1F0UA

Bovine trypsin complexed with rpr128515
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of human factor Xa complexed with potent inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0uA02
1GBKA 2VIWA 1EJNA 1O2SA 5GWZA 4ZROA 1TMUH 2ZTYA 1HJAB 4D9QA 5DP9A 1YLCA 2GP9B 2RCEA 2V35A 2AS9A 2UUYA 3AASA 2ZFSA 1O3FA 4X6MA 2HNTC 2BB4A 4UE7H 3RXJA 3P92A 3RXIA 2FLRH 5FX6A 1MAXA 2ANMH 2FEQH 1O34A 1Q3XA 1OP2A 4M7GA 1F2SE 1GI1A 1C4Y2 1ZR0A 2Y82A 2UWPA 2AGEX 3SNBA 3UFAA 4U30A 1MMJN 1DX5M 1EAIA 1RS0A 2Z6BD 4CRDA 8GCHG 2P8OB 3GDUA 3LGTA 3GY3A 2PSXA 1UVOA 4AB8A 5EGMA 2AYWA 2ZU5A 3SUEA 2I6SA 1OWIA 1C5XB 5HGGA 2W26A 1ESBA 3KQBA 1ANDA 2OQUA 1C5QA 1G3DA 2J38A 1LVBA 1C5WB 1PPCE 1ZPZA 4Y7BA 1YYY1 1EZSC 4JZFH 2BTCE 1FNIA 1O2IA 3RLYH 3SU3A 2QYIA 4OS7A 1HAIH 3B9FH 3NPSA 4X8SH 3Q77A 1KLIH 4X2YA 4FU9A 1AD8H 1UHBB 3CP7A 4FUHA 2H1UA 4HTCH 4KP0A 1Q31A 1GBBA 2ZG0H 2Y5FA 4AFZA 2A4GA 1SQOA 1O31A 4WVPE 2IOTA 1SGDE 4MTBA 4X8TH 1SHYA 2R3UA 3SORA 1HAPH 3LT3A 7GCHF 2FDAA 4NG9H 4X1PU 3PMHB 2ZNKH 3RXHA 1ANEA 4JZIA 3MU1A 1HAZB 4MLFB 5JBBS 1HCGA 2F9OA 4GUXA 4JCNA 1RTKA 4BOHA 1C5UA 3KCGH 2FWWA 3TH2H 1TMBH 1GWAA 1EPTB 3SV7A 4MPWA 1L4DA 1ZYOA 1GJ9B 2JH5D 3TK5A 2TRMA 2Z3EA 1C5YB 1FMGA 1DLKB 1EAUA 1SGFA 1YPMH 2FYQA 3T26A 3EYDA 4ZKNU 2P94A 4X2WA 1V2MT 1DT2A 4GAWA 1LHFH 4CRGA 1P03A 1GI3A 1W10U 1G2LA 2OP9A 5E0GA 1XXFA 2R9PA 2BXTH 4BNRA 1QB6A 3GISB 1DOJA 3LJOA 2FI5E 1T32A 2O8LA 1V2JT 5CHAB 1O5CB 4H4FA 4Y10E 4BXWA 1DPOA 1C1SA 1OWDA 3F9GA 1SGRE 1E37B 2B5TB 2Y5HA 2Q6DA 3M7TA 1TE0A 3P8NA 2IJOB 3SN8A 9ESTA 2A5KA 4DW2U 3BTEE 3SI3H 4D9RA 1AB9B 4AB9A 7GCHG 2BY7X 1TGBA 1QHRB 2PTCE 3VB3A 3ZZ8A 2CF9H 2D2DA 1ANBA 4TPIZ 3ZZ4A 1GBDA 1Q2WA 2NU4E 1N8OB 1B0EA 2O9QA 3DFLA 3QZRA 1GBJA 2RDLA 6CHAB 3TJUA 1LPKB 3TJVA 4DCDA 1Z6JH 5HM2A 3D62A 1AFEH 1BOQA 2I6QA 1L4ZA 1OKXA 3VB5A 2ZZUH 1K1PA 2FOHA 3LGWA 1AN1E 1FAKH 3MMGA 4BANB 1FXYA 1K21H 1P8VC 1UVSH 2ZTZA 3TU7H 3SJ8A 2ZDNA 5DJ7A 4D7FA 4E05H 1NRSH 5AFZH 3SOSA 2KAIB 1P9SA 1Z8GA 2WV4A 1O36A 2ZKSA 3M5LA 4JYUH 1XUJA 5JB8S 3A83A 2TGTA 1GVZA 2VWNA 1A4WH 2DE8A 1S5SA 1EX3A 1DXWA 1V2TT 1QR3E 2ZGHA 4GSOA 2ZDAH 3EA8A 1E0FD 1Y3VA 2A5AA 1LHDH 1UTKA 4YZUA 3LGYA 3NK8A 1NT1A 1RGQA 1IAUA 1OS8A 2SGFE 2BX4A 1TRMA 2VB0A 3LJJA 2QAAA 1BHXF 1CGJE 2Y5GA 5C1XA 1MH0A 5E0JA 3U69H 5LGOA 1WYKA 1OWHA 1GI2A 1SLUB 5DP6A 5C1YA 1IQIA 1YPKH 2BLOA 1CGIE 2WPMS 3K65B 1SGNE 1G3BA 3LU9B 3LGVA 2PKAB 4UEHH 1V2OT 3SQHE 1GGDC 1WAYB 1XVOA 1TOCB 4A1TA 4XE4A 1JOUB 2W3KA 1BTZA 3LH1A 5FPTA 1K1IA 1A61H 2AGGX 3A85A 3TJOA 1DWEH 2WPKS 2GCHF 1FONA 8LPRA 4K8BA 4Y0ZE 5C2ZA 1MBQA 1MCVA 1QJ6B 4SGBE 4RKOB 3QX5H 1A3EH 1O0DH 3PLBA 1BMMH 3T28A 4KTSA 3ZZ5A 2XW9A 1BDAA 4CH8B 1NRRH 4FXGH 1TFXA 1GBEA 1B7XB 1K1LA 3V12A 4F4OC 1SHHB 3S9AA 4K5ZA 2YOLA 1HAVB 1D3QB 1GJ4H 4AZ2B 1IQGA 4WXIA 4WH6A 4FUIA 2ZHWH 6ESTA 3BTWE 3LC5A 1TA6A 4D76A 1JBUH 3K9XB 4B2CA 1ANCA 1OP0A 1LQDB 4X2XA 3ITIA 4B2BA 1HXFH 1G3EA 3ESTA 1GMDG 1ZHRA 3BG8A 3L3TA 2WPJS 4K1TA 2BQ6B 1GCTC 7LPRA 3HKIB 3H7OA 4TWYA 3M7UA 1W14U 2G5NA 2F9NA 5C5NA 1G32B 1HJ9A 1MZAA 1O3LA 2J34A 4Z6AH 2V0BA 4K8YA 2EA3A 2H2ZA 2ZCHP 4I7YH 1TGTA 4LK4A 1V2WT 5C20A 3TNSA 1GVLA 3VPKA 3F9FA 2Z9LA 3RXMA 1LKBA 1H9LB 2GTBA 3UNQA 1BRCE 1IQFA 3BG4C 2BXUH 2YNAA 1C5OH 1KXEA 3TNTA 2Z7FE 1YBWA 5A0AE 1TPSA 5IDKA 2NWNA 1GHVH 1L1JA 2FPZA 1C5VA 5FAHA 1OWJA 3MH7A 