1F0MA

Monomeric structure of the human ephb2 sam (sterile alpha motif) domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
71
structure length
71
Chain Sequence
b'YTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-B RECEPTOR 2
publication title Monomeric structure of the human EphB2 sterile alpha motif domain.
pubmed doi rcsb
molecule tags Signaling protein
total genus 24
structure length 71
sequence length 71
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2000-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1f0mA00
1B4FA 3H8MA 2JV3A 2D8CA 2QARB 4RQNA 3KKAC 3KKAA 1X9XA 1Z1VA 3BQ7A 2KSOB 2F3NA 2E8NA 4IS7A 2QB1A 2ES6A 4PZNA 2EANA 2KSOA 5KNIA 4MHVA 2E8OA 3TACB 2D3DA 3SEIA 1V85A 1SV0C 1SV0A 3HILA 2EAMA 2QB0B 4NL9C 1SXDA 4NL9A 2KIVA 2DKZA 2KE7A 2YTUA 1OXJA 1COKA 2F8KA 3TADC 3TADA 2QARA 1UQVA 1LKYB 3BS5B 2EAPA 2LMRA 1PK3A 5L1MA 1DXSA 1UCVA 4PZOA 2GLEA 1LKYA 3BS5A 1SV4A 1F0MA 2EAOA 3K1RB 2Y9UA 2FE9A 1V38A 1X66A 5J8YC 5J8YA 1B0XA 1X40A 5F3XB 2K60A 2QB0A 5JU5A 2KMDA 2K4PA 2ESEA 2B6GA 5JRTA 2QKQA 2F44A 3SENA 2L5YA 1JI7A 1WWVA 2E8PA 1OW5A 2Y9TA 1SXEA 1RG6A 4NJ8A 5JTIA 2KG5A 2E8MA 1KW4A 1WWUA 3BS7A 1PK1B 2DL0A 2LPEA 4RQMA 2DKXA 1SGGA 3IDWA 1PK1A
chains in the Genus database with same CATH superfamily
1ZQPA 9ICBA 1N5XA 5IIJA 4ACOA 3PW2A 5L1JA 1U9LA 3BZCA 5DQHA 4X5VA 5KG3A 4RUAA 2KSOA 1SL0A 5AKIA 1D9DA 4ED8A 1SV0C 3KD3A 3HILA 3H4BA 2AH5A 3SQIA 2FMSA 3Q8LA 2HSZA 2FLNA 2F8KA 5ALNA 1ZQNA 2E1EA 9ICXA 2QARA 4OJLA 2XO7A 9ICQA 3UXOA 7ICEA 3H8WA 1S10A 7ICRA 3PMNA 8ICEA 3UXPA 3RF9A 3K1RB 4DL6A 2FE9A 2Y0SC 3S6JA 9ICPA 2HHQA 1ZYQA 4OJPA 7ICOA 4DOCA 4O3MA 2D6FC 5CEHA 2HMXA 8ICNA 3C2KA 3MDCA 2ESEA 5JRTA 5K4LA 2L5YA 2PMZF 2YY6A 4DSEA 4KX3A 3V7KA 3C28A 4NJ8A 1UT5A 8ICLA 4CF3A 5ALWA 1SKSA 2ZXHA 2KG5A 1S0VA 1N5WA 4YXMA 4C7ZA 2R8HA 2JH1A 3IHQB 4ECXA 2WF7A 2C28A 4M9NA 5ALJA 4PL1A 1TK5A 2BCUA 4M0AA 2J6UA 4QJFB 1URJA 5ALHA 3EPGA 1TAMA 5KG4A 4M9JA 5BOLA 1BPEA 3C2MA 4PHAA 3KZXA 3KHGA 2EANA 3M1YA 9ICVA 2BHNA 5KNIA 5KFFA 5ALEA 3WK8A 4MFFA 1KQQA 1PVQA 3OSPA 2JEFA 2BPGA 4NL9A 2CPRA 4KLEA 4CE6A 3QNMA 3HX0A 4GFJA 4PJ0U 4K4GA 5TZVA 3PV8A 4MF2A 4IR9A 1L7PA 2BZFA 4DLGA 4UAWA 5KT6A 1XO1A 5ALLA 4F4KA 1Z4OA 1K1SA 5J0UA 4QZAA 2G0AA 3H40A 5DDYA 5KFPA 4G9BA 3RAXA 4KMOB 4UB2A 9ICOA 5AK6A 3PVXA 3GIMA 2XC9A 2K8AA 3WU2U 3LVVA 2W9AA 2KZ3A 4JWNA 4TUQA 2EQYA 3TAQA 5DQIA 1L7NA 4HAIA 3RB6A 3BQ2A 1SXEA 5FP0A 3RH5A 2AGPA 5DB6A 1JUDA 1JN3A 2BCVA 2OHFA 5EE1A 7ICLA 4ECYA 4FZMA 2K89A 4O3NA 3NTUA 1X6JA 4DFMA 2JZBA 5KAIU 4KLTA 1ZQYA 2P35A 3ZD8A 4FBUA 5KT3A 2VIXA 2FMQA 5AICA 1RM6C 5GTIU 3T5LA 4UAUA 4NLKA 4DL4A 4JB3A 3B0XA 3F2BA 1Q46A 4P0PB 4RUCA 8ICOA 4DS5A 1JXLA 1NOMA 2GOLA 2WB1C 1N63A 2QB1A 1L8OA 3RBDA 5KG1A 1ZD5A 2DGZA 9ICKA 3GZFA 4B6JA 4K4HA 4EYIB 4Q44A 5HHIA 7ICNA 4M2YA 4FZLA 1MN8A 5J0YA 5DG9A 1ZQCA 7ICJA 2EZXA 3ZDEA 1BNPA 4KLQA 5DBAA 2KJ8A 3TQ1A 3KHRA 7ICMA 3K4GA 3NVWA 1PK3A 4TQSA 3AMZA 1UCVA 5DKWA 5DGBA 1TAQA 2A3VA 3CYMA 1N61A 3GV5B 1B0XA 4RQ5A 1S97A 1N60A 4I2FA 3PSTA 2AGOA 4RQ2A 3I76A 5AM4A 3T79A 1B43A 2F44A 4ECVA 4I2CA 4OCZA 3G6XA 4LZGA 4GIBA 4ECTA 1JI7A 2BQUA 2V4QA 4C4SA 4F4YA 4FS2A 2FJ6A 5KFNA 1EXNA 1RXVA 4EX6A 3NRWA 4Q8EA 2WF6A 2E8MA 1L3UA 1A77A 4YP3A 4JUZA 3MGIA 2KTQA 3PR5B 2DL0A 4P0QB 2LBOA 4RQMA 4C8MA 4HYKA 2B0CA 3EPIA 4F5OA 1ZQKA 3MC1A 1PZNA 3ORYA 4B9SA 3MFHA 4GC6A 3PX0A 4RQ0A 1J2MA 1CRXA 1ZQOA 9ICWA 5KFGA 4NLBA 4IQVA 3RJKA 3SYZA 4QNLA 3C1ZA 4EEKA 4F92B 1V9PA 3L3FX 3RJGA 3N7PD 2A1JB 5H2FU 2YN4A 2HOQA 3ZI4A 1M6YA 1BPYA 2ZUBA 3WK7A 2F1JA 3M6KA 2E5SA 1RPLA 1CEZA 4R65A 2EAMA 5EE9A 2QB0B 4E0DA 4KLLA 4KLSA 3QEBZ 4UB3A 3UQ2A 4P0PA 3F5EA 5J0TA 2ASLA 1LVHA 4Q43A 2MSNA 3M7DA 4XRHA 4Z6DA 1SV4A 5KFRA 4C8KA 3HP6A 2OM6A 4QIWC 9ICTA 8ICMA 4KN4A 1KFSA 3D2SA 5KFBA 1T94A 5CHGA 2ZIWA 3SR6A 2JGAA 3H4DA 3SV3A 2G06A 2KMDA 2K4HA 3SI8A 2HOFA 2QKQA 3ISBA 3PW0A 3SENA 3ZDDA 4JMUA 4R64A 5AI8A 2KEYA 2FLLA 8ICZA 2W54A 3SV4A 1Z00B 1UHUA 3C1YA 5J2BA 2PFPA 3HKZF 9ICEA 1NK4A 2HHWA 2HOIA 3NUQA 4C4RA 3NVVA 4Y2SA 5EWFA 5CP2A 3PNCA 2QLTA 1ZQWA 7ICSA 2IBKA 3UPQA 