1F00I

Crystal structure of c-terminal 282-residue fragment of enteropathogenic e. coli intimin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
282
structure length
282
Chain Sequence
ASITEIKADKTTAVANGQDAITYTVKVMKGDKPVSNQEVTFTTTLGKLSNSTEKTDTNGYAKVTLTSTTPGKSLVSARVSDVAVDVKAPEVEFFTTLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords INTIMIN
publication title Crystal structure of enteropathogenic Escherichia coli intimin-receptor complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02369 Big_1 Bacterial Ig-like domain (group 1)
I PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f00I01
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1f00I02
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 1f00I03
3QWRD 3UTPE 5IFAL 5B1XA 4ELMF 1GGBL 4ZYKA 1X6LA 5C2BH 1OP3H 3FO2A 5IHLB 4ZETA 4KKAD 5H94B 1CGVA 4JPKL 4PRPE 4HWUA 4PRID 4JPIB 4RFOL 1N2RB 3OKKA 4R97B 4BUHA 1UEXB 5EZOL 5JQ6H 3BQUD 4V1DA 1MIMH 1H3VA 1EFXD 1TCRA 4JHAL 2W60B 5ADPH 4YQXL 1L9NA 4LCWD 4PR5A 5E2WL 1JF1A 2XY1A 4EZMG 5CJXA 5MI0C 4GKOA 4QHMA 1LE9B 2YRPA 3K0WA 4RCAA 4C59B 5A2KH 4YWGL 3MV9D 3WEXA 1D9KC 1RDL1 1A5FH 4GJTB 4KK6C 3UTSD 2VAJA 5IIEB 4XAWH 1SM3L 4Y7MA 1LMKA 3C5ZA 2PR4H 5KJRH 4N8VA 4PRAA 1U41A 5DLML 1YN7A 5BV7B 1OP5H 4KHTH 3EDJA 4P2QD 4XMPL 3TT3L 1KPRB 1AC0A 4HFUH 4I4WA 5D7IF 5IMKB 2GY7B 4F8TA 5IGXH 4J6RL 3KYNB 4X6DE 2D7TH 3MGOB 4JGMA 3RDTA 1U0OB 4CN4A 3DXAB 2AKRA 5EULV 2A6JA 2WWKO 3VMNA 4CU6A 3TZVA 4ZMAT 5GIRB 1TJGH 5DJDA 5ESQA 4ZUVA 5D1QB 4G9FE 4KZEL 5I75C 3IVKB 4RFNB 5JXED 4Z7NF 2X1QA 1NC2A 3LKRA 2F5AH 2NTFB 1EO5A 4Q6IB 2SEBA 4XVTL 3V7AE 3PJSA 3S98A 4XB7A 5F97E 2LABA 1YYML 5CZVH 5FB8A 2AV1A 1ZT7A 4ZFOB 2Y23A 3QUXA 1J34A 4NZDA 3UJTH 1AIFB 3KNBA 2P8LB 4EBQL 2C1PB 2EYTB 3HMXA 5HY9B 4PG2A 5J9PB 2EC9U 4PRHE 4TQEH 1H8SA 3RZCC 5GZOC 4KMQA 5ENWB 3U2SA 1H9VA 5I19L 2H1PL 4DKAA 1KELL 4ALAH 2OR9H 3E8UH 3U0TA 1EMTL 3HC0A 5FDWB 4GQPH 4ONHA 5C0DA 4MCZB 4XBGB 2E7HA 1FL3A 3O2WH 3VWJB 2E3VA 3MRMA 2Q6WB 2AQ2A 3U79A 3FOMA 4XPTH 3VXMB 3VXUE 2Z93A 4O5LH 4JY5H 4NRZA 4DW2L 4KDWA 3ZE2F 2BRSA 3ORJA 4OJFL 4F9PC 3NOIA 2N7AA 3KPMB 3QDJA 2XOTA 5IKCA 2N1KA 3TIEB 3BI9X 4MJIA 1UXSA 4NKIL 4PJ8B 4KZVA 5B8CC 3WNKA 3OZ9L 5KG9B 3SPVA 1DVFA 2M94A 1HI6B 3G5XA 5CZXD 5IB5B 4OFDA 4B0MM 1AH1A 4PJIB 3QJHA 3R0MA 3D6GA 4OM0L 3VD5A 3LSOA 1WMYA 3P4MA 1T5WA 1EHLL 5ETUB 1RHHB 5FK9A 3V4VL 4U1MA 3EOTL 5F6HJ 5AUMB 5C0BE 4AEHH 1EXUA 4C4KO 1BOYA 4I2XA 5CWSB 2Z8WC 4AT6B 4MWFA 1S5IL 1CDYA 2GTWA 3C08L 4PJXE 2BXYA 5DZNA 1J0HA 1UZ8A 2WLYA 1UWGL 3MRRB 1X4ZA 3F7YA 5ALCH 2XN9E 4PRBA 5DD3H 1CXEA 3EIFA 5E99L 3MRDB 4UUJA 5BO1L 5J11C 4PJ7B 4DGIH 5L0QC 3P30H 3O6KL 3ULVD 3D39B 5FKAA 3W11C 3VE0A 4H0HB 2DMCA 1RULH 1JZ6A 1QSFB 1X2WA 3O9WD 1YEJL 4U2YA 1MVFA 3QFJB 1QSEE 4TVPD 3BGMA 3UYOD 1KG0C 5CHNB 3CFKB 4G7VL 3HFML 3GMOA 4ISVA 2FGWL 3CMOH 1HSBB 1S7XB 1J5OH 4XMKH 3FT4A 3LKQA 2E8YA 3ME0A 1RSFA 2VZUA 1BJ1H 5F1NB 4YNYB 2ZUQB 4Z5RA 4G9DB 3T65B 1YJDH 1JWUA 1RUML 2BX5A 2UVEA 4KMTL 1HWHB 4RBPK 3SE9L 5HYEA 3C6LD 2NX5B 5I17B 1B6DA 2ICWJ 4H25A 3PWUB 2CDFA 3BUYB 3TH3T 3NFSH 2R2EB 4WW1B 3MV8E 1UMRC 5E2JA 2AV7A 5T5NF 3LMJL 5I1AA 1UB6B 2ZPKH 2F8OA 4HLJA 5EFIB 1PSKH 1HXYA 3U7YL 3U0WH 3BH9B 4E5XB 3BW9A 3P7HA 1AE6L 1BFOB 2R2HA 1YEDB 2G9HA 4L4VD 3F7RA 4JZNB 3RWIB 3O0RL 1UCBH 1UQSB 4RISH 2A77H 4YHOL 4U1HB 1RDN1 4JRYB 1MCPL 3UAJD 4Y16C 1I1AD 2CGRH 3O2VL 3QXAA 2GGUA 3C5SB 5E1AB 2VXSL 1VFBB 4V1DE 2XTJD 4JG1H 1IC4L 5LXGH 1T6WA 4EXKA 5E8NA 2NCMA 1S3KH 4FQXD 2JCCA 4HQQL 1BBDH 1X6NA 1DQJA 2ZUWA 1SEQH 1DQDH 4NP4H 4QYOB 5KVGL 4KRPD 4X8XA 2VLJD 2PNDA 1PZ5A 2G60H 3IGAB 4EI5D 4Q9QL 3DBXB 4FFYH 4MDIB 1OAUH 3BKMH 5HGGS 4YGVB 4G6KL 3JWDH 2X4TB 2BHYA 4K23H 5D93C 1KB5A 3SKJL 5EU6A 4P59L 3D2UA 2EIEA 3GMMA 3V0AC 4Q9QH 3EYOB 5MI0B 3MXWH 1IM3A 3B9KA 2GJZB 3LN5B 3PHSA 1BZ9A 4Y19A 1D9KB 2FEDC 1A1MB 4LVHC 1FQ9C 1ACZA 3I02A 2HP4A 3CFEB 5LWYH 1OY3B 1YNTA 5JOEA 1XF3A 1BCJ1 2UZIH 1RZ8B 3TFKC 1HQRA 1E0OB 1LVEA 2EIBA 3ARGD 1Z5LB 3HC3H 5DTFA 4ODSH 3GKWL 4HGWA 1OARH 3WFHB 3OX8A 4R3SA 2R1YB 5DHVB 1OLZA 3KQGA 3PDOA 1WBXB 3H7BB 2YC1A 4JN1L 4OB5L 1J1XH 5C0AA 3S5LA 1YEGH 1XF2A 1GPOH 1F4AA 1EPFA 1L7TH 4XCFL 5E2UL 4UV7H 2ORBH 2MKLC 4GKSA 4JFYA 3ARDC 3DI2B 4OQTL 3B5TA 3LIZL 3VFVA 1KUMA 2A6KB 4OFYA 5D7SL 5FCUL 4LLQB 5E08L 3QDJE 3QQ4B 4A2LA 4PPTA 5I1LB 5T1LD 2BSSB 3QIWD 4LP5A 3RZCB 4MJIE 4U7MA 1E5UI 5C07D 1YMMB 4JFEA 5FGCB 1JYXA 5F1IB 3CH8A 3FZUD 1YN6B 4QRPB 5F7KC 4AIZA 1BHGA 3TH4T 3N1FC 4CUCA 2MKWA 4R9HA 3HZKA 3RVTC 1TZGL 1HCFX 2YD3A 2ADJB 1U8NA 3BP5A 3ARRA 1QLFA 2IPUG 1A9BB 4OKVB 4OUOA 3MJ7B 1FYTA 1U2HA 4EI6A 1LO5A 2X4RA 2Q86B 2EDKA 1CBVH 1SQ2N 4GMSL 4O4YH 4I2XE 3CFCH 1BEYH 3EYUL 1S7UB 5F7FA 1OP9A 4HWBH 5DC9B 5HVHB 3MRGB 5GHWH 3BRGC 1DFBH 1RJHA 3LVEA 3V79C 3RNQB 2XQBL 4MA3A 2HMID 3PWPD 3S36H 5EO0A 1B4RA 3PWVB 5FF6A 1MPUA 3AM8A 1X9QA 1U3ZA 4UT6L 4W4OA 1FNHA 3TBTA 3N0PB 3ARZA 2XV6B 4OGYL 3MZTA 1KPUB 1VACA 1S7QA 5E9DA 4WWKD 3CLEL 3WHE0 5TGBB 4D3CH 3JWOH 4MJ5A 5E70A 3SKMA 4JFXB 4MZ2A 4NT6B 2FR4A 2AXHA 1WWWX 5HI5D 2YPVL 1DE4A 1FE8H 2ZOKB 4V2CB 4XX1G 2OP4L 1JN6B 3LRSB 2F58L 4LLWA 3MNVB 1I7ZB 2OM5A 3R0NA 