1F00I

Crystal structure of c-terminal 282-residue fragment of enteropathogenic e. coli intimin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
282
structure length
282
Chain Sequence
ASITEIKADKTTAVANGQDAITYTVKVMKGDKPVSNQEVTFTTTLGKLSNSTEKTDTNGYAKVTLTSTTPGKSLVSARVSDVAVDVKAPEVEFFTTLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTIMIN
publication title Crystal structure of enteropathogenic Escherichia coli intimin-receptor complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 68
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02369 Big_1 Bacterial Ig-like domain (group 1)
I PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f00I01
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1f00I02
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 1f00I03
1IAOA 3CNKA 1XGYL 5KOVC 1IEBA 4HC1L 3MRLB 2MWCA 2ZUYA 3AS0A 3SKOB 1KB5B 4Z7NF 1DJSA 1LK3L 1S78C 3KMB1 1J18A 3MLUL 1YEGH 4AM0B 2GEEA 2BVYA 2QSCH 4QRRB 5CHNA 1DR9A 2EDDA 2QSVA 1LMKA 3IDMA 5EORH 5GGQH 4ISVA 5EUOB 3EYOA 4YHMH 3H0TA 1XCQA 3NZHH 2OCFD 4NO2B 4OZFH 1XF3B 4CN6A 3DLQR 3UC0L 2DMBA 2OL3H 3VFRB 2ITDB 35C8L 1CD1A 2BVOB 2HFEA 4XPBL 4HCRL 3ES6A 2JK5B 3CVIL 4HH9B 4LSPL 3FF7C 2PUQT 3OAZH 1JTTA 4M7KL 1JF6A 3MV9A 3ARFB 5CFHA 1TETH 4Y4KB 5ETUA 4JLRB 4U7KA 4Y5VB 3QT2A 2BVPB 5D9SB 4QGTA 1NAML 3LN5B 3ARDB 4PJAB 1X4YA 3U0TB 2DQIL 3PAQA 5FM5O 5C7XL 4JM4L 7FABH 4K3EH 5I30H 1T03L 3A67H 4S0TD 1XF4A 4IRSC 1R5WB 4JPIB 1JUFB 5J1AA 4P99A 3TN0B 3ZHGA 4TYUA 1BECA 1FH5H 1N4XH 3W0WB 3MCKB 4YAQB 4X7CC 2IAND 5TGBB 1KXQE 3OZ9L 2VLKB 3QZWB 1ZTXH 4HWNA 2XWBA 3BE1L 3NPSB 2DWEB 4YK4B 3CMOL 1QA9A 2Y4SA 1CXKA 1U8IA 2V5YA 3C6LC 3K4ZA 4P2RE 3L6FB 3GB7B 2VZSA 5DMIH 3UP1A 5CZXD 4GSDL 2EC9U 3GMQB 1UQSB 5GIRA 3X14A 1VFAA 3HRZB 1F3JB 1VPOL 1T7YA 3OR6B 3QCTL 4OZHF 1FYTD 2B2XL 5IWLC 2EO9A 3E2HC 4PRPD 1A4JA 3FHQA 1I3UA 2RIKA 3BDYH 4UIKH 4TN9A 1U95A 5E8OB 1XGQA 3GMMB 1NCAH 1BVKB 1Q94A 2RHEA 4PRHB 5C0ND 4PRNB 3D0VB 4W6WB 3RZCD 5EO1B 4KKCD 4HZLB 4KKAD 5FFLA 1TVBA 5E6IA 4GUPB 3T04D 3P9MB 3VFTB 3BD3A 2CGRL 4LEOB 3CZJA 2Z31A 1MLBB 2GJZA 2KQNA 4MQ7A 1RZFH 2EKJA 3RKPA 4D9LH 4HUWA 4U1KA 5GZOC 1C7TA 2G60L 1EMTH 2MSPA 4PJFE 4GMSL 3LKRA 1C16B 1QFWH 3IXTA 3RGVC 2YD6A 1SMOA 43CAA 2QQLL 3HN3A 4XWOC 4Z76A 2PN5A 2VN7A 3IETB 2XY2A 1P6AB 3TO2A 3DRQB 1TMCB 4ODUB 1F90L 1W0VB 4X6BB 2VJXA 4XX1G 4X6EA 4ENEC 3KPLB 2DQHL 4HMDA 4NJAL 2DQJH 2FZ3A 3BESR 1RDK1 5FV1L 3L3KB 4OI9A 3HMXA 3HTLX 3B9AA 2J5LC 3PXJA 1BVLB 3VGHA 1CDUA 3LS4H 3TM6A 4PGZA 5I66B 4I4WB 1Y17B 1NC4B 4YR6B 2V5TA 3PJSB 4K9EH 1OWWA 4NKOA 1PG7X 2Z35B 2W0LA 2FIKB 1MFBH 1KFAL 1HZHL 3ARVA 3MNZB 1KOEA 3KPQB 4Z7WE 3TBYB 4U1JB 2X05A 4NCC1 3U4BL 4EBQH 1GGBH 2YBRA 3VXSE 4J7RA 1NANH 2WBJD 3RWFB 4YFLF 3GUTA 2CUIA 2QQQA 5T3ZL 1NFIB 2CDEB 4NWUL 1CLYL 1FYTA 4X6DE 3CD4A 3SKNB 3PP3H 3DSNA 1AXTL 4KKLC 2VDML 4FQLL 4N33A 1MHPH 1NQBA 1ND0A 1QQDB 5D1QD 3B3IA 1R24A 2OR8A 2A6JA 3MRJA 4P9HC 5DQDL 5FA4A 1TJHH 4Y5XB 3ARSA 1MRCH 2D4DA 1MF2H 1QYGH 3Q0HA 4WWID 1HEZB 4CU6A 5BMFH 3OGOE 4WHDA 1KWXA 1C5BL 2AKRB 5C0JB 1OARL 2ZPKL 5DHVH 5I0ZA 4CU7A 4Z7QE 5D2LB 4LLYA 3L95B 3V5DB 4IRZH 5FK9B 4QTIL 4UWWA 3TESA 1N8ZB 3DJ9A 4C9FA 4NHUB 8FABA 4U6TA 5JW4N 2G75B 4JQVA 4P5MA 4M7JH 3SKJL 1QBBA 4C4KO 2VDLL 4M8VA 4F7TB 3CX2A 3VFPB 3ZDZE 5IB5A 1CWVA 4Z7UF 5B3JF 3BUYA 2P42B 5HI3D 3QHTC 3AB0C 3STZB 3QIUD 3I9GL 3OSKA 3WFBL 3VWJD 1KCVH 4IRJC 1NC2D 1W0WA 3KPPA 3SGEH 4LLDB 1BX2B 4GKOA 1N64H 3L3JB 2R8SH 1ITBB 4OF8A 4OLUH 4OLZH 4PGBA 2VLLB 2NY5H 3EGSB 3EJZD 4ODWA 5DT1H 5DQ9A 1R3JA 2QHLA 1GIGH 2OYPA 4QHUB 5I1AA 3RAJH 3BD5A 4L8DB 3OKOA 4JFXA 4P46C 4M6ML 1G7HB 1HHJA 1MQKL 4JO1L 2WBJA 3LQAL 4RMTA 4MAUH 2F54A 5DS8A 4OIIL 3FMGH 3QEGH 2P7TB 4NOFA 3Q5TA 4JGMA 3U0PA 4XCYB 1DQTA 3MRCB 4MS8C 3PV6A 3T0XA 2P5WA 5DZOA 2ZKHL 2HJFA 1MREH 3IDUA 3PL6D 3EUUA 3VGEA 5KVDL 3K80A 4GKSB 1KC5L 4NM8H 1G7JB 3QRGL 3V0WH 4DKDC 1MFCH 1F4WH 5DGRA 1M7DB 4HKZA 3F5WB 4N34A 1RUAH 5DC0A 3GSOB 2MJWA 5EBMA 1GOFA 1DBJH 1WT5C 1AD0A 5KVEH 4BQBA 1RDI1 1UKMA 3QDJE 5CSBA 1KJ2L 4K7PY 4MA7H 3NH7H 5ACZA 3PIQA 3QXTA 3P5HA 1DQLL 5L0QB 4TVPL 3FB8B 4LDLB 4WWKD 2DM7A 3EYSH 4I2XE 2ZNWA 2Y6SC 4XMLH 1QPPA 1JK8A 1J34A 2P8PB 4BQ6A 1X2WA 3RX8A 3VXUB 1ZVSB 3VG0L 2AJXL 1BIIB 2AJ3B 1UXWB 5DJYB 4RGNC 5HHMB 2VITB 4GMTL 4X5XB 1NC2A 5DJ0B 4BQ8A 1CCZA 5DYOA 1FZOB 2D0HA 2AEWA 5ANMA 4WW2F 1WSST 1J8KA 1U93B 2ORBH 4GO6B 4M7LT 4OZGE 5DO2C 4UB0L 5F7WC 4D0DB 3ARTA 2X4NA 4WI5A 4FZEH 5DJDA 1CGTA 3BKYH 4HGWB 4OTXL 4KU1A 3DVGB 1TJIH 2HLFC 1UWEL 1UZ6F 5BZWB 2HKHL 3EO0A 4OCLC 1PQZA 2BFVL 5EB9A 1E28A 4C4KT 5MERA 4WRLA 1OTUD 3FO0H 4IJ3C 2KV3A 3P11H 4PP2B 5B3NA 4NSKA 5BS0B 5BJTB 2JJTC 2NXZC 4QRUB 4XB8A 2UV3A 4QRRA 1YEFL 5IVNA 1SY6A 2R69L 1J10A 3F6LA 1HHIB 1ACYH 2DI9A 3G5ZA 5HYIA 4OZIA 3O8XD 3KLAA 1V3JA 3OKKA 3OGCB 3BAEH 5T1KB 3C08H 2Q7NA 5ERWA 5FGCE 1J1PH 1SEQL 2P24A 3RWCB 3WNPA 1RUPH 1TZGH 4K23L 2EXYC 3UTPE 4JLRA 4TNWK 5H94B 4AEIL 4TTDD 4DAGH 4JJ5A 4RAUA 2CIIB 5CMAB 4K7PX 1HCFX 1JTPA 3NIDF 1YTTA 5HTSA 1RZJC 3GJFK 3GSXA 4M61B 3QFJB 4AMKL 1PY4A 2CXKA 2R0KL 1D6EA 4JPIA 4MLSA 3L5XL 5LQBH 4U1HB 1P1ZB 4LLAA 1IM9B 3JUZA 5IFAL 2XNAA 