2GCHG 2XRCA 3PM3A 2ZPRA 4NA9H 2LPRA 3SV8A 4Q7YA 1SB1H 1C1MA 1O2UA 3K2UA 1RIWC 1TX8A 2A7HA 1YCPK 3BTME 1O2JA 1EOJA 3M36A 4CRCA 1BA8B 4WXVA 4YT7H 5DK1A 2Z3DA 1C1PA 1GJ8B 3RC4A 3RXSA 1QFKH 1EJAA 1MU6B 3L6PA 2ZO3H 1YPLH 2R2WU 4CHAC 1P12E 4B75A 3GY4A 2F9BH 1Z7KA 1GJBB 5JDUB 4XFQA 3HK3B 3OY5U 4OS4A 1CT2E 3MO3A 2FX6A 1S6HA 1SGCA 2GDEH 2SGAA 1T31A 1UMAH 2OTVA 1P2OA 2JH6D 4MNXA 4UD9H 3HGNA 1ELBA 3DA9B 2EC9H 3UIRA 1QRWA 2FS9A 1NM6A 1J17T 4J1YA 4JZDH 2WINI 2J95A 1SR5C 2QXJA 1A1RA 2GKVE 1SG8B 2PLXA 2FS8A 4I33A 3CENA 5L6NH 5TCCA 1K28D 1AKSB 1E38B 3BSQA 2BYAX 3JZ1B 1MTUA 1FDPA 1PQ8A 3MWIU 1O33A 2VH0A 1VCPA 2VVCA 3ZZ3A 3NXPA 3A88A 1NESE 1C1QA 1O3NA 1QA7A 4I31A 2BDYA 3FP6E 1C2IA 2G00A 1O2RA 1ESTA 1T8NA 1LPZB 4MG3A 2M5TA 1B5GH 3MU0A 2J92A 4MQAA 1T7CA 2QC2A 3EA7A 3ZYEA 3RC6A 2Y6TA 1EPTA 1TPOA 4TY7A 4WJG2 1PQAA 3GCTF 2HLCA 4NA8A 1XUKA 3OTJE 3RXTA 2VIPA 2Z94A 1O3OA 2XXLA 1H1BA 4DG4A 1S82A 2Y80A 2PGQB 1ETRH 2O8UA 1AWHB 2P16A 4LZ1H 1OP8A 2BVSH 2BDBA 1Z71A 4DOQA 3VGCB 4CR9A 4NFFA 2UWOA 4D7GA 2BD2A 1FY8E 1AVGH 2XYAA 2A2QH 1PPHE 3RM0H 1AQ7A 1A3BH 4ZHAA 1SOZA 3H7TA 2PWXA 1HYLA 2PR3A 5DP7A 1S81A 1VITH 1X7AC 1GI4A 1BMLA 1SGPE 2GX4A 2J9NA 1P0SH 2P3TB 3A8AA 1HV7A 1UK4A 3KEEA 2OXSA 1GI5A 4NIWA 5DKMA 2ODQA 3RM2H 5CE1A 1DITH 1EZQA 2B8OH 1SGTA 1GL1A 1V2VT 2ZQ1A 3FP8E 2ALVA 1PQ5A 2SFAA 4B76A 1S83A 1BTYA 4LXBH 1MQ6A 5F03A 4ZXXH 2HALA 3ZZBA 4NIXA 3RXOA 4U01A 2BDGA 4AG1A 1XX9A 1TGSZ 1BBRE 1GBLA 2OBOA 1DWBH 2C93B 2P3UB 4JZEH 1ZPCA 1DWDH 3KL6A 5EW1H 3F9EA 3GCTG 1QRZA 5C3NA 2OBQA 4ZUHA 5JBAS 3I29A 3T27A 1ZZZA 5I25A 4A1VA 4DIIH 2FYRA 2XNIA 2GMTB 1KTTB 4CR5A 4K1SA 1GG6C 3GY7A 1E36B 3T29A 5I46H 3A7VA 3ODFA 1TNIA 3NWUA 2FOFA 3EAJA 1UTNA 3EQ0H 1C5RA 1LDTT 1D9IA 2F9PA 2KAIA 4NWLA 3RXAA 3U8OH 1ABIH 1PJPA 2ZC9H 4D8NA 1CA8B 1F5RA 1G36A 2NU2E 2Y7XA 3RU4E 2GCTC 2XWAA 2TPIZ 1GJDB 4CREA 2BHGA 3VEQB 3MNCA 3KHVA 3ZZ9A 3E0PB 1QY6A 3GCHB 2SGQE 5LPEA 3U98H 2H5DA 2WPIS 1SQAA 1HIAB 5G4BA 1FN8A 1P11E 2VIOA 1A7SA 1C5MD 2CMYA 2XBWA 3LPRA 1NU7B 4CRBA 1UTOA 1ZJDA 4ABHA 4IS5A 1AMHA 3KQCA 1MTVA 3UR6A 1THSH 2HOBA 2TGAA 9LPRA 3U1JB 3M3SA 4Y8ZA 5EPYA 3DUXH 5FBEA 2STBE 1MTSA 5DPAA 1C2JA 3SUFA 1GBTA 4HI3A 4Q2KA 1G2MA 2DUCA 5JBTA 5K0HA 3A8CA 3D49H 2ZWLH 3MNXA 4U32A 4Y8YA 1EASA 2BDAA 4XBDA 1ELGA 3SNEA 1A0HB 1O3IA 3PWCA 2GT8A 4YOGA 1WV7H 3GYLB 1KSNA 3O8RA 2ANYA 2O8MA 1A46H 2QF3A 2AFQB 1MD7A 2XTTB 3NKKA 4DVAU 3PO1B 1HJAC 4YESB 2ZPSA 1SQTA 2J94A 3BEIB 3TK9A 1K1MA 3ZV9A 1MUEB 4X1SU 5A8ZA 1P01A 1UK3A 2BMGB 2XC0A 2K1QA 1TBZH 3E0NB 1AI8H 4BAOB 5DGJA 3VFEA 4NZQA 1BUIA 2TGPZ 4THNH 3SQEE 1C1UH 3A7WA 4FUEA 4UFFH 3MU8A 1UVPA 3EGKH 2BQWB 3ZVGA 2R2MB 3RMMH 1AHTH 1C5PA 1P3EA 2P8OC 5FHTA 1K2I1 3SU1A 1ELCA 1S0RA 2ZA5A 4GHTA 3UQVA 3A8DA 3ATKA 3PMAB 1Z8JB 1SGIB 1LHCH 2PV9B 1EAWA 3GY8A 1ELAA 1DWCH 3GY2A 2BLWA 1C2GA 2ZEBA 2BD4A 3SUGA 1LKAA 3SU6A 4K69A 3TIUA 2PUXB 1S6FA 2ODPA 1TX6A 1GI7B 1EATA 1EOLA 3IITA 3RXPA 5A09A 1QL7A 1O2KA 4I8JA 2ZFRH 3LDXH 2ZECA 2AH4X 1TNGA 4OS1A 2FOAA 4SGAE 3ATLA 2ZHFH 3A84A 1C2DA 2ZU1A 1AE5A 2ZDLA 1SBWA 1HBTH 3D23A 3GYMA 4TYDA 2G4UA 4H6TA 1E34B 2XCFA 3DFJA 3Q3XA 1HAHH 1GBAA 1UTMA 1CBWC 1P2JA 1ACBE 1O2MA 1O37A 1VJAU 1ZTJA 1KDQB 3TLOA 3AVZA 1IOEA 2FESH 1F0TA 4B74A 1HRTH 3S7KB 3OU0A 1AUTC 3UPEA 1ELTA 3M35A 4GHQA 4DURA 1P2IA 1MCTA 3ZVBA 3GCNA 1AVXA 1G30B 5LH8A 5CMXH 1VZQH 