 4WSKA 1BXCA 4AY8A 1V0MA 4DVOA 1WX0A 4C6NA 3SN4A 1ITCA 3VD9A 2GK1A 4QM1A 1CWYA 4JFUA 4JZ5A 5HMDA 1HIZA 2TSYA 4HOXA 2FDSA 3LI0A 4TV5A 3WF0A 5A2BA 3KCLA 5BOFA 1G5AA 1UWUA 1JRBA 1XSJA 1DV7A 1XGZA 3G2GA 1UIPA 2HPIA 3T40A 1QPOA 1N55A 4HHLA 2G50A 4CN4A 2CCRA 4ZQNA 1FWJC 1Q7MA 3NIYA 5FL0A 1XRVA 3E2SA 1TQJA 5TBOA 1HQTA 4I8DA 2CLFA 2Z2UA 4FLQA 1UR1A 3VDBA 2X1UA 4AVOA 3FSUA 3ATZA 3NVTA 2YCLB 5DCBA 2OT0A 3AIEA 3KL5A 2VD8A 3TYBA 5LIUX 4IIFA 3BJFA 3MYPA 1EEPA 2PURA 3JZUA 5K7JA 1I0BA 3F4NA 4GI9A 1OGGA 3CWHA 3QJAA 4LVFA 3M0JA 4PFMA 3HV9A 3VKAA 1NDWA 1G7UA 4RNHA 2E77A 1Q4WA 2O7SA 2ZTJA 3CK5A 3QGAC 3K1GA 1U2YA 4CCCA 5CZ0A 3GR7A 1CLKA 3PF3A 3LMZA 5HR6A 4JX6A 2PDBA 2X0HA 3LCXA 1XDMA 3ZJ6A 4IUGA 4M29A 3AMLA 4LB4A 4QQUA 4JHMA 4AZHA 1WUEA 3C2OA 1YHTA 2YLAA 4YVXA 1RJQA 3UGRA 4S3EA 2B81A 3S1WA 1KQZA 4Q7IA 3W1LA 4Y6GA 1JYWA 3ALGA 3UA4A 1I2RA 1GZGA 4G9PA 5D2WA 1VFSA 1AW5A 4UBPC 1KCKA 4X0VA 1J4EA 5A6MA 1F5ZA 1E72M 4IX2A 3DI0A 4JN6A 3UZYA 2HNHA 4NAEB 3WSUA 2PDYA 4GPNA 3N3MA 2DSZA 5FJUA 1BSIA 3LCIA 1EDTA 3SJ3A 2WLZA 3GXNA 5H8MA 3UWEA 3WK0A 1E5NA 1SO3A 3M0VA 5H2ZA 4FLSA 2VEFA 1J12A 1OX6A 2DT3A 4I9MA 3VKBA 3D3FA 2DZVA 5BW6A 1EIBA 4NSBA 1EP2A 3KOFA 3FAWA 1HKIA 3CYJA 3IAPA 1Q4NX 2BY0A 4AWEA 1BXNA 2DVUA 1K70A 1P48A 1XBZA 2JBMA 2PU0A 1TX0A 3CHEA 4O0ZA 2JKEA 3AAMA 4HSHA 2Z1XA 2BODX 3NURA 3H2FA 4B3KA 4EE9A 4HYWA 3UQNA 1VEMA 5XINA 3U7BA 3AMDA 1VYRA 2WQDA 2GK1B 3T2OA 3BQ5A 3ITXA 3N34A 3PB2A 3TDFA 3ITTA 4K2SA 4OGZA 1NWSA 3SQSA 1UJPA 2PTYA 1HKKA 3WJYA 3AIUA 2VC5A 2WZTA 4FF5A 3S9YA 4YCPA 2AL1A 3O0KA 2W92A 4F66A 1EUAA 2X1TA 2YA2A 2ZDSA 3H2OA 1TJPA 3RR1A 3SRFA 3LRLA 2IQTA 1FFRA 1PZ2A 3KS6A 1ZAHA 1LBLA 1Q6QA 3EOLA 4XTDA 3MANA 4WY0A 2XIJA 4CNNA 1G4SA 3AISA 3B06A 1FWRA 1W31A 3EA1A 5GJMA 4BF9A 2FLIA 4ZBCA 4GVIA 2YDSA 3AIWA 3C3NA 4F2UA 4NXKA 1GJWA 1E9YB 2E6FA 1SJAA 4HNLA 1PHQA 1IYXA 1EWEA 3DFSA 1PL9A 3Q2DA 3WJZA 4AZ5A 3P84A 2E1DA 3NOEA 4GUFA 4MPKA 1UZ1A 3N18A 4B9YA 5LNVA 2HRWA 1B31A 2O9OA 2R1PA 3SRKA 3AHXA 3WLIA 1IZKA 1HP5A 4E6MA 3CZKA 2Z7GA 4PUWA 5T8GA 4JXCA 3D46A 5F2LA 2O4QA 1I2OA 5G1TA 1J6OA 1MQRA 3WK3A 1C29A 3THDA 4ZQPA 3RO8A 2AAAA 2PC8A 3ZIZA 4UQBA 2FDMA 4HVXA 4WEVX 3W00A 2YL5A 6ALDA 3R6IA 4E8CA 1H51A 2GQ8A 3LEPA 3RNDA 1V03A 2WSPA 3COTA 4WJXA 2Y5SA 3IGXA 3UWVA 2YXOA 3FYOA 2QPXA 3TVAA 1KM6A 1OFEA 2J6VA 2QVNA 1GT8A 3HGRA 2R82A 3GO2A 1Z8AA 4ZB2A 1XYZA 3WDQA 2WM0A 3A4WA 3S1XA 4Z17A 2AAMA 1L9WA 4BI5A 1FTXA 1R9XA 2V5JA 1Z41A 4QP0A 4IICA 1WAWA 2RFGA 2ZUUA 1E43A 2Y62A 1M7JA 4DO5A 4QCFA 3EWDA 5JIPA 4O53A 3L4VA 1VLIA 4MYAA 5EMMA 4GJJA 1G94A 1VBRA 2I56A 1UPMB 1NH6A 3W73A 4GFSA 5CKSA 3STPA 1BG9A 3FGCB 2GGHA 3EMZA 5BWAA 1MW0A 4LB3A 4AISA 1MXGA 3P14A 3KUMA 5ABFB 1IWAA 3K4DA 4AU0A 1K77A 4FR6A 1YYAA 2IKGA 4CGTA 3WJXA 1DWGM 4AEOA 2QCNA 2KZHA 1LUCA 3ZO9A 4ICCX 3NDOA 3ABQA 2NSXA 3D5HA 3AS0A 1GQLA 4OBTA 3DESA 1G4EA 2G97A 1Q6EA 5E0KA 4Q3MA 2UZ9A 2WCAA 1WZKA 5FESA 5DF0A 2YBUA 7PTDA 1XPYA 3ATYA 2YDRA 4YMZA 3M5XA 4X9SA 2YL9A 2OELA 3CUGA 2PWHA 3CIXA 3HGJA 3BDKA 3FJ4A 3CH0A 4F40A 1B3ZA 2FKPA 3BZJA 4GYPC 4O1BA 4NZ3A 3SUUA 3VA8A 3GDRA 4H9XA 1Z69A 3TJLA 3N04A 1LWHA 1GQKA 4U10A 3TQVA 2Z27A 3FYPA 3BICA 2OX1A 1LT8A 1VENA 2VR2A 1BYCA 4BEQA 1MUMA 2ALDA 4HPNA 2UY5A 4UTHA 1XLMA 2HSAA 3K5XA 2BNJA 4G7FA 3UP8A 1UKOA 4ZB0A 4C1LA 5HOSA 1WDDA 3CUHA 1JDCA 2FZ9A 3UEQA 4B5VA 2EG6A 3SCSA 1Q2SA 4CD4A 3WQOA 1H3GA 3CU2A 1JDAA 1EA9C 1K9EA 2V5CA 4QSFA 2HMCA 3L23A 1V6XA 1U30A 4PCSA 4PMXA 3OTRA 4ONVA 3WN6A 2QIIA 5J8LA 1GTHA 3VMPA 4H7ZA 4PCFA 2FPYA 4CQDA 2G41A 3VGBA 2YCEA 3AIRA 3LY0A 2YCJA 3B4YA 3KXQA 4MUZA 5CCZA 3PANA 2BGQA 3USZA 3EXTA 1Q3NA 3B03A 2NXHA 2VRQA 4UMAA 4FALA 5KTLA 2QMJA 1QJWA 1S2CA 2YZRA 1VIZA 4GVFA 5CH9A 4I8YA 2X16A 1HO4A 1BF6A 1EDQA 5AFDA 3A64A 4FX6M 1XLKA 2FTPA 2XDFA 3EEGA 3VNLA 1FHUA 3IUDA 3NVDA 3AJXA 4CD6A 5ABHA 5A8OA 3RLHA 1U5JA 3THQA 3CS2A 2EKCA 5KZMA 5DT5A 3N2TA 4RK8A 4MM1A 3WENA 4P8XA 1H49A 2VX7A 1WAUA 1ZZMA 3K13A 3P5ZA 2FFCA 4E2VA 1E0TA 5I3FA 3AHYA 5DBTA 1ZCCA 4A29A 1W9UA 1S38A 2FFIA 2VDIA 3LLDA 3JR2A 3TTEA 4LUSB 3WQFA 4PCPA 5CPOA 1RALA 3MPGA 1R7OA 1R3VA 4DBUA 1B3XA 5CXPA 1BVZA 3WLOA 3ARUA 5CQ1A 4J3TA 2RAGA 3G0UA 3BLOA 4M7TA 1FDYA 2FJKA 1UWRA 3TEVA 2ZXAA 3O9NA 4HQVA 4MB1A 1DWAM 4M1BA 2PS2A 1EGVA 3H54A 1ZUAX 4HK6A 3CL8A 2QNEA 4XIMA 2PWUA 1C8QA 3LPPA 3FS2A 3AALA 4R9XA 4AD1A 4CD7A 4JKLA 5BXTA 1LOLA 1V3MA 5ECUA 1BQGA 4HN4A 3DGBA 3MI6A 5F1VA 3KBMA 5BXPA 5GNYA 