3SE8L 1CXKA 3E0GA 4JHZA 3O6FC 3RWCA 4J3XA 2GFBA 4GUPA 4NHCH 1C3AA 3ZL4H 4PJHB 4BQ6A 3ZTNL 1KG0B 5EC2B 3DMMA 3V4UL 4KFZC 1A7NH 1NMCB 3BE1L 3GNML 4D9QE 3CDYA 5F72S 2HT2C 2FX7L 1JHTB 3JXAA 1WIPA 4Z0XB 2J5LB 4QTHB 3ZT5A 4MS8D 3TNMA 3MUGB 3ARPA 1ES0B 3V4PL 1BQLH 1HXMA 4L3CB 5B38B 2EICA 3CIQA 4DEPB 1DUYB 5D7LA 1ND0A 5I8EB 2AK4A 2IANA 1NGZA 1GYAA 3HNTH 1X2TA 3LS5L 4OUUA 3INUL 3A6BH 3IDJA 4HAFA 4JFOB 1OT1A 3D9AH 1A02N 2JCCE 2NY1C 5A3IC 2NYYC 1WFUA 2C3HA 1A2YA 5SWZB 2ESVD 4ETQA 1D7FA 4U3HA 4LAQH 1B2WH 1AD9A 5IFHH 3W0WD 2DLTA 5C0CA 2PO6A 1MCCA 2Z92A 4U1KB 5CCKL 4Y16B 1RUKL 1MHEB 3D0LB 3QUZD 2C1OA 3T4AB 3S9DB 4C56E 1WEJH 5GGSB 3MODL 1ZHNB 1T7VA 3EYVB 5EZIH 3PNWB 5CIPB 2VB5A 5EU6E 3IDGA 1CE1H 1S5HB 1JHKH 4R4FH 2DMKA 3S96B 5IEHB 5DJCA 4P3DB 5I1EH 3MODH 1ZANL 5DD0L 2YOCA 1NCTA 1E6JL 4FQCH 5I30H 1WK0A 3FO9A 2X2YA 4QRRD 1AI1H 3BJLA 4P2YA 4WO4C 4YDJA 3NIGE 2AEPL 1J0JA 1MRDH 4PJGF 4IMKA 5ELIA 2X4UA 1GGCL 1JWSB 3W9EA 5D93B 4NFCA 3RWGA 2WANA 4QHKI 3V8CA 4JHBA 2CIKB 3R1GL 4NNXA 4BSVA 1HYRA 1JE6A 3V0VA 5BZWB 2I83A 3SOBL 1L6XA 1NSNL 2ZSVA 3I50L 2VH5H 3MC0A 4LVHB 2EDJA 3ARWA 5CS7A 3T0ED 4YIQA 5C0AE 2ZIBA 1V5JA 5HHMD 3PARA 1ZHKA 4GQ9H 3VFTB 4MD0A 3UYPA 1IEBB 5EZJB 5D6DA 5F9OL 3LCYA 4WFEE 1P4LB 3VRJB 2BVYA 4G3YL 2I9LB 4KAQL 3JWNC 2NXZD 3QEUA 4UBDD 2N7BA 3MLRH 1T22B 4MNHB 2VDOH 1F11A 4HIHB 1N8ZB 1UWEL 3QCUL 4JFEE 4L29B 5DF0A 4MSWB 4LSVH 2GKIA 3BYYA 3EFFB 2DTML 3UROR 2XQYK 1XZ0B 5C0RH 4Y89A 1EAPA 3ARDB 3P11L 4OF3A 1H3PL 3GPRD 1E28B 1UB5A 2JTDA 1F90H 1HOCB 1AGCB 1OCWH 4I48A 4U31A 3TH2T 4E41D 1FL5B 4P99A 7FABH 5J6GG 4KRLB 2W92A 1ZS8B 5AAMA 1BM3L 3FO0L 3N9GH 1WICA 3VH8B 4H1LB 3GI9L 2EZ0D 1A6WL 3MGTB 4PS4H 3KLSA 2MCPH 1FYTE 1UM5H 1NKRA 3IT8D 2C26A 4YXLH 1UCTA 1XH3A 3P5DA 4LCYB 3GSXA 3MRKB 1T1ZB 4GW5B 3W5NA 3IU3A 4RNRA 4H8WC 2OBGA 1QBLH 4GAJH 3ARSA 1ZVSA 3HG1A 4XWOD 3DYOA 4PJ5E 3S4SB 1F8TH 4KRNA 1YC7A 4TTDD 3EYQD 1E6OL 4WI6A 2XICA 4BJLA 1A4KA 4KROD 2ADFL 2BOCB 1PD6A 1FDLH 3FF8C 1SJXA 1MFCH 3QIBD 4GW1B 3NTCH 1SL6A 4OLWH 1IGFH 5SWQA 3X13A 2OL3L 3IKCB 5J1TC 5DHXB 2AXFA 2BNQB 4M5YH 5E9DE 35C8L 1FGVH 1YNLL 5EO1A 3KPSA 1HHHA 3CFIC 3MACL 3DV4A 4YR6A 1M6OB 1NAMB 5TE6H 3Q5YA 2X7LB 3B2VH 2X9YA 2WP3O 4G6FB 1G1CA 4YE4H 2ADGA 1XR9A 1FCGA 3WFBL 3SCMD 4R2GC 2D9CA 1MCIA 4X4ZA 3T4YB 1K4DA 3LKSB 1NGYB 3WHE1 3FQXA 2AJVH 4HWBA 4ODVH 5D71H 3LEYH 5L88L 1FZJB 5FGSA 3PL6A 3KPTA 1LEIB 3UTQB 4GI0A 5FA3A 1SJVA 1QA9A 2QR0A 1HINH 5KS9B 4OCLC 2Q7YB 3UJIL 4Y4FD 4X99A 4YHKL 1L6ZA 3NN8A 3BSZL 4ZXBA 4ZQKA 4PB0H 4JFFD 1NMBH 3UTZA 5D7LE 4N90E 1TTFA 2JIXB 2XWJA 1A1OA 4XPBH 2AK4E 2IANE 5JOFB 2FATH 4EQ3A 1Y17B 3MRIA 5AZEH 3HLAA 3SBWC 1EEZA 4L8SC 5JOPE 5EBLA 4F7EA 4V2BA 1GC1C 4HJJH 2H2RA 4MCYA 2D0HA 4LFHD 1CFNA 3IXAB 4G8GD 5C0CE 4K07A 4Y8DC 1U91A 1EO8L 4ODHH 5FXCH 4O2EA 3WS6A 1I7UB 1S9YA 1MFDH 1AGDB 1NGQH 5F96L 2Z91A 4GBXC 3KGRA 4N0FA 3VGDA 3OAUH 4M7ZB 4R4ND 4MAUH 3BVNA 4NQCD 3CSYB 3HAEH 1MAMH 4WI9A 4M18A 3IFLH 3MRQA 2MPAH 4XWGH 1F6LL 5IJVA 3GMPA 3QUML 1II4E 2X4QB 4ZO6A 1A7PH 3FHAA 5DJ0A 5JHDD 3NVQA 1IKFH 3L95B 3CSBA 4ONFH 1WJ3A 1XCTA 3B9VA 4ELMB 4AMKH 3EDEA 3BKCH 2OK0H 1DBKH 5LAXB 2Q3ZA 1G9NH 3G08B 4P2RE 5K9JH 4K3DH 1JWMB 1YECH 2R0WL 1C1EH 5BOZG 3KYOA 1W72B 2OXHA 3DUSA 4R96A 4X6FA 3MBEA 4YHPA 1TLGA 1MJ7L 4LSQL 3O3DA 4MX7B 5F6IC 4OCSH 4OT1H 1JHLL 2P7TB 1BLNA 5CUSL 3KR3L 5T33L 3MX0A 4F57L 3EFDH 5FHBL 3FRUB 3MCLH 4RMTA 1UXWA 4HJGB 1NCWH 4OAWA 1U3HA 3CZFA 1IJ9A 2ZG3A 4L5FL 1N5YL 1KOEA 4D0DB 1SMOA 2CK0L 2X9WA 3QH3A 3QEGL 4JO1L 1OF2B 3KR3H 1PGRB 1R5IB 2VUYA 2AJXL 5EOTB 1G7LA 2N7SA 4NRXB 2GITB 2HFGL 5A2FA 1LEGB 4U1SA 1AR1C 5F88B 5HHQA 5C6PB 5I76A 4PP1C 1S7VB 2DKSA 1JZ7A 3MJ6A 4MQ7A 4N1CA 4OF5A 5J57B 4R0LA 2E7BA 5KN5A 3KPQA 2VZOA 4TSCL 3MLTA 2NY7H 3FB6B 1UVQB 5JDSB 1QFUH 4OTXH 1FIFA 4LU5L 4M6NH 3T0VA 1XEDA 1TDQA 4KJQD 5ERWA 3WH2A 3ELAT 5C2UB 5CJXC 1MWAL 4M6OH 5MERA 3IETB 3ULVL 3ZDZE 5F7MC 3HNVH 1FFOA 2EH7H 2NXYC 4R7DA 1WBYA 2D31A 2VXQH 2B2XL 3VXTB 3L3DA 5AWNH 4XCYB 3DXAD 5D70H 4TVPL 3C5ZC 5J4MA 4H88L 1E4KC 2H26B 2RFXB 4Z7UA 1T7ZA 2ZJSH 3VCLA 5D1QD 1N4XL 3HG1E 2JLLA 1JYWA 1KTLB 1S7TB 5EUOA 5DQ9A 3BDYL 5JPMA 2H32H 1P6FA 2UVFA 4CADB 1J7VR 1TVBA 5HYSB 1KCRH 3WUWB 1JZ3A 1EK3A 2VDML 1W0WB 4TULH 4P5KB 5MP6L 2ZP0T 5IM7A 3KPSE 5EDXA 1T21A 2GAZA 4FS0A 1YTTA 1JNLH 5DRNB 1I85A 1T66D 1MFEH 5DHYB 3MRCB 5DEGA 5DWUH 2IPUK 5EPMA 1A7OL 3VWJD 1Q9KA 4NYLB 4WI2A 3QUXC 5JHLH 3WFCL 1KULA 5GS0C 2VISB 3OR7B 3VXMD 1XIWA 2NZ9D 3RGVC 3C8JA 1DDHB 1ZHLB 4X6EB 3VA6A 4MXQC 4HBQA 1K9IA 2EDNA 3VXSB 3ZLQC 1OM3L 2Z31D 4G9FB 2Y36H 3ZE1E 1NBZB 4MNGA 4GAFB 1ORQA 1TZHB 2WINA 4PJ8D 1MHPL 5ESVB 4HHAA 4ZUSA 3E6HA 1KCSL 1KIUA 4B7LA 5C0GB 2Q8BL 3VFOA 2XNAB 2MHAB 3GSNB 4IRSA 5KOMC 2H2SD 5ANMA 3GHBL 4HDIA 3WE6A 3JTSA 3QG7L 1AFA1 4R2GB 4S1DD 1OSPL 2WZPD 1Q9LB 2ARJB 4PRHB 4HLZG 5K8YA 2B1HH 3ZMRA 1E87A 1HQ8A 1J87A 4RMWA 2YRLA 2F74A 5BQ7A 4HS8H 5K9KA 1DVFC 1INQB 3AXLB 3DTXB 3RIFF 4Y5VA 2R1XA 4MDJB 3VXUB 4H20H 2AI0H 4K7FB 1N0LA 2VIRA 2YPLE 3FT3A 4J8RB 2VKWA 2VABB 4EVNB 3SDAA 3SJVA 1H3WM 4XPGH 1EVTC 1OD7A 3QULB 3D39D 1HCVA 1S7WA 2XZCH 4NUJA 4OLUH 3OB8A 4TSAH 1D5ZA 1QSFD 2OZ4H 