2W9MA 2LHTA 2KSOB 2LKYA 3GQCA 4B9UA 4NLZA 4EZ9A 3HJEA 2KP7A 2ZIUA 4OJOA 4NLCA 1O08A 5GTHU 1N48A 3SAHA 3MR6A 1WUDA 2M9NA 4P0QA 4P4PA 8ICWA 1S8OA 4GXJA 1SXDA 2YMLA 2W8LA 2KIVA 5KFZA 4O3OA 1XSPA 4DL5A 1KFTA 2BGWA 5D49A 2KN7A 1L3SA 3ETRA 4KLJA 3UM9A 5KFVA 5L1MA 3AU6A 2LM1A 4PZOA 4XA5A 4ELVA 3BS5A 1TAUA 2WFAA 1J97A 1MQ2A 5DQGA 1D9FA 2H3ZA 3QXGA 4F71A 1SL1A 1NKBA 7ICKA 4G3IA 1FFUA 1X40A 5F3XB 5KAFU 5HNKA 2QB0A 3KFUF 1JX4A 2E1FA 3RH6A 4Y2VA 1XU4A 1TVAA 4EBDA 4C0ZA 3GFKB 4I2EA 2B6GA 4F4XA 3AEVA 4YMOA 4MF8A 4I2BA 1RG6A 5KTQA 4OO1J 2F1IA 4ECWA 3LYSA 1L3VA 5C5JA 2VJ4A 4ED0A 1ZQEA 1NK9A 4DQRA 2K8BB 5DB8A 2YQEA 4ECSA 3QUTA 3UQ0A 5BPCA 3RJHA 2IHMA 1DGSA 1PVRA 1ZQDA 4U7CA 5AKJA 2H3VA 2G07A 1TKDA 2KNJA 1U48A 5AM3A 3GV7B 2EZYA 3QEAZ 1QQ7A 2W11A 3HT3A 4J9NA 1COOA 2I1QA 3WKDA 5G5GA 4DQSA 7ICPA 2XVTA 7ICIA 5ALIA 4IS7A 5KFSA 2FPLA 1Z00A 5ALUA 4QZEA 3RR8A 8ICFA 4IR1A 8ICBA 3RJJA 3BZKA 5AKHA 3ISDA 3FC4A 2RLTA 2PI5A 3JPQA 1S5LU 3G6YA 3Q8PB 1YZ7A 3WKCA 4UBBA 1JALA 2XI9A 1QSYA 8ICRA 1FFVA 8ICYA 3V6KA 1RQNA 1IG6A 4Y2TA 1ZQUA 4IRDA 8ICKA 1L7OA 1T4GA 1YT3A 1U45A 2HCFA 2KIWA 3GU3A 4DSJA 4UB6U 5KFWA 2ASDA 1WWVA 3ONNA 4M6WA 1ZQGA 2LYBA 2W7OA 2JZBB 4F5NA 3PR4A 3H8SA 2C22A 4R63A 1NZBA 3C5GA 5AKKA 4B9VA 4YMMA 3BS7A 4MFCA 4ECZA 4KLGA 1H38A 7ICQA 3JPNA 3FDSA 2XGQA 5DG7A 4YVZA 2RDJA 4C80A 1T3QA 2Y1JA 4YD2A 4KLFA 1WYGA 5J2GA 3F2CA 3T3FA 3BQ0A 1KDHA 1Z19A 5J2IA 3EYZA 2PFOA 4C8NA 9ICUA 2P6RA 2MUTA 1RXWA 1L8LA 2ES6A 4DEZA 1ZXIA 5L1LA 4JV0A 9ICNA 4UB1A 3TACB 1NJYA 3MR2A 3SEIA 4PH5A 1VDVA 9ICSA 5J2KA 4UATA 4R8UB 4NL9C 4O3SA 1X6IA 2DUYA 3PY8A 3O0FA 5ALVA 3MFIA 1QQ5A 2JEGA 2F1HA 5KFLA 1Q3UA 5DBCA 5D46A 3E0FA 4C8OA 5KFJA 4EYHB 4XQ8A 1Z4NA 2HBJA 3SD7A 2GWSA 3MGVA 4M9HA 4PHPA 4DQQA 4QZCA 2JR5A 3PZPA 1X66A 2MAXA 5ALMA 4F8RA 2K60A 2K4PA 3RJFA 1LV5A 1ZQBA 4JK1A 1T7PA 4QZDA 4AYBF 3C21A 1SKRA 2XCPA 5EWEA 3IG8A 1ZD4A 3NASA 4DL3A 3OJSA 2IOFA 2HHSA 5KFKA 3M8RA 2HI0A 2UVUA 1KEJA 4DQIA 1ZQQA 2KICA 3MABA 4BUGA 3D2NA 2CXYA 2KJ9A 1IM4A 2KV2A 2VA8A 5ALYA 1SGGA 4UASA 1SIJA 2ZTDA 1ZOLA 4Y2JA 4IQTA 3PX6A 4KN7A 2G5HB 2UVWA 3RRGA 2JMGA 3KKAA 2WAQF 1DGJA 3L4PA 3BQ7A 1Z1VA 4I28A 5ALOA 4MFAA 4IQUA 2E8NA 3AN1A 1YZ6A 2GO7A 9ICCA 3UMGA 4B9TA 2XY7A 5ALSA 2F8LA 4ECUA 1KSPA 5DLGA 2YMMA 2KZMA 2ALZA 4RQ6A 4NWIA 2EH9A 4BWJA 3GIJA 4CGZA 4TQRA 1NK0A 4RQ3A 4KMUA 2BDUA 4NM1A 2CRXA 2K4EA 5J2AA 2Y9UA 4FE3A 2W55A 4RPXA 2ZIWB 5KT7A 3NVZA 3J81j 4R8UA 2RP5A 2H5XA 2HHTA 2FPKA 4QZHA 4M9LA 1BGXT 5AI9A 4DQPA 2B21A 3QX7A 5E79U 3F53A 4CCHA 5KFCA 3KHHA 3TI0A 3B9JA 2KHQA 4KLHA 4YR3A 2C2DA 2K4IA 3ISCA 4KLOA 1PUZA 1ZQRA 4UQGA 3DEEA 2IA6A 4O5CA 1A76A 3CW2C 5J0PA 4NLNA 5KFTA 3MR5A 2NV3A 2WTFA 8ICSA 2DKXA 3BQTA 2Y0SF 5J0OA 1IXRA 4UAVA 2BPFA 4F2RA 9ICMA 2BDPA 2W3SA 2D8CA 4DSIA 5C0YA 4IL6U 1BVSA 2ZIUB 1ZD3A 4Y2UA 1RQLA 4RQ4A 1NZPA 5AM1A 4DFJA 2C2RA 2Q0ZX 4QZIA 1MA7A 2NRWA 2R18A 2DQNB 2N1RA 2RQ5A 5F9LA 3QU7A 1IV8A 4QWBA 2P6UA 4PHDA 1ZQZA 2DBYA 1NK8A 4M47A 2NRTA 3QZ7A 1KFDA 4F72A 3C5FA 5AIBA 1NK6A 4KTQA 3Q8RB 4B9LA 3BS5B 2DFLA 4PGYA 2DF4B 2YMPA 8ICQA 2JEIA 3UMBA 3SMVA 4UB8U 5AM2A 4FFDA 3GDXA 3I1YA 5AIAA 1T8EA 5J29A 2MRLA 4DS4A 5KFQA 1FO4A 4OJ6A 1KRPA 2C2EA 5HMLA 3T5HA 4DFKA 1S9FA 2E8PA 4PHEA 3GV8B 2RRDA 1FIQA 2IHNA 1A6SA 1L6NA 5J2FA 3KHLA 4EZ6A 3IV6A 3RTVA 1WWUA 1QSLA 2UVVA 2J6TA 4B9MA 2V9WA 3WKAA 5IILA 4I2HA 2W9BA 5T14A 4YG2A 3EZ5A 4DFDA 5EE0A 4IQWA 3VCBA 2WHEA 1RYSA 2NO5A 1ZQAA 2Z7JA 2KOBA 2JRZA 1RZTA 4GXIA 4BJQA 7ICTA 4PGQA 2F3NA 5KFAA 2J6SA 4RNMA 1X9WA 3FM9A 3N97B 1KKXA 1NK7A 2G08A 2RDIA 3HW8A 3AUOA 4GXKA 1HUZA 1DK3A 3QE9Y 5EWGA 2PMZC 2G5IB 3DV9A 3JPOA 3WKEA 2R8KA 4PL2A 4M04A 3GIKA 2I9GA 2PI4A 5J0RA 4F93B 5KL8B 2ZJ8A 3V6HA 1D8BA 4DF4A 2ZTEA 1D8YA 2EDUA 1DXSA 4IC9A 4CDGA 1MC8A 2W04A 4YQWA 5J0XA 4J9SA 2ISOA 2WB1F 3RB4A 2DPIA 4YR2A 3H0MB 4O3QA 5KFIA 2PKEA 3QYPA 3UXNA 1MSWD 2KHVA 1SWWA 3H0RB 4C4TA 4BDPA 4M6WB 4ICAA 2VKQA 9ICJA 4O0IA 2XY6A 3HWTA 4YXJA 4KITB 1O03A 3GILA 3OHBA 1UA1A 4QWEA 1XC9A 4LZDA 1B22A 1N56A 3LK9A 1XWLA 3TANA 1KW4A 2ZIVB 1JMSA 4J03A 4R66A 1NJWA 1HUOA 1AQ6A 1CI4A 3QUCA 3PO5A 5AI6A 5KG7A 