3MDUA 4RDVA 4QCEA 4GY7A 1KCXA 2BMBA 4IMFA 4RE4A 4HCLA 3KW3A 4D6JA 5CPSA 4R53A 4AY7A 1WXJA 4IIBA 5DMYA 1G7VA 1UASA 5FF2A 3N14A 1E0UA 5A6SA 1GORA 1DYSA 4ROPA 3KOWA 5E9AA 4D2JA 3GG1A 3HBLA 2PUZA 3TYEA 4N9CA 1UR4A 3M0HA 3TMQA 3DFQA 2QGHA 4GQ0A 2FHBA 5C0QA 3BPWA 3EX1A 1FXQA 4U33A 3NDZA 4INFA 2UY4A 2BVWA 2QEZA 1NQ6A 2YA0A 4LWWA 4QLKA 1P0DA 3GXTA 1HG3A 3VOFA 2XFRA 1BG4A 4J2MA 4HU8A 4D6EA 4JTUA 4DUOA 4OZOA 1KXVA 1WKDA 4DJFC 4PMZA 1XS2A 2YOCA 4KWSA 1QT1A 2POTA 1HL2A 1YADA 5A8QA 2VX4A 5DY2A 3TTQA 1XLEA 3ICJA 3PTKA 5BOOA 4Y9NA 5HR7A 3PFRA 3BLDA 4TX9A 4FSAA 2GGJA 4Z2LA 1XIDA 3A9IA 3LI1A 3TONA 4M81A 3DU0A 5CAHA 3BL3A 5H6HA 3FJ6A 3GK0A 1MI3A 2CZ5A 1I6NA 2HVNA 3LZ3A 4V1XA 3LHTA 2PP3A 1X96A 3AXIA 4C6PA 2VC9A 3GZAA 2DJXA 2R94A 4ROQA 1JAEA 3LYEA 5CBJA 2QKFA 1QVBA 4GQQA 1Q8JA 2G0WA 4H01A 4PMDA 1UUOA 2ZWYA 5I3KA 2YKKA 4GUHA 4E4FA 1QFEA 1EO7A 2ZTKA 1GJUA 2WJDA 1Z44A 3LA4A 4XZHA 2VWTA 3PAJA 4Q8OA 1RJPA 2AKMA 1EX1A 1GONA 4MJ4A 1R2RA 4HZ7A 3TCSA 2VENA 2FZDA 1CBGA 3DI1A 2PDMA 1KA9F 5FAGA 2DUZA 1W9XA 4OE7A 1RLDA 2ZZ7A 4PN2A 3RILA 5HPCA 3N19B 1AH4A 4C6MA 4J35A 3NZ1A 4CCEA 1EYWA 3H8AA 1HP4A 3LLXA 2W4XA 3BAJA 1T41A 4LV9A 1BPLB 1UMYA 3A3WA 4DJEC 5CSSA 1O5QA 4D6GA 3ZLGA 2CLHA 3FXGA 1W8SA 3P8JA 3WQWA 2CLPA 3GY1A 1Q7QA 3SN1A 2PLCA 2Z7KA 2E9BA 4O28A 1ITXA 3CQHA 2QF7A 4QGCA 2ZA3A 4JN8A 1G9HA 1QOPA 3FJLA 1QNRA 3NQBA 2E3ZA 3CWNA 3OQEA 3MUXA 4H3DA 1OY0A 4DEFA 4H6KA 1UZ4A 1QW8A 3T9PA 3RG6A 2D2JA 2NT0A 2E6AA 1KTBA 1PZ0A 4KEMA 1A5SA 3OLGA 5ABGA 4UQAA 3C61A 3W6YA 2JFEX 1XJBA 1PIFA 3W83A 1FWHC 4OT7A 3VNZA 1YPXA 4GH3A 1V7AA 2CBUA 1VS1A 4XBSA 4UR8A 2G8ZA 3MBFA 3KLLA 4Q4QA 4PMQA 1RSCA 4GNJA 3LPFA 4GZEA 3SUSA 2ZC1A 3CV6A 4XO7A 1LBFA 3GTHA 3UPWA 3LHWA 2XH0A 1FHVA 4NUWA 1CTNA 4PMUA 2QDGA 2Z1VA 3T2PA 1HXJA 3QXBA 4DI9A 2WSQA 3OVQA 1V4YA 4QAIA 1FWIC 2Z24A 2H8XA 3RR4A 2PDCA 4GBDA 3B8TA 2INZA 3W1UA 3VCCA 3LNPA 5D05A 4DO6A 2BG5A 1XIHA 5D8ZA 4PTNA 2ZA2A 1H5VA 3I4KA 3I7RA 3S9IA 3NG3A 1RQEA 3ZR5A 2VD9A 1R7AA 4BR1A 2Y6ZA 3FEQA 1JPHA 1AJ2A 5BZAA 4C6DA 4LVGA 5F1UA 3GWQA 4BWLC 2G95A 4QEHA 1IGWA 4YHGA 4JTQA 2ZE3A 4UB9A 3ARYA 3PTDA 1AL8A 4AHOA 1U83A 1XM3A 3HPZA 5HQMA 4KCVA 1TR9A 3RPTA 4J2PA 1UP2A 4D6IA 2ZZ6A 3PUOA 3O6DA 1T5AA 3ITCA 3RCNA 3WY1A 4CD8A 4ZL1A 4KWWA 1AA1B 4W89A 1DEDA 4M56A 5E6ZA 1JXKA 5MKGA 1R6WA 2ZX5A 2DH3A 1B0IA 1ISXA 2Y5JA 2WK2A 4L9XA 2E5BA 2X1IA 3ISIX 1HZYA 1EJ7L 1R9YA 3KHDA 3V0TA 3SAZA 3BG9A 3WQ8A 2NT1A 3NO3A 1ODUA 3GUWA 1CECA 5D8WA 3E49A 4A2SA 1N82A 5EMKA 1GOOA 4LBRA 2GSHA 4GA8A 4JD4A 1PVNA 4TOQA 1FQ0A 2QF8A 2BLEA 1DKWA 5I3IA 1P1XA 5CC6A 1U1UA 3CQJA 5C9UA 1T8QA 5LIYX 1H1YA 1OHLA 3DC0A 3VOJA 2O56A 4AZBA 3UJFA 1JFHA 1H7OA 4K38A 3NPXA 1BD0A 2WC4A 2WMJA 1VHNA 2ZZ5A 7TIMA 2OKTA 1GOIA 1TA3A 4JFTA 1P7TA 5BYWA 4MDPA 5G1MA 2R1NA 1GOXA 4ML9A 1TREA 5EA9A 4TXEA 3VOHA 2PDNA 3EZ4A 5JQ9A 2EG8A 1TMLA 1OG0A 3CV7A 1SMDA 2I5QA 1PZ1A 1BWVA 1P4CA 2WZHA 5A6KA 1RQHA 1RA5A 1AH0A 3AI0A 1O6IA 3L7RA 1TV7A 4XSLA 1YXYA 1XLCA 4XUGA 3CTLA 1TPDA 3GH4A 1F8MA 3DG7A 4TX8A 3SIZA 3BC9A 1AMYA 3RN6A 2J47A 3V1HA 5C8BB 3L4XA 3WDRA 5HQLA 3VPLA 3BMXA 3ES7A 1DJZA 3TN6A 2D0FA 4LXFA 4MY8A 3VD3A 5C7VA 3N2CA 2PWFA 4F4RA 1XLDA 3A4JA 3GDMA 4M6QA 5LKYA 3U5YA 3F2BA 1R85A 1KM2A 1B90A 2ACUA 3GNXA 5M17A 4DBSA 3HQNA 3WLKX 1SUXA 1TB3A 3UA3A 1CNVA 4CU8A 3W87A 5BU9A 3R2GA 3RRXA 1A4MA 3GFYA 3KAOA 3ZYZA 3DAQA 1FWTA 2XFYA 1EJRC 1VCGA 2F2HA 4D6FA 1RY8A 3H4XA 5C71A 4H19A 4MPQA 3LHZA 2VGIA 1QK2A 4AAJA 1RCQA 2GWGA 1N2VA 3WX7A 3OZPA 3NZGA 1FH9A 3TQKA 4Q8PA 4MDOA 4KESA 1JFXA 1IGSA 3WLMA 4XSMA 4PC8A 4S2CA 3C3UA 4MKVA 1H5YA 4L4LA 1KKOA 1H62A 1RV8A 3GRIA 4AEEA 1WB0A 3S46A 3NR0A 1E9IA 4H83A 3LQLA 1C9DA 1UR8A 4N42A 5EKYA 3F2CA 4AX7A 1ITQA 3LHUA 2B31A 1OM0A 3MWAA 2ZX6A 3WUFA 4YTQA 2MNRA 1ZJIA 5FAJA 3R4IA 3SRDA 1RVKA 3KWXA 3PUEA 3L0NA 3I7QA 4MJMA 2J24A 3NPWA 3ZLFA 1OYAA 3ITYA 3MSGA 1VBGA 4AF0A 4HZMA 5K9CA 4FAMA 1V6YA 4AH7A 3EWBX 1C7SA 3STGA 3VAVA 1E73M 3ELFA 3WUBA 4ZVJA 4HK5A 3L4TA 3TP4A 4FO4A 4GFIA 2DSKA 3LCFA 4PYSA 2R1KA 5REQB 4OKDA 1PJ9A 2PZNA 4EOUA 4YWSA 2PWDA 3LTSA 4NNBA 1TA3B 2ZCGA 3P2VA 3LZ5A 3IJQA 2YL8A 1WDQA 3LERA 1S3TC 2QJGA 2G4FA 3AUJA 1LWIA 1HVXA 2FVMA 2E68A 1IEIA 3NAVA 4V27A 2A3HA 1ZBCA 1EA0A 1EOMA 2WVVA 3A5VA 3PB0A 1O94A 1TTQA 2XUCA 3PFMA 2OYKA 3QPYA 1BRLB 1XFBA 1KD0A 1S2TA 3CUZA 3VOGA 1JYVA 1GYLA 5HNNA 4DRSA 1OZQA 4KFNA 1AJ0A 1D3CA 4HN8A 4AD0A 3PUGA 3W1RA 3WKZA 2YBTA 1VAHA 1VIWA 4QDPA 