1TNLA 1V2UT 1YGCH 3A89A 1CHGA 1FY1A 1UTJA 2TIOA 3Q3KA 1EPTC 2OC0A 1V2PT 1Y59T 1YLDA 4RSPA 1A0LA 5BPEA 2Q6FA 1MKWK 3RUOA 3RXFA 2Y81A 5AFYH 3SNCA 1RRKA 5GDSH 2WPLS 2CF8H 1T8OA 2ZU4A 2WPHS 2ZFQH 1GMHF 1O35A 5EXNA 2FLBH 5EQRA 1ZMLA 3P8GA 1RFNA 3MNSA 1TPPA 1FQ3A 3E91A 1TGNA 3KGPA 2ZGCA 2W5EA 2PKSC 4GPGA 1TIOA 3S0NA 3RC5A 1BBRH 1LQEA 2FX4A 3PTBA 1GGDB 2ZGJA 1QGFA 1C5ZB 1V6DA 4A6LA 1OX1A 3A7ZA 2F9VA 2A0QB 3SV2H 4QT8C 1O2HA 5JYIA 1K1NA 1QQUA 1XMNB 2BD9A 2WV5A 4DIHH 4GVUA 4MDSA 3AAVA 2D26C 2LNCA 4UONA 1SLVB 2NU0E 3FVFB 1JIRA 3SGAE 3QTOH 4ABEA 4B1TA 1MBMA 3UWJH 1C5TA 1GPZA 1TBRH 2IPHA 3MH4A 3ZZDA 2GV7A 2Z9GA 1WQSA 2HPQH 1LHEH 1NS3A 1J9CH 1GBIA 5DP5A 1FI8A 1TRYA 3E8LA 3PWBA 1ZGIA 3RXBA 1GBHA 2WUBA 2SGEE 1VITF 5AVDA 4AG2A 1FIZA 4WMDA 4X6PA 6CHAC 1GJ7B 2A7JA 3SU2A 1V2LT 2ESTE 2FI3E 3LIWA 4ZAEA 2ZHEH 1GCTB 3HATH 2VINA 5AHGH 3ZVDA 5IYTA 4TWWA 3OYPA 4FU8A 2XBYA 1DFPA 2PW8H 1GI9B 5ESTE 1BQYA 2ULLA 2QXGA 1YP9A 1PYTC 1NO9H 1DY9A 3O8DA 1OOKB 2THFB 2VWMA 2OINA 3UTUH 2ZF0H 1EKBB 3QLPH 3RXUA 1W11U 3SU4A 1AUJA 1YC0A 2SGDE 3BG4B 3PV4A 1O2PA 1TWXB 5GIBA 1KLJH 2STAE 3UR9A 1NZQH 2EEKA 1ZHPA 4IMQA 1L0ZA 2CGAA 1NRQH 3MO6A 1ZSKA 1TNJA 2JETB 3M7QA 4OGXA 1ZJKA 5ESBA 1O5DH 1HXEH 5HM9A 1RIWB 5A0CA 6LPRA 4OS2A 1ETSH 1SGFG 2HWLB 4XOJA 4WMEA 4AYVB 3RXLA 1OWEA 2H9HA 1FJSA 2ANWA 2V3OH 1CT0E 1UCYK 3KQDA 4CHAB 2ODYB 1CHOF 1NFYA 1MKXH 4XSKU 1H4WA 1S0QA 1THRH 5T3HA 3E16B 4AYYB 2G52A 2ZFFH 1WTHD 1VITG 3QK1A 3RXVA 5DG6A 3P17H 1A2CH 1SVPA 2QIQA 7ESTE 1CT4E 4ABJA 5A8XA 2ZGXH 2BDHA 1GDUA 4XDEA 3S69A 4O03A 4FUDA 1OWKA 4XBBA 2TGDA 1Z1JA 4RN6A 1WOFA 4YT6H 3TVJB 3AW1A 3KF2A 5C5OA 1B0FA 3GICB 3VB6A 1ZMJA 3PROA 1HUTH 4ABDA 2C8WB 1K1JA 4ISOA 1BMAA 1F0UA 2JKHA 4X2VA 3OY6U 1W13U 3P95A 1BJVA 1NROH 4NGAH 1C5NH 1BHXB 2CHAC 1HAGE 3O8CA 1DE7H 1FPCH 2H9EH 5EPNA 3QZQA 1W12U 2OC1A 3A81A 5FX5A 1H9HE 4ABFA 3VXFH 2A5IA 5E2OA 1JXPA 2F91A 4VGCC 4NA7A 4MNWA 2FIRH 2UUKB 5HXFA 5LPRA 1LVYA 1M9UA 2Q1JA 4UFDH 3ZZCA 2C90B 4FVDA 1VGCC 1QJ1B 3Q76A 2W7SA 3BN9A 2F3CE 3GDVA 2QA9E 4LOYH 1EZUC 1GHXH 3MU4A 1YPHE 2ILNA 4JYTA 1HLTH 2A31A 1Z6EA 1UHBA 4WF8A 4B2AA 3V7TA 3KNXA 3GY6A 4ZHMU 5ETXA 1YPGH 3ZVFA 1V2NT 1C1WH 2G51A 2OQ5A 2EI8A 2ALPA 5EXMA 4KKDA 2QCYA 1CHOG 2VIDA 3LC3A 1UK2A 4IN2A 1AWFH 2F83A 1NFXA 1HB0B 5H4IB 1LMWB 1ORFA 3NUMA 5HYOA 1NRPH 2A1DB 4HGCA 3ZZAA 4MPXA 2FOCA 4ABIA 4K3JA 1TQ7B 1O3KA 3PB1E 1A5IA 1O2VA 1C4U2 1P3CA 1L2EA 2C3SA 1C9TA 8ESTE 3RDZA 1GBCA 1H8IH 1O3JA 3DT0H 1Z8IB 4CBNA 1K9OE 4ESTE 3Q3YA 1EJMA 3LKWA 3RXDA 2GGVB 1KIGH 4K1EA 1P2KA 1KLTA 4R0IA 4ASHA 2FZZA 1PQ7A 1OYQA 3LGIA 4FUBA 1VCQA 2AMPA 2BX3A 1WUNH 2BVXH 1XKAC 1SFQB 1QNJA 2FTLE 1IQJA 1S85A 1O5BB 3TJNA 3LOXA 2BY6X 4YLQH 3W95A 7KMEH 1N1LA 1EB1H 2FOEA 3RMOH 2ZI2H 1CSOE 3ATWA 3C27B 1Y3WA 5DP8A 3TGIE 2V3HH 2RA3A 3B8JA 4BAQB 4Y76A 2R3YA 4NSYA 1EQ9A 3SNDA 4AFUA 1FPHH 4AFSA 4YLUA 4WWYA 3TITA 3GCOA 1F5LA 3QN7A 4I8HA 2ZDKA 1J8AA 3BTGE 1CA0B 3BV9B 1GG6B 2ZFTA 1AVWA 4NIYA 2UUJB 1C2KA 1QB1A 1TNHA 2AMQA 4AN7A 2GDDA 1ELEE 3MH6A 4B73A 5A8YA 1O2NA 1C1NA 1IQHA 1DSUA 4YTAA 1THPB 1AFQC 3BIVH 1WCZA 1LTOA 1WBGB 3PLPA 3QGJA 2SGPE 2FM2A 2GCTB 1CGHA 1O3EA 1EZXC 1H8DH 3CS7A 3BTKE 2WYJA 1DANH 1JRTA 2FXRA 4HFPB 2Z9KA 4X1NU 1ZHMA 1BJUA 1TGCA 4A5TS 3FAOA 2FMJA 2PTNA 8GCHF 2BM2A 3ZVEA 5C1UA 3BTDE 2AEIH 6GCHF 4ZH8A 3WY8A 1UTPA 1WTGH 2VJ1A 1F92A 