5AM0A 2KKVA 4BGDA 4DFPA 7ICUA 3H8MA 4AYBC 2OH2A 3K75D 2MUTB 1LB2B 5KFUA 5KG0A 3JPSA 4Z6EA 4Q8FA 4KX5A 1X9XA 4PPXA 1TV9A 4O9MA 1ZRMA 2GH1A 1ZQLA 2W43A 7ICHA 8ICAA 4US8A 5EE3A 3M9OB 4DL7A 2R8IA 2KJ5A 3KZIU 2ZTCA 4FZNA 1Q8KA 5J2EA 5KG2A 3QU5A 2VANA 2WAQC 3TADA 3PSFA 2FMPA 4EBEA 5ALKA 4F2SA 4GC7A 1LKYA 2PFQA 5B5EU 5CRXA 3Q8MA 3EW9A 2MU2A 4RNNA 5J8YA 2YB4A 5J2CA 1U47A 4RNOA 4UAYA 5KFYA 2AU0A 3K1ZA 3ED5A 1S0OA 3G6VA 1HJPA 3OHAA 3JPTA 3IN5A 3RFAA 4IRCA 3HRDD 5DBBA 1RDFA 1U49A 4DSKA 2OCEA 2ZUDA 5KL1B 5EOZA 3TFSA 2BCRA 4BX9C 3PX4A 2WF8A 2PXIA 1ZQVA 5CA7A 4P4MA 4I2DA 3PMLA 2HHXA 3NGDA 2KD1A 4B9NA 4RQ1A 5IIIA 4CF5A 4RT3A 3T5KA 3QZ8A 4QIWF 3IDWA 2PFNA 1PK1A 7ICGA 3V7JA 4OJ5A 5AKGA 1Z1BA 2KVCA 2ZIXA 5J0WA 2AXTU 1ZRNA 5L1IA 4CNQA 2BQRA 1X9MA 2HBMA 2OXOA 4I29A 3T5JA 2WF9A 1TK8A 4LJXA 5AI5A 1SZHA 1UA0A 4IRKA 1VLBA 8ICJA 1TE2A 3OJUA 1JROA 4MHVA 4NLGA 4YR0A 3EWAA 3RJIA 2ZIVA 4F50A 1SV0A 2JEJA 1ED1A 1NNLA 5AK3A 3N7RC 9ICHA 5BOMA 4UBCA 2KE7A 2YTUA 2AQ4A 4LVSA 1SB3C 1Z3EB 2JXJA 1NI3A 3UMCA 1XSLA 3CRXA 2EAPA 1UPHA 4TUSA 4EEYA 4XUSA 2R8GA 4GLXA 4DSLA 1JRPA 5AM5A 5HR6A 1JIHA 3MR3A 2KVSA 4A8EA 1V97A 9ICLA 1IIPA 2RHFA 5JU5A 3MBYA 2A1AA 7ICVA 4O3PA 5CWRA 3AM9A 3TKAA 1F44A 3B0YA 4OD0A 4Q45A 3WK6A 1OUQA 5AHXA 2FI1A 5DG8A 1ZQJA 2OYYA 2Y1IA 2F2AB 3AQFA 3WK5A 4J9MA 3D6JA 2W9CA 2W03A 2NRVA 2YX8A 2VA2A 5A0LA 3RB0A 4KLMA 1KTQA 1NJXA 3OPXA 2IMWP 2DPJA 2EZZA 4J9KA 1QSSA 4J9OA 3KKAC 4F5QA 2ZXIA 3PW5A 2NRZA 3LVWA 1S77D 1SZPA 1WCLA 3PO4A 1XS9D 2FLPA 3GIIA 4PZNA 3NRZA 2ATLA 1BNOA 2JH7A 2NO4A 4C8LA 5L9XA 3Q8KA 3NS1A 5B66U 2E8OA 1X2IA 3WKBA 4RPZA 3BQ1A 4MEXA 4RPYA 2IOHA 1J2NA 8ICGA 4USAA 1XO0A 4JV1A 3Q8SB 1CUKA 1Y88A 4O5EA 4QZ9A 2DKZA 1OXJA 4AP9A 4J9QA 1TFRA 9ICIA 5KG6A 1GO3F 2NRXA 3IG5A 3FAHA 2F77X 3HKZC 2LYAA 5KFOA 2IOFK 3QUBA 4ECQA 9ICFA 1L3TA 2HVIA 3QU9A 3DDHA 3THVA 2XICA 4J9RA 8ICXA 8ICHA 1JXEA 5AKXA 4BXOB 1C7YA 5J0SA 4DOBA 1ZJNA 3NVYA 1MQ3A 3C23A 4DWIA 4ELUA 3V7LA 5ALGA 5TISU 2HHUA 2BPCA 5AK4A 2Y9TA 2NYVA 3C2LA 5CB1A 2BQ3A 2AQ0A 4TUPA 3M9MB 1D8LA 5KFXA 4ED1A 1TK0A 2I5HA 5KFMA 5KFHA 5AI4A 1XSNA 3ZDAA 1KLNA 1UT8A 2W9BB 1HIWA 1ZETA 5AI0A 4EBCA 4P4OA 2XGPA 4Y2QA 1S0NA 3D2QA 1BPXA 1ZQMA 5HHHA 4DLEA 1N62A 3QU2A 4CF4A 1ZD2P 1RYUA 4F91B 4M9GA 3RH4A 1N2XA 4JV2A 2LM4A 2HBKA 2W8KA 4DL2A 2KFZA 5DLFA 3RRHA 2Q4TA 1QH9A 1BPDA 5D4BA 2ZUCA 1AROP 4DOAA 3PSIA 8ICCA 8ICPA 2BR0A 3F5AA 3I28A 4Y2PA 2H3IA 7ICFA 2ZG6A 1WG8A 4J9PA 3CP8A 5AK5A 1ZQFA 2A19A 1QCKA 2MA1A 4QW8A 3QUQA 1SWVA 4DF8A 3CNHA 4QW9A 3EUB2 1WCNA 4US9A 2XIDA 5J2HA 3HPOA 4NY8A 3MGHA 4BWMA 4J9LA 2DWQA 4F4WA 4FS1A 3V6JA 4YMNA 3RBEA 3N7SC 1SKWA 4RZRA 3SAFA 1NKCA 4WJ3B 3E58A 4F4ZA 3RAQA 4ZH4A 1S76D 2HW3A 2BCSA 2H3FA 1PVPA 3M8SA 2HBLA 4F5PA 4NXZA 1QLNA 2ODGA 2AGQA 4UB4A 4Y2XA 1OW5A 3M6ZA 4ED3A 1P7DA 1ZQXA 1ZQSA 3ALRA 5KFDA 4TURA 4DCCA 5CJ7A 2P66A 5HR7A 8ICIA 2AJQA 4ED7A 1VJ5A 2YB1A 5DGAA 1Q3VA 1FEZA 1S0MA 4I2IA 5KT4A 2BKEA 1HEKA 2O6KA 5ALFA 4ELTA 5IIMA 3AU2A 4BXOA 3PW7A 9ICRA 4DO9A 1K5OA 1F5SA 3H8JA 5AKZA 4YN4A 3H7IA 5DDMA 1QTMA 3SZ2A 5HP4A 1L7MA 3LDAA 4QWDA 4RQNA 4U6PA 4DSFA 2ISPA 3AQEA 2W7PA 2XY5A 3IM1A 4F3OA 2HDOA 3RJEA 1C20A 2AHOB 1DOQA 1KBUA 4Z6CA 3ZDCA 3OTQA 1U4BA 4I27A 3LWLA 2YMQA 2VA3A 4ECRA 1A0PA 2ASJA 1NJZA 2H3QA 5IIKA 4EENA 2R8JA 5IIOA 2JHDA 4RQ7A 4P2HA 1NKEA 5ALDA 1UQVA 1LKYB 4RQ8A 4QZGA 5G5HA 4QZ8A 4O5KA 3IRUA 3A0HU 2LYHA 3KTQA 2GLEA 3N4MB 3V72A 4I2GA 2I6XA 4NV0A 1KN5A 3WK4A 4I2AA 5AKYA 4NM2A 4YCXA 4Y2YA 1XNSA 3QU4A 2LI6A 2VJ5A 4F5RA 1ZQIA 5JUMA 4KLUA 5KT5A 5DB9A 1ZJMA 1X9SA 2KFNA 5CR0A 3RR7A 1KL9A 1SL2A 3ICXA 1QQ6A 9ICGA 8ICTA 3WK9A 2HHVA 4QZBA 5ALZA 3Q8QB 5IINA 5KG5A 4RT2A 3LWMA 3IP4B 1L5UA 8ICUA 1ZQHA 2F76X 1ZQ1C 3BJYA 4FO6A 1PK1B 4FBTA 2LPEA 3E2EA 5AKLA 4QZFA 5DB7A 2ZIXB 3PSPA 3ZD9A 5ALQA 2K8CB 3A0BU 1B4FA 1T3NA 1ECWA 2HVHA 2JV3A 3L5KA 2UVRA 2QARB 3BDPA 9ICAA 3OGUA 3U26A 4UB5A 3N28A 1K1QA 1BPBA 3PW4A 3FYHA 2KKPA 3VC8A 2XCAA 1NK5A 1DRGA 4I2JA 2D3DA 4UAZA 4YFKA 2FPMA 1V85A 2WF5A 2A1JA 3MDAA 1X42A 2FDRA 1DK2A 5ALTA 3F2DA 1COKA 3H0LB 3TADC 3AL0B 5F9NA 4JWMA 2LMRA 3RB3A 1BPZA 4YD1A 4QWAA 4C7YA 4ED2A 4K4IA 2V4RA 2KZZA 4Y2RA 1F0MA 2EAOA 4EELA 1RYRA 5J2DA 8ICVA 1V38A 3TAPA 4RU9A 3OSNA 5J8YC 5KFEA 5KT2A 3M9NB 2ZJ5A 3KBBA 4UARA 4CRXA 5AKEA 3C29A 2ZJAA 5HMMA 5L1KA 5J0QA 3TARA 2OEHA 2E3TA 2W3RA 3ZDBA 4QWCA 4ED6A 4ZOHC 5J2JA 4EX7A 4O3RA 3JPPA 3ETLA 2BCQA 2OWOA 2G09A 3TFRA 5JTIA 1ZQTA 4MEYA 4KLDA 4UW9A 2KK0A 2W9CB 5ALRA 5ALPA 3KOOA 3JPRA 3R9KA 4KLIA 3SAGA 2CN1A 5ALXA 4PGXA 4Z6FA 2M0NA