2OMAA 3H2MA 4S3AA 2PTDA 3TXVA 3RO6A 3TNOA 3DBNA 6REQA 2RGLA 3T42A 2A2IA 1TPEA 3A13A 1W3IA 3R7MA 3NZQA 1KLZA 2PP0A 1UHVA 4A05A 3MP4A 1VEOA 3CUXA 4LT9A 3GTIA 4HT3A 2J7FA 2OLAA 1TV4A 1X1ZA 3E0IA 2PDHA 4ZFMA 4J3XA 4DPQA 4X9YA 2JQXA 3QEZA 1K3UA 3NWRA 1KWGA 3WFLA 2X2GA 3C4UA 3EDJA 1BAGA 4LCSA 4HD5A 1RH9A 2ATSA 3P7YA 4FXFA 3VD4A 1JUEA 1VCVA 4HA1A 3NXFA 3KL3A 3PWIA 3AOFA 1JZ5A 4O52A 1KFBA 1PIIA 3QHMA 3FDKA 1KBLA 2Q8LA 1OVDA 3I7SA 2AMGA 4K7YA 4QS5A 3UZXA 4RPPA 1EZWA 2PWGA 4BS0A 1TFVA 1B9BA 2J6XA 5BNKA 2XM1A 4MWAE 1FWGC 3DH7A 5FL1A 3OLEA 1UWSA 3SSZA 4HOWA 4AMAA 2PDJA 1W3JA 3AXKA 3KZPA 3L4YA 3LUTA 1XUZA 4FNQA 2JE8A 4H9MA 3C0SA 5JBFA 1N8IA 2ISDA 4IFKA 3G1XA 4F48A 3IK2A 1G0CA 3W7RA 3NSNA 3CT7A 3QYQA 2VR4A 4ZOCA 2XJ7A 3WF2A 1UH3A 1SSDA 3WLNA 3MUZ1 3N15A 1VLWA 2J7BA 2PRHA 1OT1A 2BV9A 4AC7C 4W86A 3SQLA 5AYXA 1GW1A 4ZO9A 2WKJA 1RXOB 1V6WA 2PDXA 2CLEA 1JDFA 2QUVA 1NSJA 3ABRA 4Q4KA 4W84A 3SQMA 1LQ2A 3NQAA 1VH7A 1V0NA 1Q6FA 3W6LA 4HPHA 3PSWA 1QI4A 5AHMA 4C7DA 1PUDA 3KCJA 4HNVA 4QX4A 4GQGA 2WVVB 3TJ4A 3HJZA 2JGYA 3KTXA 2D2OA 1DHPA 1I9CB 3UG4A 2E6YA 3OG2A 1GYMA 1JCTA 2PMQA 2QCDA 2CLMA 4H00A 1R3YA 4HPXA 5T9BG 1KBKA 4GXMA 3MWCA 1EJUC 3IK4A 4IOTA 4MB3A 4JTJA 2ZX7A 3PBUA 3PUDA 3R11A 2BOEX 4LS1A 5D09A 4F0RA 1E1EA 3LS9A 4E0CA 3P0WA 1A4LA 2VWSA 1MZHA 2F8QA 5G1YA 3C0LA 1TPVA 4KCUA 3EX2A 3OLDA 3H70A 3JVAA 1TVNA 3MB9A 5SWUA 1CDGA 3PY2A 4NRSA 4Y90A 3NSMA 4NF7A 2CC0A 3R43A 4IZGA 1S2UA 3MKCA 3ZR6A 2IPJA 5A2AA 3QOKA 5KETA 3VINA 4H4IA 4RE2A 2QJIA 5D2TA 4CN6A 1LL6A 3WDHA 4L6DA 1OB0A 1H7WA 4R5EA 1ZENA 3ZZ1A 1L0PA 5EMYA 2H9AB 1E6QM 2P5NA 3GXDA 4L56A 3PK7A 1DJWA 4MNKA 2VEMA 1TKKA 1W3KA 3RITA 2X1RA 1FBAA 1IR2A 3M6DA 4OQVA 4NNCA 1MEIA 3QW4B 1DTNA 1C8VA 1Z48A 3N25A 4W8BA 3RMEA 3KCOA 3ES8A 8CGTA 4QJ4B 4LV4A 5D2VA 4WJEA 4BHYA 1KBIA 3KL0A 5FF7A 2I16A 3WDIA 3QV8A 4X60A 3UCCA 3EWUA 4IFKB 1V6VA 3KTCA 1AQFA 2WO5A 3FXYA 4A4AA 2OVLA 3W2KA 1W5PA 1TPWA 3W53A 2GLKA 4C6OA 4YTSA 4MHBA 1AH3A 1L2UA 5A94A 4XBJA 3VYLA 1HKVA 3NEHA 4QEEA 4YLWA 3E5PA 3WH9A 3RM8A 3TR9A 4JIHA 2QCFA 5GVJA 2J7CA 3M44A 2XG9A 5FEWA 1X1NA 4J40A 1O5RA 1P0KA 3CIWA 3L5LA 3P8IA 4NZ4A 4O50A 2QT3A 3W25A 5I5RA 4GYJA 3EWXA 5U4NA 3VZZA 3WBXA 2DZPA 3LGEA 3BH4A 4XZIA 4L4PA 1HFBA 3TOPA 2YW4A 1A50A 2BVDA 3TA6A 1ZALA 4PH6A 4N2YA 5DX7A 2E0PA 4XKYB 4FNTA 1FWDC 4DI8A 2XFWA 1B3YA 3H22A 1ZJAA 3GYCA 2QJNA 4PL2A 3QGVA 4Y96A 2WVTA 4ATWA 4IJRA 2BXZA 4HJWA 4ADTA 4HHHA 3VIOA 3H7UA 1OX4B 3GIYA 4AC1X 2CNCA 3TN3A 3VMNA 1SW7A 2XSAA 5AYBA 3TR2A 4UQDA 1H1NA 4L9YA 3T4WA 3PPGA 4PUEA 4RL3A 2J79A 4HCDA 4I5XA 1L2QA 3QOMA 3UVAA 1GHSA 3WLHA 3GDTA 3UCDA 4OJYA 4Q7BA 3Q65A 3L65A 4MZ8A 3GBDA 4W87A 5HWJA 2GFTA 4AQLA 3FX4A 2ISVA 3RXZA 3QSTA 3LCGA 2QUUA 2V9DA 4DJFD 2X09A 6A3HA 1WPCA 1YNQA 3TWBA 2VRJA 3DKJA 1VFMA 3MJYA 2Q01A 3TW9A 4KEUA 4ZO8A 2PCEA 4JDYA 1SSGA 5HQEA 1GPWA 4JOMA 4PR4A 5CAKA 1W3HA 4GGBA 3IRDA 3AYVA 1J5SA 5CPTA 4CQ8A 1EJWC 4ZE5A 2XYLA 2W63A 1DXFA 4ICNA 3LTYA 2Y7DA 5C7HA 3LB0A 4WSJA 3QY7A 1F7BA 3QHOA 5JIWA 2HBXA 1JNDA 1PBGA 3F5JA 3WO8A 1NOFA 5BOEA 3UCQA 3HM7A 4D6CA 1PYMA 3VC6A 4Q8WA 5DMLA 3QM3A 4UMBA 3KBNA 2W27A 1NFPA 2C6QA 4Q8MA 2EJAA 1T0OA 4LPCA 4WF7A 3EB4A 5FD0A 3N2BA 1C92A 4A21A 2CLIA 1XLLA 2OSXA 4PB4A 4ALDA 1M7XA 2I9UA 2CZEA 1B1YA 2IW0A 2HTMA 1OQFA 1QI2A 2W66A 2J8FA 4ERGA 1YTKA 3RRAA 3S1GA 3M41A 3W71A 2WWDA 4DYEA 4UTWA 4L4OA 4M51A 4RW3A 1O5KA 4IFRA 5FF3A 4H9TA 2QUNA 3O07A 2DUAA 4GC4A 2VVSA 2O55A 4F3HA 3M9YA 3IVTA 1HL9A 3I6TA 3CO4A 3SCWA 3O1NA 5LNRA 4MLJA 3QMRA 1HJQA 4QJ3B 4J3SA 2W5FA 2WKLA 1TE1A 1V3JA 4G2DA 1PV8A 4A3YA 3WLSA 4NKCA 1AK5A 3F4WA 3LM3A 1NQKA 2YFOA 4H9YA 5EYWA 4Q8QA 4TX6A 1PX4A 1F3WA 4IL2A 2IKHA 1E9ZB 4K8EA 5HNTA 3WNOA 5JMUA 3EXSA 2B7PA 4W5UA 1S2WA 3F4CA 1IWBA 1WNOA 2XU2A 1E3XA 1GQIA 1H7NA 3W2UA 3R94A 4DELA 3A12A 5FSEC 4O1AA 2XVNA 3EA2A 1TZZA 4KH2A 3HG2A 3PBGA 1W9VA 4OV4A 4UQCA 3REQA 1TJ1A 2Z6IA 3WQVA 1XLGA 3SJNA 3BARA 3NQFA 1DJGA 4Q6XA 1C93A 2C13A 1PB0A 5DELA 1SJBA 2EJ1A 1Y0EA 1NU5A 3DECA 1K9DA 2E6DA 1YNYA 3LLFA 1L6WA 4LBSA 1V8EA 2NQ5A 2EPMX 4Q8TA 1K9FA 3NZPA 1XD1A 1VPXA 5HANA 2LLEA 2O92A 1RD6A 4DHGA 3VDHA 1F9CA 2W3ZA 1TV8A 4GKTA 3R25A 4O1EA 4WVXA 1XQKA 4PB3A 3GU2A 3AIQA 1A5UA 2VZTA 3M0LA 1XSKA 2AOSA 4IIHA 4KW2A 4OV9A 2P53A 2D3LA 1KFJA 1OC5A 3GNDA 2BHZA 3L4WA 4Y2WA 3AWOA 2V3GA 4FLOA 3DIPA 3QV9A 1R2SA 3D47A 2PD9A 3RM9A 2HJPA 1F74A 2CERA 3B9EA 4L5ZA 1KM4A 3U2ZA 2B7OA 1IEXA 4HYVA 