1ELFA 3PYHA 4OS6A 1V2RT 2HGTH 5BRRE 1MTWA 3PLKA 1G3CA 1P04A 1MZDA 2ZFPH 1FV9A 1NRNH 1SOTA 4TPYA 3R3GB 1EAXA 4ABAA 2VVUA 5C67A 1Z1IA 5JB9S 3V0XA 1Y8TA 1GMCF 2G81E 2BOKA 1AIXH 1F7ZA 5EG4A 1AZZA 1FY5A 1Y5AT 2OD3B 3SHAH 3ATIA 2H6MA 2H5CA 4ABBA 1UTQA 2BQ7B 3BTTE 2VGCC 4JK6A 2ZDMA 4UFEH 3UUZA 1DSTA 1LVOA 4NIVA 3F9HA 2Z9JA 3E3TA 4I8KA 2ZCLP 3ZZ7A 1EUFA 1LHGH 1GI0A 1O39A 2W7UA 3E6PH 4GCHF 3UNRA 2BLVA 3SZNA 1QL8A 8KME2 3F6UH 1PYTD 5A0BA 2BLQA 2XBXA 3UOPA 1IQEA 1C1VH 5EXLA 1O3HA 4YM9A 3MNBA 3A82A 4GLYA 4AX9H 4H42U 1YCPH 1KTSB 2FOMB 1Y3XA 1O5AB 1AY6H 1JWTA 1J14A 4MNYA 1EXFA 3STIA 3SNAA 4O9VA 1Y5UT 2PKAA 1AU8A 1D6RA 1FY4A 1ZRBA 1YPHC 2FTMA 2A4OA 2ZCKP 3E90B 3SBKA 1P06A 2SNVA 1SSXA 3SW2B 1T8MA 3ZVCA 3P70B 1MTNC 1FY3A 3TGKE 4O3TA 3UNSA 2G8TA 1SGYE 2G4TA 2GMTC 1C1OA 2PUQH 1BTHH 1SGQE 1XUGA 1XM1A 6GCHG 1DXPA 5FCRA 1O3GA 1QJ7B 3S9BA 3H5CB 1P10A 1FN6A 5EODA 5JBCS 1ELDE 3URDA 4AOQA 1O32A 3RXEA 1GBFA 1D3DB 4FUGA 3PMJA 2VWLA 3AAUA 3HK6B 2AIPA 1P2NA 1TA2A 2GZ8A 1UJ1A 1F0RA 2H9TH 5E2PA 4OGYA 4NZLA 4IMZA 1HAVA 1O3MA 2WYGA 1NU9A 5GXPA 1C1RA 1GMCG 4X0WU 3GCHC 5F8ZA 4R8TB 1NY22 2AIQA 4ZKOU 1BTWA 2VIVA 4IGDA 3MOCA 1ZGVA 2BD8A 3PTNA 1BTUA 2BY5X 1W7XH 2ZU2A 4A92A 1D4PB 1YPEH 1HFDA 1ZSLA 1C2FA 3MYWA 1V3XA 4I8LA 1QBVH 1J16A 1D3PB 2XC4A 3ODDA 2ZU3A 4GCHG 3W94A 2J4IA 1MD8A 1CBWB 1VR1H 1EP6A 1GJCB 4IW4E 4IC5A 1O3AA 1BRAA 1PFXC 3U8TH 1GJ6A 1F5KU 1PPGE 3M3VA 1YF4A 4XBCA 1O2XA 1H9IE 5F8XA 3RXRA 5J4SA 3S7HB 2ASUB 4A7IB 1QIXB 1IQLA 1HPGA 1A5HA 5GPIB 4J2YB 4WY3A 1GBMA 3IWMA 1TB6H 1Z8RA 2G5VA 1ZSJA 1MKXK 4AGKA 4ISNA 4MVNA 4ABGA 5EU8A 3BIUH 3UOUA 3MI4A 2VIQA 3RXGA 5SGAE 1BZXE 1IHSH 4MPVA 3SJOA 3SJKA 1V2QT 3ZYDA 1CE5A 3PO1C 1DM4B 1Y3YA 1TX7A 2BY8X 1KXFA 3M5NA 1F0SA 4Y11E 1W7GH 3KQEA 1HDTH 1K22H 1CVWH 3D65E 2HPPH 2SNWA 1TLDA 3ZV8A 2OC7A 2PKSB 3M37A 1ID5H 4BAHB 3V3MA 3UWIA 4IC6A 5EQQA 2XWBI 4E7RG 2FOGA 1RXPA 1NPMA 1BT7A 3FP7E 1CU1A 1P57B 2CV3A 3RP2A 3DHKH 3SJ9A 1YCPM 3RLWH 5TCAA 1YPJH 2B0FA 3AW0A 5T6GA 1W2KH 3HKJB 2VWOA 4ISHH 1OPHB 1YKTA 1SPJA 1DLEA 4FUCA 2P95A 1MQ5A 1S84A 1ARBA 4Q7XA 2ZTXA 1N6XA 3TPIZ 1O3BA 1PPZA 1CO7E 1XKBC 5F6MA 1AKSA 4CRFA 1Y3UA 1BB0B 2HVXA 4O97A 3OX7U 4DJZB 5A2MH 1QCPA 1DICA 1IHTH 3FFGA 3F68H 1OSSA 1XUHA 2PGBB 3SJIA 1K1OA 1GHAF 3MHWU 4Y0YE 1GHYH 1ELVA 1GHBF 3SUDA 1O2ZA 2AMDA 1BTPA 4NFEA 4FU7A 2UUFB 2C8YB 1SGEE 4CBOA 2OC8A 4IN1A 5CHAC 2A7CA 3A8BA 2W3IA 1TBQH 4YO9A 2P93A 1DUEA 1QBNA 1C9PA 3VB4A 4U2WA 1O3CA 1RJXB 3TH3H 3N7OA 1JMOH 2DE9A 1SI5H 1FIWA 4NSVA 3URCA 3SV9A 1AB9C 1KXCA 3T62A 1P02A 1WSSH 1XUIA 4Z0KA 3QTVH 3MTYA 2QY0B 3RXQA 2ANKH 2P59A 1N8OC 1GDNA 4I32A 1UVUH 1O30A 2OLGA 2BDIA 5K7RA 5HMAA 1GMDF 1C5SA 2Z3CA 3BEFB 4MNVA 1O2TA 1NC6A 3ENSB 1ZLRA 4Q80A 4BAMB 3U9AH 1QTFA 4WH8A 1SL3A 2VU8E 1TONA 2BDCA 1RTLA 3A7YA 1TQ0B 3BTFE 3FZDA 1E35B 4CRAA 1T8LA 1HJ8A 1O2YA 2BOHB 1ZRKA 5DP3A 3TH4H 1FZZA 1GMHG 1NN6A 5GCHF 1KXDA 3K6ZA 3U8RH 3RU4T 1W3CA 1UO6A 5E0HA 3SHCH 5FPSA 5GJ4B 1UVTH 2B7DH 3F1SB 1N6YA 2C8ZB 2GZ7A 2VVVA 4Y71A 1C2LA 1HNEE 2BVRH 1GHAG 1LO6A 2R0KA 1O2OA 4IBLH 2XCNA 1GHBG 3BEUA 5FCKA 3BTHE 4MPUA 1O38A 4X6OA 1UCYE 4BTTB 5L30H 4BTUB 3M5MA 3VB7A 1HGTH 2QXHA 4ZKRU 3MFJA 3RXCA 1SFIA 1INCA 1P2QA 2Q6GA 3VXEH 1ZPBA 1QRXA 4NCYA 1EB2A 1C2HA 3P8FA 3ELAH 3JZ2B 2CHAB 3FZZA 1GI6A 4FUFA 4ISIH 2VNTA 3LGUA 4FVBA 1SLXB 1W0ZU 1L1NA 3GY5A 