chains in the Genus database with same CATH topology
1B4FA 3H8MA 2JV3A 2D8CA 2QARB 4RQNA 3KKAC 3KKAA 1X9XA 1Z1VA 3BQ7A 2KSOB 2F3NA 2E8NA 4IS7A 2QB1A 2ES6A 4PZNA 2EANA 2KSOA 5KNIA 4MHVA 2E8OA 3TACB 2D3DA 3SEIA 1V85A 1SV0C 1SV0A 3HILA 2EAMA 2QB0B 4NL9C 1SXDA 4NL9A 2KIVA 2DKZA 2KE7A 2YTUA 1OXJA 1COKA 2F8KA 3TADC 3TADA 2QARA 1UQVA 1LKYB 3BS5B 2EAPA 2LMRA 1PK3A 5L1MA 1DXSA 1UCVA 4PZOA 2GLEA 1LKYA 3BS5A 1SV4A 1F0MA 2EAOA 3K1RB 2Y9UA 2FE9A 1V38A 1X66A 5J8YC 5J8YA 1B0XA 1X40A 5F3XB 2K60A 2QB0A 5JU5A 2KMDA 2K4PA 2ESEA 2B6GA 5JRTA 2QKQA 2F44A 3SENA 2L5YA 1JI7A 1WWVA 2E8PA 1OW5A 2Y9TA 1SXEA 1RG6A 4NJ8A 5JTIA 2KG5A 2E8MA 1KW4A 1WWUA 3BS7A 1PK1B 2DL0A 2LPEA 4RQMA 2DKXA 1SGGA 3IDWA 1PK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4F A;  3H8M A;  2JV3 A;  2D8C A;  2QAR B;  4RQN A;  3KKA C;  3KKA A;  1X9X A;  1Z1V A;  3BQ7 A;  2KSO B;  2F3N A;  2E8N A;  4IS7 A;  2QB1 A;  2ES6 A;  4PZN A;  2EAN A;  2KSO A;  5KNI A;  4MHV A;  2E8O A;  3TAC B;  2D3D A;  3SEI A;  1V85 A;  1SV0 C;  1SV0 A;  3HIL A;  2EAM A;  2QB0 B;  4NL9 C;  1SXD A;  4NL9 A;  2KIV A;  2DKZ A;  2KE7 A;  2YTU A;  1OXJ A;  1COK A;  2F8K A;  3TAD C;  3TAD A;  2QAR A;  1UQV A;  1LKY B;  3BS5 B;  2EAP A;  2LMR A;  1PK3 A;  5L1M A;  1DXS A;  1UCV A;  4PZO A;  2GLE A;  1LKY A;  3BS5 A;  1SV4 A;  1F0M A;  2EAO A;  3K1R B;  2Y9U A;  2FE9 A;  1V38 A;  1X66 A;  5J8Y C;  5J8Y A;  1B0X A;  1X40 A;  5F3X B;  2K60 A;  2QB0 A;  5JU5 A;  2KMD A;  2K4P A;  2ESE A;  2B6G A;  5JRT A;  2QKQ A;  2F44 A;  3SEN A;  2L5Y A;  1JI7 A;  1WWV A;  2E8P A;  1OW5 A;  2Y9T A;  1SXE A;  1RG6 A;  4NJ8 A;  5JTI A;  2KG5 A;  2E8M A;  1KW4 A;  1WWU A;  3BS7 A;  1PK1 B;  2DL0 A;  2LPE A;  4RQM A;  2DKX A;  1SGG A;  3IDW A;  1PK1 A; 
#chains in the Genus database with same CATH topology
 1ZQP A;  9ICB A;  1N5X A;  5IIJ A;  4ACO A;  3PW2 A;  5L1J A;  1U9L A;  3BZC A;  5DQH A;  4X5V A;  5KG3 A;  4RUA A;  2KSO A;  1SL0 A;  5AKI A;  1D9D A;  4ED8 A;  1SV0 C;  3KD3 A;  3HIL A;  3H4B A;  2AH5 A;  3SQI A;  2FMS A;  3Q8L A;  2HSZ A;  2FLN A;  2F8K A;  5ALN A;  1ZQN A;  2E1E A;  9ICX A;  2QAR A;  4OJL A;  2XO7 A;  9ICQ A;  3UXO A;  7ICE A;  3H8W A;  1S10 A;  7ICR A;  3PMN A;  8ICE A;  3UXP A;  3RF9 A;  3K1R B;  4DL6 A;  2FE9 A;  2Y0S C;  3S6J A;  9ICP A;  2HHQ A;  1ZYQ A;  4OJP A;  7ICO A;  4DOC A;  4O3M A;  2D6F C;  5CEH A;  2HMX A;  8ICN A;  3C2K A;  3MDC A;  2ESE A;  5JRT A;  5K4L A;  2L5Y A;  2PMZ F;  2YY6 A;  4DSE A;  4KX3 A;  3V7K A;  3C28 A;  4NJ8 A;  1UT5 A;  8ICL A;  4CF3 A;  5ALW A;  1SKS A;  2ZXH A;  2KG5 A;  1S0V A;  1N5W A;  4YXM A;  4C7Z A;  2R8H A;  2JH1 A;  3IHQ B;  4ECX A;  2WF7 A;  2C28 A;  4M9N A;  5ALJ A;  4PL1 A;  1TK5 A;  2BCU A;  4M0A A;  2J6U A;  4QJF B;  1URJ A;  5ALH A;  3EPG A;  1TAM A;  5KG4 A;  4M9J A;  5BOL A;  1BPE A;  3C2M A;  4PHA A;  3KZX A;  3KHG A;  2EAN A;  3M1Y A;  9ICV A;  2BHN A;  5KNI A;  5KFF A;  5ALE A;  3WK8 A;  4MFF A;  1KQQ A;  1PVQ A;  3OSP A;  2JEF A;  2BPG A;  4NL9 A;  2CPR A;  4KLE A;  4CE6 A;  3QNM A;  3HX0 A;  4GFJ A;  4PJ0 U;  4K4G A;  5TZV A;  3PV8 A;  4MF2 A;  4IR9 A;  1L7P A;  2BZF A;  4DLG A;  4UAW A;  5KT6 A;  1XO1 A;  5ALL A;  4F4K A;  1Z4O A;  1K1S A;  5J0U A;  4QZA A;  2G0A A;  3H40 A;  5DDY A;  5KFP A;  4G9B A;  3RAX A;  4KMO B;  4UB2 A;  9ICO A;  5AK6 A;  3PVX A;  3GIM A;  2XC9 A;  2K8A A;  3WU2 U;  3LVV A;  2W9A A;  2KZ3 A;  4JWN A;  4TUQ A;  2EQY A;  3TAQ A;  5DQI A;  1L7N A;  4HAI A;  3RB6 A;  3BQ2 A;  1SXE A;  5FP0 A;  3RH5 A;  2AGP A;  5DB6 A;  1JUD A;  1JN3 A;  2BCV A;  2OHF A;  5EE1 A;  7ICL A;  4ECY A;  4FZM A;  2K89 A;  4O3N A;  