1HNYA 3IJ9A 4F2TA 3NZRA 3DFNA 1DXIA 4Z2GA 1IT8A 4ADUA 2ZRYA 2DIJA 1BSLA 2VEKA 1IV8A 1H60A 4JYFA 1RBLA 1LL7A 3PZNA 6XIAA 1WKEA 2WMKA 4JKMA 3ARRA 3KBSA 1XRTA 3LBOA 4K8GA 3CYVA 4LAKA 4L6HA 2WKGA 4MNJA 2YBVA 2VYOA 3OHMB 1JUKA 3OEXA 3W7EA 1W56A 3W76A 1ISYA 4CEUC 1UH4A 5AHFA 1J2WA 3LMYA 2DT2A 1NF7A 5E9XA 4AMCA 3E74A 3I6EA 4FIQA 1SW3A 5TIMA 5H8PA 4JKKA 2NUXA 2DT1A 4LEFA 3MVIA 1TRDA 2JEQA 1YTEA 2NLIA 2PODA 1JD9A 2I1OA 2QQ6A 4ZA0A 2V0TA 1KM0A 3B04A 8XIAA 2DVTA 2CWNA 7CGTA 2BASA 3H55A 2ZRVA 3IJ6A 1F3EA 2A79A 5M3WA 2F84A 2VUNA 4MNMA 2QUMA 1DIOA 3M1ZA 1OFQA 1T8XA 1E5JA 3FVDA 4LUTA 1HUVA 4HHMA 4C6FA 3CHDA 3WG6A 4MB4A 1SZGA 3EKLA 1H50A 1XBVA 5CGTA 4IXXA 3UGVA 3TU9A 2QZRA 1DWFM 3E12A 4MJ2A 1XCXA 4PBGA 3CHCA 1TWIA 5LNWA 3Q37A 4DQWA 4XD3A 3BXWA 1ZBWA 3T55A 3TAOA 1OBAA 1S3HA 1DP0A 3CUIA 3GX9A 1KRAC 3F7JA 4IPLA 5DRIA 4CQBA 3WMCA 2D23A 2XSXA 3EWZA 1GEQA 1REQA 1VD6A 2NX9A 2YIHA 3MUCA 3LXAA 3E6EA 2YZ5A 3REQB 4QE1A 3F03K 4LALA 1RLCL 1DJYA 2EKGA 4NYYA 2DGAA 2XINA 4UTLA 3RMJA 4S2BA 4AVNA 3BV4A 1NIUA 5RUBA 3I65A 1GUVA 3WD0A 3UJSA 3QLDA 3HG3A 1EJSC 2VO5A 4D72A 2QHAA 1PTDA 1VYPX 5AYZA 1RK6A 3ZSSA 3QF0A 1F07A 2W91A 4MMWA 2ZX9A 2V8ZA 4LQ1A 5A3HA 4PUUA 4QQ3A 3WYZA 1E55A 1AODA 4DB7A 5LYRA 1RQBA 4ZO7A 2V5DA 3TNBA 1FUYA 3RJYA 4FXRA 3WH7A 3CPRA 4AD3A 1GWJA 4KMQA 2PB1A 4O16A 3M0ZA 4DO4A 2OGYA 4MWAC 4GISA 4D9PA 5K3VA 3GC2A 2VGGA 1TCMA 3VKDA 1Q6LA 2V2CA 4QG9A 3M0YA 1UP3A 1O12A 1TV5A 3W75A 1E3ZA 2QV4A 4XG1A 1CXFA 1DJQA 3TTOA 3SCTA 4Y8EA 1ISZA 4QR6A 4WOZA 4UTFA 1QW9A 3G1SA 1DQUA 2GUYA 3W6MA 3V4BA 4IPJA 2A4AA 3WEMA 1YXCA 1SR9A 4ZQCA 4NNAA 4TQTA 3PULA 2EHHA 4KWUA 3VIFA 1GYNA 2NX1A 1SZFA 1ZY9A 3AHZA 3C2YA 1UD5A 1KFEA 3O6CA 2C19A 5DMNA 5FJIA 5CC3A 2FZMA 3GVRA 3BLLA 4KPLA 3EDFA 4KS0A 2C8NA 3TW6A 4CU7A 3DYOA 3GC5A 5TF0A 4FPSA 3TQPA 3W1MA 4JICA 2YSWA 3S83A 4DWSB 3WQCA 5D9OA 2YLLA 4X2PA 3U5UA 1K8ZA 2H3BA 3BVJA 3T78A 2DSWA 1XL9A 3A22A 2HVMA 4S3FA 2ESCA 3FA3A 2V81A 3P74A 1NP0A 1EYEA 3CUFA 4K37A 4XAYA 3SGGA 3N9SA 1MXSA 4FX7A 1GGOA 4GKLA 3WQGA 3LGDA 3KDNA 3R10A 2CHRA 2D2GA 3CZGA 1HVQA 4TO8A 1H4PA 4LEQA 5C54A 3KLKA 4LU0A 4AWUA 1YMYA 4Z1YA 1T40A 4FIRA 1HW6A 4U4MA 2C1GA 1J93A 3UXAA 1SR0A 3AUOA 1EBHA 2VRKA 3UFYA 2Z0IA 3HN3A 4OBSA 1TX2A 2NZLA 1UR0A 4C1KA 3L68A 1NDZA 2XVPA 3R0UA 1JCLA 2Q09A 3CHFA 2O9TA 3HJEA 5C9ZA 4HIBA 3U9IA 4AZIA 3GDLA 3ARXA 2CWXA 3LD5A 4R34A 1HT6A 2CETA 3H2AA 1XP3A 1O5XA 2WMIA 2Z25A 4PCNA 2X42A 4ML4A 4LYPA 4PRRA 3V7PA 4N7QA 1E1CB 5A8NA 3VOIA 3SO7A 4JQ3A 3N73A 4Q4PA 5L6UA 1K9TA 5AOUA 4ZQOA 1L6SA 3VGEA 3LPOA 3OVRA 4QJ1A 3FNDA 1LWJA 2FGLA 2OWCA 3CAQA 4KFOA 1I1XA 5A8GA 2AQVA 1MDLA 3D6NA 3QR0A 1QASA 3L67A 1E1FA 4DX3A 3M0KA 1ME7A 2VCCA 1C8YA 1VJIA 2WYSA 5B7ZA 4B4HA 1ENUA 4QDWA 4A8LA 3C6CA 4J3ZA 4ZENA 4JN7A 3W02A 4TMCA 3WELA 4D1IA 3TYDA 2OZTA 1GVSA 2J8TA 3PC0A 4G6CA 3O7UA 3QQ0A 3OLIA 2CZDA 2J77A 4JHOA 5LA1A 1W1ZA 2DUXA 2O0TA 2PDUA 2WMFA 3HZ3A 3WD4A 4WOQA 1T99A 2QS8A 3IJ7A 2NQ9A 1LF1A 3W81A 2WAGA 2FHCA 4A3UA 1R47A 5AY7A 1VPYA 1EX5A 4QDMA 3R79A 4JEQA 3G5EA 3W7CA 3H6OA 3IJLA 3WH5A 1AQMA 4LCQA 1VQTA 2Z2BA 2FIQA 4Q4OA 2OXNA 3LBCA 5FKYA 4I7UA 1TV3A 3EYPA 5E0CA 2PLMA 1XR2A 5HJYA 2VI0A 4GHRA 5LNUA 3AIBA 3FLUA 3VNDA 2PC4A 5HWNA 3W2JA 2QCMA 1GPFA 1UD8A 1I45A 3W01A 2C15A 4KIRA 3QLLA 2HK1A 3NL5A 3W7JA 3SM0A 3S9ZA 3OHIA 4PTMA 1M7PA 1JPDX 4M82A 3W7DA 5J5RA 4JYDA 4US6A 2PGEA 2ZKMX 1ZU8A 4YIWA 3DFTA 2ZA1A 4EXQA 1R38A 4Q8NA 1L6YA 2GJXB 5BRPA 4HHPA 4QS6A 2TRSA 3WJWA 2OQLA 5I24A 5TNVA 3URAA 4GI8A 1FFQA 3MUAA 1AW1A 4ICMA 1R3QA 3PWAA 4EVZA 3SB0A 5C2GA 1KXTA 1JZ2A 1K03A 3LDVA 4PTXA 4P8WA 1FOBA 1IT7A 3OZMA 5AHLA 4RUBA 3N29A 4Y9MA 3LCWA 4KIEA 2CZVA 1F4AA 3P62A 4JS3A 5E0FA 2ADAA 4H6EA 3T44A 4J9JA 2FVKA 3WFAA 2PFHA 1QNOA 3UXLA 1W9BM 3VIIA 3W38A 3OVGA 5GQBA 4C5ZA 3BSHA 1V51A 2Y8KA 4GI4A 1KGUA 4PMJA 1HKJA 4E3TA 3PAOA 5A6BA 1LJYA 5LA2A 2VQTA 3VIMA 2Y5EA 5LA0A 4DPPA 3UWUA 3UPMA 3BSGA 1QWKA 4GCXA 3W7IA 3GR4A 4DUVA 1JZ4A 1CGXA 6TIMA 1TELA 3MUY1 1FWBC 1TJ0A 1B3WA 2J7EA 4F79A 4MY1A 1TIWA 2Y88A 3DEQA 1B3OA 3PZIA 3RX4A 4NXSA 2OR2A 3ANVA 3XISA 3IGHX 3M4HA 3N1AA 2QYGA 1VFLA 1MVYA 4LANA 1YEYA 5D9PA 4XB3A 3SGZA 2GUBA 3UYCA 4CNSA 1W5NA 4W8LA 2E7FA 4HU0A 4HGXA 4GXPA 4V1YA 1MQQA 3TCEA 3ARWA 1IR1A 1W2VA 4GGHA 3G8EA 4IM4A 3BOFA 4DWSC 2YCLA 4L9ZA 4B5UA 1WO2A 1LCOA 2NSOA 4IT1A 4UOQA 2I57A 4DWDA 1MFUA 2I5GA 3PZOA 3PNUA 3IRSA 2HS6A 4JPGA 2EXOA 5FEZA 1NF0A 3S2CA 1Y8BA 3G0XA 