1J1OH 3HRPA 5HHVH 1FJ1B 3IS0X 4GRMA 4YBQD 3EJZD 1QP1A 3PP4L 4PREB 4QHLB 3KHOA 1UWXH 3K74B 4PB9H 4UDUB 1T2QL 5DDHA 3TV3L 4XVUC 1UV0A 3Q5TA 2I9TB 1VADA 2C3WA 2OX5A 1ZSDA 3KPOB 3BMWA 4IOFD 2GEEA 1AXIB 2CLVA 5C0BB 3LQAH 2J88H 1T2QH 4GBXB 3VMPA 4YPGA 1LITA 3D87B 5IEKA 3MRFA 4MD5A 1RIHL 4UDTA 4GW4A 3BX7C 3HUPA 1OPGL 4LGPB 5I8CB 2J8UF 3QG6A 4OD2B 2EYSA 3OJMB 3SE3A 1WZ1H 3LV3B 4U1JA 1G7MA 4QT5A 4UWWA 2VLME 3O6LH 1DBMH 5HPMA 1LO4H 3GB7A 1A6AA 2UZXB 1CD1A 4JRYD 3ILPA 3HAEA 4XGZA 1QSEB 1BJ3B 2N40A 3OKDA 4NM8H 5KOVC 3FN0L 3W9DB 5JIKA 3MNZB 3O45B 3K2UH 3QEQD 4LMQI 5IHBA 3IJSB 2V7HA 3WNOA 1QNZH 3OB0H 4N0YL 3IRPX 2H41A 3WNPA 2X1PA 3QFDB 2VERN 5IWLC 5IB1A 3TO2B 3TWCL 3NH7H 3DVFA 1D5XB 4PV8A 1OSZB 1UM4L 1I3UA 4NNPL 1KTDB 2CLZB 1A14H 5T1KB 3MV8B 1JV5A 3GJFK 5FECA 4U6TA 2NLJA 2BCKB 1BV4A 1I1YB 3L1OL 5BRZD 3I9GH 3O11B 4L8BA 3MRHB 3UBUB 3GSQA 4YHYB 4U6XB 1UGNA 3LHPL 3IDXH 4AL8H 4ZYKB 4YFEA 1QYGL 3FO2B 1IAMA 1AJ7L 3I85A 1KTRL 2VXTH 4XAKD 3UXFA 1Q9OA 1QTYT 1RZ7L 5LBSH 1D9KD 3OKKB 4XP4L 4Z7UE 4V1DB 1MUJA 3ZYIA 1ZLWH 1JFQH 1TCRB 1HZHL 3U7WH 3LY6A 3UO1H 5EUOE 5IESL 1F2QA 1JF1B 1AC6A 2A1WL 3RX5A 2E6QA 4QHMB 1OTSC 2NXYB 1NH6A 3ZYZA 4JCMA 3PDDA 5HVWA 4UTBH 3WEXB 1K85A 4QXTA 4PJEF 5FYKH 1N59A 3C5ZB 4G8FA 4ONGL 5IQ7H 1R3HB 2V2XA 5ADOL 4N8VB 4NBZB 1WV7T 1YN7B 2CR6A 4UZGA 2R8SH 5C3LD 4MB5A 4I4WB 3AS3A 4JQXC 3VYKA 1VEOA 5L8LB 4M7JH 1QLRA 4P23A 3RDTB 4Y2DC 1F45A 3RTQC 4F7PA 3QXVA 4P9HH 2A6JB 1MRCH 5ESQB 5DJDB 3BP4A 4I3RH 4ZUVB 1AP2A 4OFIA 3RZCD 4YK4B 5GZOD 2B20A 4MNGE 1EZVX 2RHEA 3QNXA 1NC2B 3RY6A 5DQJA 2W0KA 4ONOA 3T0DA 2K7QA 1YMMD 2R0KH 2SEBB 1RUPH 3PJSB 2H32A 5FB8B 2AV1B 1ZT7B 1HHJA 3QUXB 1J34B 2VWEE 3U46A 4U4BA 2D03H 3OKLA 3KNBB 2GCYA 2DQJH 3C6SA 4LASL 3BMVA 4KQ4L 1J18A 1TJHL 5I1CL 1FVDA 1PLGL 3IJHA 4JM2F 1Y0LA 4PJAF 3RWDA 4LIQH 5CILL 1DN0A 3FCTA 3S3SA 3U2SB 4J3UA 5IV2A 3N85H 1HEZB 3WHXA 3U0TB 1IE5A 5B1RA 3HC0B 2HWZH 4ONHB 5C0DB 5E6IC 5L7XH 1ESLA 1FL3B 1NL0L 1P7KA 4UILL 1PLGH 3MRMB 1FIGH 1MFAH 4YDLC 3TJEH 3FOMB 4BSWA 4BFIA 2EIDA 4HBCL 4NRZB 5LVEA 3DNKA 1MUQA 1AFD1 3RVVC 3LPFA 3QDJB 3MJGX 1CICA 4APQA 1SY6H 5IKCB 3SJVE 3ZDXF 4EN3A 4MJIB 1DQML 4ZFGL 5E24E 2EEBA 1EHNA 1IILE 1UXSB 1I1RA 4IJ3C 5TFSL 2QJDA 4HC1L 1CD8A 1DVFB 1RJLB 3G5XB 3VFPA 3V5HA 3QJHB 3G6AA 2KV3A 1I9EA 4FQ2H 3O3UN 1KB9K 3LSOB 1TCMA 1T5WB 5EOQL 2MSBA 1R3LA 2X40A 1YUHA 3I3EA 4GMTH 5FK9B 4U1MB 5GSRA 1FPTL 1KYOK 1QFWM 4LSRL 4W4OC 1UT9A 2FDBP 3W11D 1RZKL 4FQJH 1DANU 1EXUB 2UUDH 3CPLA 3X3FH 4HULB 4I2XB 4DVRL 2DBLH 4MWFB 4WR9A 1B3JA 5AYUL 3SDYH 2AJYL 4GXVH 4ODTH 2BHUA 1UZ8B 1YDPB 4NM4L 5CP7A 3F7YB 4PRBB 3OQ3B 4UUJB 2ZCKL 4DZ8A 3CX5K 3ZYOA 3B3IA 5DJYB 3BP7A 1P4BH 3LPWA 5FKAB 3VE0B 3H3PL 4OLVL 2OZ4A 5TQ2H 4LQFA 1X2WB 4JM4H 4LCIH 2QADC 3BGMB 1QSVA 5T3XD 4ISVB 3GMOB 2B1AL 4U05A 5FYJL 1FFRA 4G9AA 3ZT7A 5DSCA 3OKNA 2RQ8A 3LKQB 4KJWC 4Z5RB 2COQA 5SWZD 8FABA 4H25B 4JANA 4S1RL 5DS8A 2CPCA 2CDFB 1KENH 1JA3A 5DGQA 1G9ML 2Y06L 2AV7B 4Y16D 5I1AB 4GSDL 2BVTA 5MEQA 3UTOA 2EH8L 1HXYB 4J6LA 4OZGA 2Y07L 3BW9B 1R3KA 5T3ZH 5DMIH 2C5DC 1TPXC 4PTTA 2G9HB 1N3NA 3N06B 5E2TL 4LOUC 1KEGL 1CTNA 2PO6C 4LHUA 3GSOA 4OI7A 5F6HI 3QXAB 3OTTA 2BK8A 5DEFA 1F3JA 3CSGA 3S37L 4HUUB 5E8NB 1CK0L 2D7PA 2JCCB 2Y4SA 5I15H 4X5XA 4L3AA 5CJ5A 5DK0A 4CAJA 5HTSA 5FYLD 3PUCA 1JBJA 2Y5EA 1MNUL 3TNNA 2RIAA 1PZ5B 1HK6A 1BVKA 2DIAA 3VI4F 1LWRA 1T1WA 3EGSA 2FEDD 1BQUA 4IMKC 3QJFA 4IDJH 4TOYL 3B6SB 3EO1B 5EU6B 3D2UB 3V0WL 1IBGH 3GMMB 3TFKD 3G8LA 3MGAA 1HYRC 4P46A 3TP4A 1J05A 4JFHE 1OAYH 4XNQA 4MB4A 1Y6MR 2ZOLB 4XVSL 1H8NA 1IZKA 1I7TA 3B9KB 4DGVH 1ODAA 4Y19B 1P4LD 1XPHA 3VD9A 5C0FA 1YYLL 3I02B 4Y4KA 2ICWI 5DRZA 3RWJA 4I0CC 1XF3B 1W0VB 3SY0A 3FN9A 2W9DH 2R0ZH 3GMLA 4JRXA 4JDZA 4J3TA 2BPDA 1XFPA 2FNBA 2NTSP 1ZT4A 5DTFB 1VFMA 3ARDD 5FA4A 3OX8B 4R3SB 4K3GA 3PDOB 3GFUA 3X3GH 3LN9A 3CC5A 1TVDA 5CP3A 4I3SH 1MCSA 1MF2H 4JZJA 1KJMA 2VDLL 5C0AB 3S5LB 2V9QA 2AGJL 1XF2B 3ZHGD 2VLKA 4ODXA 4DGYL 1XR8A 4GKSB 4KHXH 4JFYB 4EKXA 4WCYH 12E8H 1RZJH 5KVDH 3VFVB 3D18A 3WJLA 3WXWH 5E2VH 2DLFH 4Z8FL 3RVTD 3PV6B 4DKEL 1TJIL 1JYVA 2ZZUT 1CLOL 3L5XH 4JFEB 1KGCD 4CJ0A 4ZS6C 2B7DT 3O2DH 4F7TB 4NWTL 1WT5C 4AIZB 1MQ8A 1U8LA 4K94L 5IMOB 4HV8A 1JNHB 2Y25A 4YDLB 1A9EA 1A0QH 2APXA 2DI7A 3LS4H 2QQNL 3LH2L 3HZKB 4LDOB 3QUYA 5DVKA 4Q6YA 3BP5B 5J3HC 2XZQL 4WUXA 1QLFB 1WBZA 3B9EA 1FO0H 1DQQA 1LDPH 4RAVA 3E6FA 1FYTB 3V6OA 1LO5B 1VHPA 1MY7A 2X4RB 1O7CT 2YA0A 4M8VA 1KTKE 1FH5L 4LFHG 1J86A 5I16A 4BFEA 3TGXA 5CSBA 1SY6A 4OBSA 1U95A 3TBWB 2JB5L 1N6UA 3AS2A 5TE4L 2RBLA 5EO0B 4K2UL 2R1WA 5FF6B 4WHCA 1GVIA 3TESA 1LDSA 1MI5A 1ZLVH 2MNUA 3TBTB 2OI9C 3FMGL 4MQTB 4BH7A 4RDQG 4XXCC 3TJHC 1MOEA 1ZAGA 5KAQG 2HKHL 1IGMH 5CFHA 2H3NA 1S7QB 5I1GH 4ZOCA 1I8KA 2JIXD 2MWCA 4PUBH 4WU7A 1JGLL 4MJ5B 3HZMA 4MAYC 3SKMB 5ICZA 2FR4B 4CMMA 2HT2D 1DE4B 3JBG7 1EFQA 3X11B 3KYKH 4D0CA 4LLWB 2P42B 2XRAL 4ZXBC 4AEIL 1CDIA 4JDTH 2E7CA 4ZS7H 3RWCB 2GFBB 3JWOC 4UT7H 1C3AB 2QADB 3QRGH 1D6EA 2AERT 1BCH1 1Z0NA 3GSUB 5LJYH 4WFHE 4S1SL 2B0SL 3DX6A 2KKQA 1CGXA 1WAAA 4A6YH 2NY1D 5A3ID 4ZFOL 2NYYD 4JGJA 1IGCL 1BZ7A 3TPUA 3TNMB 1RV6X 5K9QG 1HXMB 5ID0A 3MLVL 4MNQA 3CK0H 