3LS5L 4KTYA 1AXSA 4EDXA 1G9EA 2ZWKA 3GJFA 1RV6X 3QZWA 1I7ZB 4PJGA 4JO2L 3QIWC 4HF5L 1WISA 4P23A 1EPFA 3V52H 2VXVH 4QYOA 1RDM1 5ICYA 3GMQA 3OF6D 3NCMA 3O9WA 4L8BA 5IB1B 3QQ3B 1RAMA 4NN5B 2VDOH 3RY6A 4ODTH 4LSTH 3B2UC 2M26A 5KJRL 4POYA 2NY4C 3U7WH 2GK0B 3DUSB 3UJTL 2PXYC 4DKFL 4KK8C 1NAKH 4HMEA 2NW3A 4GFTB 1H5BB 1A6WH 1A47A 3D0VA 3LCYA 3MZGB 4ZO7A 2YOCA 3KPRD 5T1MB 5D1ZB 1JJUA 5DUBB 5M7QA 4L9DA 1T2XA 4GUPA 1QFWM 2X4PB 3M8OH 5IROC 3WBRA 3T09A 1UKSA 4KJYB 4LEOA 4U49A 1JPSL 1SM3L 4JR9H 4S1DC 1FNSL 5FUOH 2VDNL 1FNHA 1WFTA 3O8XA 4XXCA 4LHQB 4YJZL 2NXYB 3QG7H 4KZDH 1FCGA 4EIGB 4J1UA 3BO8B 5C07B 3X3FH 1L7TL 4KHTL 4JFFA 3C2AH 1PX4A 2UY7A 5J06A 4HIEB 5GS0D 4NUGL 4M02A 5T5NG 1A7NL 1MWAH 4ZFZA 3P5GA 2IH1B 3UTSD 2N4IA 1BFVL 1DSFH 3PWLB 4G43B 3Q6GL 3DRQA 3S35X 5EH1A 3GPRD 4DGIH 2LVEA 3VXNB 3S36L 4JFZH 3SDYH 5HYFA 2QQKL 1CQYA 1EHLL 2IFGA 1MRDH 2WWKO 3WDIA 3NABH 3K8KA 1HH9B 1BVLA 1FSKC 1QRND 5I66A 4J12A 4MMZC 2D0FA 5FA3B 5ITBL 1NC4A 1TQBB 4LNVA 2W0KA 3RWJB 1OF2B 1OGTA 3JWDH 3TZVA 4Y88A 3SGDI 3KHQA 5JNYB 1T89A 4Z77B 4O2EA 3SE4A 2X4SA 2OS7A 5EIIB 2X40A 4OGYL 4N36A 2BP3A 1AP2A 3QNZB 3OF6A 3UBUA 3VFVA 4ODXB 3STBA 1FGVL 2FBJL 4X4ME 2CDEA 3ZE2F 5CINH 3ILQC 5JHDB 1CIDA 1QDDA 2R0WH 3L5WB 1Q9LA 1CDGA 4A6YH 4TPRH 5E1HB 1QQDA 3T8XB 3K7BA 1IAIH 5ITFB 5LAXB 5EOCJ 2FSEB 2YC1A 5GGSB 4WO4A 5CILL 4IMLA 4JY4B 4PBVC 1IGYA 3O4OC 3G5YB 3KPRA 2A1WH 1HEZA 1HH6B 1VA9A 1UKQA 1TN3A 5D96B 2AKRA 4TSBH 5FYJD 1NEZA 5GRJL 5BOPA 4WI8A 1UWGH 5A2FA 3T0BA 3MRMA 1KG0A 5D2LA 4F2MA 1H3WM 3GMLB 4RGMB 3T3PF 4KVCH 5I0DA 4LCYB 5KANI 1YN7B 1BCJ1 1EBPA 2NY0D 2EIZA 1LP9E 3G5VA 3ULSB 3FQRB 4Z5RB 3QHFL 4C59B 2WQ8A 2AJYH 3IGAB 1A6VH 3LKPB 3RVUC 4I18C 2UWEF 1QO3A 4R3SA 3GKWL 3MYJA 2X1OA 5ESVB 4HIHA 1NMCB 4NJ9H 4XGZB 5JPNB 4RFEB 5E7FA 1AQDA 1Q0XH 1JPFB 4S1RH 1I8LA 3QDGD 3E1F1 4GG6A 4XHJC 4TQEL 5JOFA 4HS3A 1RIUL 1C1EH 3MREB 4GAJH 2X44D 2ZUWA 3QUXB 1XIWD 1BQHG 3MGAA 2OR9H 3FRUB 1FO0H 5IBTL 4NC1C 4QHUA 1JYNA 3MRRB 3VGAC 1G7LB 4I3SH 3OMZA 1CG9B 4X6CA 5DJCB 1UG9A 3I6GB 5I1GH 4DEPC 2DKSA 4Z7NE 1FVCA 4L1DA 4FP8H 1AIFB 4FMFA 2X6MA 5F9OL 2QHRH 1KCSH 2B1HL 4J4PA 4OCXL 2I25N 2BZDA 4LARL 3G6JE 4DK3A 1AHWB 3UTQA 4LSSL 3MRCA 4MWFB 1FFRA 3QWRD 3SO3B 1U9KA 4QHLB 5I19L 2AI0L 4RIRA 1ZANL 2NTFA 3WS3B 4JFHD 5IVXB 5L8KB 1EIBA 2GSIB 3MNVA 4G9FD 2R56H 4Y5YC 4MGXA 5D5MF 4G8EB 5J89A 5D2NA 1S7WA 1BJ1J 3BZDA 1CFVL 4MD5B 3HC0B 1W0YT 4OV5A 3VXTB 2R9HC 1YNLL 2G9HB 1JPGA 1T22A 3CH8A 2D7TH 1JF5A 3GSOA 1PEZA 4JZJC 3VXPB 4N1HB 1V7PB 4E5XB 4J23A 4YNYB 1B88A 4C55A 5A40E 3CDGA 4NNXB 1KWVA 1KB5H 2WBWB 5CCKL 2J8HA 2YZ1A 4JFEE 2UUDH 4U7MA 2HFGL 4LHUA 4ODSH 3IFOB 4YBQD 1GGYA 1F58L 5GRYA 5E8NA 1SY6H 4Y4HD 1FRGL 3C87A 4OF6A 3O0RL 5IMKB 3ULUD 3BPLC 5I1KL 2LU7A 3PWNB 3WNNA 5K93A 1YEDB 2FEEL 3ZTJG 2YEZB 1U8JA 3M45A 4JDTH 3EAKA 4PJCF 2ESVB 1HHHB 2BDNL 3ULVD 3VRLF 5B38A 4EI5D 2C3GA 4DN4L 3QDGA 4KK6D 4NQCA 1R3HB 4F7MA 2FECL 2PO6D 5KG9B 2UZIH 4PBWD 1QSEB 3RL1A 3P7FA 1T0NB 1XIWA 4ZFGH 1E6OL 4WCYL 1BQSA 1GL4B 2V7HB 3KQGA 4MCYA 1NBYA 3BFOA 1U0QA 1C7SA 3B8YA 5INDB 3EZ8A 5E56A 3RGVB 1IXXA 1RHHB 5SV4A 1HIMH 1G9MC 3SDDB 4XP5L 4PLNC 3NIGF 4O51B 1BEYL 1SEBB 4JFDD 4AEHH 3GSQB 1JCKA 3B9EA 5GS1B 1YDPB 1FV1B 3TO4B 3IAPA 4XNXL 12E8H 4G6KL 3BZ4B 4X98A 1S9WB 3RWCA 3HE7A 2Y72A 2IJ0C 3QO0B 1IAII 1X5AA 5I1JH 2YD3A 4JZNA 1MNUL 5H94A 2XOTA 1BBDL 5C0AB 5CMAA 1VHPA 3PGCA 1KZE1 5TDOA 4NOBA 1D5ZB 1F42A 1Q72H 4CKVX 3K8LA 1VGKA 5F3BA 2IC2A 2B8OT 3CVHA 3NZHL 4Y1AD 2OL3L 1MCBA 2FGWL 4O2FB 1A14L 3LDBB 1HNFA 2IPUG 4Y4HA 5LGJB 2VDQH 5DMGC 4MQTB 2VLRE 1VFOA 3F62A 1AFA1 1I1CA 4XXDA 4F57L 3D1MC 5IQ9B 2K7PA 3VCLB 1UWXK 2Q8BL 5IB1A 3MXVL 1LO5B 1GGIH 5C6TH 7FABL 4EJ1C 4K3EL 2NW2A 1MCOH 2LQRA 1O7BT 2F74B 5EU5B 2VDPL 1P7HL 3HG1B 3HB3C 4ETQB 5CEZE 3GHBH 3EHBD 5D7KE 1FH5L 1N4XL 1ZT4B 5FGBC 4AT6A 15C8L 3MZTA 4NRZA 3QEQB 3M9ZA 2C1PB 3MLZH 4Y19E 1ZTXL 4OGXH 5ADOH 1U8QA 4X4XA 3VYKA 5DMIL 1Y18A 3CFKA 4YHPB 1BGXL 4ZAKC 2BSSA 3PP4H 1IILE 2VABA 4NO5B 4WFHE 1MJ7H 4JFDA 2E9JA 4MXQC 4BYHA 2P8MB 4WW2C 2M8XA 4FFVD 3T77A 3BDYL 4IRJB 4M8QA 4UIKL 1XZ0A 4BFIB 1WK0A 3T65A 1NCAL 4NKMB 3CFEB 1WT9B 3G84A 5KSVA 2W60A 1C08A 3HZKA 1T20B 2IGFH 3GEWB 1NEZG 3BX4A 3RWGB 4XNQA 1AJ7H 1ZA3A 4FQIH 2FRGP 2D03H 1XF1A 2RIAA 4D9LL 3KYNA 1KLUB 4WY7H 4X9GA 2XKNB 1R3LA 1EMTL 1OTTC 3FTGA 1B90A 1EHAA 3PHQA 4Y1AA 4PGEA 2A6KA 4WUUE 2KQMA 4HUUA 2CD0A 4JN2A 1CD9B 3WFEH 3D39D 1T5XB 1KN2H 1NDGB 1IAIM 2O5YL 4GXVL 3FQTA 5EG6C 3SN6N 3H7BB 3OJ2C 3IKCA 1FVEB 4UILL 1TLKA 2IANB 4ODXA 3EFDH 1JZ4A 3MODH 2ATPA 1DBMH 4WW1A 1Z0MA 5JHDA 2PCPA 3L5WA 3LS4L 1ADQA 4PJEB 3FOLB 1RU9H 3VE0B 3IKQA 1ZLSH 5TJWK 4HGKC 2APVA 1XH3B 4KZVA 2VSDA 4K9EL 4IOPB 1RK0B 4P5KA 2YK1H 1LE9B 4M5YH 3K3QA 3EOAA 5JW4Q 4PRPB 5EN2B 1HH6A 1PSKH 1JWUB 2H2PC 5B4MD 4DN8A 4PJDE 1HILA 25C8H 4EBQL 4F9PA 3BWAB 4R4ND 4QWWC 1J05A 4E41E 4Q6IB 5D7JC 4L4TB 4TNVK 3GMLA 1FN4A 5C0FA 5I8CB 4RGNB 2V6HA 4O00A 3QDME 3QWQB 2PETA 3MRQB 1YN7A 2F53A 3KYKH 3VXRD 2APWA 4KMTH 3U79A 1TJHL 1MRCL 1MF2L 3QG6A 2R1XB 4LGPB 5BMFL 2D2OA 3LKPA 3UO1L 3QUKB 2VERN 1BWWA 5D71L 1QR1A 5FECA 1OQOA 5I75B 2LAGB 1N5AA 2ZUXA 3W5MA 1F4AA 5A2KH 2F58H 