4O18A 4P5UA 2DSUA 1DWIM 3E0LA 4U3AA 1ZAIA 2WC7A 1GTEA 3VVGA 5AVHA 3B0VC 4GYPA 4HBKA 3SY1A 3B0UX 3C0JA 3MBDA 3S42A 4GE8A 2OB3A 3NCOA 4H04A 2ON3A 3OBAA 3O2LA 3SUWA 1E0VA 4LOCA 1W1IE 1E6PA 2Z00A 3CPUA 2NW0A 3GXPA 5AC6A 3HFTA 1IEVA 2VHLA 1PCKA 3P61A 2Q3OA 3PJTA 1PEZA 1GOMA 2RJHA 4I6VA 4AW7A 1W37A 3E38A 1VPQA 3FHAA 1FCUA 2Y24A 1CX9A 3AU6A 1H2JA 3BK0A 3G1FA 1Y7VA 1KKRA 1NTHA 2B7QA 3DOPA 5BU6A 4UTTC 2REQB 1S5WA 4XAGA 1C90A 2ZXDA 1CGUA 4PUMA 2Y61A 3ZOAA 4XZBA 3BCDA 4EWJA 3I68A 1NM9A 4NZCA 5H91A 1A5OC 2VFFA 1FWSA 3OP2A 2JEPA 4FNSA 1RPXA 1JQVA 1M9HA 4PMOA 3O15A 3BJSA 4LC6A 4E2BA 1ISWA 5ENLA 3HGSA 3AYSA 3UWQA 3ABSA 1NFBA 1WXZA 3UYIA 4YU1A 1CXLA 2QVHA 3IACA 3G6MA 5F4XA 4GLEA 2D0HA 3A4AA 3WFZA 4AIOA 2J74A 1GOWA 3VXGA 2OG9A 2VVNA 5CLTA 3MMDA 1ML1A 3CASA 1KR1A 1RD5A 3UJRA 3BGJA 2UY3A 2ANUA 2RDXA 3VIPA 2DW6A 4V33A 3G0SA 3W1TA 1ZRQA 3AMCA 1MQPA 4QE5A 5D4YA 2WJZA 3AICA 3L12A 4I9JA 4B5NA 1WZAA 2OOGA 1RY0A 3LXCA 3HPFA 2XN0A 4CUCA 3GW0A 4XD5A 4JL2A 2OO0A 4IMAA 4PEKA 5EGRA 2EG7A 2Y89A 3KBJA 1UJQA 4DF0A 1JCYA 4CU6A 2QMKA 2BS9A 3NNTA 3EMQA 1ADOA 1ZJBA 3OB8A 1FWCC 2Q3RA 1NWUA 3WLTA 3G24A 1BKHA 1IF2A 4RNFA 5C2CA 2XGZA 3SN0A 3LSCA 4GH1A 1BWLA 2WZEA 3WJSA 3MUIA 1GNXA 1E15A 2PTXA 4OUIA 4Z0JA 2QAFA 3N3TA 4F0LA 1CXEA 1W1VA 1AUSL 4I3GA 4NJKA 4LVBA 3M07A 2WHLA 1OJXA 1FX6A 5HNRA 2PRLA 1EFZA 1XCFA 2B7NA 3M0IA 4EIVA 3UXKA 4RZ4A 3F4VA 4B9ZA 4O8RA 5EBAA 1EJTC 3BW2A 5EB8A 1KCLA 4HMEA 1O60A 2G96A 1OFRA 2Q02A 3VK5A 1S2VA 4Z42C 1GK8A 3H26A 4JNZA 1Y5XA 2C71A 4IX0A 3QTPA 3M7WA 3S1UA 1JCJA 4LF2A 2RKXA 1WBHA 3DYPA 4N4QA 2HE5A 3FKRA 1HN1A 2G37A 3VCRA 4W7UA 2ZE0A 4P61A 4ACYA 3K30A 4E8GA 1H61A 4OU1A 2X30A 5CPNA 1XSIA 1W1A1 2NVCA 4H6RA 2RDUA 5IFPA 4I5UA 3LV5A 4JX5A 1EGZA 3GFZA 4FS9A 3W70A 1Q6RA 3L2MA 4UCFA 3NYZA 1DPMA 4GACA 2IXUA 4DJFA 1WDPA 4C91A 3GLCA 2VFDA 4AZCB 3S2LA 1PDYA 4P7RA 1N8WA 4MSSA 3AIVA 3BQ6A 2HROA 4GO8A 2F9RA 3FGCA 3HA1A 4B90A 4ACZA 3CWOX 1KGWA 1M1BA 3G1DA 4MVAA 1BVWA 5ABFA 1UW9A 5HA7A 1GVRA 1K6WA 2ZRWA 3W7HA 4IPIA 2HXUA 2A6LA 2DW7A 1Q63A 5FI8A 3GXFA 3E02A 4Z1BA 3WK1A 1W6TA 1ZTVA 1NY1A 1S5TA 4FLRA 3UXDA 1LOSA 3SEPA 3EOOA 5F2MA 3S5YA 3S47A 3F5KA 4FF7A 4B16A 3AU2A 1S2AA 5DRCA 2JK2A 1WZMA 2D0GA 4NL1A 1FP9A 1TZ7A 2ZYFA 4TV6A 3VUPA 3BCJA 1G4PA 3GVQA 4GC3A 4LGXA 4J3WA 1E0WA 4XX6A 3NL3A 1YNPA 2BXYA 3DUGA 3LN3A 1UC5A 4U31A 5I79A 3MA8A 4YTRA 3W26A 2PE4A 1XLHA 4H9UA 4D8ZA 1CLVA 5U7SA 3XINA 2ATMA 2F38A 1H7RA 3LM7A 5CG7A 3U2CA 2PU1A 3GNNA 3L4ZA 4CD5A 3V5CA 1NDVA 4GRSA 2DZWA 1C3FA 3EX4A 3KVJA 4NT0A 4X3ZA 3CMFA 1F4HA 4Y9OA 1QU4A 4GWEA 1ADDA 5D2XA 4REQB 3JUGA 4ILSA 5MHBA 1PX8A 2VCBA 3W3OA 5CSYA 3VI2A 3LNMA 4DJEA 4JTLA 4FA3A 4I6KA 3G3DA 2HQAA 2XTKA 3DHUA 3EOEA 1UR2A 1DIKA 1M3UA 3GH5A 4P8UA 2BDQA 4IP4A 3EMCA 4HNUA 2G4JA 1XIGA 4N6FA 2WM1A 4UOJA 3TC3A 1QNPA 2PF8A 3S2MA 4JTKA 4YYCA 3ZS4A 2GQ9A 4HYRA 4IGHA 2JIEA 3E2RA 4JIQA 4LH8A 5A8PA 4MKNA 3TIMA 3TYZA 1J96A 3KBVA 5TQLA 3HTWA 3EA3A 1GOKA 4G8TA 4J5NA 4LC8A 5CPMA 2GJPA 3PS7A 2B0MA 3H2EA 4QLLA 5D33A 1R3TA 3L9CA 4IUOA 2PEVA 2I5IA 1Z42A 4S3BA 1R87A 3M47A 2VFHA 3WLPA 4WXZA 3C2VA 4NI8A 3R0DA 2AGKA 1I2NA 3QZAA 4BF7A 3VABA 4MOZA 1MNSA 4AZGA 3KRZA 4ADSA 1AJZA 1OSEA 4B15A 4RV3A 4FR1A 2ABAA 3QKEA 3VE9A 1WBJA 2YX0A 2E9LA 2GWNA 2ZX8A 4LUSA 4ACZB 5HMFA 1R30A 5DANA 1YX1A 1V93A 3ARZA 1GOQA 2DZSA 1AW2A 4CNUA 4W7VA 2OZ3A 3QV6A 2W0UA 4U2YA 4W7WA 3T07A 1FWNA 2WNWA 1W9DM 3NQDA 1OGBA 4WRHA 3W1NA 1SW0A 2XISA 4WJ8A 3MKKA 5FEXA 4N9EA 2RH9A 4IGSA 3GVGA 1B9ZA 2ZBTA 3PR2A 4L64A 4BWLA 5DY3A 1JDEA 5D02A 4HP5A 2HV5A 1A3HA 3TTYA 2VDGA 3DN5A 2D1ZA 4ZQRA 2OJPA 3HGOA 3KTSA 1MUCA 2HK0A 4DYJA 4Z1AA 1QW7A 2PDIA 2C1HA 3B97A 2V2DA 1E6RA 4BEUA 4HMNA 3SY8A 1UKTA 1E40A 1JG9A 3OIXA 1XIFA 4QITA 1DXEA 2VCAA 4R9OA 4S3CA 4PUKA 4PMNA 4KBXA 1R0MA 1EHNA 3THCA 3UR5A 3MHFA 1JRCA 2PF0A 4WR3A 4AIUA 3TC6A 1GCYA 4K1WA 2XFFA 1BYAA 1PXGA 1KBBA 3C86A 2X2YA 1JI1A 2PP1A 2ALRA 1TPUA 3G8RA 1KXQA 2PDWA 1MSSA 4FNPA 4ZB5A 3G22A 4L7ZA 5IM51 4JEJA 1X1OA 4AYGA 3ME3A 1XWYA 1Y5WA 2OQHA 4MWAD 4GYKA 2Y0FA 2NQJA 2GGGA 5I3HA 4F0HA 1O1ZA 1J0ZA 1I2PA 3SDOA 4FK9A 2QULA 1UZDA 2A6NA 3K8KA 1J8VA 3QMSA 4H2HA 3WEZA 3SCVA 3W7LA 1V02E 3II1A 3ARTA 1K02A 4UCGA 3RCMA 1SJDA 4JR5A 2WLYA 2I17A 3JU2A 1W8GA 3OZOA 4BQ2A 1GVQA 4DXVA 4OHQA 4EPEC 3CQKA 5DO8A 1Z7AA 1S5MA 3BMVA 4O0KA 5LHEA 4B2DD 3KX6A 1TPC1 4EP8C 2CESA 3BOLA 1FCQA 5CC7A 1VBUA 3N13A 3B40A 3G1AA 4LVAA 2YPIA 3N6QA 3PZGA 