2PYEE 3VG0H 5D7LB 3WS6C 1YEKH 1ND0B 2AK4B 1X2TB 1NGZB 1NUNB 4GXUM 4OUUB 3WLWC 2QSVA 3IDJB 2HJFA 1IFHH 1X5XA 2IBZY 4OF8A 2ATPA 1UC6A 4ETQB 3WKML 4A2MA 5SX5K 3MBXL 3DV6A 1AD9B 2DOCA 2XI9A 5C0CB 3ESVF 2PO6B 4I0PC 2DD8H 2C1OB 4KDTA 3KJ4C 4HS6A 1I3VA 2R2BA 4WO4D 3CXDL 4Z7VA 1BVLA 3PABA 3IDGB 1PG7H 3EYFA 5I8KH 4C9FA 3VG9B 4HKBA 3U6RB 2DYPA 5DJCB 4KQ3H 2D3VA 2AJSH 3U9UA 2XZAL 1FSKC 3MBEC 3TBYA 1OWRM 5ACMA 1U8QA 2APWA 3FO9B 1OGTA 1QUNA 3RPKA 1LP9A 4YDJB 4J3WA 4WFFE 4PLJC 1OD9A 1I9RL 4NCDA 2BJMH 3SEPA 3MA9H 4LKXA 3MRBB 2HVKA 2X4UB 4OZGF 4G7YL 2O5YH 3W9EB 3RBSA 2P24A 3FQNA 5HBBA 1HE7A 3DSFH 3JVGA 4L9LC 1U3HC 3RWGB 4JRXE 3WBDA 4YC2C 1NFKA 4PTUA 4WDIA 3N50A 3MLYL 4BSVB 3GJEA 3V0VB 4FNLL 4RGOH 4YHNA 2ZSVB 5IBLC 2FHFA 3QEHA 1VDGA 3VFGL 3UTPD 2EDDA 1T5XA 4YIQB 4KZDH 1GZ2A 2NY6B 2X4OA 1H8UA 2ERJC 2PF5A 4QY8A 1RUAL 4QKJA 2AAVA 1EDQA 1ZHKB 4R0LC 3U4AA 1FNEA 4MD0B 4NZTL 4NZRH 4HWZB 4LAJH 3STLA 1MQKL 5I1HL 1KF9B 2YD4A 5C09A 3WDIA 2FJHA 4IS6A 1JI2A 3UBXI 3QEUB 4Z7WE 3FOLA 2CJUH 4JEGB 1F11B 1EHXA 2HKFL 3AS1A 5GQBA 2F8XC 2ZWKA 3DOSA 3IDNA 3QI9C 4W6WB 1ZT1A 2VC2L 1EAPB 2XA8H 2H45A 3ARYA 1UYWL 4JE4B 3AREA 2BFVL 4LIQE 5F7YC 1WFNA 5K9QI 1FGNH 5KSBE 3CDFA 5D7JA 4JR9H 3V6OE 2R4SL 5AAWA 5E8OB 1XH3B 1INEL 4KY1L 4M6AA 1GIGL 2KUTA 3N1QC 3QZWA 3TYFB 3GSXB 4AK8A 3IU3B 4RNRB 3NCFB 3VXSD 1G0YR 1UEYA 5D96C 1ZVSB 2RJMA 2AW2A 1I85C 3RKPA 4LEXH 2LU7A 3HG1B 5F89B 1CI5A 4PGEA 1EO7A 4NN7C 2IPTH 1QR1A 2CD0A 2VDPL 1A4KB 1XIWC 4BKLA 5IVOA 1MI5E 3P73A 3O2DA 3SDXE 4Z78A 4LLDA 3X13B 2PXYA 1P9MA 5HYQA 2AABH 4F80A 4R2GD 4ZG1A 5DJAB 2AXFB 4PRHD 5EO1B 1RJZA 1U8MA 1UH4A 1HHHB 2W07A 3EJJX 3KPSB 5E5MA 4F15B 5BZDB 3DHJA 5LKNA 1N6QH 1GGTA 3DV4B 4LL9A 3AAZB 5ESAA 1NBVH 1IT9L 2BVUA 3UBXA 1FO0A 4S0UA 2VWEC 2X70A 4BM7A 2ADGB 3CNKA 1XR9B 2FO1A 2FWOA 4JHWL 3T3ME 5KVEH 5L2KA 3VXUD 1DLFL 2OI9B 1Q1JL 1K4DB 3FQXB 2ITCA 3ZDYE 1D5BB 1A6TB 2GIYA 4KRMB 4M4RA 2DLIA 5ISZA 3BEVA 2HG5B 3PL6B 5FA3B 1SEBB 4MAYB 4AQOA 3VDCA 2QR0B 5DD5L 1FNSH 4Y5VC 4XMLH 1WAAE 3L3IA 1PZUB 1F42A 3IFNH 4X99B 1P53A 4HWEH 4LLVA 4FRWA 1PG7W 3NN8B 4ZXBB 4ZQKB 5LGKA 4WI7A 4DAGL 4MNQE 5CD5C 3UTZB 2BOBA 2XWJB 2VLRA 1A1OB 3U1SL 1LQSR 4PY7B 5E5RB 4MMZC 3TVMA 1HH9A 5C0BD 4QRSA 3L3HA 4QF1A 3MRIB 4LSDA 4EDXB 3HLAB 2F53A 1T2JA 4GBXD 1EEZB 2X09A 3EHBC 4UNVA 5ACZB 4ZTPH 5EBLB 4F7EB 1WFTA 3HC4H 5IT2H 4I77H 1J0ZA 4X7FC 5T1MA 2UUDK 4MCYB 1CFNB 1ZOXA 1U91B 2E27L 4O2EB 1S9YB 4HXAH 5CKAA 4Z7VE 1X5ZA 3NCXA 1HSAA 2Z91B 4N0FB 4PJDA 4A6YA 4BZ1L 1QSED 5DMKA 3BVNB 3T3MF 1N7ML 3MRQB 5EU4A 1E4XH 4Q74A 5IJVB 1WC7A 3GMPB 3ARXA 3L7FA 3ZDYF 3SE3C 5DJXA 3X12A 2I60L 1YMHA 2V2WA 2WNGA 1AFB1 5CSZB 4L8CA 2O5XL 3KJ4B 3PWNB 3SHSA 3ZZ1A 2JELH 2QLVB 2OX8A 4G6JH 2IPKA 1DBBH 5C0EA 5TQ0L 2YD9A 4MXWL 4QRQA 1LO0L 3NPSC 4YX2L 4HPYH 1O7VA 3RVUC 1F3RB 1WAAF 4IM8A 4P4KC 3MV8D 1DP0A 2DWEB 5GGTH 4GO6B 3FT2A 2OJEA 3KYOB 1ZLSL 4HS3A 5AZ2H 5EWIL 3DUSB 4X6FB 3MBEB 4YHPB 1G1QA 3B9AA 3WJJA 1T03L 1BIHA 4MXVE 1BLNB 1UOSA 5DT1L 2FBJH 4KUZH 1G9NC 1RQ5A 1IC1A 4NQEA 2CLRA 2VRPA 2YK1H 1AR1D 1UXWB 4IOPA 1ZEAL 2R29L 4OAWB 5ALBL 4U0RC 1U3HB 3CZFB 4UNUA 3QWOA 1HYSC 4PP1D 3H8NA 4YC2B 4NJAH 2AEQH 3NPZB 2CQVA 4KTDL 3QH3B 4O02H 4P3CL 2J4WL 4NUGH 2WBJA 5HHXH 2W1NA 5C09E 4KGLA 1G7LB 2DQGH 4HZAA 3BD3A 1DLHA 4U1SB 1S7RA 5T5FH 4Q9CA 3CH1A 3G6DH 5HHQB 2V5TA 2NXYD 1UM6L 2EDFA 4PLKC 5HGHA 3FTGA 3CJJA 5CGMA 2O93L 5IF0A 2IQ9H 4MQ7B 2NPLX 1SBSH 4R0LB 3TA3A 1Q0YH 3KPQB 1DL7H 3C5ZD 4IRJC 1CTOA 3MLTB 5FUZH 5KN5B 1CU4H 1T2XA 3AY4A 4AQ1A 1U8KA 1T04A 3FONA 2HLFC 2CKNA 1LP9F 5D2LF 2VXVH 4S1QH 4XNXL 1TDQB 4LVOC 5ERWB 1HHIB 3NA9H 2DQIL 5E0QA 4R7DB 1FFOB 1LEKA 1MCWW 1WBYB 2D31B 2VXUH 1IC5H 5JIIA 4IEFB 1B0RA 3L3DB 5TF1H 3U7AA 2Q20A 2CDGB 5ABDE 3L5IA 4Z7UB 4LLMA 4HIIB 5ITBL 3VCLB 3CADA 1IGIL 4CAGA 3ARBC 3RI5K 5D6CA 3HI5L 1NC2D 2VL5A 4MXVF 5EUOB 5HD8C 3F7QA 3ZHDA 5GRYA 5DQ9B 1L7IH 2A9MH 4P23C 5E94A 5JPMB 5DQDL 1TVBB 3QUXD 1RDO1 3SO5A 1BYFA 4G8IB 5CJBA 1P4IH 5GS0D 2X1XR 1WT9A 3RL2A 3RGVD 1I8IB 5IVNA 5DUML 2BPHA 2PYFA 4Y5YA 4MXQD 4OSUH 5IM7B 3RI5F 3VGGA 1T21B 5D96B 3RX8A 1KIRA 1WTGT 2ZKHH 5DEGB 5EPMB 1F6FB 2FLBT 4NN7B 5J89A 4QNPE 1Q9KB 3NIFE 4R90H 3ULUL 3BYTA 4X5WA 4ELKB 1XIWB 1C12A 5L2KE 1XF1A 4JG0H 5DR5H 1CL7L 2J8OA 5HYIA 1UA6H 3QDJD 2IF7A 4U2ZA 5ISZE 3HI6L 4XC1L 2FHCA 4JFZH 1ORQB 1RIUH 2HAZA 2X6MA 4OLXH 2WINB 5JR1L 2VDKH 4ZUSB 3E6HB 1B4JH 4M8QA 2Q1EA 3UJJL 1YY9C 3MZGB 1BWWA 1DVFD 1QLEL 2C3GA 5ANMB 2FD6L 3HZVA 4QXGH 5GGVY 5FYLL 1MHHA 5B38G 4HDIB 3WE6B 4JO2H 4WI4A 3JTSB 4XX1E 5LGKE 1RFDL 5CEZD 1CICC 4OCRH 4APQC 5DGRA 3GBNH 1U8OA 1OW0A 3FKUS 4DVBA 2HT3C 2VLRE 4HGMA 2BERA 1KWTA 1OL0A 4JFPA 4LRIA 2F74B 5BQ7B 1KJ2H 2DS4A 5K9KB 2F53E 5JORA 1QBML 1IQWH 4UQ2A 4Y5VB 3QXUA 2R1XB 5GRJH 2VIRB 3FT3B 3EKCA 4NO3A 3T2NH 4XVUD 3SDAB 3SJVB 6FABH 5JW5A 2I26N 3OKMA 1NCAH 1ONQA 5M94B 2R9HC 4OD3L 4X9GA 1S7WB 5KW9H 2DRUA 1MJ8H 4NUJB 4QNPF 5F7EL 1D5ZB 2JJSA 3NIFF 5IG7A 4PJDE 5IMLA 4UINL 4GRMB 5HPOA 4YHZH 5D5MA 2FJFA 1VEMA 1ZLVK 1C5BH 4DQOL 2IALA 1YEFL 1SJEA 1NDMA 5DDHB 3CFJA 1MRFH 3STBA 4UT9L 1K4CA 1VADB 2HTLC 1BJ1J 3I75B 1ZSDB 4IBLT 4QXUH 2UWEA 3NZHH 1NBYA 2CLVB 3K3QA 