5FKPB 4IJ3B 5EU4B 4X7FC 2MSBA 1AGDB 4E52A 3G04B 2NXZB 4A2MA 1T1YA 4PLJD 4X9FA 1LE5B 1MH5B 1VFBA 5BXFB 3BH8B 3VXMD 2CLRA 1P53A 3JV4A 5ABDE 3D39A 1WC7B 5D1XC 2HYMA 4KWUA 1GGCH 5ECJE 4B0MM 1Z9LA 4HHAA 4FQQA 2H9GA 3V6OC 5LKNA 1CF8H 3OJMB 1UZ6E 3ARBD 5CP3A 2NTSP 2XI9A 5JLZA 32C2B 1KCVL 2L7UA 5B38G 2PW2B 3EOTH 3CSGA 1URLA 1A6TB 4Q9BA 4HWEH 3WS6C 4LQ1A 1XR8A 2R8SL 4U1NB 5DI8A 5DJ2B 3OR7B 2NY5L 3ZKMC 1WTGT 1H3VA 5DT1L 2Y7QB 1JGEB 3DVNB 1GIGL 5EZIH 4Y7MA 3SDAD 4AK8A 4IRSA 3ARUA 4BZYA 3HC0A 4PJHF 3CLFH 1KJ3L 4RRPA 3OBAA 5C09E 5D1QB 2G9HA 1YMME 4BQ9A 5SX5H 3P9LA 3MBXL 3LQAC 4YZFE 3ZE1F 1XGTB 4PJ7A 4MAUL 4RAHA 1JNHA 1Z5LB 3QIWB 3FMGL 3QEGL 5DQJA 5E2VH 1EO7A 4PGCB 4BM7A 3TYFB 2K1MA 3C6LA 5E00A 4PRAB 3RNQA 3DGGA 1MREL 1BBJB 1INEH 4HK0A 5F9AC 1QHPA 4LK4A 3VXRA 1OP3K 3MCG1 5IWLA 3T1FB 1AGFB 1MEXL 3WFCL 3RIAF 3CCHB 1ERNA 2CLZA 2NY4B 3V0WL 5A1AA 3C60D 4S1QL 2PXYB 5EIVA 1MFCL 1YEDA 1HN1A 1G6RA 2EYTB 1A2YB 1RUAL 1BQHB 1HHHA 3VFSB 1X2TB 5C0GA 2R29L 1XCTA 3FO9B 4MA1C 2BPHA 5KVEL 1BZ9A 4ZXBC 4BK4A 3QPXL 3VWJB 4MA7L 8CGTA 1T0NA 4L5FH 3WV0A 4YUEH 3VXMA 3FQNB 2P8LB 1HUPA 4JRWA 1ZOXA 3MFGB 1DV8A 5GJTL 4F7CB 3EYSL 2Y07H 4XMLL 4N9OB 1ZLVK 3STLA 4I0PD 4PJBF 1DQJB 2EDEA 1YJDH 3ARBA 4FFWC 2JELH 1JWIA 3BDWB 2R39A 5IUSA 4X8JA 1EERB 2J8UB 2V7NB 4L29A 4RQQA 1FNFA 2ZG1A 1CBVL 4TUOB 5T1LD 3E8UH 2XQYG 2APTA 3B5TA 1G0YR 4FZEL 1OTSD 3P4OA 2E8YA 4OFYD 1TJIL 1VERA 3BOVA 3TA3D 1FSKB 3L3GB 2VIRA 4OF5A 3DRTA 3VFOB 1WAAE 5TDPA 3WXWH 4U0QB 1S7TB 4R0LB 4L3EE 4JG1H 5EU7E 3PL6B 5A3IC 3SDXB 2BRRH 1F6AA 4M93C 4N5UA 4HDIA 5L7XH 3U9PH 1KELH 4OFVA 1HCVA 3HUJB 3UTPD 2XPGA 4D0BA 4E9LA 4G9DA 3NPZB 3V4PH 3O3BA 2DB8A 4NKIH 3BAEL 5ELIA 5DMKB 4H0IA 1WWAX 1DCLA 3C08L 1HYSD 2RCSL 2YD1A 2OI9C 1YPOA 4L3CA 2MKLC 1FYHB 3HI5H 3V95A 2Z8RA 4MXWH 2EDWA 4XP9H 3NIFE 4YDVB 3JTTA 5L2KE 4PGDB 2IBZY 2HVJB 4YDKL 5E5RB 3FONA 3JV0A 1RZKL 4JAMB 4P49A 1T6WA 3MRIB 4WWKB 3DBZA 3O4OB 4XPHH 3FFDA 5HHVH 1LO5A 5CJXC 4JKPL 4MNGE 5GRXG 4KZEH 4N0FB 5E8DH 1KPUA 1D5IH 4QRPE 1KCGA 1KCLA 3W2DL 2IPTL 3CXHK 5LQBL 1ZA6B 1QSFB 2Z93A 2W92A 1ZT4A 2W38A 5GRVK 2C1PA 1IC1A 4QHKJ 2PNDA 1M71B 3LH2H 4L8CB 1H15A 4UQ3B 4NT6B 4YLQT 1PW9A 1UADC 4PP1D 1A1MA 2HVKA 4FG6C 4LSTL 4ODTL 1FPTL 1CN4A 1SJEA 3CFDB 2VRAA 4OM0L 5DJZA 1WWCA 1Z9OA 5MHSE 5DDHB 5EU6E 4TUKH 1A6WL 1WCBA 3TA3A 3BN9C 4PREB 1UM5H 3ARED 3FQUA 2EYSB 3H9ZA 3TH4T 1T20A 1S7QB 4MJIE 1MQ8A 4LNRB 4BSJA 4G6AD 4JY6B 5IFJA 4KQ3H 3TF7C 3RWGA 1OAYH 2FX8H 2UWEE 4GW1B 5DRWB 3O3AB 5FUOL 5FDYA 2A6IA 4KZDL 4DEPB 1XF2B 3KJ6H 4XNUH 3BQUC 4P46A 3X3FL 2XKNA 1EJOL 4D2NA 4YXLH 3C2AL 1G7QB 1OB1B 2R0ZL 1K2DB 4OLWH 1DSFL 5D7LE 1NDGA 1LEKA 1I1RA 2H6PB 2X1QA 2X70B 1UH3A 3H7BA 1BMGA 4Y5YB 2GUOB 5L88H 3OKLB 3ZKXB 4JFZL 2P46B 4G96A 3H8NA 5I1CL 4ESKA 1MRDL 3ZE0F 3ALXA 3NABL 4MB4A 2QKIA 2FJGA 3VE0A 3MFFB 4PJIA 1MHHA 4PV9B 2CR6A 1RJLA 1MSPA 4TOYL 3QWOA 1KTLB 3Q5OA 1RK0A 4KRPD 3VRIA 5JIKA 4UZGA 1FZKA 4BSWB 4UNTA 4Z78A 1BP3B 4U2YA 4ZFOB 3WSQH 1UVQB 3LPWA 5DURD 4XPTH 3BPLB 3RL2A 2C1OB 5CINL 5GRZA 1Q1JH 2BVQB 2R0WL 4OIAA 5TH2B 2YPLE 5I71C 4A6YL 5JOPE 1U91B 3U83A 4LEXH 1O0VA 1MUJB 2VUOA 5GSRA 3RTQD 1RJYB 2WUCH 2G5BA 3CUPA 4KDTC 3ROOA 3AREA 4JM2D 4X80L 1FCCA 3T3AA 1RDJ1 4UQ2A 1CFBA 1IQDA 3RHWF 5HYJA 3DV4A 3DGCR 4GW5B 4I0PC 5DLMH 2XTJE 4ZO9A 3TCLA 4TSBL 1MIEH 4BZ1H 3VJ6A 2GJJA 3MBED 1KB9K 4FQ1H 3UTSB 4J2XA 2DLEA 4RMQA 4YFEA 1UWGL 4GKZA 1IGJB 2VISB 3S35H 1BREA 3VRLE 1MCEA 5AG8A 4OD1H 5C0BD 4QHKI 1LE5A 3LEVH 4XP4H 2BNRE 5BXFA 2DJ4A 1LO4L 5IHBA 3AS3A 3WO4C 1LEGB 2AV1A 1QBAA 1QRNB 1U3HD 1A6VL 4BH7B 5ALCH 3LD8C 3D3VA 2APBA 1BM3H 3FT4A 5D7IE 4NJ9L 1JHLH 1A21A 5GSVB 4KROD 5F72S 4U4BA 4S1RL 3I50L 3PWVB 5MENE 1I4FB 4LCWD 5E2UH 2EEDA 3NIGE 2WLYA 4KV5F 3KLDA 1C1EL 4IIQC 4GAJL 2ZCKH 5SX4H 5F9JA 3U46A 2AABH 3TYGH 1FO0L 1VESA 5HVHB 3VG9B 4I3SL 2V9RA 1KV3A 1YPZF 5FXCH 3DX8B 5GGTH 3ALSA 1MAKA 3T4YA 2QHRL 1KCSL 2EDJA 3QIWA 4QY8B 3R8QA 3QJHA 4OFPA 5C9JA 4PGCA 1CGSH 3SCMD 3TYFA 3ZT5A 4PRAA 2LS8A 1RZ8B 4LIQE 3CMGA 5HYSG 1I9IH 1FNGB 2R56L 3CFWA 4NQXB 1AGFA 4NGHH 5INCA 4JM2A 4UBDD 5KVFL 3WN5B 1UH2A 3NFSH 3IDXH 3BP5B 4FRWA 3MOBH 2PXYA 2X4QA 1F13A 1HHKA 4JFED 2NY0B 3UJJH 4B7IA 1DN2A 4QXUH 4O02H 3MBEA 1JMZA 2D7TL 1EFXD 1DUZB 1DLHA 4UTBL 5EOQH 3DSFH 1HWGB 1QR4A 4NO0A 5IROA 4KMQA 3U36B 3ISWA 1M6OB 3FO1A 5C0BA 1KB5L 2NY2C 4ZAKB 2BRSA 3S4SG 3FQNA 2P8LA 4ODSL 2OMNA 3QR2A 4Y4FC 1VCAA 3PWJA 1BLNB 4ZQKB 3GSUA 1OCWH 4DCQA 3QNYA 1AFB1 3KWWA 4M62H 1ZEAH 3I75A 3T0ED 4G6AC 1YEHH 4JDTL 3U0WH 4LU5L 1JA3A 4FOMA 4I9WE 1EK3A 2O61B 1BD2A 2ZNXA 2AJVL 3Q6FB 3SDCD 4XVJH 3IRPX 4OCWH 4DKEH 5CD5D 2JCCB 3EYVA 3BIAX 2UZIL 2VXUH 4ZTOL 4NBZB 5I1HL 5JO5A 3SGJC 2WWMC 4ZFGL 3ARWA 4J6RL 4CVXB 2RAMA 1N3NB 4P9HH 3L3GA 1G1QA 3RI5F 4R8WL 1TQCC 3MRFA 5HDBF 1OGAB 3O41A 3SBWC 3SPVB 1JGUL 3U82B 1D5BA 1I7TB 1NL0H 4FS0A 1I9JH 4G9FB 1PYWA 3W9EB 1HIML 3OKNA 3SCMA 4AEHL 3MRDB 1Q9WA 5DMKA 3L7FB 1OOAA 3QDHA 2WIMA 1NFDF 4I48A 2ARJB 5HI5C 12E8L 3D69A 4GAYB 4MHHI 5D70H 2BNUB 2ZZUT 4G5ZL 2X1WL 1FL5B 1FDLL 3JUYA 3NFPB 4OAWA 4MYWB 5I1JL 2X9XA 5FF6B 2HVJA 2NY1C 1FZMB 1BWMA 2AK4D 4P9MH 4EXKA 2H32A 4YXHL 2OQJB 4JAMA 4LRIC 1EFXA 