5AVNA 3S4TA 4G1KA 4HKPA 3W22A 2WSRA 3F1QA 1TWWA 4B91A 4HSNA 4NJGA 2X8RA 4B5TA 1YIXA 1WDWA 3PZVA 1Q65A 1UC4A 4FOJA 5I77A 4PTDA 3BGAA 1Y5VA 2NXGA 3HOJA 3IVSA 2FTWA 4MZ1A 3TX9A 3UR8A 2H8ZA 3MHGA 3BE7A 2NV1A 1QI5A 3M5YA 1CXIA 4HB7A 4O8AA 3P67A 3VNIA 4JIEA 1ZSXA 3V3WA 3AZTA 1AZ2A 1O7AA 4Z2KA 1X97A 3NM3A 3FOKA 3U2OA 1UZHA 4PZVA 5C9RA 3AXMA 1W3NA 4R27A 1MXDA 4GINA 3BJTA 4UFLA 2PDGA 5G2WA 4RDZA 4JTFA 2YL6A 1BF2A 3BAIA 5LZLA 1VBJA 1QATA 4C90A 1G6CA 1QR7A 2GJRA 1JYXA 1DWJM 3PPFA 1G69A 3BAKA 2BBFA 1ZLPA 1FA2A 5AC8A 3ABXA 2H3DA 4QROA 1WDRA 3ARQA 5D03A 4AVFA 1Z89A 1E51A 2DIKA 2DZTA 4M6PA 3CH9A 5A6TC 2VX6A 3OBKA 1XH0A 3EB2A 5CBBA 4IJBA 4JYEA 2NV2A 2FHFA 4BF5A 5I7GA 4YN5A 1R3RA 4I90A 5B80A 2CBVA 4R7JA 1MW2A 3FAXA 1HO1A 3WNPA 4UZSA 2CKRA 4UFIA 3WL0A 2IPFA 3INPA 3M6YA 5AN7A 4GUGA 5J04A 2PZ0A 3HG4A 1YXDA 3WDJA 2WSYA 4NX5A 5CPQA 4IQJA 3IIPA 5CEWA 3R1ZA 3O3RA 2VMFA 1POJA 1K8CA 2A7NA 3EPOA 3NSXA 4O10A 1Q45A 1H11A 4NJIA 1CXHA 2A5HA 2P76A 3GD6A 1VJSA 4ZZ9A 2ZIDA 4RE3A 4U5IA 2C91A 3CQIA 3WBWA 4JIIX 1W54A 1H1ZA 3GKFA 1QOQA 4WQ6A 4Y7EA 5AHNA 1F05A 4TTUA 5AHIA 2XN2A 2IS7A 3IEBA 5T26A 4S3DA 1Y65A 4O57A 3YPIA 4H9ZA 4PUNA 6PTDA 2BVTA 2A7RA 1XGEA 1O4UA 3VKKA 1EWDA 4GVGA 5C55A 4S1FA 3IAQA 1EF2A 2VQUA 4O11A 3PTQA 1TMQA 3OVPA 3FEMA 3STFA 3TK7A 1LOQA 3FW6A 1LLZA 4R3UA 4FNUA 4Q8UA 1XIBA 3FKKA 5DFAA 2TYSA 3EDKA 4YYFA 3ONCA 1GZJA 2NVAA 4DUXA 4NILA 4IPPA 3FCPA 1HJSA 4LFYA 2MANA 3AWNA 3NQ8A 4DBEA 5F2IA 4WHBA 3M43A 1FXPA 3W1AA 3SW6A 5MF5A 3SGUA 1TUFA 4RV8A 4AHPA 1A5MC 3T0DA 1IIGA 2QJJA 2AKZA 4DZ5A 2HNEA 3PPHA 4EACA 3DERA 1KC7A 3NL6A 3MO7A 1WOAA 2WCGA 3QGKC 3N4EA 4JTAA 1D8WA 3UVIA 3WQPA 3RFAA 3TH6A 1W2PA 1RP9A 4UTJA 9RUBA 2BHYA 2P3EA 4L80A 3K2GA 1KM3A 4GVHA 5HATA 3LOTA 1ECEA 1AD1A 8A3HA 3RPMA 5LIKX 4CN1A 2NQHA 1XFCA 4JDBA 5M2FX 3B05A 4HNNA 2QDEA 4JTCA 5BROA 3S5OA 5I3DA 2WHJA 2P0IA 1XLJA 1IEWA 2YCKX 3W84A 4KCWA 3MP5A 1LDCA 3UBPC 1GHRA 5BXRA 3KFTA 3UZ5A 3WNNA 3E2QA 3FA5A 4GOAA 2X0SA 4JTHA 4IG2A 1DJXA 2P8CA 3EKZA 2A1YA 1B54A 1EPVA 3IUIA 3AC0A 1QPKA 2RDWA 3GDKA 3QSRA 4MAVA 2GZXA 1WDSA 2DJLA 3ERPA 3UERA 3G3MA 4GY1A 1WCGA 3DG3A 4DWSD 2BTMA 1OX5A 1A3XA 4P7QA 3PP7A 4PMVA 4JFSA 5D30A 1RA0A 4TTGA 1K7EA 1UD6A 1NEYA 1EDGA 4JAWA 3TYAA 1EIXA 5H8UA 2CLLA 3FY1A 1F3TA 4KCTA 4CQAA 2PBOA 3VX0A 5A8MA 5HAOA 2PCQA 1LG1A 1ME8A 3IJDA 3GH7A 5I03A 2WPGA 1MW1A 3AMKA 4MAZA 4IMCA 1HJUA 1OCNA 4ENLA 3T6CA 3DZ1A 3DBPA 4G7EB 2DZAA 1A0CA 3H24A 2O9RA 3PZUA 3UR7A 3ZSTA 1MDRA 2BP1A 4UTKA 3T4CA 1W5QA 1TG7A 3EWWA 3PM6A 3KOXA 2A3AA 6XIMA 1XKYA 1L8NA 1JD7A 2E5CA 5K2ZA 3MV01 4CVWA 1FHDA 4AWTA 1LLOA 3KVMA 4HNOA 4YJ5A 3VD5A 1SZNA 3U48A 5K4ZA 5HBFA 5XIAA 2J62A 4KT2A 4UOZA 3IPWA 4QTGA 3GXMA 2EEXA 1CYGA 2EPNA 2DY3A 3HB9A 2FMOA 3BLPX 4OWGA 1FCVA 1OEPA 1RBOB 3S6OA 1X7FA 2PWVA 3N2XA 2G3JA 1JPMA 3GE7A 1CI1A 1ZFJA 4ECLA 2J25A 4TR9A 3ITOA 4E5TA 4WDWA 4JGDA 1BTMA 2XIOA 3FHQA 2WNQA 1PKNA 2W67A 1TCDA 4AIBA 1QNSA 7ENLA 1SFLA 3MHUA 1U5HA 4A3RA 1J01A 3BAXA 4JHZA 4Q4RA 2CW6A 4DUWA 2GDQA 4YVPA 4RZ5A 4PEEA 5IXEA 2INFA 1SM9A 1DORA 3PBMA 2HCVA 2X7WA 2DORA 2GUUA 4UNKA 4LY8A 4BZYA 3APGA 5D32A 5G2HA 4DJDC 2TODA 1ICPA 1QWGA 2OODA 1TTJA 1SMAA 3V5OA 2ZVRA 1TV2A 1BHGA 5REQA 3W7MA 3VKJA 2CFFA 3VGGA 2CIPA 3B0XA 5BRBA 1DJIA 3UT0A 4ATLA 3O6AA 5HXMA 1CZ1A 1OF8A 2J9YA 2IXVA 3CXOA 4QE4A 3RIKA 1WV2A 1A47A 4PFHA 1R3WA 4IG2B 2VUYA 4LYQA 5M03A 5F2GA 1OK6A 1IZJA 1RP8A 4LYKA 2Y8UA 4A6GA 2BY1A 2FH8A 1TZ9A 3H7RA 3FK4A 2QXWA 4FB7A 3GFXA 3T09A 3AROA 1OIMA 2OYLA 2PDPA 4IXHA 1BRLA 5DCEA 4I9TA 3A3XA 1OFBA 4DM2A 3D3AA 2ASHA 1JGIA 1U5VA 1YE4A 5F4WA 3QY8A 4MFEA 4PL1A 2R8WA 1EP3A 3EGJA 1M04A 3MSRA 1UIOA 1UWIA 3KE0A 5IBXC 4H8VA 3FJNA 1JZ3A 3W23A 4H41A 3WQEA 4GBUA 1K1DA 1UMLA 4EF8A 2INEA 4BI7A 3MW7A 4AG0A 1O68A 4Q8VA 2VT0A 4BQ5A 1XICA 1PAMA 1AG1O 5C9WA 3AJ7A 2DZUA 3T7VA 2RDTA 3LSBA 3ZFHA 3W7NA 4JIRA 4A3HA 4K36A 5CZKA 2AL2B 2IPWA 5KEZA 3T05A 1UPPA 3UPBA 3PNZA 1YTDA 5ABTA 2XIBA 4ZCWA 1TTIA 5DXYA 1T7LA 3SCPA 2ZDRA 4JBRA 5LGZA 1US2A 3W74A 4KERA 3T2QA 1QRQA 2Y63A 3CLWA 2ZOXA 3GR8A 3OQ8A 2DP3A 1YPIA 4QIUA 4WIWA 4GNKB 3EX3A 4FEZA 1RZMA 1UKSA 3KOZA 3B8WA 5IHSA 3H2NA 4GIYA 3CAWA 3GYEA 1JULA 2XN1A 4XIAA 4BK9A 4KWOA 3QR3A 7A3HA 1FKWA 1POKA 3QVQA 5CZSA 1CT5A 4JTTA 4MNLA 5EBUA 1OCQA 3M7SA 1P6WA 2WANA 3AXHA 1KFKA 3EAUA 3IUHA 4JY8A 3FV9A 4IGMA 2RUSA 1YBQB 4O54A 3CNYA 1XGDA 2VP8A 5FJJA 1W0MA 2GVEA 1BYBA 4OOUA 4MKSA 3FIGA 2YJQA 2YXGA 