1FUJA 5E8EH 1O5GH 4VGCB 1ESAA 1GJAB 5L2ZH 2ZDVH 5T6DA 1VGCB 4Y8XA 1G9IE 1QURH 3M61U 3ZVAA 3EE0B 2GZ9A 1DDJA 4KTUA 3NCLA 3R0FA 3RMNH 3PMBB 4LZ4B 2BD7A 1XUFA 1LPGB 3NZIA 2QXIA 2FI4E 1L1GA 1ARCA 1C5LH 2HRVA 1EP5A 2J2UA 3TK6A 1HIAA 1D6WA 2GT7A 2GV6A 1GL0E 1O5EH 4B71A 5ABWA 3LONA 2ZQ2A 2FP7B 2D8WA 3I78A 1C4V2 2JH0D 3MH5A 1PPFE 5FPYA 1UTLM 2RA0A 1TRNA 1GCDA 3Q00A 1ZTKA 2FOBA 1QB9A 5GCHG 4AFQA 3LH3A 2QN5T 5FBIA 3U1IB 1IQNA 1BMNH 3STJA 3P6ZB 3T25A 1W8BH 4BTIB 2RG3A 2WUCA 3A7TA 2B9LA 4PROA 1JRSA 1P2MA 3QGNB 1O2QA 1DVAH 1QL9A 2JETC 2XBVA 4WMFA 1AE8H 1QBOA 2A2XH 3SO3A 1TAWA 3OSYA 3E1XB 2HNTE 1ZOMA 4INHA 3QUMP 1TMTH 2CJIA 1BCUH 1O2LA 2OCVB 1KYNA 3G01A 1PPBH 3SV6A 1O2WA 3K6YA 2G55A 3A80A 3I77A 1DS2E 4TY6A 1XVMA 2ZHDA 1YM0A 1MKWH 1QA0A 1ABJH 3BF6H 2HNTF 2UWLA 1FLEE 1TNKA 1FAXA 1IQKA 4FUJA 2PFEA 4ISLA 4NWKA 3UY9A 1DUAA 1NTPA 3SGBE 1LCYA 2QV1A 1HAOH 3RMLH 4UFGH 4JZ1A 2CN0H 1BRBE 1RD3B 1BIOA 1GDQA 3T5FH 1OYTH 1T4VH 1V2KT 1J15A 4O3UA 1ETTH 5B6OA 2BZAA 4YOJA 1KXAA 5DO4H 1C2EA 2O8TA 1LVMA 5PTPA 4DT7B 1TALA 3QO6A 5EQSA 1P9UA 2TBSA 2CXVA 3UREA 1A5GH 2OUAA 1G37A 2BY9X 1CQQA 1QQ4A 1AFQB 2EI7A 1GVKB 3MU5A 1OXGA 2AERH 4ZKSU 3O8BA 1SC8U 3SI4H 4X1QU 1NFUA 4E7NA 3RXKA 3TGJE 1KXBA 4AGJA 3KN2A 4X8UH 2NU3E 3HPTB 4A1XA 1ZTLA 3ATMA 4Y79A 3QWCH 1AGJA 3P8OA 4INKA 1HAXB 2A4QA 3FANA 2ZP0H 4KTCA 4Q7ZA 1NFWA 2PSYA 3V13A 5F8TA 5L2YH 2EI6A 4AORA 2FODA 4RKJB 2ZIQH 1P09A 4DGJA 5T6FA 2GVFA 2QGRA 4BXSA 4BAKB 1MU8B 1W0YH 1TPAE 4Y6DA 4ZXYH 1D3TB 1U6QA 3M3TA 4UDWH 1C1TA 1SLWB 1T4UH 2XC5A 1MAYA 2YNBA 3A7XA 3RU4D 1KDQA 1C2MA 3HGPA 4ZMAH 2NU1E 4F49A 1BRUP 1HAYB 2QF0A 3SGQE 1TOMH 1VJ9U 4Y7AA 1TABE 1VCWA 4X8VH 4E06H 1IQMA 1O3DA 1GI8B 2GD4B 4K60A 4KGAA 2ZPQA 3T2NA 1WQVH 4HZHA 2VGCB 2IN2A 1P05A 3EDXB 2BD3A 1PPEE 3GDSA 1KY9A 2AGIX 1O3PB 3KIDU 3CS0A 2C4FH 1JIMA 3SU5A 1AZ8A 1WU1A 2D1JA 4OS5A 1SMFE 2ZGBH 1AO5A 3IG6B 1A0JA 1DY8A 2VH6A 3UQOA 5EW2H 4X6NA 3C1KA 5EOKA 2O8WA 2A45B 1Y5BT 5TJXA 1BITA 2A4RA 2Y7ZA 3ZZ6A 1RTFB 3VGCC 5J4QA 2A32A 5AF9H 2BD5A 1V2ST 3BTQE 2Z9IA 5JPMH 5DP4A 4CH2B 4KELA 2R0LA 4ZHLU 5FXLA 1O5FH 4X1RU 3A86A 2FO9A 3GOVB 3S9CA 1GHWH 3B23B 3A87A 2P3FH 1GJ5H 1ZMNA 1UCYH 1MTNB 3QDZB 4JMYA 4JYVH 3MO9A 4I8GA 3M5OA 1BTXA 5LPFA 3SU0A 1XXDA 1CA0C 3L33A 2V6NA 4DY7B 4INLA 2C8XB 3EA9A 4H6SB 2F9UA 2ZHQH 4JK5A 2BZ6H 1GHZA 4K2YA 4YOIA 1BBRK 3DD2H 2PHBA 1TYNA 1O2GH
chains in the Genus database with same CATH superfamily
1GBKA 2VIWA 1EJNA 1O2SA 5GWZA 4ZROA 1TMUH 2ZTYA 1HJAB 4D9QA 5DP9A 1YLCA 2GP9B 2RCEA 2V35A 2AS9A 2UUYA 3AASA 2ZFSA 3AK5A 1O3FA 4X6MA 2HNTC 2BB4A 4UE7H 3RXJA 4F48B 3P92A 3RXIA 2FLRH 5FX6A 1MAXA 2ANMH 2FEQH 1O34A 1Q3XA 1OP2A 4M7GA 1F2SE 1GI1A 1YLNA 1C4Y2 1ZR0A 2Y82A 2UWPA 2AGEX 3SNBA 3UFAA 4U30A 1MMJN 4ACBA 1DX5M 1EAIA 1RS0A 2Z6BD 4CRDA 8GCHG 2P8OB 3GDUA 3LGTA 3GY3A 2PSXA 1UVOA 4AB8A 5EGMA 2AYWA 2ZU5A 3SUEA 2I6SA 1OWIA 1C5XB 5HGGA 2W26A 1ESBA 3KQBA 3SYJA 1ANDA 2OQUA 1C5QA 1G3DA 2J38A 1LVBA 1C5WB 1PPCE 1ZPZA 4Y7BA 2J5UA 1WXRA 1YYY1 1EZSC 4JZFH 2BTCE 1FNIA 1O2IA 3RLYH 3SU3A 2QYIA 4OS7A 1HAIH 3B9FH 5C94A 3NPSA 4X8SH 3Q77A 1KLIH 4X2YA 4FU9A 1AD8H 1UHBB 3CP7A 4FUHA 2H1UA 4HTCH 4KP0A 1Q31A 1GBBA 2ZG0H 2Y5FA 4AFZA 2A4GA 1SQOA 1O31A 4WVPE 2IOTA 1SGDE 4MTBA 4X8TH 1SHYA 2R3UA 3SORA 1HAPH 3LT3A 7GCHF 2FDAA 4NG9H 4X1PU 2F4LA 3PMHB 2ZNKH 2M2AA 3RXHA 1ANEA 4JZIA 