3NMEA 5CJQH 3QWRA 5DMJB 3DROA 4HCRH 4HH8A 4YPGB 5FUCE 1FNLA 3CCHA 1UKSA 2ICEA 4G6MH 5IEKB 1U3YA 3MRFB 4KKNA 4MD5B 1SL4A 4DWHA 4UDTB 4GW4B 4XPFL 1DSFH 1U9KA 3HUJA 5K59E 3H42H 3QG6B 2P5WE 5JA8B 1I3RA 2EYSB 4XT1C 1T89A 1NMAH 3BQUA 4D9QD 5EN2A 4JKMA 1G7MB 4QT5B 3LQAC 1ZHBA 4LHQB 3BGFB 5C6WH 4NQEE 4LCWA 5HPMB 4LKCA 3GB7B 1FVCA 1A6AB 1CD1B 1ZXQA 4PYHA 3NPSB 3ILPB 3HAEB 4XGZB 3OKDB 1B0WA 1SYSA 3DSNA 1NGPH 4WHTA 4P4KB 3MV9A 2IADA 5IOPA 1OAQH 1KN2H 3BISA 1WISA 2V7HB 1NAML 3RP1A 3ESUF 2F8VA 3V6ZA 1HHGA 1FZOA 3IU4L 4C16A 3DHMA 5IB1B 2YA2A 1A3RL 4X6CA 3KAAA 5B39A 3DRQA 3OKYA 4PV8B 1GAFH 4PJDF 4EOWH 5J6HA 2E3XC 5KSAA 2YD2A 5GGTA 1JV5B 4JZOA 2NLJB 1SMAA 3VH8G 3L3OA 4L8BB 1LO3H 3MNWA 4H1LG 3UPAA 3PAQA 3GSQB 5EU6D 3F62A 4YMDA 3D2UD 1CGSH 3LN4A 2AK1H 2PN5A 5DUBA 1P69B 3VYJA 1QRND 1WUNT 3IF1A 1OTSD 4JQIL 4J4PC 1J0YA 1Q9OB 4H26A 4Y19D 4NN6C 2OXGA 1MUJB 4JVWA 5D8JL 4K9EH 4U1NA 2QSCH 5DFVC 4P46C 4BZ2L 1NLBH 1XGYL 1AXTL 1RU9H 4M62H 4YDVA 1KIQB 4Y2DD 5FIEA 3RTQD 4ZNCD 2NR6C 1V7MH 4QXTB 4KVCH 4M93C 1JGUH 1N59B 4G8FB 5C86A 2AQ3A 3DGCR 4DTGL 2V2XB 3C60A 3MJ9L 2D2OA 2IGFL 4NKMA 5IP4A 3FFCD 1WLHA 4PGDA 1PY9A 3DETC 3MLZH 4OM1H 2BC4B 4X7TA 4YZFE 1M7DB 1M05A 2OYPA 3LKNA 2GHWB 1BGXL 4QHKJ 4OZIF 1MPAH 3V2AR 3NCCB 5DK2A 1QLRB 4P23B 3P77A 3JUZA 4F7PB 4UV4L 3RAJL 4OFYD 1TN3A 5E8PB 3DO3A 2IMMA 1I1CA 4YHIA 1EJOH 3UTTB 5GS1A 3BP4B 4Y1AD 1AP2B 4JZJC 3DARA 5D2NA 5HSFA 4MJ6A 3QNXB 1VGKA 5DQJB 3EO0A 1NCNA 4XP9L 5I1DA 3LEXA 3REWA 3IKKA 2H32B 1O7SA 4YUEL 2R0LH 5E6ID 4ZUUA 3TLRA 2X05A 3EYSH 1HHJB 4P9HC 3U46B 1N0XL 5EOCJ 4MA7H 5E8DH 2GCYB 3OKLB 3WJLC 1W72L 3C6SB 4FQIH 3I6KA 1FVDB 2AVGA 3IJHB 1U36A 1Y0LB 3RWDB 2CXKA 3KLDA 4JGUA 3FCTB 3RVVD 2JK5A 2CKBH 3PGFL 5IV2B 1X4XA 3WHXB 5HDLA 1JNNL 4BQCA 1FYTD 1I9JH 1WK1A 5F2QA 3QNYA 1P7KB 2F19L 2VRAA 1VKXA 2K3TA 1Q72H 1CDJA 2F54E 2E6JA 1R3IH 1JGDA 3I6LD 4N1EA 3O41A 4BSWB 1RVFL 4BFIB 2ZUSA 1XGRA 3QUYC 1JZ5A 5EUKA 4R26H 4OD1L 1CICB 4APQB 4LSTL 2DLGA 4J3OC 2YPKA 4OI9A 1FFPA 2E6PA 3V6OC 5C6TH 3CVIH 1GHFH 2EYRB 1EX0A 4FQQA 1KC5H 5D5ME 3VFPB 3V5HB 5D7KD 3L9RA 1IM9B 3VFNA 1IXXA 4OGXH 1NGXA 4QOKB 1R3LB 4LARH 3CDGA 2UWEE 3NCYS 4OF6A 3RS1A 2KDGA 5GSRB 4XCCL 3CCKA 4OFVA 4CNIA 4RIRA 1KJ2A 4JPVL 4GAGH 5EORH 3MRLA 4U1IA 4GLRH 2A73A 4L4VA 1UKQA 1ED3A 1J35A 2QADD 3VLGA 5CP7B 2W38A 1R0AH 4WEUD 3HUJE 1VGEH 1F4WH 2R23B 1I1AA 2QQKL 2M8XA 4M61B 4DZ8B 4YXKH 3B3IB 2H8PB 4HD9A 1YEIL 3BP7B 4LCUA 3WFEL 1AO7A 1T83A 3W5MA 4LCWE 4FQXA 3VXOA 3WMSA 1VFAA 5JIHA 4NZUH 3OR6A 1WSST 4RAHA 1CZ8L 1P7HL 3UYRL 4BELD 4F2MA 3BKYH 1YY8B 4P5MA 5D7LD 4F9LC 1CFTA 3MV9E 5KSUA 4H8WL 2AK4D 2VLJA 4EI5A 3UTSE 1U58A 1TFHA 3OKNB 2A6DA 4QRTA 3AU1A 2HRPL 3MLSL 4L1DA 4ZTOH 3S3PA 1J12A 1YEHL 3NIDE 4P2QE 2F15A 4HCRA 8FABB 4JANB 4J6JA 4LOUD 1H15B 5DJ6A 4NGHL 2JJTC 4FN0A 4OIIL 5BVPH 4KPHH 2PO6D 3I3DA 3MA7A 3M8OL 5MEQB 1XT5A 5HGBA 1A7QL 5CGTA 1KEMH 3DRTA 4OZGB 1MCJA 1PDKA 3VI3F 2UWEF 4OIIH 4DOHE 1ZLUH 5TDPA 3QDHA 4PTTB 1C16A 1CFSA 3GSNL 1N3NB 1OGAD 1XMWA 1BIIA 3GO1L 4Z7OE 1NCDH 4KXZH 1PWBA 2QHRL 2L04A 1G7QA 4QKHA 3GSOB 3BAEH 4DZBB 4LF3A 4UB0L 1UKTA 5DEFB 4FZ8L 1F3JB 4OLYH 4J1UA 5B4MC 3V95A 4I18C 4CVZA 4M1DH 5HYSG 4LSUL 1A7RL 3WUWG 4X5XB 5DK0B 3V52H 5D72H 4EDWH 1WVZA 3OGOE 1YPZA 4OGZA 2J6EL 3TNNB 5FO9A 4JDVA 1IGYB 1IC7H 4MJ2A 3WNNA 1T1WB 4GS7C 3EGSB 2C3XA 3U30C 1DBAL 1KACB 3QJFB 4NN6B 3A67H 3JVGC 4YHLH 2QQLH 5LQBL 5C3TA 5T1LA 4X6CF 1IAIL 2XY2A 5GJSH 2D4FA 3BRDA 2R69L 3OJVC 5I0DA 4J2XA 1CDBA 2PY2A 1QVOA 4P46B 1J05B 1KJVA 3H3BC 4XNQB 1GC1L 1PKOA 4NWUH 1FAKT 5INCA 1FIHA 2FZ3A 3LQMA 3KDMA 4Y4KB 5D9SA 4E52A 5DRZB 5D2NE 3RWJB 2O5ZH 1MSPA 2XKSA 4YHML 2V5YA 4LPCA 1BP3B 3GMLB 4JRXB 4LEOA 3S35L 4JDZB 3QCTH 4QTIH 1DTUA 4WJ5A 4X4YA 3QCVL 2AJ3A 5FA4B 1S8DA 4L8DA 1H0DA 3GIZL 1BFTA 3F12A 3IB4A 1AGEA 2VKXA 2X44D 4K7PX 5CKGA 4LLYA 1QRKA 4JZJB 1KJMB 3C5JA 2WUCH 1LO2H 2F5BH 2A83A 3TO4A 2VLKB 1KPVA 4ODXB 3PWPA 4ZS6D 1XR8B 2MH4A 4HEPG 3QQ3A 2ICCA 2CUMA 2HLAA 4JAMA 2YS4A 2ZNWA 3AREC 1S9XA 3D18B 5KVFL 1J1PH 3HG1D 1RZFL 5SX4I 4HXBH 4Y4HA 5SWSB 4NO0A 4J6NA 3GZKA 5J7CC 2AJZA 4E9LA 4XP1H 1M4KA 5J3HD 3V5DA 4GLRI 5DJ2A 5F44A 1RZFH 1WWAX 1KB9J 1RZJC 4EUPH 3BHBA 3A6CL 1KCVH 1U8LB 5TPWL 3T2OA 4HV8B 1A9EB 3G83A 5HGDA 1XF5B 1IMHC 1V05A 1H3UA 2J8HA 1FNFA 3QUYB 2CKBA 3CDGE 3G5YA 4ZFZA 1WBZB 1BQHG 1EV2E 1W0YT 1DQQB 1X5IA 3DJ9A 4RAVB 3TCLA 3W2DL 4KKLC 5CJOL 2PXYC 1P9MC 4O9HL 5L2JA 1RJCA 3RA7L 3S34L 3OXSB 1QKZH 4F7MA 1Q0XL 4L4VE 2DQUH 3TJHD 3ALXA 5I16B 1I7RA 4HPOH 4JKWA 1NLDL 15C8H 4DUWA 2B8OT 4NDMA 1U95B 3R8QA 5GGQH 1PX3A 4HUXB 4MAYD 3MOQA 2CO7B 2XTJE 3IKRA 1AO7E 3BZFA 1QHPA 1TZIA 4X7SL 4RWYL 4LDLB 4ZXBD 2Q7NA 2YMXL 3GGWA 5BW7C 2H3NB 2R56L 2EEDA 1XAUA 1I8KB 4WU7B 5DJZA 2FL5A 2VLJE 4HIXL 3TIDB 3HZMB 1NAKL 2Q8AH 5ICZB 3ULUF 3WXVH 4R97C 3PAKA 3R4DA 3ALWA 4PV9A 4CMMB 2ZCLL 2Q76A 4AENA 4D0CB 4YDKL 2V7NA 4FZEH 1MIEH 2QQQA 2EXYC 2I25N 4N9GA 1NFIA 4OCXH 4KI5E 4IDLA 1D6EB 3VPPA 1MJUH 5K9OA 3TVMC 4FFZH 3OGCA 4XNYH 1VPOL 4PRPA 1GGIL 3M17A 3WLWD 3CDGF 1RURH 3DX6B 1F4XL 3IDYB 1WTLA 3OAYH 3T2QA 2ARWA 3T3PE 3L3GA 1CF8L 1BZ7B 3UC0H 5GS0L 5IK3A 3TPUB 3UEZA 4YO0A 4ZPTA 1K5NA 