3NTU A;  1X6J A;  4DFM A;  2JZB A;  5KAI U;  4KLT A;  1ZQY A;  2P35 A;  3ZD8 A;  4FBU A;  5KT3 A;  2VIX A;  2FMQ A;  5AIC A;  1RM6 C;  5GTI U;  3T5L A;  4UAU A;  4NLK A;  4DL4 A;  4JB3 A;  3B0X A;  3F2B A;  1Q46 A;  4P0P B;  4RUC A;  8ICO A;  4DS5 A;  1JXL A;  1NOM A;  2GOL A;  2WB1 C;  1N63 A;  2QB1 A;  1L8O A;  3RBD A;  5KG1 A;  1ZD5 A;  2DGZ A;  9ICK A;  3GZF A;  4B6J A;  4K4H A;  4EYI B;  4Q44 A;  5HHI A;  7ICN A;  4M2Y A;  4FZL A;  1MN8 A;  5J0Y A;  5DG9 A;  1ZQC A;  7ICJ A;  2EZX A;  3ZDE A;  1BNP A;  4KLQ A;  5DBA A;  2KJ8 A;  3TQ1 A;  3KHR A;  7ICM A;  3K4G A;  3NVW A;  1PK3 A;  4TQS A;  3AMZ A;  1UCV A;  5DKW A;  5DGB A;  1TAQ A;  2A3V A;  3CYM A;  1N61 A;  3GV5 B;  1B0X A;  4RQ5 A;  1S97 A;  1N60 A;  4I2F A;  3PST A;  2AGO A;  4RQ2 A;  3I76 A;  5AM4 A;  3T79 A;  1B43 A;  2F44 A;  4ECV A;  4I2C A;  4OCZ A;  3G6X A;  4LZG A;  4GIB A;  4ECT A;  1JI7 A;  2BQU A;  2V4Q A;  4C4S A;  4F4Y A;  4FS2 A;  2FJ6 A;  5KFN A;  1EXN A;  1RXV A;  4EX6 A;  3NRW A;  4Q8E A;  2WF6 A;  2E8M A;  1L3U A;  1A77 A;  4YP3 A;  4JUZ A;  3MGI A;  2KTQ A;  3PR5 B;  2DL0 A;  4P0Q B;  2LBO A;  4RQM A;  4C8M A;  4HYK A;  2B0C A;  3EPI A;  4F5O A;  1ZQK A;  3MC1 A;  1PZN A;  3ORY A;  4B9S A;  3MFH A;  4GC6 A;  3PX0 A;  4RQ0 A;  1J2M A;  1CRX A;  1ZQO A;  9ICW A;  5KFG A;  4NLB A;  4IQV A;  3RJK A;  3SYZ A;  4QNL A;  3C1Z A;  4EEK A;  4F92 B;  1V9P A;  3L3F X;  3RJG A;  3N7P D;  2A1J B;  5H2F U;  2YN4 A;  2HOQ A;  3ZI4 A;  1M6Y A;  1BPY A;  2ZUB A;  3WK7 A;  2F1J A;  3M6K A;  2E5S A;  1RPL A;  1CEZ A;  4R65 A;  2EAM A;  5EE9 A;  2QB0 B;  4E0D A;  4KLL A;  4KLS A;  3QEB Z;  4UB3 A;  3UQ2 A;  4P0P A;  3F5E A;  5J0T A;  2ASL A;  1LVH A;  4Q43 A;  2MSN A;  3M7D A;  4XRH A;  4Z6D A;  1SV4 A;  5KFR A;  4C8K A;  3HP6 A;  2OM6 A;  4QIW C;  9ICT A;  8ICM A;  4KN4 A;  1KFS A;  3D2S A;  5KFB A;  1T94 A;  5CHG A;  2ZIW A;  3SR6 A;  2JGA A;  3H4D A;  3SV3 A;  2G06 A;  2KMD A;  2K4H A;  3SI8 A;  2HOF A;  2QKQ A;  3ISB A;  3PW0 A;  3SEN A;  3ZDD A;  4JMU A;  4R64 A;  5AI8 A;  2KEY A;  2FLL A;  8ICZ A;  2W54 A;  3SV4 A;  1Z00 B;  1UHU A;  3C1Y A;  5J2B A;  2PFP A;  3HKZ F;  9ICE A;  1NK4 A;  2HHW A;  2HOI A;  3NUQ A;  4C4R A;  3NVV A;  4Y2S A;  5EWF A;  5CP2 A;  3PNC A;  2QLT A;  1ZQW A;  7ICS A;  2IBK A;  3UPQ A;  2W9M A;  2LHT A;  2KSO B;  2LKY A;  3GQC A;  4B9U A;  4NLZ A;  4EZ9 A;  3HJE A;  2KP7 A;  2ZIU A;  4OJO A;  4NLC A;  1O08 A;  5GTH U;  1N48 A;  3SAH A;  3MR6 A;  1WUD A;  2M9N A;  4P0Q A;  4P4P A;  8ICW A;  1S8O A;  4GXJ A;  1SXD A;  2YML A;  2W8L A;  2KIV A;  5KFZ A;  4O3O A;  1XSP A;  4DL5 A;  1KFT A;  2BGW A;  5D49 A;  2KN7 A;  1L3S A;  3ETR A;  4KLJ A;  3UM9 A;  5KFV A;  5L1M A;  3AU6 A;  2LM1 A;  4PZO A;  4XA5 A;  4ELV A;  3BS5 A;  1TAU A;  2WFA A;  1J97 A;  1MQ2 A;  5DQG A;  1D9F A;  2H3Z A;  3QXG A;  4F71 A;  1SL1 A;  1NKB A;  7ICK A;  4G3I A;  1FFU A;  1X40 A;  5F3X B;  5KAF U;  5HNK A;  2QB0 A;  3KFU F;  1JX4 A;  2E1F A;  3RH6 A;  4Y2V A;  1XU4 A;  1TVA A;  4EBD A;  4C0Z A;  3GFK B;  4I2E A;  2B6G A;  4F4X A;  3AEV A;  4YMO A;  4MF8 A;  4I2B A;  1RG6 A;  5KTQ A;  4OO1 J;  2F1I A;  4ECW A;  3LYS A;  1L3V A;  5C5J A;  2VJ4 A;  4ED0 A;  1ZQE A;  1NK9 A;  4DQR A;  2K8B B;  5DB8 A;  2YQE A;  4ECS A;  3QUT A;  3UQ0 A;  5BPC A;  3RJH A;  2IHM A;  1DGS A;  1PVR A;  1ZQD A;  4U7C A;  5AKJ A;  2H3V A;  2G07 A;  1TKD A;  2KNJ A;  1U48 A;  5AM3 A;  3GV7 B;  2EZY A;  3QEA Z;  1QQ7 A;  2W11 A;  3HT3 A;  4J9N A;  1COO A;  2I1Q A;  3WKD A;  5G5G A;  4DQS A;  7ICP A;  2XVT A;  7ICI A;  5ALI A;  4IS7 A;  5KFS A;  2FPL A;  1Z00 A;  5ALU A;  4QZE A;  3RR8 A;  8ICF A;  4IR1 A;  8ICB A;  3RJJ A;  3BZK A;  5AKH A;  3ISD A;  3FC4 A;  2RLT A;  2PI5 A;  3JPQ A;  1S5L U;  3G6Y A;  3Q8P B;  1YZ7 A;  3WKC A;  4UBB A;  1JAL A;  2XI9 A;  1QSY A;  8ICR A;  1FFV A;  8ICY A;  3V6K A;  1RQN A;  1IG6 A;  4Y2T A;  1ZQU A;  4IRD A;  8ICK A;  1L7O A;  1T4G A;  1YT3 A;  1U45 A;  2HCF A;  2KIW A;  3GU3 A;  4DSJ A;  4UB6 U;  5KFW A;  2ASD A;  1WWV A;  3ONN