3MU1A 1HAZB 4MLFB 5JBBS 1HCGA 2F9OA 4GUXA 4JCNA 1RTKA 4BOHA 1C5UA 3KCGH 4XRNA 2FWWA 3TH2H 1TMBH 1GWAA 1EPTB 3SV7A 4MPWA 1L4DA 1ZYOA 1GJ9B 2JH5D 3TK5A 2TRMA 2Z3EA 1C5YB 1FMGA 1DLKB 1EAUA 1SGFA 1YPMH 2FYQA 3T26A 3EYDA 4ZKNU 2P94A 4X2WA 1V2MT 1DT2A 4GAWA 1LHFH 4CRGA 1P03A 1GI3A 1W10U 1G2LA 5DN6D 2OP9A 5E0GA 1XXFA 2R9PA 2BXTH 4ZCNA 4BNRA 1QB6A 3GISB 5T1VA 3KQ5A 1DOJA 3LJOA 2FI5E 1T32A 2O8LA 1V2JT 5CHAB 1O5CB 4H4FA 4Y10E 4BXWA 1DPOA 2PP6A 1C1SA 1OWDA 3U28C 3F9GA 1SGRE 1E37B 2B5TB 2Y5HA 2Q6DA 3M7TA 1TE0A 3P8NA 2IJOB 3SN8A 5EJ1A 9ESTA 2A5KA 4DW2U 3BTEE 3SI3H 4D9RA 1AB9B 4AB9A 7GCHG 2BY7X 1TGBA 1QHRB 2PTCE 3VB3A 3ZZ8A 2CF9H 1W0KD 2D2DA 1ANBA 4TPIZ 3ZZ4A 5FL7D 1GBDA 1Q2WA 2NU4E 1N8OB 1B0EA 2O9QA 3DFLA 3QZRA 1GBJA 2RDLA 6CHAB 3TJUA 1LPKB 3TJVA 3N7DA 4DCDA 1Z6JH 5HM2A 3D62A 1AFEH 2WZQA 1BOQA 2I6QA 1L4ZA 1OKXA 3VB5A 2ZZUH 1K1PA 2FOHA 3LGWA 1AN1E 5GNDA 1FAKH 3MMGA 4BANB 1FXYA 1K21H 1P8VC 1UVSH 2ZTZA 3TU7H 3SJ8A 2ZDNA 5DJ7A 4D7FA 4E05H 1NRSH 5AFZH 3SOSA 2KAIB 1P9SA 1Z8GA 2WV4A 1O36A 2ZKSA 3M5LA 4JYUH 1XUJA 5JB8S 3A83A 2TGTA 1GVZA 2VWNA 1A4WH 2DE8A 1S5SA 1EX3A 1DXWA 1V2TT 1QR3E 2ZGHA 2WPDD 4GSOA 2ZDAH 3EA8A 1E0FD 1Y3VA 2EY4C 2A5AA 1LHDH 1UTKA 4YZUA 3LGYA 3NK8A 1NT1A 1RGQA 1IAUA 1OS8A 2SGFE 2BX4A 1TRMA 2VB0A 3LJJA 2QAAA 2CK3D 1BHXF 2V3MA 1CGJE 2Y5GA 5C1XA 1MH0A 5E0JA 3U69H 5LGOA 1WYKA 1OWHA 3DCLA 1GI2A 1SLUB 5DP6A 5C1YA 1IQIA 1YPKH 4DT4A 2BLOA 2QE7D 1CGIE 2WPMS 3K65B 1SGNE 1G3BA 3LU9B 3LGVA 2PKAB 4UEHH 1V2OT 3SQHE 1GGDC 1WAYB 1XVOA 1TOCB 4A1TA 4XE4A 1JOUB 2W3KA 1BTZA 3LH1A 5FPTA 1K1IA 1A61H 2AGGX 3A85A 3TJOA 1DWEH 2WPKS 2GCHF 1FONA 8LPRA 2K0QA 4K8BA 4Y0ZE 5C2ZA 1MBQA 1MCVA 1QJ6B 4SGBE 4ACAA 4RKOB 3QX5H 1A3EH 1O0DH 3PLBA 1BMMH 3T28A 4KTSA 3ZZ5A 2XW9A 2JIZD 1BDAA 4CH8B 1NRRH 4FXGH 1TFXA 1GBEA 1B7XB 1K1LA 3V12A 4F4OC 1SHHB 3UB0A 3S9AA 4K5ZA 2YOLA 1HAVB 1D3QB 1GJ4H 4AZ2B 1IQGA 4WXIA 4WH6A 4FUIA 2ZHWH 6ESTA 3BTWE 3LC5A 1TA6A 4D76A 1JBUH 3K9XB 4B2CA 1ANCA 1OP0A 1LQDB 4X2XA 3ITIA 4B2BA 1HXFH 1G3EA 3ESTA 1GMDG 1ZHRA 3BG8A 3L3TA 2WPJS 4K1TA 2BQ6B 1GCTC 7LPRA 3HKIB 3H7OA 4TWYA 3M7UA 1W14U 3NRLA 2G5NA 2F9NA 2WV9A 5C5NA 1G32B 1HJ9A 1MZAA 1O3LA 2J34A 4Z6AH 2V0BA 4K8YA 2EA3A 2H2ZA 2ZCHP 4I7YH 1TGTA 4LK4A 3PRDA 1V2WT 5C20A 3TNSA 1GVLA 3VPKA 3F9FA 2Z9LA 3RXMA 1LKBA 1H9LB 3OEED 2GTBA 3UNQA 1BRCE 1IQFA 3BG4C 2BXUH 2YNAA 1C5OH 1KXEA 3TNTA 2Z7FE 1YBWA 5A0AE 1TPSA 5IDKA 2NWNA 1GHVH 1L1JA 2FPZA 1C5VA 5FAHA 1OWJA 2IPQX 3MH7A 2GCHG 2XRCA 5EIYA 3PM3A 2ZPRA 4NA9H 2LPRA 3SV8A 4Q7YA 1SB1H 1C1MA 1O2UA 3K2UA 1RIWC 1TX8A 2A7HA 1YCPK 3BTME 1O2JA 1EOJA 3M36A 4CRCA 1BA8B 4WXVA 4YT7H 5DK1A 2Z3DA 1C1PA 1GJ8B 3RC4A 3RXSA 1QFKH 1EJAA 1MU6B 3L6PA 2ZO3H 1YPLH 2R2WU 4CHAC 1P12E 4B75A 3GY4A 2F9BH 1Z7KA 1GJBB 5JDUB 4XFQA 3HK3B 3OY5U 4OS4A 1CT2E 3MO3A 2FX6A 1S6HA 1SGCA 2GDEH 2SGAA 1T31A 1UMAH 2OTVA 1P2OA 2JH6D 4MNXA 4UD9H 3HGNA 1YY3A 1ELBA 3DA9B 2EC9H 3UIRA 1QRWA 2FS9A 1NM6A 3DSPA 1J17T 4J1YA 4JZDH 2WINI 2J95A 1SR5C 2QXJA 1A1RA 2GKVE 1SG8B 2PLXA 3SZEA 2FS8A 4I33A 3CENA 5L6NH 5TCCA 1K28D 1AKSB 1E38B 3BSQA 2BYAX 3JZ1B 1MTUA 1FDPA 1PQ8A 3MWIU 1O33A 2VH0A 1VCPA 2VVCA 3W1EA 3ZZ3A 3NXPA 3A88A 1NESE 2K8IA 1C1QA 1O3NA 1QA7A 4I31A 2BDYA 3FP6E 1C2IA 2G00A 1O2RA 1ESTA 1T8NA 1LPZB 4MG3A 2M5TA 1B5GH 3MU0A 2J92A 4MQAA 1T7CA 2QC2A 3EA7A 3ZYEA 3RC6A 2Y6TA 1EPTA 1TPOA 4TY7A 