4G42B 4JZOA 1XGRA 3I3EA 3UBXA 2I07A 2R2BA 4LQFA 4PG9B 4ETYA 2VLRD 5HHPA 4W6YB 2XT1B 3WJJC 3ET9F 1Q72L 1FL6A 3QH3B 3VD7A 2W9DH 4FXKB 2DTMH 1ZGLB 3PHSA 2VRPA 4EI5B 5D7JB 1KX0A 2HT4D 2QSQA 1QEWB 3CFBA 2R4SH 2MCPH 4OZHA 4ZYKB 2PO6B 4PJ8C 3HRPA 4JHZA 1M71A 5CEZD 2JB6A 5LG1A 5JW5B 5HGHA 2Y36L 1CFQA 2DQDH 3H42H 3MRPB 4HV8B 4NN6C 3MROA 4Y19D 1GGIL 3CXHJ 4BH8B 5C6TL 5E6ZA 4I18A 3SDCA 1J35A 5H2BA 1MCOL 3OXRA 2XN9A 4EUPA 4KJPC 2VH5H 1I8IB 1W8NA 5JW3L 1QFPA 5M62A 1S9XB 3MMEB 1FNLA 3GHBL 3U4AA 4WFHD 3WJLC 4MSWB 3ARRA 3JV6A 4YDJA 1X3DA 3UTTA 5SX4I 5IIEB 5J6GA 2GSGB 2VAAB 3VWKD 5ADOL 4X7DC 4WREA 2XWTA 2D7PA 2CK0L 5D1XB 1UJ3C 1O7CT 3QULA 1IGMH 1MJ7L 1KBGH 1F02I 2CO7B 4YHOH 3HPLB 3BEWB 1TNNA 1NLBL 3CC5B 1CT8B 4F80A 2W65A 4XRCA 1MCJA 2CKBL 3DARA 2XRAH 1AD9A 2FJHA 2OTWB 5SWSA 2VMFA 5LGHH 2IGFL 2AK4A 2ICWA 4WUUD 1RPQA 5HHQB 4DFIA 3BKMH 4LIQL 2GUOA 4H25B 5IOPA 1AJ7L 4OCYH 4FQIL 1GPOH 1PY9A 2Q76A 5ID0B 1JZ6A 2D03L 3GBML 1S9YB 2BVTA 2EC8A 5J13C 5EPMB 1YQ2A 3P4LA 4J6JA 3GSNA 2J6EH 4JZJA 4OD2A 4KK5C 2FO4A 4GAGH 4U6XB 2CRYA 1HXYB 3WFEL 4WGVB 1B2WH 1I9RL 4P2RB 2DQEH 1T0MB 1KN2L 2HG5A 4V1DE 3B9VA 3V8CA 3GRWH 3TPUB 5JZ7C 1H0DA 4LAQH 1A1NB 4ZFOA 4ODVL 4AH2A 4Z7VE 3G8KA 5CJOH 1RULL 5CEYA 1YEEH 5J57B 1EO8H 1T66C 1G1CA 3QA3A 1R3IL 2ADGA 2BVQA 3QISA 1UM4H 3OX8B 1HI6B 2OSLB 4H1LB 4XMPH 3DROA 4M5ZH 1UCTA 3W9DA 2OK0H 2A0LD 3LRSB 3R06A 3VGGA 1A9BB 2WIIA 3KXFA 4E41D 4K9EC 3DI3B 4AG4L 1EHXA 5JORB 5KSBE 4IDJL 3FOMA 4RDQG 4HJ0D 4M5YL 3HFML 4UT6L 3QDMD 1YQVH 3UEZA 5IMMB 4GW5A 5JXEC 1AC6A 3O2VH 3MLPA 1AKJB 3QQ4A 2NX5A 3I6KB 3SJVE 5K9OB 4XNMA 1YZZA 2BXZA 2N7SA 1NGYB 5HY9A 4PJFB 3RNKB 1DDHB 3C2SA 4Z7UA 3IF1A 3RVWC 3ARQA 5IW1A 4KY1H 5B8CC 3KPOB 3KYKL 3QUZD 3S36X 2XFXB 3ARGD 4KMTL 1S7SB 4WI6A 5DVNA 1KB9J 5TFSH 3FB6B 3B4NA 4X4YA 1H9VA 2GFBA 2OBGA 2NR6C 5EUOF 3VDAA 4PJ9C 1S7VA 2YKLL 4NQVB 1C8PA 5EUKA 1HXMA 3MLWL 4HC1A 3BGMB 1QHOA 4M17A 1CLZH 2QADD 3FB5A 3QEUB 3MC0A 2Q7YB 2F58L 3S5LG 2E9WA 2ICES 5IW6B 1RMFH 1S5IL 2WUBH 3ZZ1A 4LP4A 5C08D 2BK8A 3PABB 4C83B 3WL9B 5I76A 5FYKE 1DY0A 2BPDA 5KTIA 4Z7WB 4PD4K 1GGCL 2IQ9H 4TNWF 4ZO6A 1A7BA 3VXSB 5SWZE 1CF8L 2LFGA 5F9DC 1XF5A 1RY7B 5TDNA 3OAYH 4X6DB 3D0LA 4HCRA 3RP1A 2MCG1 4Z7OE 4XCNA 4JDZB 3EOTL 1KLFA 5ESAA 5KAQF 4HWEL 1RUQH 5MEQA 3QI9C 4PJGF 4RFNB 3RUGB 1NAMA 3H9SE 5C70A 1MCNA 2WV3A 2NY5C 1EEUA 2ZUQC 1L9NA 2DQGL 4HUNB 1D5XB 4G8GE 1J88A 2J4WH 5DTFA 1CLOH 4PR5B 3PWPD 3CLFL 3LRHA 2VKWA 1BFSA 4ZFFB 3TBTA 4QXTA 5FGBA 2JIXA 4RFOL 2O5XL 3BPNB 1A6AB 3ECBB 1EAPA 2DIBA 3DBXB 2FHFA 1MJ8L 4LLQA 5C71A 5E94B 4NQEE 4RMUA 2DMCA 4MD4B 5E2VL 1RUMH 5CD3A 2ZWLT 1U92B 2G2RB 4BSVA 3KDMA 2XG5A 4QXGH 2K9UA 2XZCH 1INEL 2A73B 1MCHA 1NBZB 1V3LA 4OLXH 3ARGA 4XX1E 1ZLUK 3RKDC 5FHAH 5JXAL 4ONHA 4WW2A 1I7UA 5E9DB 2PW1B 4QRTA 4R9HA 4YDLC 4N68A 5ISZE 4N1EA 4ZPTB 2NLJA 4YDIL 4KJQC 5K59F 4Q9QL 1K5NA 5KVGH 4MJ6B 3AU1B 1AY1L 2AJZA 4XT1C 1I3RA 4Y8DC 4OQTA 5C08A 3C9NA 3L3HB 3RVVD 4L5FL 1MCQA 4YUEL 1H8NA 3VFMB 3NACH 3D25A 2CKNA 4ZTPL 2Y07L 3KPNB 3QNXB 4OBSA 3SGKC 4JO3H 3LKSA 1YJDL 2OM5A 3KR3L 4U1SB 3SPVA 2XA8H 4LKCB 1PEWA 2JELL 1YY9C 2BPEA 1F3DH 4ZSOE 5HYSB 4GLRH 5HGBB 3ROLB 2AXGA 1L7IH 5TE6L 1CL7I 3CPLB 3U7YH 4EUPG 4L3ED 3E8UL 3C6SB 4D8PA 1MIMH 1AQKH 5BCAA 1KTKE 3EYFA 3IDNB 4GAYA 3TT1H 5JPMA 2BNUA 3LSOA 4UMGA 1FL5A 4GBXD 3PWPA 1C12B 4DVBB 3WXWL 1TFHA 4TVSa 4CVZB 1MCWM 1NFKA 1INQA 2DL2A 4JG1L 2HT2D 2OZ4H 3S4SB 5F1IB 4G42A 5GS3A 3V5HB 3S96A 1YNTB 3TFKD 1JRHH 2XKUA 3U9PL 4PG9A 1CDCA 5L2KD 1IKFL 3QDJB 4OKDA 3O3DB 3C60B 5CBAB 1J5OH 3V4PL 1EEYB 2IAMD 4YGAB 4J6MA 4I2XB 5CLTA 1RJZB 3LZFL 4XVSH 4DN3H 5D7JA 2ZSWB 1HHGB 4MXWL 4XP9L 1F6FB 4QKXB 3RRQA 4K3DH 1QEWA 2ADJB 5D2LF 1DY1A 3K0WA 3KJ4C 5JW5A 4EN3D 3D18B 2H3NA 1RZKC 3S98A 5JDJA 1KACB 3UAJC 4C56E 3G08B 2YR3A 3O4LA 4G80B 4NCDA 4OZGB 3TLRA 2P5EA 1LK2A 1H8OA 1S7UA 4XBPA 4I0PB 3PWUA 4KZEL 1ZK9A 3RWIA 1C5DA 1D5IL 3UTOA 5FO9B 1WVZA 5F6HJ 3OKEB 5I73B 4JFYA 4WV1C 2XG4A 4HLZG 2DM3A 5C0RH 2VOTA 3PF2A 3UYPA 1M1SA 2R0LH 4M48H 2V5MA 1INDH 2AEQL 3KVQA 3S8WA 3WLBB 1CIUA 5IIEA 5MHSD 5EU6D 2PTTA 4WU7A 3WNMA 2Y5TB 3IVKB 5FB8B 1T1ZB 4YQXH 3WO4B 1I8MA 3PDOB 4P2QE 1YA5A 2R2HB 1KJVB 4PRIA 5C0CA 3MPCA 1PKOA 3MLTB 1CYGA 3V6OA 5IJVA 1KULA 4LCCC 2OP4H 4MJID 1X7QA 4LOUC 5I1DB 2FHCA 2AV7A 5FGCB 1P9MC 3WEXB 1QSZA 4TUKL 1I8KB 1HOCB 4ZUWB 3G9VA 3WS6A 2LU4A 4Y2OA 1FFPA 4LPWA 3FB7A 4IIQB 1UM5L 3V5KB 2WP3O 5BRZA 4PUBH 4X5LA 4Q6YA 3KLHC 3IFPB 1U8HA 3IS0X 4M6OL 1UB5B 1A6PA 2EDRA 4WI4A 5IBUG 2YHFA 2N7BA 3DX6A 2ICWJ 3NCEB 4K3GA 2W9LA 3MSPA 3CDYA 4XP6L 1IC4H 3KJ6L 4XNUL 4KKBC 1J1OH 1S9YA 3GIZH 4YXLL 3MV9E 5JTWA 1IAKB 3C22A 3J7HA 3L9RB 1IRAY 3TWCH 5DD6B 3FF8C 3DYOA 1NCNA 4LLWB 4OLWL 4Y16D 3ARYA 2GTWB 1WICA 2IBBA 4XTRD 3U1SH 3CSPA 3WLWD 3BGFC 5L88L 1A1NA 3KPMB 4P3CH 1G9MH 4NIKB 1B0RA 5EBWB 1U8OB 2Q6WB 3N9GL 1HSAA 3FCTB 4U33A 1GAFH 2W0FB 3ILPB 3OX8A 2IF7A 1R14A 2FD6H 4H1LA 2CDGB 1IODB 4F7EA 1SYSB 1TLGA 5DJAB 3RJDA 2HMID 1G7PA 1XGYH 3WNOA 5DD1L 5LGKA 2LTQB 2P1YA 2ZUSA 4ZXBA 1P7KB 2YPLD 2HN7A 5J0BA 5JOPD 1LK3H 4FQXC 2NY2B 1NGXB 1KJ2A 5EOTB 2LABA 1PKQA 4UOJA 2ZUTA 2R23B 3MLUH 4YO0B 4Y4FB 1MCRA 3WSQL 1ZHLB 3UBXI 3ZL4H 5F88B 5IHLB 3PBFA 2VL4A 5EFIB 4NZDA 3TCXA 3DTXA 3MUY1 1OW0C 1I3GH 3NBNA 1OAKL 2CR3A 2XXMB 1MLCB 3SQOH 1NMAL 1PZUB 35C8H 2WUCL 4W81A 4XPBH 1PWBA 5HI4C 4M7KH 5F7UA 4OKVA 2NY6D 3MA7B 5B1XA 3T2PA 1J8HB 1LO2H 4YIQA 3GSWB 1MIEL 4M7LL 2X4RB 4UT7L 5FYJH 4FQ1L 5B39G 3DV6A 3C5ZD 5F6HI 2KBGA 3BW9A 1T03H 2BHZA 3CZFA 4CDHA 1JE6A 1UEXB 5EU7C 1YNKH 5E8PB 3LEVL 2Z92A 3PABA 2YPKB 3WL9A 1EX0A 4AYFA 5MEND 2FEDD 1IZJA 1GZPB 2UVEA 4QRSB 3SKMB 1UOSB 3CH1A 1ED3A 2IFFL 1ULVA 4H0GA 3LQZB 1FVUB 5ALCL 1ZAGA 2CK2A 2AAVA 3X11B 1IGTA 1JHLL 4GKNA 1JHTA 5FO8B 5D5MA 1VPOH 4JQXC 1N0XH 1P2CB 4Z0XB 4LLVB 3THMH 2R2EA 5M95B 1OZ7B 1KPRB 3OJDA 4U1IA 3RUGA 5E2UL 1I1FB 4PD4J 4JANB 1D9KC 1IEAB 5DURB 2ZCKL 5ACMA 5HPMA 3TYGL 1QSVA 2EYRB 4P5TC 4MX7B 1FG9C 5CP7B 1MPUA 1WF5A 1T5WA 2ICWI 1IKNC 3AMLA 4OGAC 4WDIB 1FYTE 3QAZC 2VDRL 1ZGLP 4QHMA 5CKGA 5DMJB 4ZS7H 2VWEE 3RTQB 2I5YL 4S0UA 3KYOB 4MAYD 5F3HB 2J3SA 5GGTL 3H6JA 1A7QH 4JB9L 5GJSL 3R1GH 1S5HA 3ZSTA 1A9EB 1CGSL 3TH3T 2G60H 4HEME 2G2RA 4GMSH 1OHQA 5A43C 4ZOBA 3RDTD 4YFLI 5AYQA 3QXAB 1I9IL 4XPAL 1PAMA 2QQLH 4UNVA 1JGDA 3IFNL 1PLGL 4NGHL 3NA9H 4JRYA 3K2MC 5E9DA 2PW1A 4MTHA 5MEPA 1RVFH 4F15B 1F90H 3UJJL 3WHE0 1CFTB 4O02L 4BKLA 5GPRA 3OHXB 4NJAH 4LAJH 2Y9RT 5EOQL 3EJYC 1MHCA 2XYCA 3DSFL 1U3HB 1TVHB 4OLVH 3AXLB 5EC1A 3RWEA 2OJEA 3T2QA 4I9WD 2C26A 1UJ3B 2EDNA 3C09C 5IMOB 5DRXA 5T3XE 4H20L 4D0CB 4R4FL 3QFDB 3IDJB 3KPNA 3BQUA 4APQC 3L3DB 4ZS6D 1ZEAL 3BHBA 4CNIB 1K4DA 3L5IA 4LKCA 1YEHL 3AM8C 3B9KD 3ORJA 3RWHB 1XGUA 5DJ8A 3BYTA 4GRLD 5TF0A 3G6JB 4KUCD 1P7QD 1KEML 5T3ZH 3ULVH 2OMBA 1EXUB 3AY4C 4NWUH 5GHWL 5CZVH 3VMOA 2XIDA 4KVNL 4OCWL 1U0OB 4DKEL 4HJJH 1AE6L 1DVFD 5FKAB 2VXUL 2NY3C 4NWTL 4HWZA 2CRIA 4AQ1B 4Y5VC 2YUZA 1AO7B 4TUJA 2AQ2A 5DQDH 4P9HL 2ILLA 5IK3B 2F54E 1KLGB 3DX7B 3DIFA 4K2UH 3TJHC 4WFED 3V8OA 1NL0L 5BZDA 3K7UA 1I9JL 4GRWE 4W4OA 2P5WE 3WXVL 1YNTA 2DLGA 1YN6A 3TN0C 1Z9MA 5HHOA 3IU3A 3O3DA 5E70A 2YD4A 5CBAA 4JFEB 3BZFA 4JQIH 4Y2DC 5GGUB 5IMLB 3NPSC 4YK4C 5FUCE 4URTB 3MGOA 4PJ5D 4UOW0 3SKJH 5D70L 1HHGA 2YA2A 1ITCA 3L5HA 3MQIA 1GC1L 3VI4F 1REIA 2AXFB 2HRPH 5EO9A 3P0VH 3ZYIA 1R5VA 3VPPA 1OP9A 1R3KB 3WFBH 4J3XA 3Q3GB 4PPTA 4F58H 4G80A 2YS4A 4XBGA 4TNVF 4Z6AT 4LPYA 2DBJA 1QPXA 1BZQK 2X4UB 2XTJC 1T2QH 1XT5A 3O6FC 3J8F7 1T04B 1VADA 1SMAA 2VC2H 3MV01 3EYQC 3MA9L 3AC0A 4NQSB 2W9DL 2ZSVB 2DTML 5FYLE 1E8IA 3VXOB 5I16A 5EDXA 5I9QC 2R4SL 3FFCA 2MCPL 3VRJB 3WUWG 5IGXH 2E3VA 5ANME 1ZLWK 2ADIA 3EDDA 4KFZC 1X5XA 5ILTH 2NNAA 3B9KA 1I1YA 1MQKH 2MOVA 4JO1H 4KTEH 1T7ZA 1T1ZA 3LQAH 3H42L 4BZ2L 1JNLL 3GSRA 1P7QA 4IOFC 4H8WH 4PJ9B 3MRNA 4WNQB 3HMXL 4LVEA 5I1DA 1A1OB 3IXAA 4J3SA 2ZKHH 4GI0A 2VH5L 1JYXA 3W39B 2F5BL 3BT2L 1KJMB 3LHPL 4BQCA 1RSFA 5IB3B 5J3HD 3GMPB 1ORSA 1P4LB 4QKJA 4QRRE 3O6ML 5AD0B 2EE9A 2FL5A 4IIQA 1RHFA 3PQYD 3LY6A 4OZIE 4CMMB 1NUGA 3W11C 3D85A 1UB5A 4S1SL 1DFBH 5IVXF 3OG6B 4C16A 2H2SC 3DO3A 3GBLA 5JMRA 4R97C 1IGML 3UYRH 1KBGL 1KOAA 3HI6L 4JFOA 5HYQA 4NQUA 4RMRA 1GOGA 2B1AH 2MH4A 4PJ5A 2VAJA 3D6GA 2VLRB 2Q3AA 1JI2A 1VACB 4RA3A 5L2JA 2ZUQB 3VG0H 4M1GA 4POZD 2R1YA 1EV2E 3U48A 3TIDA 2BY1A 4GMTH 3MV7A 4R4BB 2A9ML 4IS6B 4P2OD 4GT7A 4QO1A 3QEHB 3S88L 3UDWA 4I1NB 1J7VR 4V1DD 3REVB 5K9KB 2X42A 4KDVA 1CFNA 4P59L 2Q86B 3LIZL 3MJ9H 2WAHA 3D9AH 4UB0H 4PJGE 1JGLH 2CDGA 2BOBB 3WBPA 1NGWB 4Y19B 2BERA 4DGYL 1AR1D 5IEKB 3MUGA 5KS9A 3P0YH 3P5FA 2HKHH 2BFVH 3GJEA 5EOTA 2BC4B 3ARPA 4GG8B 4Y4FA 5C6WH 1IQWH 3MYZA 4YPGA 5F7DA 2IALB 5EFIA 1E27A 3HAEA 3X12A 1ZWIA 3AVEA 1S9VB 5FFTA 1MJUH 3H9HA 5KSUB 5I15L 2C3VB 5JQHC 1DE4B 3DWTA 4M3JA 3C5JA 4EI6B 2JJSC 4E0RB 1SEQH 3RVXC 4G8FA 1KGCE 3VGFA 1CXIA 2PYFB 3PQYA 1LILA 3I02B 2LE9A 1YQVL 4YX2L 1RZGB 1J8HA 3NCBB 3O2VL 5I8EA 4JFFE 1EEZB 1G7MA 4OFDA 3DMMD 3Q2CA 4GK1A 3QXWA 5HGAA 5E2JA 1EGJH 4ELKA 3SBWA 3VFWB 2VZOA 4WUUB 4AMKH 2ZJSL 1UEXA 3L5XH 5KSAC 4KY1L 2QQNL 4ZRVA 4UV7L 3TVMD 2OXGA 3LS5H 1U8LA 3UZQA 3F7PC 2H1PH 4UNUA 4JO2H 5EBLB 1FVUA 1YMHB 5D4QA 3T08A 4YC2B 5FYKD 3O2DH 2C3XA 3OXSA 2IMMA 2I9TB 1QACA 1JTOA 4LHJB 5B22A 4DUVA 1QBML 4GJTB 5FCSH 1CLZL 2D4FA 4WTZA 5ACLA 4P57A 5SWZD 4LSRH 4PJHA 4GQPH 2XKSA 1IAMA 1RMFL 3UJTH 3TNNA 2ZCHH 1HSBB 4NQDD 4MD0B 1CICD 2EIDA 4QOKD 4G6FD 3ETBF 3U2SB 4PJDB 3H9SD 3WJJA 2IQ9L 1TITA 3OAZK 5JDSA 3BH9B 3LMJH 3RIAK 4WDIA 4OZFA 2OL3A 3HE6C 4E41B 3UZEA 4G8GD 2VDNH 4PJ8A 1J9CT 5L0QC 3KJ4B 1MI5A 3QDMB 4CN1A 1RUQL 4YHNB 3KPRE 3MUJA 4F37F 2EICA 2IADB 4DZBB 4U31A 4NHCH 4NUGH 5BO1L 5B39B 1A7NH 4NQED 4RCAA 2JJWA 2HJLB 1BFVH 3EJJX 3Q6GH 1B4RA 2J4WL 1CLOL 4QKGA 3P4NB 3HS0B 5DJXA 4XBEH 4YHZH 1FFOA 1SYVA 4XVUD 2Z4QA 5DHYB 3WJLA 1CFTA 3V4VL 5DRZB 3FZUC 2QQKH 1ZVYA 2XZAL 3DMMA 1NLDL 3VD9A 1EHLH 5JR1H 1TPXC 2EZ0D 3TBSA 4ZDHA 1TVHA 3P77B 4I3RL 1U8NB 1IGFH 1WIOA 4MB3A 5ITBH 4HIIA 3TVMA 2XZCL 2QADB 2E8ZA 3BEVB 1ZSDB 3EO9H 3BPCA 4LCUA 1FIEA 4FQCL 2K7QA 3M17B 4GG6E 1UKTA 4KGLA 1L0XA 3MGTB 5SV3A 5J6HB 1R0AH 3MO1A 4D3CL 3VMPA 1RUKL 4F7PA 4OF7A 4PLKD 1FHGA 1RZ7L 4FTVD 1XARA 3BZEA 5KVGL 3EBAA 5GRUL 1U0OA 4IM8A 3QIBD 4LF3B 1NGZA 4X6CE 4NQDA 1CICA 4YHKL 1AO7A 3NACL 4CVUA 5CILH 5C09B 3HLAA 1FFNB 1YMMB 2QTEA 1KIRB 1HQ4B 4JO3L 4HJGA 