A;  4M6W A;  1ZQG A;  2LYB A;  2W7O A;  2JZB B;  4F5N A;  3PR4 A;  3H8S A;  2C22 A;  4R63 A;  1NZB A;  3C5G A;  5AKK A;  4B9V A;  4YMM A;  3BS7 A;  4MFC A;  4ECZ A;  4KLG A;  1H38 A;  7ICQ A;  3JPN A;  3FDS A;  2XGQ A;  5DG7 A;  4YVZ A;  2RDJ A;  4C80 A;  1T3Q A;  2Y1J A;  4YD2 A;  4KLF A;  1WYG A;  5J2G A;  3F2C A;  3T3F A;  3BQ0 A;  1KDH A;  1Z19 A;  5J2I A;  3EYZ A;  2PFO A;  4C8N A;  9ICU A;  2P6R A;  2MUT A;  1RXW A;  1L8L A;  2ES6 A;  4DEZ A;  1ZXI A;  5L1L A;  4JV0 A;  9ICN A;  4UB1 A;  3TAC B;  1NJY A;  3MR2 A;  3SEI A;  4PH5 A;  1VDV A;  9ICS A;  5J2K A;  4UAT A;  4R8U B;  4NL9 C;  4O3S A;  1X6I A;  2DUY A;  3PY8 A;  3O0F A;  5ALV A;  3MFI A;  1QQ5 A;  2JEG A;  2F1H A;  5KFL A;  1Q3U A;  5DBC A;  5D46 A;  3E0F A;  4C8O A;  5KFJ A;  4EYH B;  4XQ8 A;  1Z4N A;  2HBJ A;  3SD7 A;  2GWS A;  3MGV A;  4M9H A;  4PHP A;  4DQQ A;  4QZC A;  2JR5 A;  3PZP A;  1X66 A;  2MAX A;  5ALM A;  4F8R A;  2K60 A;  2K4P A;  3RJF A;  1LV5 A;  1ZQB A;  4JK1 A;  1T7P A;  4QZD A;  4AYB F;  3C21 A;  1SKR A;  2XCP A;  5EWE A;  3IG8 A;  1ZD4 A;  3NAS A;  4DL3 A;  3OJS A;  2IOF A;  2HHS A;  5KFK A;  3M8R A;  2HI0 A;  2UVU A;  1KEJ A;  4DQI A;  1ZQQ A;  2KIC A;  3MAB A;  4BUG A;  3D2N A;  2CXY A;  2KJ9 A;  1IM4 A;  2KV2 A;  2VA8 A;  5ALY A;  1SGG A;  4UAS A;  1SIJ A;  2ZTD A;  1ZOL A;  4Y2J A;  4IQT A;  3PX6 A;  4KN7 A;  2G5H B;  2UVW A;  3RRG A;  2JMG A;  3KKA A;  2WAQ F;  1DGJ A;  3L4P A;  3BQ7 A;  1Z1V A;  4I28 A;  5ALO A;  4MFA A;  4IQU A;  2E8N A;  3AN1 A;  1YZ6 A;  2GO7 A;  9ICC A;  3UMG A;  4B9T A;  2XY7 A;  5ALS A;  2F8L A;  4ECU A;  1KSP A;  5DLG A;  2YMM A;  2KZM A;  2ALZ A;  4RQ6 A;  4NWI A;  2EH9 A;  4BWJ A;  3GIJ A;  4CGZ A;  4TQR A;  1NK0 A;  4RQ3 A;  4KMU A;  2BDU A;  4NM1 A;  2CRX A;  2K4E A;  5J2A A;  2Y9U A;  4FE3 A;  2W55 A;  4RPX A;  2ZIW B;  5KT7 A;  3NVZ A;  3J81 j;  4R8U A;  2RP5 A;  2H5X A;  2HHT A;  2FPK A;  4QZH A;  4M9L A;  1BGX T;  5AI9 A;  4DQP A;  2B21 A;  3QX7 A;  5E79 U;  3F53 A;  4CCH A;  5KFC A;  3KHH A;  3TI0 A;  3B9J A;  2KHQ A;  4KLH A;  4YR3 A;  2C2D A;  2K4I A;  3ISC A;  4KLO A;  1PUZ A;  1ZQR A;  4UQG A;  3DEE A;  2IA6 A;  4O5C A;  1A76 A;  3CW2 C;  5J0P A;  4NLN A;  5KFT A;  3MR5 A;  2NV3 A;  2WTF A;  8ICS A;  2DKX A;  3BQT A;  2Y0S F;  5J0O A;  1IXR A;  4UAV A;  2BPF A;  4F2R A;  9ICM A;  2BDP A;  2W3S A;  2D8C A;  4DSI A;  5C0Y A;  4IL6 U;  1BVS A;  2ZIU B;  1ZD3 A;  4Y2U A;  1RQL A;  4RQ4 A;  1NZP A;  5AM1 A;  4DFJ A;  2C2R A;  2Q0Z X;  4QZI A;  1MA7 A;  2NRW A;  2R18 A;  2DQN B;  2N1R A;  2RQ5 A;  5F9L A;  3QU7 A;  1IV8 A;  4QWB A;  2P6U A;  4PHD A;  1ZQZ A;  2DBY A;  1NK8 A;  4M47 A;  2NRT A;  3QZ7 A;  1KFD A;  4F72 A;  3C5F A;  5AIB A;  1NK6 A;  4KTQ A;  3Q8R B;  4B9L A;  3BS5 B;  2DFL A;  4PGY A;  2DF4 B;  2YMP A;  8ICQ A;  2JEI A;  3UMB A;  3SMV A;  4UB8 U;  5AM2 A;  4FFD A;  3GDX A;  3I1Y A;  5AIA A;  1T8E A;  5J29 A;  2MRL A;  4DS4 A;  5KFQ A;  1FO4 A;  4OJ6 A;  1KRP A;  2C2E A;  5HML A;  3T5H A;  4DFK A;  1S9F A;  2E8P A;  4PHE A;  3GV8 B;  2RRD A;  1FIQ A;  2IHN A;  1A6S A;  1L6N A;  5J2F A;  3KHL A;  4EZ6 A;  3IV6 A;  3RTV A;  1WWU A;  1QSL A;  2UVV A;  2J6T A;  4B9M A;  2V9W A;  3WKA A;  5IIL A;  4I2H A;  2W9B A;  5T14 A;  4YG2 A;  3EZ5 A;  4DFD A;  5EE0 A;  4IQW A;  3VCB A;  2WHE A;  1RYS A;  2NO5 A;  1ZQA A;  2Z7J A;  2KOB A;  2JRZ A;  1RZT A;  4GXI A;  4BJQ A;  7ICT A;  4PGQ A;  2F3N A;  5KFA A;  2J6S A;  4RNM A;  1X9W A;  3FM9 A;  3N97 B;  1KKX A;  1NK7 A;  2G08 A;  2RDI A;  3HW8 A;  3AUO A;  4GXK A;  1HUZ A;  1DK3 A;  3QE9 Y;  5EWG A;  2PMZ C;  2G5I B;  3DV9 A;  3JPO A;  3WKE A;  2R8K A;  4PL2 A;  4M04 A;  3GIK A;  2I9G A;  2PI4 A;  5J0R A;  4F93 B;  5KL8 B;  2ZJ8 A;  3V6H A;  1D8B A;  4DF4 A;  2ZTE A;  1D8Y A;  2EDU A;  1DXS A;  4IC9 A;  4CDG A;  1MC8 A;  2W04 A;  4YQW A;  5J0X A;  4J9S A;  2ISO A;  2WB1 F;  3RB4 A;  2DPI A;  4YR2 A;  3H0M B;  4O3Q A;  5KFI A;  2PKE A;  3QYP A;  3UXN A;  1MSW D;  2KHV A;  1SWW A;  3H0R B;  4C4T A;  4BDP A;  4M6W B;  4ICA A;  2VKQ A;  9ICJ A;  4O0I A;  2XY6 A;  3HWT A;  4YXJ A;  4KIT B;  1O03 A;  3GIL A;  3OHB A;  1UA1 A;  4QWE A;  1XC9 A;  4LZD A;  1B22 A;  1N56 A;  3LK9 A;  1XWL A;  3TAN A;  1KW4 A;  2ZIV B;  1JMS A;  4J03 A;  4R66 A;  1NJW A;  1HUO A;  1AQ6 A;  1CI4 A;  3QUC A;  3PO5 A;  5AI6 A;  5KG7 A;  5AM0 A;  2KKV A;  4BGD A;  4DFP A;  7ICU A;  3H8M A;  4AYB C;  2OH2 A;  3K75 D;  2MUT B;  1LB2 B;  5KFU A;  5KG0 A;  3JPS A;  4Z6E A;  4Q8F A;  4KX5 A;  1X9X A;  4PPX A;  1TV9 A;  4O9M A;  1ZRM A;  2GH1 A;  1ZQL A;  2W43 A;  7ICH A;  8ICA A;  4US8 A;  5EE3 A;  3M9O B;  4DL7 A;  2R8I A;  2KJ5 A;  3KZI U;  2ZTC A;  4FZN A;  1Q8K A;  5J2E A;  5KG2 A;  3QU5 A;  2VAN A;  2WAQ C;  3TAD A;  3PSF A;  2FMP A;  4EBE A;  5ALK A;  4F2S A;  4GC7 A;  1LKY A;  2PFQ A;  5B5E U;  5CRX A;  3Q8M A;  3EW9 A;  2MU2 A;  4RNN A;  5J8Y A;  2YB4 A;  5J2C A;  1U47 A;  4RNO A;  4UAY A;  5KFY A;  2AU0 A;  3K1Z A;  3ED5 A;  1S0O A;  3G6V A;  1HJP A;  3OHA A;  3JPT A;  3IN5 A;  3RFA A;  4IRC A;  3HRD D;  5DBB A;  1RDF A;  1U49 A;  4DSK A;  2OCE A;  2ZUD A;  5KL1 B;  5EOZ A;  3TFS A;  2BCR A;  4BX9 C;  3PX4 A;  2WF8 A;  2PXI A;  1ZQV A;  5CA7 A;  4P4M A;  4I2D A;  3PML A;  2HHX A;  3NGD A;  2KD1 A;  4B9N A;  4RQ1 A;  5III A;  4CF5 A;  4RT3 A;  3T5K A;  3QZ8 A;  4QIW F;  3IDW A;  2PFN A;  1PK1 A;  7ICG A;  3V7J A;  4OJ5 A;  5AKG A;  1Z1B A;  2KVC A;  2ZIX A;  5J0W A;  2AXT U;  1ZRN A;  5L1I A;  4CNQ A;  2BQR A;  1X9M A;  2HBM A;  2OXO A;  4I29 A;  3T5J A;  2WF9 A;  1TK8 A;  4LJX A;  5AI5 A;  1SZH A;  1UA0 A;  4IRK A;  1VLB A;  8ICJ A;  1TE2 A;  3OJU A;  1JRO A;  4MHV A;  4NLG A;  4YR0 A;  3EWA A;  3RJI A;  2ZIV A;  4F50 A;  1SV0 A;  2JEJ A;  1ED1 A;  1NNL A;  5AK3 A;  3N7R C;  9ICH A;  5BOM A;  4UBC A;  2KE7 A;  2YTU A;  2AQ4 A;  4LVS A;  1SB3 C;  1Z3E B;  2JXJ A;  1NI3 A;  3UMC A;  1XSL A;  3CRX A;  2EAP A;  1UPH A;  4TUS A;  4EEY A;  4XUS A;  2R8G A;  4GLX A;  4DSL A;  1JRP A;  5AM5 A;  5HR6 A;  1JIH A;  3MR3 A;  2KVS A;  4A8E A;  1V97 A;  9ICL A;  1IIP A;  2RHF A;  5JU5 A;  3MBY A;  2A1A A;  7ICV A;  4O3P A;  5CWR A;  3AM9 A;  3TKA A;  1F44 A;  3B0Y A;  4OD0 A;  4Q45 A;  3WK6 A;  1OUQ A;  5AHX A;  2FI1 A;  5DG8 A;  1ZQJ A;  2OYY A;  2Y1I A;  2F2A B;  3AQF A;  3WK5 A;  4J9M A;  3D6J A;  2W9C A;  2W03 A;  2NRV A;  2YX8 A;  2VA2 A;  5A0L A;  3RB0 A;  4KLM A;  1KTQ A;  1NJX A;  3OPX A;  2IMW P;  2DPJ A;  2EZZ A;  4J9K A;  1QSS A;  4J9O A;  3KKA C;  4F5Q A;  2ZXI A;  3PW5 A;  2NRZ A;  3LVW A;  1S77 D;  1SZP A;  1WCL A;  3PO4 A;  1XS9 D;  2FLP A;  3GII A;  4PZN A;  3NRZ A;  2ATL A;  1BNO A;  2JH7 A;  2NO4 A;  4C8L A;  5L9X A;  3Q8K A;  3NS1 A;  5B66 U;  2E8O A;  1X2I A;  3WKB A;  4RPZ A;  3BQ1 A;  4MEX A;  4RPY A;  2IOH A;  1J2N A;  8ICG A;  4USA A;  1XO0 A;  4JV1 A;  3Q8S B;  1CUK A;  1Y88 A;  4O5E A;  4QZ9 A;  2DKZ A;  1OXJ A;  4AP9 A;  4J9Q A;  1TFR A;  9ICI A;  5KG6 A;  1GO3 F;  2NRX A;  3IG5 A;  3FAH A;  2F77 X;  3HKZ C;  2LYA A;  5KFO A;  2IOF K;  3QUB A;  4ECQ A;  9ICF A;  1L3T A;  2HVI A;  3QU9 A;  3DDH A;  3THV A;  2XIC A;  4J9R A;  8ICX A;  8ICH A;  1JXE A;  5AKX A;  4BXO B;  1C7Y A;  5J0S A;  4DOB A;  1ZJN A;  3NVY A;  1MQ3 A;  3C23 A;  4DWI A;  4ELU A;  3V7L A;  5ALG A;  5TIS U;  2HHU A;  2BPC A;  5AK4 A;  2Y9T A;  2NYV A;  3C2L A;  5CB1 A;  2BQ3 A;  2AQ0 A;  4TUP A;  3M9M B;  1D8L A;  5KFX A;  4ED1 A;  1TK0 A;  2I5H A;  5KFM A;  5KFH A;  5AI4 A;  1XSN A;  3ZDA A;  1KLN A;  1UT8 A;  2W9B B;  1HIW A;  1ZET A;  5AI0 A;  4EBC A;  4P4O A;  2XGP A;  4Y2Q A;  1S0N A;  3D2Q A;  1BPX A;  1ZQM A;  5HHH A;  4DLE A;  1N62 A;  3QU2 A;  4CF4 A;  1ZD2 P;  1RYU A;  4F91 B;  4M9G A;  3RH4 A;  1N2X A;  4JV2 A;  2LM4 A;  2HBK A;  2W8K A;  4DL2 A;  2KFZ A;  5DLF A;  3RRH A;  2Q4T A;  1QH9 A;  1BPD A;  5D4B A;  2ZUC A;  1ARO P;  4DOA A;  3PSI A;  8ICC A;  8ICP A;  2BR0 A;  3F5A A;  3I28 A;  4Y2P A;  2H3I A;  7ICF A;  2ZG6 A;  1WG8 A;  4J9P A;  3CP8 A;  5AK5 A;  1ZQF A;  2A19 A;  1QCK A;  2MA1 A;  4QW8 A;  3QUQ A;  1SWV A;  4DF8 A;  3CNH A;  4QW9 A;  3EUB 2;  