2HH0H 3HMXL 5ID0B 4MNQB 4CSYA 4M5ZH 4NZJA 1KWZA 4MB3A 1WITA 5GRUH 5CINL 1MREL 2HJFB 4GKOG 1ZGLM 1ULVA 2DQHH 1NUFA 5GXBB 3P0YH 3WIIL 2GK2A 4MA8H 2KH2B 1EIBA 1YPZE 2ATPB 2VDRH 4RFNC 1G7PA 4N0CC 3MJ8A 4OZHF 3Q6FA 3DV6B 4KTEH 3C2AH 4Q6IC 3AS0A 1AQKL 3C8HA 2PCPA 1Z6JT 3MBED 2PTVA 3L3KA 2PTTA 4TUJA 5I6XC 3OKEA 5JPNA 3DVNB 1M1SA 4HS6B 4N8CH 3OAZH 4NIKB 1CT8A 2MQ0A 4PLJD 4MHHG 3PABB 1OAXH 3S88L 1RD6A 3EYFB 2UYLA 1HTNA 2IT6A 4XP6L 1QHOA 1U3HD 5DMGC 4HKBB 4Z7QE 2DYPB 1YNKH 4FHBD 1V7NL 3ILQC 3TBYB 4OZFH 3WJJC 5CEZL 1CLZH 1U8QB 4KI5F 4AG4L 5E00A 1OGTB 1D5IH 1LP9B 3KPLA 4FMKA 4GS7B 5IBLD 4LKXB 3U30B 2HVKB 1K8IA 2VDQL 5GISH 3VFSA 1UADC 2P24B 1NCUA 4YBHA 3FQNB 2H9GA 4JO4L 4NQSB 5CD3A 4PTUB 2Y5TA 3PQYA 5GJTL 5HYJD 3GJEB 4PY8J 5DD1L 5I66A 4ZAKA 4YHNB 4G8EA 4RWHA 3QEHB 4OCYH 3F65A 1T5XB 3SKOA 2X4OB 2JJVA 2ZCHH 4LQ1A 5E95B 3PWPE 4XPAH 4QY8B 4OCWL 3VW3L 3S8WA 3TA3C 1CR9H 4HEME 5FHAH 3QIBA 4YJZL 1J9CT 3AY4C 3QI9D 4AQ1C 3STLB 5BJTB 5LGHH 3MUY1 4WHYH 2MQ3A 3O81A 5C09B 1JF6A 3OJ2C 4W68A 2FJHB 4IS6B 3F7PC 5DEZA 4U3XA 4CN6A 1FAIH 4YDIL 3L5WB 3HMWL 3KXFD 4LPVA 3FOLB 1WZKA 4CU8A 4ERSL 3H9SA 5T1DH 4ZRWA 1AGFB 1PQZA 3IDNB 1ZT1B 5FOBA 4Z95H 3N1PC 5BMFH 5FFSA 3AREB 1KBGL 3QHZL 4NQVB 1B9ZA 4AEFA 3KMB1 2P4AB 4PJXA 2NNAA 1TTGA 4Y0GA 3THMH 4X4MA 1NGWA 1TNMA 3Q6GH 3QPXH 4MQXC 1XIWD 1GZPA 1B6UA 3I2CH 4Y5YC 3QZWB 1JGVL 1B08A 4YXHL 2DQEL 4L4TA 4JFFA 1E4JA 3TC9A 4PGEB 1D6VH 3ARTA 1K6QL 1MSBA 5FM8A 1QR1B 2QBWA 2X4SA 2FX9L 4I8DA 5I2IB 1C5CL 3MRPA 3C22A 4NBYB 4BKLB 3P73B 4ENEC 1OAZL 4Z78B 1A64A 4LLDB 5DD6A 4EUPA 2PXYB 4LDEB 5HYQB 3K1KC 1INDH 1I9IL 1A3LL 5FFRA 3UDWA 1RJZB 1U8MB 4W6YB 5CJ8A 5E5MB 2CMRH 3O6MH 2OCFD 2FSEA 1MCEA 5ESAB 5HDBF 3UBXB 1FO0B 5IQ9A 1I9IH 3BT2H 2X70B 4IMLA 4LSSH 5C2BL 4HGKC 2FWOB 3DPBA 5BCAA 5L2KB 4G5ZH 2ORKA 2XXMB 4WGVB 1J8HA 3F5WA 4NQCA 3RY5A 1KB5H 4QHUA 2ITCB 1WF5A 5JQ6L 1MH5A 1MIML 5CD5D 1QBBA 4ZD3H 4PJFA 3RL1A 3BEVB 5ADPL 3BDBA 4I0KA 4U6YA 4PGJA 4ZFFB 1DV8A 5FKPA 2IC2A 5L9DH 4JPWH 2IJ0C 5DO2C 3L3IB 3EHBD 5J0BA 5EBMA 3WIFB 1A5FL 4LLVB 3RPIA 3B43A 4XAWL 3H2WA 4P2OC 2PR4L 1ZA3A 2EE9A 5KJRL 3HB3C 1EVUA 4NJ9H 2BOBB 1EEYA 4I13B 2VLRB 1G1RA 3K81A 4KHTL 5HDQH 4LLAA 1HH9B 3TVMB 3RJDA 4QRSB 4K71C 2JJSC 4ZUWA 3L3HB 3ZKMC 4HFUL 4UTAH 3VGFA 1HUPA 3P9WB 5IGXL 3MROA 2F53B 4FQ1H 2D7TL 3W39A 2DDQH 3P0VH 1KJ3H 1D5MA 2DKMA 5T1MB 2V5SA 3HCVA 5HHME 5EO9A 3FB8A 4JPIA 1TJGL 3BDWA 4K3EH 2DQDH 1JGEA 1T0NA 5E5UB 3K4DA 2F5AL 2W60A 4XCNA 1HSAB 3WFDH 2RCSH 2C6UA 5CZVL 4PJDB 4A6YB 1CIDA 3RVUD 3U4BL 5DMKB 2WWKT 3UJTL 5JIPA 5EU4B 4P4KD 1WC7B 4X80H 3WH3A 1BF8A 1HH6A 3JV6A 3L7FB 3VU2A 5MEOA 3P5IA 3DGGA 5DJXB 5FM5M 5GGVL 3X12B 4TQEL 1YMHB 2V2WB 3ALTA 4AIOA 5JUEH 5I6XB 3U4BH 4L8CB 3IAPA 4ALAL 2OR9L 2VTFA 3E8UL 3DECA 5C0EB 2IPKB 3MLWH 4E41E 2XQYG 1NCCH 4QRQB 1KPRA 3O2WL 4HKXA 5EU3B 5IMKA 5MENA 5GGVH 4NHUA 3PQYE 4XPTL 1QEWA 4O5LL 3LKPA 4JY5L 1HYSD 3FT2B 5JW4R 2OJEB 4HS3B 1RIVH 1D3CA 3NABH 5GIRA 3GBMH 1A6VH 3S5LG 5D1QA 3FFDA 1UOSB 2VSDA 1ZTXH 3RNKA 3GSRA 4NQEB 4Q0XH 2CLRB 2VRPB 1K3IA 5KSAC 3QIUA 4IOPB 4NOFA 5J1AA 3NCJH 1ZLUK 4FOMA 4N38A 2W59A 5FYKU 2V9RA 3QWOB 4PLKD 1MEXH 1DY0A 25C8H 4OZFA 4U1LB 4IRJD 5HY9A 2WBJB 4X6DF 2HLFD 4WTZA 5ENWA 1IQDA 1DLHB 3M45A 5FUOH 4FQHA 3MO1B 5HVHC 5IMMA 2L0DA 4AEHL 4EJ1C 5FDWA 4OZIB 1X7QB 1AY1H 3VWJA 3FTGB 3H9SE 5IF0B 2DI9A 3TA3B 2EC9T 3VXPA 3QHTC 1SYVB 2FH6A 1T1YA 5ALCL 1PBYA 5DD3L 1FNGA 4AQ1B 1U8KB 5F9WC 3U48A 3O4OC 4HK0A 3FONB 3P9MA 3ARBD 4DGIL 3ET9F 3P30L 2Z31A 3VA2C 5HD8D 3QXTA 4MA1C 4C4KT 4NQDA 1LEKB 4X4ME 4PJ8A 1RULL 1VA9A 4P23D 4JFHD 1B0RB 3WSQH 2YUVA 4UI2A 4HU8A 3CMOL 3C60C 3UTTD 1J5OL 4XMKL 4LLMB 2DLEA 3Q0HA 4L4TE 1BMGA 3BWAB 4PJBA 5D6CB 4JFFE 4KUCF 2VL5B 3GDBA 3MPCA 1PFCA 1YJDL 2VQUA 5E94B 4YFLI 1DQTA 5C7XH 1NMCC 1N64H 5E6YA 1ZVHA 3TCXA 3NFSL 3RL2B 4E0RA 2FGZA 5DFTA 4Y5YB 4PGZA 2ZPKL 1F3DJ 2J5LC 5JZ7C 3Q1SH 3DUUA 5D2NC 3BO8A 1PSKL 4G8GE 3U0WL 1KIRB 3IJYA 2ZUTA 2IG2H 1YZZA 2D7OA 5EC1A 4DEPC 5EU5A 3LRHA 3P4OB 4X5WB 4DKDC 1UCBL 2DQCH 4RISL 1YY9D 2A77L 2CRIA 1C12B 1QSFA 5A40E 2CGRL 3B5GA 1J8HE 4NQCE 4JFDB 1IGJA 1FC1A 5CAYB 2AJUH 1CICD 5T3XH 4APQD 3AB0C 2EDYA 2MTPA 4JG1L 4PJFE 4TSBH 4HX1B 2HT3D 5LXGL 3PWJA 2DIBA 2VDNH 1S3KL 32C2A 3NCEB 3MV01 1CLYH 1N26A 4PJXF 1BBDL 5F1NA 3T65A 2ZUYA 4M8QB 1I4FA 1SEQL 5KANI 1DQDL 4NP4L 1BD2B 1R5WA 3HZVB 5I1KH 1MHHB 1QG3A 3IDIA 2G60L 3U0PA 4FFYL 1IM9D 1OAUL 3BKML 4WW1A 2GJ6A 3JWDL 4QOKD 3ULUC 4QKGA 1U8OB 1UB6A 4WUKH 4DVBB 4K23L 4RMUA 4NC1E 5I1IH 4JFPB 2R9HD 4R8WH 5F3BB 4JN2A 4N8PA 1F97A 3ZE0E 4K8RH 5JORB 2E9IA 3KS0H 4C56A 1FBIH 4UQ2B 2YXFA 3MXWL 3H9HA 4NOBA 3RWIA 2C4XA 1CGWA 1BF2A 5IW6A 4RAUA 4C83A 4TUOA 3NAAH 1RAMA 2FH8A 4NO3B 4P2OB 5JW5B 3QEQA 5LWYL 2HJKB 3OKMB 1WZMA 1ONQB 2HTLD 3EOAA 3GHEH 2UZIL 4Y2OA 5FYJU 2EC8A 2CK2A 4K71B 5IMLB 2W0FA 1DBJH 2FJFB 3HC3L 5F3HA 3MREA 4ODSL 2BVPB 1OARL 3DUHA 1KMB1 1SJEB 1K9TA 3CXHJ 3CFJB 3PP3K 1K4CB 4WY7H 5CGYC 4KKBC 1SBBA 4K3JH 4M9PA 5CEYA 5BRZA 2UWEB 4D8PA 1J1XL 1NBYB 1T83C 4Q7DA 1YEGL 3SE4C 2YXMA 1GPOL 3PF2A 2V2TA 1L7TL 3DROB 3GSVA 4UV7L 2DWDA 2ORBL 3CCHB 3QUKA 1OQXA 2ICEB 5MENE 1TVHB 1K3ZA 4G80A 