4NRYB 1E4WH 4JHAL 1YJDC 4PJEF 5E0QA 2LVCA 3MNWA 4XCEA 2XA8L 4N5EC 2DWDB 5IV2A 4ORGA 3N1QC 3LKQB 3V6BR 3I84A 1UMRC 4MJ5B 3IB4A 2EDXA 1L7IL 5D2NE 4HGMA 2UYLA 4D9RE 1U3ZA 4K3JH 5T5NF 1MIML 4LKXB 1FC1A 2FHBA 2ICEB 3HR5B 4YXKH 1ZHKA 1MY7A 2BY3A 2HTLD 2FR4B 3GKWH 1AH1A 3CDGE 1K4CA 2OZ4L 2WMPA 3IJHB 1M4KA 1R5IB 4MMXC 1TJGH 3L7EB 4AJ0A 4MDJA 5DUMH 1SVZA 3QUYD 4NFCA 3HPJA 4WJ5B 4G6ML 1H5BC 1D6VL 1I85C 1J12A 4BUHA 3G5XB 4N8PA 4C56D 1SHMA 5D1ZC 5E4EC 1T04A 4G7VH 4WFFD 3V6FA 1MJJB 5T33L 5SWQA 4NQSA 2X2YA 2CLVA 2ZSVA 4XVSL 4DN3L 5IBTH 2E7MA 2A83B 3Q48A 3C5SA 1C3AA 1TCRB 4NDMA 3FJTA 3OKDA 3QDGE 4F33B 3O45B 4NQCE 5B8CA 1LVEA 5I2IA 1S9KC 1SBSH 3WFDH 4NQTA 3UTZA 2GT9B 5F9OH 1SL4A 3T2OA 4OZ4B 2F9BT 4FTVA 1BOGA 4ZESA 4OCXH 3N1MC 2BSTA 5DHVA 4J3OC 5I19H 4QHNB 2AI0H 3N50A 3QQ9D 1IM3B 1KT2A 2MMXA 1DQMH 1P4LA 5C0RL 4ORZC 4OCRL 2R0LL 4P0DA 1QD0A 1CFVH 4M48L 1XEDA 4L3EB 4EIZC 5HYEA 2F8XC 1S7RA 3EDFA 4NNYA 4ZOAA 2FLBT 2IQAB 3S34L 4XAWH 2WQRA 3IJSB 4YQXL 2C6UA 3AROA 2GJ6A 3MRGB 3VD5A 4GBXB 2GHWB 5J9PA 2BCKB 4HKJA 1K8DB 4NNPH 5D93C 5C3TA 3LRGA 3KYMA 4IEFB 5CJQH 3MOAL 2HFGH 3BN3B 4HD9A 5L2KB 3QI9A 2B5IB 1FRGH 3IAGC 4HH8A 4N0CC 3O0RH 2D7OA 4WI7A 5K33A 2IAMB 1A6ZB 5ENWB 4MJ2A 4ZODA 1T83C 2A74A 4FQHA 2HH0L 4MNGB 4R4BA 4IS6A 4P5TB 3WSRA 2WM0A 3OG4B 3TBVA 3RY5A 4QRPB 4DN4H 1RDN1 5K9KA 3MR9A 5IB2B 1EGIA 2YA1A 5IM7B 3WUWB 3QAZB 1A8JH 4L4JA 3TIEA 2N7AA 2E9IA 4EN3B 1J1OL 3WHDA 3GIZL 1AGCB 3ULUE 1KWTA 4P4KD 3BKCL 1RDL1 1E6OH 4WCYH 5GS0L 3TWCL 3ZHGD 5D6CB 5KZCD 2ZOLB 4MQXD 1B6EA 3T0DA 2H2TB 5AWNH 3ZKQD 2O5ZH 3CSYA 3U1SL 2ZG3A 4NZJA 1FORL 3EOYG 4YWGL 1OAUH 4P3CL 2AGJH 4XP5H 3LEXB 4WTZG 2DF3A 2FYYA 4UINH 1NCWH 4FQJL 1BEYH 1V3KA 1BCH1 1H3TA 3O11B 3B2VH 5EU6B 5C0EA 2H26A 3QRFM 2FD6L 3GZKA 4G6KH 4N8VG 4J8RB 1G84A 4R96B 3FT2B 3PNWA 3B43A 1NMCC 2J8UF 4E0RA 1IBGH 1JNNH 3GGWB 4MJIB 2QV2A 3DO7B 2F15A 3V79C 2XA3A 3C09B 5E6ID 4HEPG 1MNUH 1ES0B 1DQQB 4OZFG 4JFDE 4GXUM 4MNQA 1K8IA 1BBDH 3NN8A 3U9UB 1OSZB 4HXAH 2DM2A 2Z31D 5F7MC 3ZL4L 3HI1A 1ETZA 3SGKA 3QUXC 4APQB 4X6FA 3QXDA 2ZOKA 4PV8B 4FXGB 2X9WA 3BUTA 1N0LA 4JHBA 1F2QA 1TZHA 4L4VD 5F97E 1U6AH 4WCOA 1I3GL 2BHUA 4HIJA 4WU5A 4UXMA 1JFQH 5LCVH 3RVTC 4KRMB 2A9NL 3SDXF 5D7LB 3SQOL 2V2XA 3P40A 2FGWH 4O58H 1A14H 5FUZH 3HUJF 4CADB 5HDOA 2NY3B 2ENSA 3ZKND 3GMRA 4QRQB 1LO2L 4F57H 1VEPA 1AHWC 3BIKA 4L8SB 4W4NA 2VUZA 4XNZB 5FYJL 3SO3C 2Q8BH 3MXVH 3DXAA 2DM4A 5K9QI 4Y1AE 2ATKB 4R2GC 4ZPVA 3ZHLA 5DSCB 1AR2A 2VDPH 4AY0A 3F7YA 1YPZA 1YNKL 4P4KA 4V2CB 1XGPB 4JO4L 15C8H 5BW7C 1CXLA 4LVHC 5B1RA 4Y2DB 4QT5B 2P47B 3SY0A 3MXWH 4OIBA 4UU9B 3NGBC 5CSZA 2EEAA 5JHDE 4UTAL 1BJ3A 1WIPA 1P4BL 4MXVF 3DUUB 1BGXH 5GGRY 2HLAB 2MHAA 3RU8H 1Z3GH 2YPLB 1N0XL 2HT3D 3L3IB 3THML 3O3EB 4HFUH 3WIHL 1WWBX 4QCIA 4N90E 1A4KA 1U8MB 5E03A 2E7LA 4QTHA 4E42A 3WBQA 2IADA 1SL5A 1KZA1 3SO5A 1QLFB 3VFNB 4QEGA 2WINB 2NZ9D 5IHZA 3V6ZB 2HJLA 1T3FB 2XTJB 3RFZC 3NAAH 3O6FB 3X13B 4XP1H 3HS0A 4XPGL 3WE6A 2DQFB 4LASH 4WV1A 4G6JH 2VO5A 2VLJA 4ZS7L 1IL1B 5DRZA 5I9QB 4EDWH 1IE5A 1IJKC 1A7QL 5DK0A 2ARJQ 2F53E 2NY6B 5E8EA 3R1GL 4L4VA 3DETC 4PBXA 3MLYL 4QF1A 2BNRB 2K3TA 5F7FA 1CXHA 4K94L 2WW8A 2IH3B 5E5MA 2DYPB 3KPSA 3S3SA 3C5ZB 4LCCA 1I1AD 3BVNB 4FZ8H 3SDDC 5D7IB 2F8VA 3NA9L 1P9MA 5F93C 2O5YH 4GXVH 2YSSB 1MOEA 3L3OB 5T3XD 3PXHA 1RVFL 3RI5K 1MHEB 5GS1C 4UILH 5FDWA 4NUJB 1PDKA 1Q9OA 4DGVH 3TO4C 5MENB 1ZHBB 4XZUB 4RAVB 1SB2B 3CFJB 4ZUVA 3LKNA 5I1LA 2FEEI 5F89B 4OLVL 1GJIA 3D39E 2PYEA 3ZHKA 4LF3A 2AJUL 1N6VA 1LNUB 4P3DA 4AENB 4PIRF 3CVHL 4R97B 1LEIB 2FECI 3BX7C 1EH9A 3HNVL 3QJFA 2XACC 2V2TA 1CD0A 2JJVA 1YMMA 1KIRA 2CKBB 4PG2A 2BSED 5FV2A 2RR3A 3ULUL 3GHEH 1MWAA 1NFDA 4FN0A 5E99L 2F54D 4PJXB 1XR9B 3ULVL 1L6XA 1F4HA 2DAVA 5CZVL 3LDBC 1AGEA 1KWWA 1DN0A 1CI5A 2DKMA 5T1DL 4HJJL 2HTKD 2X5PA 2H45A 5FGRA 2P5WD 1ZT1B 4MAYB 3D2UA 3M1BA 3PHOB 4OFKA 4PJ7E 4S2SA 4H5SB 4WHYH 3UO1H 4HUVA 4X99B 5FO7A 4K2UL 5D71H 5DRNA 4L9LA 3RDTB 2RGSA 3FAXA 3TPKA 3WKML 3AAZB 3L7EA 5IB4B 4FQXA 3ESUF 4NYLB 2N56A 4MA3A 5IG7B 2R1WA 3VXRE 3S6CA 5H35B 2GGUA 1LO3H 1FFQA 4F8TA 4JQIL 3LB6C 2YPVH 5IVZA 1MJJA 3G6AA 4N9GA 4I13B 1I1AA 1YY8A 3WDHA 1GC1C 3FQXA 1OW0A 2WSKA 4A6YA 3F12A 3KLSA 4N8CL 4R90L 2HRPL 3P0VL 4I5BA 1HTNA 6CGTA 3C8DA 5FYLD 1G1RA 2DLFH 5DEZA 5FAAA 3N85H 2GYSA 4Q2ZB 4F58L 3LEYH 2BJMH 2V9QA 3VXME 3TNMA 1CDYA 4YGVB 1NJ9A 1T2QL 1WEJH 4M43H 1KPVA 1V5JA 4F3FA 2VC2L 1EA9C 4FHBD 4GRLB 4KHXH 2H8PB 3VH8A 3NCXA 1I7RA 3MRKA 2GO0A 1S7XA 4JFQB 4WI3A 1JWMB 3P73B 4HLZH 1UENA 3CXDL 5DEFA 3HKFA 5KSAB 1DVFB 1KJ3H 2X1XR 3GK8L 5IGXL 3RIFK 1A7RH 4DZ8B 4X0KB 5ILTL 3QUMB 5CEZH 1QRKA 1T21B 3MBXH 1UCBL 3IJYB 4KTEL 4U1LB 5IP4A 1B4JH 4QRRD 1PZ5B 4IBLT 2J88H 2UZYB 3UPRA 4Q58C 5ESQB 4H8WL 2W9EL 4C57C 2HFTA 3EO1B 2I27N 4HWUA 5JUEL 3E6FB 5DFVD 1V4LA 5IF0A 2E7CA 4EVNB 1RK1B 1MEXH 3PDGA 3WFCH 5JHLL 5C92A 1GHFL 1ZT7A 3C8JA 3R0NA 2PF5A 3RWDB 1D9KA 3ARFD 3MRBA 3EDKA 3O6KH 4S1QH 4Y4KD 3RPIA 5GZND 4KUZL 4PFEA 4UIMB 3WIFA 4R7NB 1FO0A 3ARDD 1DFBL 3IDIB 5CZXC 5HVGB 3K2UH 3QPQD 4JRXA 5EU3B 4QRPA 5GGSY 2VZVA 2R29H 1E0OB 1IKNA 1WV7T 3UYRL 1J0HA 3HE6B 4OQ1A 2Y25A 2VZUA 5DK2A 2APFA 1YUHB 5F21B 4Q97A 