4WJG2 1PQAA 3GCTF 2HLCA 4NA8A 1XUKA 3OTJE 3RXTA 2VIPA 2Z94A 1O3OA 2XXLA 1H1BA 4DG4A 3KYGA 1S82A 1S6LA 2Y80A 2KCYA 2PGQB 1ETRH 2O8UA 1AWHB 2P16A 4LZ1H 1OP8A 2BVSH 2BDBA 1Z71A 4DOQA 1BMFD 3VGCB 4CR9A 4NFFA 2UWOA 4D7GA 2BD2A 1FY8E 1AVGH 2XYAA 2A2QH 1PPHE 3RM0H 1AQ7A 1A3BH 4ZHAA 1SOZA 3H7TA 2PWXA 1HYLA 2PR3A 5DP7A 1S81A 1VITH 1X7AC 1GI4A 1K0HA 1BMLA 1SGPE 2GX4A 2J9NA 1YWUA 1P0SH 2KCAA 2P3TB 3A8AA 1HV7A 1UK4A 3KEEA 2OXSA 1GI5A 4NIWA 5DKMA 2ODQA 3RM2H 5CE1A 1DITH 1EZQA 2B8OH 1SGTA 1GL1A 1V2VT 2ZQ1A 3FP8E 2ALVA 1PQ5A 2SFAA 4B76A 1S83A 1BTYA 4LXBH 1MQ6A 5F03A 4ZXXH 2HALA 3ZZBA 4NIXA 3RXOA 4U01A 2BDGA 4AG1A 1XX9A 1TGSZ 1BBRE 1GBLA 2OBOA 1DWBH 2C93B 2P3UB 3VG8A 4JZEH 1ZPCA 1DWDH 3KL6A 2F43B 5EW1H 3F9EA 3GCTG 3H09A 1QRZA 5C3NA 2OBQA 5EJZA 4ZUHA 5JBAS 3I29A 3T27A 1ZZZA 5I25A 4A1VA 4DIIH 2FYRA 2XNIA 2GMTB 1KTTB 4CR5A 4K1SA 1GG6C 3GY7A 1NBME 1E36B 3T29A 5I46H 3A7VA 3ODFA 1TNIA 3NWUA 2FOFA 3EAJA 1UTNA 3EQ0H 1C5RA 1LDTT 1D9IA 2F9PA 2KAIA 4NWLA 3RXAA 3U8OH 1ABIH 1PJPA 2ZC9H 4D8NA 1CA8B 1F5RA 1G36A 2NU2E 1WDIA 2Y7XA 3RU4E 2GCTC 2XWAA 2TPIZ 1GJDB 4CREA 2BHGA 3VEQB 3MNCA 3KHVA 3ZZ9A 3E0PB 5CHBA 1QY6A 3GCHB 2SGQE 5LPEA 3U98H 2H5DA 2WPIS 1SQAA 1HIAB 5G4BA 1FN8A 1P11E 2KX4A 2VIOA 1A7SA 1C5MD 2CMYA 2XBWA 3LPRA 1NU7B 4CRBA 1UTOA 1ZJDA 4ABHA 4IS5A 1AMHA 3KQCA 1MTVA 3UR6A 1THSH 2HOBA 2TGAA 9LPRA 3U1JB 3M3SA 4Y8ZA 5EPYA 3DUXH 4FOUC 5FBEA 5IK2D 2STBE 1MTSA 5DPAA 1C2JA 3SUFA 1GBTA 4HI3A 4Q2KA 3OTPA 1G2MA 2DUCA 5JBTA 5K0HA 3A8CA 3D49H 2ZWLH 3MNXA 4U32A 4Y8YA 1EASA 2BDAA 4XBDA 5F53A 2LELA 1ELGA 3SNEA 1A0HB 1O3IA 3PWCA 2GT8A 4YOGA 1WV7H 3GYLB 1KSNA 3O8RA 2ANYA 1SKYE 2O8MA 1A46H 2QF3A 2AFQB 1MD7A 2XTTB 3NKKA 4DVAU 3PO1B 1HJAC 4YESB 2ZPSA 1SQTA 2J94A 3BEIB 3TK9A 1K1MA 3ZV9A 1MUEB 4X1SU 5A8ZA 1P01A 1UK3A 2BMGB 2XC0A 2K1QA 1TBZH 3E0NB 1AI8H 4BAOB 5DGJA 3VFEA 4NZQA 1BUIA 2TGPZ 4THNH 3SQEE 1C1UH 3A7WA 4FUEA 4UFFH 3MU8A 1OHHD 1UVPA 3EGKH 2BQWB 3ZVGA 2R2MB 3RMMH 1AHTH 1C5PA 1P3EA 2P8OC 5FHTA 1K2I1 3SU1A 1ELCA 1S0RA 2ZA5A 4GHTA 3UQVA 3A8DA 3ATKA 3PMAB 4I86A 1Z8JB 1SGIB 1LHCH 2PV9B 1EAWA 3GY8A 3F2GA 1ELAA 1DWCH 3GY2A 2BLWA 2XNDD 1C2GA 2ZEBA 2BD4A 3SUGA 1LKAA 3SU6A 4K69A 3TIUA 2PUXB 1S6FA 2ODPA 1TX6A 1GI7B 1EATA 1EOLA 3IITA 3RXPA 5A09A 3N99A 1QL7A 1O2KA 4I8JA 2ZFRH 2RFKC 3LDXH 2ZECA 2AH4X 1TNGA 4OS1A 2FOAA 4SGAE 3ATLA 2ZHFH 3A84A 1C2DA 2ZU1A 1AE5A 2ZDLA 1SBWA 1HBTH 3D23A 3GYMA 4TYDA 2G4UA 4H6TA 1E34B 2XCFA 3DFJA 3N7EA 3Q3XA 1HAHH 1GBAA 1UTMA 1CBWC 2RDEA 1P2JA 1ACBE 1O2MA 1O37A 1VJAU 1ZTJA 1KDQB 3TLOA 3AVZA 1IOEA 2FESH 1F0TA 4RI0A 4B74A 1HRTH 3S7KB 3UAIC 3OU0A 1AUTC 3UPEA 1ELTA 3M35A 4GHQA 4DURA 1P2IA 1MCTA 3ZVBA 3GCNA 1AVXA 1G30B 5LH8A 5CMXH 1VZQH 1TNLA 1V2UT 1YGCH 3A89A 4Z1MD 1CHGA 3F2HA 1FY1A 1UTJA 2TIOA 3Q3KA 1EPTC 5HKKD 2OC0A 1V2PT 1Y59T 1YLDA 4RSPA 1A0LA 5CDFE 5BPEA 2Q6FA 1MKWK 3RUOA 3RXFA 2Y81A 5AFYH 4ASUD 3SNCA 1RRKA 5GDSH 4Q63A 2WPLS 2CF8H 1T8OA 2ZU4A 2WPHS 2ZFQH 1GMHF 1O35A 5EXNA 2FLBH 5EQRA 1ZMLA 3P8GA 1RFNA 3MNSA 1TPPA 1FQ3A 3E91A 1TGNA 3KGPA 2ZGCA 2W5EA 2PKSC 4GPGA 1TIOA 3S0NA 3RC5A 1BBRH 1LQEA 2L74A 2FX4A 3PTBA 1GGDB 2ZGJA 1QGFA 1C5ZB 1V6DA 4A6LA 1OX1A 3A7ZA 2F9VA 2A0QB 3SV2H 2L6OA 1O2HA 4QT8C 5JYIA 1K1NA 1QQUA 1XMNB 2BD9A 2WV5A 4DIHH 4GVUA 4MDSA 3AAVA 2D26C 2J97A 2LNCA 4UONA 1SLVB 2NU0E 3FVFB 1JIRA 1FX0B 3SGAE 3QTOH 4ABEA 4B1TA 