1WCN A;  4US9 A;  2XID A;  5J2H A;  3HPO A;  4NY8 A;  3MGH A;  4BWM A;  4J9L A;  2DWQ A;  4F4W A;  4FS1 A;  3V6J A;  4YMN A;  3RBE A;  3N7S C;  1SKW A;  4RZR A;  3SAF A;  1NKC A;  4WJ3 B;  3E58 A;  4F4Z A;  3RAQ A;  4ZH4 A;  1S76 D;  2HW3 A;  2BCS A;  2H3F A;  1PVP A;  3M8S A;  2HBL A;  4F5P A;  4NXZ A;  1QLN A;  2ODG A;  2AGQ A;  4UB4 A;  4Y2X A;  1OW5 A;  3M6Z A;  4ED3 A;  1P7D A;  1ZQX A;  1ZQS A;  3ALR A;  5KFD A;  4TUR A;  4DCC A;  5CJ7 A;  2P66 A;  5HR7 A;  8ICI A;  2AJQ A;  4ED7 A;  1VJ5 A;  2YB1 A;  5DGA A;  1Q3V A;  1FEZ A;  1S0M A;  4I2I A;  5KT4 A;  2BKE A;  1HEK A;  2O6K A;  5ALF A;  4ELT A;  5IIM A;  3AU2 A;  4BXO A;  3PW7 A;  9ICR A;  4DO9 A;  1K5O A;  1F5S A;  3H8J A;  5AKZ A;  4YN4 A;  3H7I A;  5DDM A;  1QTM A;  3SZ2 A;  5HP4 A;  1L7M A;  3LDA A;  4QWD A;  4RQN A;  4U6P A;  4DSF A;  2ISP A;  3AQE A;  2W7P A;  2XY5 A;  3IM1 A;  4F3O A;  2HDO A;  3RJE A;  1C20 A;  2AHO B;  1DOQ A;  1KBU A;  4Z6C A;  3ZDC A;  3OTQ A;  1U4B A;  4I27 A;  3LWL A;  2YMQ A;  2VA3 A;  4ECR A;  1A0P A;  2ASJ A;  1NJZ A;  2H3Q A;  5IIK A;  4EEN A;  2R8J A;  5IIO A;  2JHD A;  4RQ7 A;  4P2H A;  1NKE A;  5ALD A;  1UQV A;  1LKY B;  4RQ8 A;  4QZG A;  5G5H A;  4QZ8 A;  4O5K A;  3IRU A;  3A0H U;  2LYH A;  3KTQ A;  2GLE A;  3N4M B;  3V72 A;  4I2G A;  2I6X A;  4NV0 A;  1KN5 A;  3WK4 A;  4I2A A;  5AKY A;  4NM2 A;  4YCX A;  4Y2Y A;  1XNS A;  3QU4 A;  2LI6 A;  2VJ5 A;  4F5R A;  1ZQI A;  5JUM A;  4KLU A;  5KT5 A;  5DB9 A;  1ZJM A;  1X9S A;  2KFN A;  5CR0 A;  3RR7 A;  1KL9 A;  1SL2 A;  3ICX A;  1QQ6 A;  9ICG A;  8ICT A;  3WK9 A;  2HHV A;  4QZB A;  5ALZ A;  3Q8Q B;  5IIN A;  5KG5 A;  4RT2 A;  3LWM A;  3IP4 B;  1L5U A;  8ICU A;  1ZQH A;  2F76 X;  1ZQ1 C;  3BJY A;  4FO6 A;  1PK1 B;  4FBT A;  2LPE A;  3E2E A;  5AKL A;  4QZF A;  5DB7 A;  2ZIX B;  3PSP A;  3ZD9 A;  5ALQ A;  2K8C B;  3A0B U;  1B4F A;  1T3N A;  1ECW A;  2HVH A;  2JV3 A;  3L5K A;  2UVR A;  2QAR B;  3BDP A;  9ICA A;  3OGU A;  3U26 A;  4UB5 A;  3N28 A;  1K1Q A;  1BPB A;  3PW4 A;  3FYH A;  2KKP A;  3VC8 A;  2XCA A;  1NK5 A;  1DRG A;  4I2J A;  2D3D A;  4UAZ A;  4YFK A;  2FPM A;  1V85 A;  2WF5 A;  2A1J A;  3MDA A;  1X42 A;  2FDR A;  1DK2 A;  5ALT A;  3F2D A;  1COK A;  3H0L B;  3TAD C;  3AL0 B;  5F9N A;  4JWM A;  2LMR A;  3RB3 A;  1BPZ A;  4YD1 A;  4QWA A;  4C7Y A;  4ED2 A;  4K4I A;  2V4R A;  2KZZ A;  4Y2R A;  1F0M A;  2EAO A;  4EEL A;  1RYR A;  5J2D A;  8ICV A;  1V38 A;  3TAP A;  4RU9 A;  3OSN A;  5J8Y C;  5KFE A;  5KT2 A;  3M9N B;  2ZJ5 A;  3KBB A;  4UAR A;  4CRX A;  5AKE A;  3C29 A;  2ZJA A;  5HMM A;  5L1K A;  5J0Q A;  3TAR A;  2OEH A;  2E3T A;  2W3R A;  3ZDB A;  4QWC A;  4ED6 A;  4ZOH C;  5J2J A;  4EX7 A;  4O3R A;  3JPP A;  3ETL A;  2BCQ A;  2OWO A;  2G09 A;  3TFR A;  5JTI A;  1ZQT A;  4MEY A;  4KLD A;  4UW9 A;  2KK0 A;  2W9C B;  5ALR A;  5ALP A;  3KOO A;  3JPR A;  3R9K A;  4KLI A;  3SAG A;  2CN1 A;  5ALX A;  4PGX A;  4Z6F A;  2M0N A; 
#chains in the Genus database with same CATH homology
 1B4F A;  3H8M A;  2JV3 A;  2D8C A;  2QAR B;  4RQN A;  3KKA C;  3KKA A;  1X9X A;  1Z1V A;  3BQ7 A;  2KSO B;  2F3N A;  2E8N A;  4IS7 A;  2QB1 A;  2ES6 A;  4PZN A;  2EAN A;  2KSO A;  5KNI A;  4MHV A;  2E8O A;  3TAC B;  2D3D A;  3SEI A;  1V85 A;  1SV0 C;  1SV0 A;  3HIL A;  2EAM A;  2QB0 B;  4NL9 C;  1SXD A;  4NL9 A;  2KIV A;  2DKZ A;  2KE7 A;  2YTU A;  1OXJ A;  1COK A;  2F8K A;  3TAD C;  3TAD A;  2QAR A;  1UQV A;  1LKY B;  3BS5 B;  2EAP A;  2LMR A;  1PK3 A;  5L1M A;  1DXS A;  1UCV A;  4PZO A;  2GLE A;  1LKY A;  3BS5 A;  1SV4 A;  1F0M A;  2EAO A;  3K1R B;  2Y9U A;  2FE9 A;  1V38 A;  1X66 A;  5J8Y C;  5J8Y A;  1B0X A;  1X40 A;  5F3X B;  2K60 A;  2QB0 A;  5JU5 A;  2KMD A;  2K4P A;  2ESE A;  2B6G A;  5JRT A;  2QKQ A;  2F44 A;  3SEN A;  2L5Y A;  1JI7 A;  1WWV A;  2E8P A;  1OW5 A;  2Y9T A;  1SXE A;  1RG6 A;  4NJ8 A;  5JTI A;  2KG5 A;  2E8M A;  1KW4 A;  1WWU A;  3BS7 A;  1PK1 B;  2DL0 A;  2LPE A;  4RQM A;  2DKX A;  1SGG A;  3IDW A;  1PK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...