3HUJB 1FRGH 4CDGC 1BAFH 1I3RB 4WFHD 5C9JA 3BQUB 5EN2B 1ZHBB 4OF7A 2C3VA 4LCWB 5F8RC 3JV4A 4LKCB 1FVCB 3SDDA 1VSCA 2I27N 4XP5H 1V7PA 4L9DA 4KI5C 4F3FA 1L0YA 1SYSB 4WHTB 3EDDA 2IADB 5IOPB 2ZUUA 4RGMC 2R1YA 3VXRD 1FZOB 4Q9RL 2BY1A 5TJWK 4X6CB 2ED9A 5B39B 4KMLB 3DRQB 1CQYA 4PBWD 5EOCH 4H5SA 1CBVL 5GS2H 4O4YL 3CFCL 3LOWA 5KSAB 1BEYL 2P45B 1E4WH 4LCCA 4N37A 4LSPH 1NCBH 2NW2B 4J4PD 4JZOB 5F7DA 4HWBL 4YGAB 3VXME 3S97C 4Q9RH 1KCUH 1CVSC 5F9DC 5GHWL 2IH1B 3RUGA 2XACC 1DFBL 1JVKA 3L3OB 3MNWB 4HWNA 4OCNC 3S36L 4KJPC 4DOHB 43C9A 3LN4B 5LG1A 4NQDE 5DUBB 5DFVD 4P46D 4PJ5A 3IF1B 1WCBA 2YEZA 1OAKH 1YN6A 4H26B 4KH2A 1YQVH 5IVXA 4OV5A 2NR6D 4D3CL 5I18H 3JWOL 1KWXA 3BPNC 2HFEB 4HH9B 4P49A 4PJBE 5F9WB 3O4OB 3DETD 4UIKH 1JPSH 1NDGA 4X8JA 1FE8L 4JRXD 5F71A 1A9BA 1U0NB 1PX4A 1T0PB 3MJ7A 4MA1B 3QHFH 4GG6A 4YDVB 1SHMA 5B8CA 4GRWH 4WU5B 4D2NA 1DR9A 3EDFA 4X0KB 4NHCL 5FYKD 3NZ8B 3ZL4L 2X4NB 3LZFH 3C60B 2QL1A 4K9EC 3SQOH 1A7NL 4NKMB 2W0PA 4JKPH 4PGDB 4XVJH 3GI8H 4QO1A 2LVCA 2VLKD 4JCLA 5KTIA 1M05B 5JW3H 1U93A 3V6FA 1TXKA 4I9WD 5DK2B 4XB8A 1CFVH 2HT4C 1FORH 3JV0A 1QSFE 3MLXH 1BQLL 3QAZC 3QRFM 2P43B 1E8IA 2IAMA 1RK0B 3HKFA 2HYMA 4MMXC 2V17H 4YHIB 4RRPA 5GS1B 5SWSD 3HNTL 4WRFA 1YEEH 3ZYJA 5D2NB 3A6BL 4MJ6B 3TO4C 1JTOA 1MJJA 1VGKB 3EO0B 3D9AL 4NT6A 3LEXB 4HT1H 3REWB 2DIJA 4ZUUB 4WUUA 2YRZA 2ZOKA 2PW2A 3RU8H 1R3JA 2FB4H 2FRGP 4LAQL 1B2WL 3NA4A 5IFHL 5TF0A 2XTLA 3I6KB 1KNOA 1FFNA 4M7ZC 4Y4HC 5HHPA 3QUYD 1OHQA 3HE7A 4HIJA 2GJ6E 1WEJL 4PJHA 1IARB 2DQTH 5EZIL 4Q97A 3I6GB 1RHFA 2JK5B 1IJKB 3AB0B 4PJBF 1T7WA 2YD8A 1CE1L 1JHKL 3G81A 4WFGD 4R4FL 4KK8C 3QNYB 1VKXB 3DX8A 1BNLA 4LNVA 1AGBA 4D9RE 5I1EL 5I9QC 1JGDB 3O41B 4FQCL 3RKDC 5I30L 3GK8H 3OG6B 4JRYE 4M00A 4Q2ZA 1OQOA 2DICA 1AI1L 5EUKB 1HKLH 3PGDB 1MRDL 2YPKB 4LLUA 3QEQE 4JB9H 5I8EA 5CEXA 1UMRA 4NSKA 4OGAC 1FFPB 4ZDHA 4M48H 2I07A 5FM5O 2A2QT 1X3DA 5DA4A 4KVNH 3L9RB 5E56A 2ITDA 4JY6A 3VFNB 2LAAA 3D85A 1NGXB 2VH5L 4P2RA 2XZZA 4H0GA 5TE7H 3BZEA 5EBWA 2XKNB 3CDGB 5BRZE 1LK3H 1G6RH 4CNIB 4RIRB 3GEWB 1KJ2B 3HN3A 3MRLB 4U1IB 3ES6A 4GQ9L 4WEBH 2A73B 1ED3B 1PKQA 1J35B 4XAKE 2JCCF 5A16B 4R6UA 3CLFH 5DA0B 1OP3K 1NJ9A 5IHUH 3MLRL 2VDOL 4LCUB 1AO7B 4FQXB 4LSVL 4HUWA 4OZHB 4YFLF 3OR6B 1BBJA 1FVEA 2XWTB 4MNQD 4LP4A 5C0RL 2HN7A 4F2MB 4P5MB 4JQVC 1CFTB 1F90L 5KSUB 2VLJB 5GGUA 1OCWL 4EI5B 3KYAA 1U58B 2MQGA 7FABL 2A6DB 4QRTB 4S2SA 3N9GL 3NCYP 4LRNH 4PS4L 2MCPL 1UM5L 3AMKA 5FYJD 4YXLL 5L6YH 3O8XA 5DJ6B 4ZRVA 4X4XB 3NIGF 2O61A 3PIQB 1QBLL 4GAJL 5E6ZA 3MA7B 5ILTH 3MXVH 3RUGE 5HGBB 1OP5K 1F8TL 4RGMB 3DRTB 4M7LH 1AFVH 5CLTA 2I9LA 5B4MD 4IRZH 5M95B 3KPRD 5T3ZD 3OMZA 4PJCA 4N5UA 5TDPB 1C16B 3NFNA 1CFSB 1FDLL 1MFCL 1BIIB 4MNHA 4U3CA 3NTCL 1P5UA 2DYPD 1IGFL 4OLWL 2MFNA 5B3NA 4TUKH 3X17A 1G7QB 4UOW0 4M5YL 3EOBA 5IVXE 1FGVL 3BOVA 4HKZA 4X9HA 1HIMH 4LF3B 4Z0BH 5TE6L 4J1UB 4EIZC 4N36A 4M43H 3V7MA 4CVZB 3B2VL 3PHQA 4YE4L 1ZS8A 4BA8A 4DCQA 1F58H 3MGTA 1YPZB 2ICES 4GG6E 3FQRA 3VFUB 2FIKA 4M7KH 2AJVL 4JDVB 1QPXA 1S7SA 4ODVL 5D71L 2FLRT 2X41A 3LEYL 2BRRH 3G5ZA 2N56A 2WP3T 3SDCA 1U6AH 2A6IA 3BPNB 1RY7B 4MLIA 2CDEA 4HW6A 5T1LB 1HINL 3E2HC 3GM0A 3UZQA 1WWCA 1QVOB 3TT1H 1KJVB 2YUXA 3QPQC 2AS5M 2VUZA 4PB0L 2EO1A 3QQNA 4ZAKC 1NMBL 2VJXA 5C09D 2FX8H 5INCB 2FZ3B 3RUGF 4XPBL 2B4CH 5KBNC 5D9SB 1ZA6A 2HFFA 2FATL 1M6OA 1REIA 3R8BB 5AZEL 1H3XA 5IHZA 4NN5C 3NBNA 3DIFA 3WNLA 2C4FU 4LEOB 5C0NC 4WUUE 4HJ0C 4HJJL 1TNNA 3VFMA 3O3AA 4WJ5B 5D4QA 4GKNA 4XCEA 2Q87A 4X4YB 2AJ3B 2Z9TA 5HI3C 3P5GA 1S8DB 3ARED 3QAZB 1AQDA 1H0DB 1NUGA 3F12B 1GZQA 4PJHE 4CRPA 5B3JE 1AGEB 4ODHL 1P7QB 1MFDL 1U8JA 1NGQL 4CBPA 3C5JB 1MVUA 2EDXA 1FNAA 2A83B 2YPLA 3TO4B 1QD0A 1KPVB 3OAUL 3PWPB 4MAUL 1MAML 3IFLL 4GG6F 2GO0A 1IVLA 3QQ3B 1AD0B 2MPAL 4XWGL 3RWFA 2HLAB 4JAMB 2IMNA 2Z8VC 4XTRC 5ICYA 4DN3H 1S9XB 1A7PL 3GRWA 3TEUA 1G84A 1RMFH 3O6FA 3SKNA 5T3XE 4Y4HB 3EBAA 1IKFL 4NO0B 1Z3GH 3MUHL 4ONFL 1IGTA 2AJZB 4RBPH 4AMKL 3V5DB 3BKCL 4DN4H 2UY6A 2OK0L 1DBKL 4ZSOA 1G9NL 5HJ3A 5K9JL 4KKLD 4K3DL 2PXYD 4WW2A 5I1JH 2HVJA 4QLRA 3BHBB 3NACH 1YECL 3WS3A 1C1EL 3WIHH 2VR5A 5C70A 1JUFB 1MCRA 1VESA 5I9QB 3LEVH 5HGDB 1F4YH 3MYJB 4FQLH 4OCSL 4OT1L 4OQ1A 4D0BA 3HE6C 4FA8A 3DYMA 3HNSH 1FZKA 4HF5H 2CKBB 4ZOBA 3G5YB 1CDUA 4ZFZB 3EFDL 2BVQA 3MCLL 3TCLB 2DM3A 5L2KD 1NCWL 4X6BA 2DQFA 4NKDB 3P9LA 1T7XA 2EKSA 4AY0A 3KJ6H 4F7MB 3UDWC 1PKQE 1I7RB 3KPNA 4M6ML 1CDHA 2LTQC 2WUBH 2Y9RT 3IFOA 1NKOA 4P57B 3RGHA 4OFPA 4WREA 1ADQH 2OX9A 3HAEG 4K7PH 3BZFB 1TZIB 4PFEA 5AD0A 4YHYC 4M6MH 3GGWB 4ORGA 2NY7L 1CE6A 2EXYD 3ZKNC 1QFUL 2VLRD 4OTXL 2YKLH 4M6NL 2FL5B 5DJZB 4KK5C 5HHOB 3TVMD 5JW4M 4J23A 2G5BA 4M6OL 3F6IA 4WO4A 3BKJH 1G6RA 1NC4B 4PV9B 3HNVL 2EH7L 2Q76B 2VXQL 4AENB 5DUPH 5AWNL 3RWEA 2MQCA 5D70L 2V7NB 2MOVA 1KIPA 2G2RA 4N9GB 1NFIB 2ZJSL 4FABH 4NC1C 5K9OB 3MOBH 4TPRH 3IDMA 5FFLA 4F33A 3OGCB 4PRPB 3M17B 4FQPA 4XPHH 4PJCE 1X5JA 4GOSA 5D7IA 1MCOH 3RQ3A 1KCRL 4RQQB 1G1YA 3L3GB 5MEPA 1DJSA 3OPZH 5IK3B 3ROLA 3CFWA 4N0CD 1KN4H 4YO0B 4ZPTB 1K5NB 4TULL 3LQZB 4D9LH 3RDTC 3FF7C 1JNLL 2R39A 1MFEL 4AEEA 4F58H 2KBGA 5DC4B 5DWUL 1RPQA 3MR9A 5I8OH 1JZ4A 3TZVC 5F70A 1G7IA 4DKFH 3ABZA 