1CGWA 3QPXH 4JPVH 5IR1A 3H3PH 2B1AL 1M05B 4N0UA 5GGRB 4H26B 5GJTH 4J3VA 3W0WD 1DEEB 5C0NC 1ESLA 3HZMB 4YHIB 3RZCC 4KKCC 4KKAC 5F44A 5DMYA 4Q6IC 3VI3F 1QFWI 2YRPA 4LSQL 2NYYD 2V2WA 4P23D 1LD9B 2BNQB 1IJ9A 1KUMA 2MKWA 3MACL 3O9WD 2EXWD 4ZUSB 2VXSH 5CJ8A 1WBXB 1CBVH 1L0QA 4CRPA 1MFEL 3MJ9L 2V9TA 3D9AL 3AGVA 4PY7A 1WBZB 3GMNA 5KANG 1JGLL 3RPKA 3S3PA 1G7IB 1TPXB 2UUDK 3TBWA 3H7LA 1F11B 5I75C 1OD9A 3P0YL 3MRLA 3DO7A 2OS9A 2L0DA 4LPVA 1T4KB 1KB5A 3SKOA 2JCCF 3ME0A 5F6IB 2DJUA 4J3TA 1H3PL 1QOKA 4AM0A 1JBJA 1KGCD 5CKAA 2EDQA 1IQWL 2NZIA 4ONFL 3WMSA 5FIEA 4PV8A 1JHKH 1GGTA 1MJUL 5EUOA 3AM8A 1NANI 3OTTA 4JFFD 4N0YL 1NBVL 2RCSH 4NO2A 1XF3A 3VFRA 2ITDA 2BVOA 5F71A 4HH9A 2JK5A 1N59B 2VYRE 4J3UA 4KQ4H 4JGJA 3ARFA 4Y4KA 4Y5VA 2BVPA 4YDKH 5D9SA 1RZKH 3LN5A 3ARDA 2I9LB 4PJAA 4WVRA 1JGVH 1MCDA 5F9WB 1JZ2A 2RIEA 3U0TA 2WBJC 1UXSB 2RB8A 1KTDB 1EGJL 4JKPH 3Q1SL 2AS5M 5CWSB 3HNSL 1R5WA 3MJ6A 4XVTH 1Q9KB 3W2DH 2IPTH 1JUFA 2EH7L 2C7UB 4P2OB 1C5CH 1XGPA 5D1QC 3V0AC 1NC4D 3TN0A 3W0WA 3MCKA 4YAQA 4V1DB 2P43B 2X41A 4CL7A 3S37L 5TGBA 3TZVD 1V7NL 2VLKA 2H1PL 1J11A 3T3ME 3FRPA 2DWEA 4Z7VB 4HLJA 1YEJL 1CD8A 4N8VB 4MZ2A 3L6FA 3GB7A 3O2DL 3QCUH 1G6RL 1UQSA 4HKBB 1FL3B 5C0DB 3HRZA 1F3JA 1UB6B 4PJIE 3OR6A 4LSRL 1FPTH 2V5SA 4LSVH 1FIGH 1IARB 2GCYB 4OM0H 3F58L 1AFD1 3SGEI 5KSBB 5E8OA 3GMMA 5C0IB 1B0GB 2ZCHL 4ZRWA 3VFNA 1BVKA 4PRHA 4PRNA 4WO4D 2CIKB 5EO1A 3U4EB 1T3FA 4HZLA 5E4EB 3SJVB 3LMJL 4YLIA 4TSCH 3P9MA 3VD3A 3P4MB 5HI3C 3VFTA 3LVEA 3QIUC 1MLBA 3VWJC 5TF1H 4WEBH 1F4XL 5HVFB 2BNRA 3GSVB 1EJOH 5F8QC 4GRMB 2DYPA 2GW5A 4MDIB 4NHCL 5HYJE 2R0ZH 3EJZC 1C16A 2YUWA 2X89A 4W70A 1KMB1 5MI0C 3IETA 1Q8MA 1J0KA 5HGGS 3L3OA 4ODUA 4XBEL 4YHZL 1W0VA 4X6BA 3KPLA 5I1CH 5JR1L 3L3KA 3MV8B 3SE3A 5TPWH 4KI5E 3IDGB 1IGFL 3VFUB 4I4WA 1Y17A 1CE6B 5DEGB 4QNPF 3D3VE 3PJSA 4R0LC 5D8JH 4YR6A 4AENA 4HT1H 4TOYH 1LEIA 1X5YA 3PL6C 5ADPL 5ICZB 5SWZB 4DFHA 2Z35A 3EO9L 1OAXH 3ZHDA 2FIKA 5DJ6B 2DL9A 1A6UH 5D93B 3MNZA 1I9EA 3KPQA 4PTUB 3TBYA 3HNTH 4U1JA 5JW4M 1R0AL 1JV5B 3ZDXE 1JF1B 5ICXB 3RWFA 3BP7B 4PJXA 2DDQH 3H9SB 1XR9A 4U3HA 4LBEB 1NFIA 4GKOG 1TTFA 4J4PD 2XZQL 2DQCH 3SKNA 4PDCA 4G8GB 5J56B 3VH8G 2FCBA 4MA8H 4ZNEA 4WWKC 4Y5XA 5L8JB 4X80H 2YUXA 4H5SA 3IKNA 1E4WL 5BVJB 4D9RD 1EEQA 1KN4L 2IG2H 4JN1L 2FX7L 5C0JA 1N6QL 4NQEB 4ZUUB 4NPYB 2VQ1B 4NYLA 3DYMA 5I17B 5IG7A 3L95A 3V5DA 2ZP0T 5FK9A 5C9KA 4OF3A 1N8ZA 4N1CA 1L4IA 3ARZA 4NHUA 2D31B 4AIOA 4HFWB 1IC7L 3WFHB 4K3JL 2EKSB 4Z0BL 1TTUA 3NMEA 4LHUD 2G75A 1LO4H 1WCQA 5ISZB 1CGUA 2L4OA 4F7TA 4YXKL 3VFPA 4PJFF 3VXUD 3VXQB 2I24N 2VE6B 1OTUC 4PYGA 3S7GA 2JJSA 3STZA 5HHMD 1CZ8H 5C0BE 2GTZB 1NUDA 2A2QT 1TJGL 3HZVB 1WMZA 5DUML 3I50H 4LLDA 4HUXB 4NN7C 5I8OH 1BX2A 4NQCD 3L3JA 3O8XC 4XXCC 4KJWD 4G8IB 3ZYOA 2SEBB 2VLLA 4M1CD 3F7VB 4G7VL 1H8SA 3EGSA 1TIUA 1OT1A 4RNRB 1P5VA 1KIUA 1WBYB 4P4RB 2CUMA 3D5OF 3MJ7B 3QIBB 1BFOB 4ZSOB 1BD2E 2AEIT 4L8DA 4LCWE 4XH2B 1GZQB 1SBSL 2DJSA 3WFDL 1G7HA 4U1MB 4TTDC 3IJYA 5FFSA 1G0DA 3NCFB 3KS0H 2Y5EA 4Z7WF 5GQBA 2BXYA 5ESQA 4WHTB 2P7TA 4B41A 3IDYB 1CFSB 1UC6A 4XCYA 1N7ML 3SHSA 1JMXA 5T1KD 3RA7H 2E6PA 4WR9A 3G6DH 4EQ2A 4X6DF 1S8DB 4R2GB 1DQML 3BYYA 3OQ3B 1DP0A 5HHNB 1ZHNB 4GKSA 2YMXL 3HE7D 4K8RD 3QHZL 3ZKXC 1E6JL 3C8KB 1G7JA 3RUGF 3OV6A 5KVFH 2E9BA 5F7YC 1KTRL 1M7DA 3BDBA 3SE4C 3F5WA 4LMQI 5IEHB 4XAWL 4LVHB 4UTBH 4DK6A 2A6DB 3JSSA 1WFUA 5EU3A 2X4OB 2P44B 3I3BA 3NGBB 2DI7A 4NNPL 3LN4B 3I6LE 1DANT 3C8HA 3QFJD 3REWB 1MCPH 4HWBH 4Z7QF 1XMWA 4B5EA 5CJQL 5KTEL 1IM9D 3FB8A 3QUYB 1DEEA 5HGDB 2P8PA 3VXUA 1WQVT 2AXHA 1ZVSA 5HXMA 4HX1B 4MCZB 2YD7A 1BIIA 2AJ3A 2BNQA 1UXWA 5DJYA 5SX5K 3HC3H 4LU5H 2VITA 4X5XA 3ZDZF 1BZ7B 5DJ0A 4UUJB 1FZOA 4PLOB 1WBXA 5A2IH 2AJVH 4MXVE 4CAGA 5GGVH 3MJ8B 1RURH 4JKMA 1U93A 1KG0C 4OZHE 4ZTOH 4D0DA 5I1HH 1IJKB 3BP4B 1D5MB 3T0EE 5JW4R 1ACZA 5GS0C 4HGWA 2GGXA 5IJKC 3DVGA 4J6RH 2EDLA 1UZ8B 5DC9B 5BZWA 4R8WH 3QZWG 2FWOB 4LVOC 5AWNL 5HSFA 2O5ZL 1JGUH 4P2QB 4U6YB 5IBLD 5BS0A 4PP2A 2XN9E 3NFNB 3GPRC 5BJTA 3E6HB 1G9NL 4QRUA 1IAOB 3ALTA 1OAUL 1IEBB 3FN3A 2AGJL 1L6ZA 1HHIA 4UINL 1NCWL 4X9HA 3B2VL 2NXYD 4KRLB 4EZMA 3OGCA 5C07D 5ALBH 5T1KA 2AK1L 3UTTE 1FAIH 1FIFA 2KUTA 4G5ZH 1IBGL 5CGYD 1JNNL 4YHYB 3IDMB 1FDLH 4NC1E 4ISVB 2CH8A 2CUHA 1N59A 4UDUB 4JCLA 4Q0XL 5C2BH 2VNCA 3EYOB 3H0TB 1XCQB 5TQ0L 4YXHH 4HXAL 2CIIA 1CD1B 2HFEB 3CCKA 3ES6B 3MV9B 5FYJU 5ETUB 3ZTNL 1KWYA 1U6AL 5HVHC 4M61A 3QFJA 5SWSE 3VG9C 5I74B 1JFQL 4O5LH 5LCVL 4U1HA 1P1ZA 1DL7H 1IM9A 1UMRA 2AK4E 1X6NA 4O58L 5FUZL 2IT5A 4IDLA 1XF4B 1I7ZA 3I3DA 5J1AB 2DTSA 4GXUN 4M9OA 2Y36H 3WUZA 5KZCB 1NH6A 4KK9D 3WD5H 1MFNA 1FL3A 3MJGX 3QQ3A 4DW2L 4DWHA 1OSPL 2XWBB 1E4XH 3S9DB 1QA9B 5JHDD 4OUUB 1U8IB 1DTUA 3VA6A 2GK0A 1EFQA 4KXZH 3DUSA 5JW3H 4PB9L 3WN5C 2LAAA 3X14B 1VFAB 2NY0C 1H5BA 4OZGF 1I85A 1LO0H 5DXWA 4N90D 5T1MA 5D1ZA 1YC7A 5AZEH 5DUBA 3MXWL 2X4PA 1U95B 4Z8FH 1XGQB 4KJYA 2CK0H 1Q94B 4PGJA 3RU8L 2FJFB 1Z3GL 1TVBB 3KXFE 5E6IB 1OPGH 4HFUL 1HDMB 3BO8A 1NLBH 5C07A 2FBOJ 4KJWC 2CKBH 2Z31B 4HIEA 5DC4B 4MVBD 5JA8B 2GJZB 1KWZA 2F53D 5JOEA 1XIWC 2C4FT 2IH1A 2NX5E 1F8TL 3PWLA 5AZ2L 4G43A 4HUWB 4U1KB 3NAAL 3P5DA 4OSUL 4XP1L 