1QHZA 1AL7A 4C7GA 2EBNA 3GG7A 2FB2A 2E9MA 2YB1A 3RPDA 3AZSA 1M65A 3RLGA 3DFOA 4H7CA 2CBIA 2YYUA 2WMGA 2VM8A 1OABA 4EXBA 4LY4A 1H09A 3NQ7A 4L6OA 4J3UA 1IT0A 2QW5A 4M5PA 4JTGA 3SCRA 4Q22A 5I2UA 5HJXA 1UR3M 3KVKA 3GHTA 2JF7A 2P0OA 2PI6A 3OZYA 2Z1BA 2GGEA 2ZRZA 3L4UA 1UH2A 2ZUVA 4M0XA 4E3VA 5E5CA 3TSDA 1JR1A 4NP7A 4IP7A 1TJ2A 3E2VA 3P3BA 5G4HC 4ZTYA 1LQ0A 3RDKA 3M5VA 3R13A 1XDJA 4H8NA 4YPJA 3NGJA 3BMWA 3NEVA 4J27A 1QBBA 3B8DA 4P2VA 1UD2A 3MTWA 3HFYA 4D8LA 3O0FA 2HPMA 1R2TA 1VC4A 3IANA 4BJHA 1IXOA 2BY3A 5DN1A 2VZUA 3BO9A 1JUBA 4WDUA 2XVKA 3L2IA 3WLLA 4E2OA 3FSTA 1ZB5A 1SQ7A 1ZP3A 3NL2A 1RBAA 5FF4A 1ZCOA 3IJ8A 3UY7A 2VZSA 3EBVA 1ZBVA 9CGTA 1TQXA 1IE7C 4GCAA 2CU0A 2PGWA 1UG6A 2OGJA 1ZS2A 1DE5A 1XCWA 3KRSA 2AQWA 2GQAA 4DLFA 4FZIA 8XIMA 2ISFA 1BKSA 2W62A 4K1GA 2OOFA 3L5MA 4RZBA 1VRDA 1G67A 1ZQ5A 3DCPA 1PE1A 1IZCA 4LTSA 5FIPA 3VX1A 3POCA 5AHEA 1LP6A 3N9RA 2XZ9A 4CEXC 4JQAA 4GXWA 1EF3A 1TYGA 5FOOA 1KFLA 2X40A 4NVTA 3S5NA 3CEUA 1Q85A 2X05A 3UWWA 4ERAA 4GNVA 4WY0F 1GW9A 2DU2A 2H9AA 3VMOA 2XWDA 3STEA 4H8HA 1JVNA 1HTIA 1TWDA 3DFYA 3UNTA 1Z9AA 4QRNA 1E6NA 4YTTA 4WLCA 3QFEA 3ANUA 3PBWA 4GI6A 2BGNE 4IQLA 2JGQA 3V36A 2FH6A 1MYRA 3SZ8A 1QNQA 3W88A 1Z3NA 3AS2A 4HZ6A 1EC7A 1OC7A 1FH7A 1C9WA 1XXXA 4XKMA 1HX0A 5GNZA 1U1JA 4IJCA 4O14A 3MV11 1JJKA 3IIVA 1YRRA 3SECA 1W1TA 3C2RA 3QPZA 4S23A 1XISA 3BOXA 2EPKX 4H2CA 1ONXA 3WNLA 1T6MA 1ADSA 1UCWA 2VZVA 4PMYA 4I7VA 3AS3A 3OYXA 5CJ5A 1YPFA 3NPVA 4NAFA 3ZVHA 3VM7A 3WUGA 3VILA 3W7PA 4RCXA 2YDAA 2WW5A 5DCDA 1CB2A 4HJFA 5D37A 2C16A 1MUWA 1Q6GA 3NOYA 4CKQA 1EEXA 1YDNA 5KZDA 2E5DA 4A8IA 1NARA 4XKYA 1SGJA 3LPGA 1XIMA 4MJZA 2HXTA 2E25A 3UD6A 1TJRA 3O8AA 2VFEA 3NQCA 4DXXA 4HPGA 1FHLA 3SUVA 3RX2A 5KZEA 3O6YX 3UG3A 3I3EA 2FYMA 1V0KA 4TVDA 1OX4A 2W61A 3RLUA 3A21A 3MMWA 3THAA 5LNSA 1JF6A 4XBKA 3CV1A 3MO4A 1MFVA 2G3MA 3OIHA 3UF9A 4HA4A 1UB3A 5BMXA 3V16A 4J7RA 4BA0A 1XW8A 4RNJA 4E38A 2VELA 1NELA 5BXSA 4WY0B 2PPGA 1KW1A 1NDYA 2R1LA 2J75A 3I6RA 4WDTA 5J5DA 2EPHA 3LHYA 2D24A 4XAPA 1XC6A 3WH8A 5FJOA 1DJNA 4C6IA 5A95A 1PO9A 3GUGA 2IUZA 4J28A 2XZ7A 4YTUA 1QTWA 1E0XA 4WGXA 3MP3A 3P5YA 3ITVA 1JQXA 1AMKA 1SZRA 2XH7A 3IIXA 5DT7A 3BGGA 3SIMA 1TPFA 2TAAA 4O1CA 1XYLA 1XQLA 2D2HA 3VIJA 2PAJA 3PZTA 3UZZA 1QAPA 4F9DA 3QV7A 2J7DA 3A4XA 1ZGDA 4WKAA 3FVMA 1EPXA 4C60A 4D6HA 3WF3A 3GAYA 1PX3A 4XISA 1K4GA 5EFFA 2Y4SA 1G1YA 2OO6A 4NI3A 3OODA 2HBVA 3B9AA 4TMBA 1E6ZA 1PZ3A 2FGBA 3BG5A 2OZ0A 1UOZA 1X7IA 1UUQA 3EWYA 1RK5A 1TVPA 5GNXA 3C2EA 1M53A 4NJHA 1E4NA 3W2LA 1PSCA 4ZEPA 2ZRXA 3OJGA 1XV8A 3EWCA 4GK8A 4JTRA 3NPUA 3AMGA 2IQDA 4HCHA 2ZUWA 1HL8A 3OGRA 1JI2A 3VTRA 3LX9A 3HURA 2A3CA 3N12A 1EUNA 2QJMA 2L5HA 3UESA 4C6KA 2YA1A 2CHNA 1KLYA 4MWAA 1A3WA 3M16A 4M8UA 4B5SA 1LYXA 2RJGA 4NAFB 3ZVHB 1X6LA 4N9BA 1D3GA 3NQEA 3RX3A 1V6TA 3W0KA 1M68A 1ME9A 4XZ9A 2CBJA 1H0GA 1Q6DA 4GZIA 1EKOA 1TTPA 4ZOEA 5EFDA 3G77A 3UJEA 4GQBA 1LUCB 1UBSA 3T8LA 5T9CE 1UBPC 2D3NA 3C8FA 3S8HA 5C6MA 2VGBA 3ZM8A 4IMEA 3C56A 3G6LA 2NWRA 1RUSA 3FN9A 3A47A 1AQ0A 2FJUB 5HMEA 4B2DA 3KDOA 5DLCA 1VFOA 3U57A 1CIUA 3TLLA 3CL6A 4GIRA 4KRUA 4MZYA 3MQTA 1KFCA 3BUVA 3O05A 4UTUA 2ZQ0A 3IIOA 3I3BA 1LQAA 4B5WA 2GGIA 9XIMA 4PSRA 2YXXA 3WBEA 1YDOA 1KTCA 3T8QA 3C52A 3ARVA 3G1VA 4C6LA 2AQOA 2O4MA 4D6DA 1M7OA 1S46A 1OADA 4A35A 9XIAA 2ZVIA 3PBVA 2F2KA 5CGQA 4X0NA 2J66A 3MU7A 2Y2WA 2ZZ1A 4PGLA 4ZR8A 4LS2A 4NIRA 1EQPA 4EPDC 1BVNP 1XLIA 4DY1A 3CPGA 3K8LA 2DQWA 3F5LA 2Z1KA 3V0UA 3UR2A 3VD7A 2PTWA 4JNMA 1SU5A 5FF0A 3H4GA 2NLYA 5I07A 2V3FA 1XIIA 1XYMA 2C79A 3HQPA 4BFAA 3SSJA 4A3QA 2KX9A 3H53A 1PHWA 2WNZA 3L0KA 1W1YA 5GJPA 4PBFA 2ZC8A 1PKLA 2EPOA 2W9MA 3GSMA 2PWEA 1RCXB 3M5ZA 1OCBA 3QPEA 4RNIA 4QISA 1ELSA 4JQ2A 4URIA 3WNMA 3T0TA 3P0XA 1XH1A 4AXKA 2E09A 1LRNA 2Y1HA 3AO0A 2RHGA 4KKXA 3ARSA 4PODA 1P0EA 2QGYA 1JZ6A 3NA8A 2V2HA 2WJEA 3UG8A 4KETA 4LCRA 4FNRA 3KVLA 4GIAA 3IVUA 4L1GA 4N4PA 2E8YA 2Z2AA 1DE6A 2ISWA 1AZ1A 2E4TA 4S38A 1XC4A 3K8MA 4MWAB 4N02A 3PHAA 1XF0A 3ZT6A 1WXYA 1TO3A 3P81A 4U3CA 4F0SA 5E70A 2OT1A 1GKRA 2QLYA 3ITGA 4IIGA 2OEKA 2NQZA 2CKSA 3MCOA 4P7NA 2ODOA 4XZLX 4PSPA 5IRPA 1XG3A 4AD5A 2FQIA 3W7GA 5AC7A 1OF6A 1NJJA 2KAUC 3BZGA 4JTSA 1A49A 3QH2A 3FA4A 1DL3A 3BCFA 2JKAA 3ITLA 4U2ZA 2BZNA 4IIDA 1ICSA 3VUSA 4O4VA 3CQ0A 1V5XA 4UTMA 3QMTA 3H2CA 3U2EA 3H4WA 1UWAA 3MMTA 3LG3A 1J2BA 5E93A 4K6AA 3LXBA 4BY3A 4XO6A 4L1XA 3CC1A 4AZ7A 5FJTA 3VIGA 4QNEA 3E3HA 5LSMA 4M24A 4NZFA 