3K4ZA 5JHLL 3IETA 4U6VH 4FXKA 4G42B 4YK4C 1G7PB 5DMGD 3MJ8B 3CDCA 3Q6FB 4UOW1 2GW5A 2PCPB 3ILQD 2FBOJ 1FLRH 1PYWB 1V4LA 2VL4A 4TUJB 2RFXA 4X6DB 2Y36L 3OKEB 4YAQA 5JPNB 2VZVA 5IFJA 1JPTH 3DVIA 1CT8B 2PTUA 1QFWH 2PW1A 2BHZA 4PG2C 2UYLB 1Z0MA 5C0IA 4M1GH 5H37H 1KGCE 4O58H 2AEIT 1F2XK 4AYFA 2VE6A 5E00B 3ZDZF 1FC2D 2B1HL 3KPLB 1EGJH 3RIFK 5KSVA 1MCLA 1K8IB 3QIUC 4TRPH 4KTYA 3VFSB 4PJCF 2X89A 4HS8L 2ZWLT 2H9GB 2R4RH 2EDTA 4XHJC 1V8HA 5I73C 4NYLA 3U9PH 2ENSA 2G75A 3E2HB 5CD3B 2Y5TB 3PQYB 1JK8A 1G9EA 4H20L 2AI0L 2W91A 3TA3D 4GRWE 1DDHA 8CGTA 5DZLA 1B90A 3QA3A 1MAJA 4ZAKB 1L9MA 3MQIA 1JTPA 3VXSA 3CVHH 4P4RA 4O51A 4XPGL 3MRJA 5KTEH 1DQLH 2IFFH 2XZCL 2VZSA 4OLUL 4TSAL 1F00I 3SKOB 5ESVA 4TN9A 2OZ4L 1J1OL 5HHVL 2I5YH 2VOTA 1OOAA 2XXCB 4NN5B 5EA0H 5KS9E 5IW1B 3WDJA 1Q38A 1IL1A 2P8MA 4PB9L 3LDBB 1A4JA 2BDNH 3P4NB 4LQFH 3QYCA 3QFJD 1IEHA 4F7CA 2RAMA 3VGAC 2NY5H 3LQAL 2J88L 4ZSOE 3H9SB 2VQ1A 2DLHA 4MQXD 3MOAH 1I3GH 3ZE1F 1PQZB 5FOBB 2QKIA 3HR5A 2VAAB 2NX5D 1UACH 1WZ1L 1P2CA 2MOGA 3ZTJH 2M1KA 5HHNA 5IJKA 2LQRA 3K80A 1NEZA 2CIIA 3O6LL 1AR2A 2NZIA 4PJXB 5HYFA 1KV3A 2NNAB 3QULA 1DBML 3SN6N 1NGWB 1LO4L 3HS0B 2GT9A 3L3JA 2XN9B 4BFBD 1GZPB 5FO7A 4MVBD 4ENED 1J0KA 5GRZA 3EUUA 1LD9A 4NM8L 4JFDD 4L8SA 3K2UL 4PREA 5F7UA 5DURB 1QNZL 4L4TB 4JFFB 3HA0A 2H2PC 3HE6B 2AXGA 1E27A 4Y5XA 4ODWA 2X4SB 4O2CA 3NH7L 5DI8A 4PY8I 3MRPB 1JRHH 4PYGA 1BD2D 2D9QB 5DD6B 1A14L 4GBXA 1BQHA 2BY2A 4EUPB 3O3BA 4LPWA 3WIHA 5TDOA 3QDGA 1URLA 3AROA 2EDWA 1CQKA 3WD5H 3I9GL 2GSGB 4OD2A 2FSEB 2FECL 4POZD 1IAIM 2LTQB 3IDXL 4AL8L 5IQ9B 3EO9H 5DO2D 1K8DA 2EO9A 2VXTL 4QCIA 4WW2F 4XNUH 5LBSL 4CW1B 1J8HB 3F5WB 4QHUB 2W9EH 2Q3AA 3W9DA 3E3QE 4P2OD 1A6UH 1ACYH 3MFGB 3HB3D 4PJFB 3RL1B 1JFQL 2HA1A 3U7WL 5LCVH 1M71A 3UO1L 4UNTA 4U6YB 2I24N 5FKPB 4FP8H 1ADQA 3ZKMD 4XBEH 4M3JA 3ZSTA 5D7IE 3TYGH 1K9JA 3MRNA 1GH7A 5IBTH 2OJZH 4UTBL 5EBMB 2OR7A 1KTDA 5ECJE 3RPIB 4YEFA 3MLUH 1GSMA 5FYKL 2LE9A 1XGPA 3ZKSD 4PR5B 1ZA3B 5BS0A 1FVUA 2CXGA 5IQ7L 1EEYB 3U36A 1QFWI 2BVEA 3B9KC 6CGTA 2R8SL 1FLTX 5I74C 4Z7NE 4ZUWB 3VD4A 3MROB 1BFVH 3D0VA 2IBGA 4M7JL 3VMOA 3W39B 1GJIA 5JQHC 1D5MB 4JO3H 3S6CA 3HCVB 4PRAB 5CP3H 3CU7A 4P9HL 2ADIA 5EO9B 1MFBH 3FB8B 5J56B 1MRCL 1DY1A 4QKIA 4XNMA 3BDWB 5TDNA 4I3RL 5DYOA 1JGEB 1T0NB 5IFAH 1GGBH 4RGNE 1C8PA 3RRQA 4XCNB 1VENA 2AKRB 1RUPL 2R0KL 4JPKH 3TZVB 5ICXA 4RFOH 3BESR 1I75A 5EZOH 2D03L 2DQJL 1DZBA 3LKRB 4M17A 4JHAH 1HH6B 3JV6B 3TBVA 5MEOB 2Z0BA 4UQ3A 3DGGB 4YQXH 1TITA 3PG2A 2ZNXA 4LIQL 3ZE2E 2EDLA 2IEPA 5E2WH 2XA3A 3FO1A 1R3HA 4QRPD 1E4KA 3N85L 2BMKA 2HWZL 3SDDC 5L7XL 2X1WL 4GKZA 4YWGH 4HKXB 1FIGL 1MFAL 4Z7UF 5KSAD 5MENB 1SM3H 3TJEL 4EIGB 4NHUB 1F3DH 1G6VK 1QEWB 1I1FA 3LKPB 1DEEA 4Z9KB 5DRXA 5EUOF 5DLMH 4XMPH 1SY6L 3TT3H 1J10A 3VXSE 4J6RH 3FRPA 3FFDB 1T0MA 2N4IA 1CXFA 4RX4D 3RNKB 2Z93B 3GSRB 3GMNA 3B2UC 1BUUA 3QIUB 5L8JB 4LCCC 5J1AB 4M1GA 2W65A 3DVGA 5I73B 3C87A 4ESKA 3TF7C 1JPST 4KZEH 2GK0A 4FQ2L 4OZFB 1CS6A 1A1NA 3RGVA 3NFPA 2APVA 1IZJA 4X5LA 3ZHKA 3SO3C 2BP3A 2YZ1A 4XVTH 1EGJA 4GMTL 3SPVB 1YYMH 1H3TA 1IQDB 5EIQA 2E5EA 4FQHB 1HEZA 1WZLA 5IMMB 4FQJL 3J8F7 3X3FL 3KHQA 1FN4A 5BVJA 4EBQH 2DBLL 2E9BA 3P4MB 3UZVB 3SDYL 4GXVL 4HUVA 4ODTL 1PEWA 3UCRA 3ALSA 3VXPB 3AM8C 2H1PH 3C60D 5I19H 1NBQA 1T1YB 1KELH 1ZMYA 1FNGB 5CSGA 4HK0B 1EMTH 4E42A 3CVHA 3P9MB 1UENA 3WBPA 5IB3A 2Z31B 2GTWB 1P4BL 1JRHI 5C08A 1Y18A 4NQDB 3C09B 1T8DA 5TQ2L 2YSSA 3VGAB 3L7EA 1Z9LA 4DW2H 4JM4L 2YD6A 4LCIL 4OJFH 2DL2A 1RJLA 2JKXA 3BDXA 1X5FA 3OG4B 1WQVT 1Z9MA 4CMHC 5JZ7D 3OKOA 4NKIH 2P46B 4PJBB 3OV6A 3OZ9H 3DMMC 4M02A 3ARFA 2BY3A 4X9IA 5IUSA 3FT4B 5FV2A 1KENL 4C55A 2FECI 4OM0H 2IAMC 3BRFA 4E0RB 2MJWA 4UIMA 3QDGE 1L0QA 3LB6C 3NCWA 1EHLH 1JWUB 1YDPA 3QBTB 3V4VH 3DUUB 3EOTH 3BO8B 4JLRA 1CDGA 4X7EC 1KXQE 3IJYB 1WGOA 2EDQA 2QV2A 1DANT 5EC1B 5T3ZL 5EU5B 5DMIL 5DJYA 1S5IH 1KLGA 1ZE3C 5CBAA 3P7FA 3C08H 1RTM1 3B83A 3QO0A 3OSKA 1UWGH 3S37X 1YJDC 5E99H 3HE7C 5BO1H 3OJDA 1IGJB 2R2HB 3GIVA 3O6KH 3ULUD 3QSKB 3L9JC 3ROOA 3PWJB 1EBPA 32C2B 5I15L 1T4KA 2BVOA 1YEJH 2PYEA 3L6FA 3GMQA 1I4FB 4G7VH 3HFMH 3K7BA 2YBRA 2FGWH 1R5WB 2W0LA 3IDIB 3U0PB 4JKKA 5BS0E 2GJ6B 3VG9C 4IDJL 1RUMH 4KMTH 1DQJB 5D1XA 3SE9H 4PJGA 1CIUA 1IBGL 4JN2B 4MTHA 2LAGB 5DVMA 1HQ4A 3P40A 4CVXA 5IWLA 2XPGA 2K9UA 4C56B 5JLZA 3LMJH 1OAYL 4DGVL 3H9HB 5IW6B 4RAUB 4C83B 1KB5B 1IODA 3U7YH 4TUOB 2XR5A 1AE6H 3QEQB 5CGYD 4KKBD 3EOAB 4X98A 2ZUVA 4HMDA 3O0RH 1IM3B 4HUUA 1AO7D 4K8RC 4EZMA 4YHOH 2W9DL 3T0WA 1MCPH 2XG5A 2R0ZL 3JWDC 1BZ9B 5I74B 2WMPA 2W0FB 3O2VH 3G9VA 4N5EC 5F3HB 2VXSH 3MREB 2KL6A 3P7GA 1YNTB 2NY6C 1P5VA 3HHRB 1KT2A 3ECBA 1IC4H 3X3GL 1HQRB 3MCKA 1EZVY 4HQQH 3RHWK 4I3SL 1A22B 5CEYB 1MF2L 5BRZB 5D6DC 4D8PB 1A6ZA 3B6SA 5MHSE 3EO1A 5KVGH 4DUXA 4HGWB 4PBXA 2V2TB 3GSVB 2DWDB 1Q8MA 3QUKB 4KHXL 5EZLA 4M7LT 4WCYL 2YC1B 4G6KH 5EIIA 12E8L 1RZJL 5KVDL 4KI5D 1PVHA 2ZOLA 1QRNA 4G80B 4NO5A 1QO3A 5KVMC 3WXWL 5E2VL 4CKVX 2DLFL 4IIQA 3RHWF 3SKJH 3T0BA 4P59H 4FTVA 5C9JB 1ERNA 4QHNA 2D7MA 1BZQK 1W0VA 2C3VB 3L5XL 43CAA 3O8XC 3GMRA 3JV4B 3O2DL 3SDDB 2BNRA 1V7PB 3IKNA 2OR8A 3STZA 2NW3A 4JQXA 4F3FB 4Z7WA 5F1SA 1A0QL 3FQWA