3K81A 1G0XA 4LASL 2ED7A 3LKRB 4G6JL 4LIQH 4Z7UE 3VXNA 5B3JE 1UEYA 4O4YH 1OP5H 5EULV 3IXTB 4YPJA 4EDWL 43CAB 2EIBA 4AEFA 1U36A 2GAZB 4Z76B 3MV8A 5FCUH 1S78D 2AJSH 4B50A 3TO2B 1E4KC 1HH9A 3GBMH 1UT9A 4K94C 1T1WB 3VFUA 4X6EB 1CE6A 5FA3A 4AZ8A 2FZ3B 4PB0L 3RWJA 1OF2A 5ICZA 2VLMD 1I9RH 4FZ8L 1MRFH 5JNYA 1X5HA 3GI8H 4POUB 5T5FH 4Z77A 3W5NA 4CAJA 5EIIA 4ODVH 2CXGA 3QNZA 4DGVL 4NKOB 1JF1A 1RULH 3G9AB 4AK1A 4LBEA 3WNLA 1R3IH 1EUTA 3T8XA 1WJ3A 1KX1A 2YBRB 4K71C 5ITFA 5LAXA 1FG2B 5H37G 2FSEA 3GUTB 1NUNB 4AG4H 2AERT 2B7DT 5GGSA 4YBQC 1LITA 4IDJH 4JY4A 1FYTB 3G5YA 3HFMH 4IRSD 4UT6H 4Y4HC 2XWJB 4KDWA 1ND0B 3ULUC 2GY7B 4ELMB 3GHEL 3B3IB 2C9AA 4GS7B 5C86A 1R24B 1P84K 3MLXL 5BOZG 1P5UA 1KYOK 4LP5A 4NZUH 4O9HH 3RZCB 5FA4B 5KS9F 2IEPA 3ULVC 4NPYA 1AI1H 4EI5C 5E6YA 5I17A 4Y0GA 4KK6C 4KI1A 1VSCA 3C6LD 4DOHE 4LCYA 2PO6C 3WFHA 2PKDA 4EOWH 1F45A 3QUMH 3ULSA 5EBGA 3FQRA 4Z5RA 4NKDB 1X44A 5A16B 4LLYB 4M1DH 3IGAA 2P45B 3CFCH 2YKLH 5EA0L 5ESVA 3MLWH 3E3QE 4XGZA 5JPNA 1QG3A 4RFEA 3VI3E 4P5MB 1JPFA 1CS6A 4J3WA 3VGDA 5K9JH 5KBNC 3KNBB 3BUYB 1LO3L 2RICA 2DI8A 1S5IH 3GDBA 3H2WA 3MREA 4N32A 2YPVL 3F7VA 3QUXA 5GS2D 4LHUG 1W0WB 1NGQH 3KPPB 3FRUA 5GZOD 3MRRA 1G7LA 4X7SH 1HINL 1CG9A 1DLFL 4PGBB 5DJCA 3I6GA 4OLEA 1NCBH 4ODWB 4LPXA 4XH2A 3RGVD 2DLFL 1AIFA 3N85L 3UROR 2VB5A 4XWOD 5C08E 3LEYL 2BJML 5I1AB 1FC2D 5M94B 4DVRL 1IMHC 3OKOB 1AHWA 1WEJL 4M43L 4ENED 1E4JA 4JFXB 4MWFA 2DBLL 4YBLC 1HHJB 1QKZL 2DQGH 4QHLA 2WBJB 2VSCA 2F54B 5DS8B 4KHXL 3WS3A 5IVXA 1DBAL 2GSIA 4GQ9L 1TVDA 4G8EA 3F7QA 4JCMA 2ITCB 3M07A 1G1YA 4MD5A 4FNLH 3BRGC 4DQOH 1RJCA 4GRWB 3U0PB 3VXTA 3B8SA 3PV6B 2P5WB 1H3UA 1A7RL 3CK0H 5CEZL 4RFOH 2O5XH 5IEHA 5BW7A 2Z9TA 4S10A 4U7SA 1B4JL 1MJ8H 3VXPA 2J88L 3O6LH 5E1AB 3W81A 1V7PA 4H8WC 4LVNB 4E5XA 4YNYA 1N2RB 4NNXA 3NIDE 4HKZB 3PWPE 1ZE3C 5I1IH 3UPCA 3U6RB 4Z9KB 3E0GA 4GJXA 2OTPA 5EBMB 3IFOA 1JP5A 3EHBC 5JXAH 5I6XC 4KKLD 1AD0B 4XMKL 5HGDA 5IMKA 2DN7A 1UKMB 4WEUD 1WK1A 3O6KL 4CVWA 3PWNA 5ACZB 2YEZA 5E4IA 4PY8J 4BUGA 2ESVA 5TE4L 4YDIH 4HK3N 3K2UL 4F9PC 1JK8B 1J34B 4GAFB 4Q9QH 1X2WB 1R3HA 1OLLA 4ERSL 1AY1H 3NZ8B 2HRLA 5KG9A 1NCTA 3QIUB 5GGTA 1QSEA 4FFVC 4JPVL 1D5MA 3HG1D 1NC2B 3H3PL 2CRMA 3BPOC 2QR0B 5DYOB 5ANMB 1FAKT 1MFDL 2V7HA 4ZTPH 9CGTA 4F8QA 3O4LE 1DBBH 4UV4L 2P5EE 3KR3H 4P2QA 5INDA 5DJDB 3GMOB 3RGVA 1RHHA 3E6HA 3SDDA 5MI0B 2VXSL 3EO0B 4O51A 1PQZB 1E28B 1NDMB 4NC2B 1SEBA 5MERB 5TE6H 3GSQA 5GS1A 2YXMA 1YDPA 4F9LC 4NSKB 1FV1A 3TO4A 3ZMRA 4IRJD 4YE4H 3BZ4A 2BX5A 1S9WA 3G6JF 1D7FA 2QEJA 2Y1VA 3G5ZB 3TGXA 4OZIB 1AFVL 3KLAB 3QO0A 4UDUA 5C0CE 4PRIE 3OKKB 3V6OE 2MQGA 1DBKL 5ERWB 4U1GC 4UT9H 5C0AA 2P24B 5GISH 3WWKC 1UH4A 1IKFH 1KXVC 1JHKL 5L8LB 1D5ZA 4XAKE 4P46D 1DEDA 1J0YA 5BRZE 4JJ5B 4RAUB 2JTDA 3LZFH 4O2FA 4NO3B 4QNPE 1Y6NR 5LGJA 2AEPL 3GSXB 4MS8D 4KQ4L 5D6DC 1D6EB 2DOCA 4RFNC 5B4MC 3NTCH 3A6CL 5IQ9A 1JGVL 3VCLA 2XNAB 3RZWA 4EDXB 1AXSB 3GJFB 2N1KA 4R4NC 1FNAA 4M4PA 2XXCB 4PJGB 2F74A 5EU5A 4OUUA 4R6UA 3ZE2E 2D7QA 4P23B 4XVTL 4QYOB 4X5WB 1I3VA 3HG1A 4G7YH 5ICYB 5FFRA 4ETQA 1A3LH 1C5CL 3O9WB 4L8BB 4F37K 1RDO1 1LGVA 4I77L 3BPNC 1CXEA 2W0PA 3QEQA 2AEQH 1RFDH 2MPAL 1FM5A 5LBSH 1FQ9C 5FYKH 2NW3B 2PTVA 3QCUL 2Y6SD 4YHPA 4BFGA 1MFAL 2FJFA 4XCCH 4NO5A 5LGKE 2P8MA 4L4TD 1HDMA 1FIGL 4LSVL 1NCCH 4RGND 1T7VA 4IRJA 4PLJC 3T3PE 1PKQE 4BFIA 4NN7B 4NKMA 4OQTL 4PY8I 4TVPE 3CFEA 3O8XB 1WT9A 4OJFH 5DO2D 4J1UB 4JFFB 5HYJD 1KZB1 4WTWA 4HIXL 4TSCL 1KSRA 3ARBC 1JL8A 4M6OH 4LSUL 2HLFD 4NKQB 4ZFZB 1K6QH 2D0GA 5TF1L 4WEBL 2GAZA 5F96L 2ORJA 4IMKC 1KWUA 4XP6H 1KLUA 1SL6A 1T1WA 2NXZD 2FX9L 3UZVB 3UXFA 3R8BB 2IBZX 1JVKA 2YN5A 3P5IA 2KPNA 4HW6A 4KI5D 3SDAC 5FM4A 1T5XA 3EDEA 3D3VD 1K85A 3WHXB 2VXQH 4DJMA 1FVEA 1U0NC 5LWYH 1BFTA 1OGTB 2IANA 3TZVB 1KENH 1IZKA 2YZ8A 3N9GH 2EXYD 4OD3H 5TPWL 4O2EB 2X4SB 5EZOL 4PJEA 1VFUA 3FOLA 2OR7A 1AP2B 2BVEA 3UBUB 1WZMA 3VFVB 1FG2A 5D8JL 5KW9L 4HT1L 1XH3A 5DD1H 4MHHG 1WT5A 4IOPA 2GY5A 1OAXL 1LE9A 1XFPA 4PRPA 1A6UL 5D5ME 1Q9LB 5EN2A 2XWJA 1JWUA 3UPAA 3C60C 4ELMA 3HNTL 3RUGE 1BNLA 1U3YA 3BWAA 2YC1B 4WO4B 1WWWX 4IMLB 4WTXA 3RZCA 1IGYB 2DDQL 3KPRB 4JG0L 3QIWD 4Q6IA 2DQCL 4L4TA 1HKLH 5I8CA 1NEZB 1OAKH 3MRQA 1F00I 1NMAH 4LGSB 2A38A 3SEPA 4MA8L 1P84J 3B2UD 3MRMB 1KG0B 1A7PH 4NKDA 5A16A 4F2MB 1KYOJ 3QYCA 4JJHA 2R1XA 2NY4D 4GH7B 2LU3A 4RRPG 5CZKA 3R0MA 4OB5H 3QUKA 2J6EA 2IG2L 1U3JA 2PXYD 1CQKA 2EH8L 4KK8D 4M7LH 3CX5K 4OV6F 4UT7H 2EIZB 3AS2A 3G5VB 5I73C 1VDGA 4LVOB 4PJCE 5DWUH 4M6NL 5FKPA 4NM4H 4Q9RL 4NO0D 5EU4A 1A5FL 4NZTH 3B6SB 3GRWA 1AGDA 5I18H 3KNBA 1QO3B 3G04A 1MCIA 4R3SB 1RD6A 3MYJB 3UJIH 3GPRB 3CIQA 2JJTA 4HIHB 5IHUH 4JRYE 3I2CL 4RWYL 5E9DE 1MH5A 2J12B 1AQDB 4S1DD 1ONQB 1OTSC 3BH8A 3WIIL 1WC7A 4GG6B 3TA3C 1DUYB 4Z18A 2IFFH 3CLEL 4HS3B 5JOFB 2FO1A 1GH7A 2WLZA 2KKQA 3BXNB 32C2A 4YBHA 1CZ8L 2PW2A 3R4DA 1QTYT 5DVKA 3K74B 5JIHA 2A77H 1BD2D 1A6TA 3JXAA 5I8OL 4X6CB 1NCDH 5E95B 1O7VA 4U1NA 1FE8H 5DJ2A 1FVCB 4JKWA 3OR7A 2Y7QA 1JGEA 1ORQB 5BV7B 1HYSC 2ZUUA 1U58B 3DVNA 2GIYA 4JE4B 5CUSH 4JY5H 1MAJA 2ITCA 3UTQB 3V2AR 5D1QA 3BISA 2VDRH 4RIRB 4FQ2H 3VDCA 2I5YH 2NTFB 3MNVB 1DY2A 1XGTA 5D2NB 4GOSA 3PAKA 4JB9H 1S7WB