3R12A 1W5OA 3PZ9A 2J4GA 1SYTA 4FOKA 1VGAA 1TR1A 4AY1A 1DQXA 4QJ5B 2P10A 1DIDA 5I00A 5AKQA 2QIWA 3KZSA 4ZXLA 3DHDA 3IGSA 1NWRA 2PLJA 2GJNA 1J6PA 4LUYA 4NZ1A 4YCOA 1SFTA 3C2FA 3KP1A 3E9AA 2ZUNA 3TE9A 4E2DA 1XRFA 4U28A 1FKXA 1Z32X 2Z26A 4QSHA 3LQGA 1I2QA 4HSOA 2AMXA 2QR6A 3LRKA 4J4KA 3B8SA 4G56A 1C8XA 4B3LA 3O16A 5I09A 2QCCA 1J10A 1CEOA 4M19A 3A5FA 1TIMA 3E96A 3HPXA 2OZ8A 2Q8ZA 2BGSA 1J0KA 2VOMA 1TPH1 4MB5A 3R5EA 3AHVA 1XG4A 1VFFA 7XIMA 1M03A 5FACA 1VCFA 5DBUA 1OINA 5G4EA 2WC3A 3AQUA 3CV2A 4ORIA 4JNYA 2GJLA 4QAWA 1K7FA 4JX4A 5D9NA 3IGUA 4O1FA 1XX1A 4TVUA 4POCA 2PSNA 3VIKA 4F8XA 1US3A 3TW7A 3VM5A 3HPSA 2ACSA 4ASTA 2J88A 5A1AA 3WUEA 4XQ6A 3JS3A 3RK8A 3SR7A 1IQ8A 1V3IA 4WK9A 4DF1A 5D9MA 3V18A 1KWKA 2C0HA 4C6EA 4ZE4A 1F6KA 3SRHA 3W85A 3IJIA 5K9DA 1YE6A 4LUJA 1UA3A 2CPUA 1DWHM 4EPBC 1JCXA 1M5WA 4RLIA 2GPTA 2VL4A 4UR7A 1J79A 3U3HA 1DTUA 3GIQA 3VKCA 1ZHAA 2X41A 4DZIA 1P43A 1QDSA 3ZVIA 1NFGA 3WNKA 2QAPA 2PDQA 4DWSA 3EXRA 4S3KA 1JPIA 5C70A 2PLKA 1SFSA 4IGNA 3HMCA 1MRAA 1OC6A 1CGYA 2JIWA 4B92A 4DJDD 2A3BA 3TXZA 5G2IA 5C2XA 4TVCA 1W17A 2GVLA 1HGWA 4TU1A 3HG5A 4XK2A 1R8LA 2WCSA 3V75A 1PIGA 1L6GA 1WP6A 2V5KA 1RHCA 3EDEA 2DQXA 2R6OA 4W4QA 4DAIA 4PA8A 3ZT5A 2FZBA 1B4EA 3RU8X 1XBXA 1EOKA 3U4FA 1ZAJA 2EAWA 2OEMA 5F4SA 1KO0A 2HE8A 4LUIA 4RE0A 4B5XA 4BCEA 3GTFA 3BG3A 4ERIA 3V35A 4US5D 4LJ3A 2F6KA 3QZ6A 2VNCA 3UWYA 1KV8A 4MYXA 2A3EA 4HMCA 1VKFA 2JKPA 1EB3A 1TUXA 1EXPA 1C91A 3H12A 3IWPA 1KM5A 2F6XA 1XD0A 2BSLA 2YW3A 3CB8A 3W72A 2BFGA 5JBEA 4W9TA 3E0WA 2Z4GA 2EQDA 3P93A 4UTTA 1JCNA 3WLJA 4D1JA 4C6QA 4W85A 1E1CA 3DFPA 3WQ4A 2XWEA 4UFHA 3CM4A 1ZJHA 4DXKA 3TMLA 5CSRA 4NY2A 1V0LA 1XIEA 4MUPA 5CBIA 1D2KA 1YW1A 3TFCA 3IV3A 1S1PA 1WUFA 3QYSA 2QCHA 1THFD 1KR0A 4QG6A 2E28A 4KF1A 3ZR4A 4Q6JA 2JF6A 4V15A 2WMHA 4K8HA 1GVEA 1EGMA 2V5LA 5GPRA 1AD4A 3BAYA 3TYUA 4UXDA 3B8VA 3LRMA 1UR9A 1XYFA 3TUUA 5AC4A 4L4MA 1E6XM 1PKYA 7REQA 2A3LA 4NX0A 1Q8AA 3SY5A 3OBEA 4W93A 2QCEA 5I3JA 3QRHA 1NAL1 3RCYA 3M64A 2RGMA 6CGTA 4HNTA 2P1FA 4JIPA 1MZRA 1TWZA 4O13A 4R85A 2HDJA 4WDXA 1UYQA 4JL1A 4WKFA 5CZJA 1SO4A 2YB4A 4UMCA 1MO0A 2DZBA 4O17A 3FDGA 3T0BA 3GXIA 1NWTA 1XRSA 3BLEA 1ONWA 3KP0A 4Y9AA 1IXPA 5AC5A 5MKGB 4C65A 3U0HA 3T0AA 3BTNA 1LL4A 2VR5A 3EX6A 2WV8A 3T81A 3AFBA 3LCHA 2GJXA 1UROA 1GEHA 2Z6JA 1I75A 3Q58A 4TUFA 4WCJA 3MKVA 3BAWA 4WZHA 4DIAA 3E1F1 3R8GA 3CT2A 1WYIA 3SURA 3OYZA 1EL3A 5FCZA 5M1TA 3WD2A 4F0KA 1E4LA 2R1MA 1HJXA 1R46A 4EK7A 1FDZA 4GX8A 4ORMA 4PBEA 1LT7A 1D7KA 3B9NA 3ZXWA 4Y9PA 2V82A 3RAOA 3UZJA 3EPMA 5BRQA 3NDYA 1YLVA 2O7QA 2A7PA 3A24A 5K4XA 5K9XA 1ESWA 5E1QA 5I02A 1UP0A 3ARPA 4Z2JA 3BLKA 3SCOA 1P7TB 3DHFA 1PTGA 2Y7EA 1N8FA 2UBPC 3VE7A 4UZUA 5FJRA 1CGTA 2YR1A 3QHNA 1GVIA 1BEUA 2POZA 2DFAA 4FMVA 4UTIA 4QG8A 3A9BA 2YYTA 3E5BA 1KB3A 4WX2A 5HINA 2VURA 1KQYA 2A21A 3GVWA 3U6WA 1EO5A 4ZQMA 4KEZA 2EO7A 5HMSA 3LENA 2ICSA 1VYSX 2G5WA 4ZO6A 4QNWA 3WLRA 4YL2A 4DNMA 4Q4MA 2V69A 3O06A 4QXIA 4UFJA 4O1DA 5CJMA 1VR6A 4EAMA 1WKYA 1KV5A 3ZJ8A 1B2YA 3NQMA 2ABBA 4DLMA 4DAFA 1QBAA 3ABOA 2ZUTA 1LTDA 2QPUA 3EOSA 2V5BA 2VOTA 7REQB 1X98A 4GMEA 1MNZA 1PWLA 4IWWA 1BYDA 1PPIA 3B0PA 3LCLA 4LYRA 1QI0A 1A5CA 4W8AA 5HUPA 2PDLA 3CZEA 2GSEA 4LAOA 3KWSA 3VDAA 4IFOA 3PN8A 3TJIA 1A5NC 2XGBA 5C9XA 5HWMA 2J27A 2ZFAA 1WE5A 3CZJA 1AFSA 1R9ZA 1QCWA 3IS4A 5A6BD 1SO6A 3N4FA 3AXXA 3PVFA 1QUMA 5EMJA 2OTDA 1H7PA 1EJVC 2A0NA 3W9ZA 3LHVA 4F0MA 2C14A 1PKMA 4UQ9A 1EXBA 3GBEA 1I1WA 1K6AA 4M7SA 4RZ6A 1VP5A 3N2OA 2XM2A 1P6CA 3NXLA 5CG0A 2PD5A 2ZADA 1PYFA 3RUBL 3HIJA 4XAFA 2DV0A 3MY9A 2REQA 1RVGA 5FSDC 2Y85A 3FYYA 2FZNA 1VHCA 3WQDA 3AYTA 3S2NA 4AF0B 5KSWA 1P0BA 3TOYA 3BW4A 3RHGA 1XPGA 5DXXA 2OSYA 2IPGA 1D8CA 2QV5A 4C6JA 5H1WA 3W7QA 4UQEA 4G1NA 3TJXA 1JZ8A 1SPQA 1I8JA 2GDVA 2WBKA 3G1RA 4TIMA 4AXNA 3W86A 3WZ0E 4AB4A 3DHPA 1XLAA 1ZPTA 4OTKA 3EOUA 1JZ7A 5IDIA 2BXVA 2MUCA 1X6NA 2WZIA 3B4UA 4GY0A 2C3ZA 2PGRA 3SCQA 3VGDA 4IISA 4XVEA 1H41A 3QQWA 2R9RA 1TMHA 3UU0A 2Z29A 4KEVA 4AHQA 1Q5MA 4RJEA 5AB3A 3A3HA 3LV6A 4AIEA 3TQ0A 3MI2A 4RKAA 3ONBA 1X38A 3K4WA 3SCUA 2QUTA 2E1WA 4IL0A 1YDVA 2G3IA 4O0QA 3U7VA 4XAZA 2XIQA 5JUVA 2GOKA 4X61A 2DIEA 1M6JA 4MLRA 4OUEA 4Z0SA 4RDYA 3BW3A 3QBUA 1XHGA 2EGZA 2B4GA 5T91A 1J0YA 1SJCA 3GIPA 4E4UA 3MC5A 4IQDA 1TSIA 3URQA 4R7WA 4Q4SA 3SCNA 4CNTA 2Y7GA 2VXNA 3UW6A 6REQB 1D3HA 1NOUA 5LIWX 3LBMA 1JEZA 3LU2A 1PWMA 5E6YA 3SFKA 1V3KA 1HJVA 4MTVA 5KZ6A 2E8ZA 3B0YA 2Q8XA