1MBMA 3UWJH 1C5TA 1GPZA 1TBRH 2IPHA 3MH4A 3ZZDA 2GV7A 2Z9GA 1WQSA 2HPQH 1LHEH 1NS3A 1J9CH 1GBIA 5DP5A 1FI8A 4B6FA 1TRYA 1SQRA 3E8LA 3PWBA 1ZGIA 3RXBA 1GBHA 2WUBA 2SGEE 1VITF 5AVDA 4AG2A 1FIZA 4WMDA 4X6PA 6CHAC 1GJ7B 2A7JA 3SU2A 1V2LT 2ESTE 2FI3E 3EE7A 3LIWA 4ZAEA 2ZHEH 1GCTB 3HATH 2VINA 5AHGH 3ZVDA 5IYTA 4TWWA 3OYPA 4FU8A 2XBYA 1DFPA 2PW8H 1GI9B 5ESTE 1BQYA 2ULLA 2QXGA 1YP9A 1PYTC 1NO9H 3FKSD 1DY9A 3O8DA 1OOKB 2THFB 2VWMA 2OINA 3UTUH 2ZF0H 1EKBB 3QLPH 3RXUA 1W11U 3SU4A 1AUJA 1YC0A 2SGDE 3BG4B 3PV4A 1O2PA 1TWXB 5GIBA 1KLJH 2STAE 3UR9A 1NZQH 2EEKA 1ZHPA 4IMQA 1L0ZA 2CGAA 1NRQH 3MO6A 3PV5A 1ZSKA 1TNJA 1KMHB 2JETB 3M7QA 4OGXA 1ZJKA 5ESBA 1O5DH 1HXEH 5HM9A 2V7QD 1RIWB 3WW7A 5A0CA 6LPRA 4OS2A 1ETSH 1SGFG 2HWLB 2QF4A 4XOJA 4WMEA 4AYVB 3RXLA 1OWEA 2H9HA 1FJSA 2ANWA 2V3OH 1CT0E 1UCYK 2WHXA 3KQDA 4CHAB 2ODYB 1CHOF 1NFYA 1MKXH 4XSKU 1H4WA 1S0QA 1THRH 5T3HA 3E16B 4AYYB 2G52A 2ZFFH 5B6LA 1WTHD 1VITG 3QK1A 3RXVA 5DG6A 3P17H 1A2CH 1SVPA 2QIQA 7ESTE 1CT4E 4ABJA 5A8XA 2ZGXH 2BDHA 1GDUA 4XDEA 3S69A 4O03A 4FUDA 1OWKA 4XBBA 2TGDA 1Z1JA 4RN6A 1WOFA 4YT6H 3TVJB 3AW1A 3KF2A 5C5OA 1B0FA 3GICB 2VBCA 3VB6A 1ZMJA 3PROA 1HUTH 4ABDA 2C8WB 1K1JA 4ISOA 1BMAA 1F0UA 2JKHA 4X2VA 3OY6U 1W13U 3P95A 1BJVA 1NROH 4YXWD 4NGAH 1C5NH 1BHXB 2CHAC 1HAGE 3O8CA 1DE7H 1FPCH 2H9EH 5EPNA 3QZQA 1W12U 2OC1A 2YMSC 3A81A 5FX5A 1H9HE 4ABFA 3VXFH 2A5IA 5E2OA 1JXPA 2F91A 4RT1A 4VGCC 4NA7A 4MNWA 2FIRH 2UUKB 5HXFA 3KYFA 5LPRA 1LVYA 1M9UA 2Q1JA 4UFDH 3ZZCA 2C90B 4FVDA 4RT0A 1VGCC 1QJ1B 3Q76A 2W7SA 3BN9A 2F3CE 3GDVA 2QA9E 4LOYH 1EZUC 1GHXH 3MU4A 1YPHE 5C0UA 2ILNA 4JYTA 1HLTH 2A31A 1Z6EA 1UHBA 4WF8A 4B2AA 3V7TA 3KNXA 3GY6A 4ZHMU 5ETXA 1YPGH 3ZVFA 1V2NT 1C1WH 2G51A 2LP6A 2OQ5A 5KGOA 2EI8A 2ALPA 5EXMA 4KKDA 2QCYA 1CHOG 2VIDA 3LC3A 1UK2A 4IN2A 1AWFH 2F83A 1NFXA 1HB0B 5H4IB 1LMWB 1ORFA 3NUMA 5HYOA 1NRPH 2A1DB 4HGCA 3ZZAA 4MPXA 2FOCA 1UW7A 4ABIA 4K3JA 1TQ7B 1O3KA 3PB1E 1A5IA 1O2VA 1C4U2 1P3CA 1L2EA 2C3SA 1C9TA 8ESTE 3RDZA 1GBCA 1H8IH 1O3JA 3DT0H 1Z8IB 4CBNA 1K9OE 4ESTE 3Q3YA 1EJMA 3LKWA 3RXDA 2GGVB 1KIGH 4K1EA 1P2KA 1KLTA 4R0IA 4ASHA 2FZZA 1PQ7A 1OYQA 3LGIA 4FUBA 1VCQA 3F2FA 2AMPA 2BX3A 1WUNH 2BVXH 3OEHD 1XKAC 1SFQB 1QNJA 2FTLE 1IQJA 1S85A 1O5BB 3TJNA 3LOXA 2BY6X 4YLQH 3W95A 7KMEH 1N1LA 1EB1H 2FOEA 2KCOA 3RMOH 2ZI2H 1CSOE 3ATWA 3C27B 1Y3WA 5DP8A 3WWBA 2V3HH 3TGIE 2RA3A 3B8JA 4BAQB 4Y76A 2R3YA 4NSYA 1EQ9A 3SNDA 4AFUA 1FPHH 4AFSA 4YLUA 4WWYA 3TITA 3GCOA 1F5LA 5DSFA 3QN7A 4I8HA 2ZDKA 1J8AA 3BTGE 1CA0B 3BV9B 1GG6B 2ZFTA 1AVWA 4NIYA 2UUJB 1C2KA 1QB1A 1TNHA 2AMQA 4AN7A 2GDDA 1ELEE 3MH6A 4B73A 5A8YA 1O2NA 1C1NA 1IQHA 1DSUA 4YTAA 1THPB 1AFQC 3BIVH 1WCZA 1LTOA 1WBGB 3PLPA 3QGJA 2SGPE 2FM2A 2GCTB 1CGHA 1O3EA 1EZXC 1H8DH 3CS7A 3BTKE 2WYJA 1DANH 1JRTA 2FXRA 4HFPB 2Z9KA 4X1NU 3FO8D 1ZHMA 1BJUA 3WWFA 1TGCA 4A5TS 3FAOA 2FMJA 2GJGA 2W6ID 2PTNA 2WSSD 3CNRA 8GCHF 2BM2A 3ZVEA 5C1UA 3BTDE 2AEIH 6GCHF 4ZH8A 3WY8A 1UTPA 1WTGH 2VJ1A 1F92A 1ELFA 3PYHA 4OS6A 1V2RT 2HGTH 5BRRE 1MTWA 3PLKA 1G3CA 1P04A 1MZDA 2ZFPH 1FV9A 1NRNH 1SOTA 4TPYA 3R3GB 1EAXA 4ABAA 2VVUA 5C67A 1Z1IA 5JB9S 3V0XA 1Y8TA 1GMCF 2G81E 2BOKA 1AIXH 1F7ZA 5EG4A 1AZZA 1FY5A 1Y5AT 2OD3B 3SHAH 3ATIA 2H6MA 2H5CA 4ABBA 1UTQA 2BQ7B 3BTTE 2VGCC 4JK6A 2ZDMA 4UFEH 3UUZA 1DSTA 1LVOA 4NIVA 3F9HA 2Z9JA 3E3TA 4I8KA 2ZCLP 3ZZ7A 1EUFA 1LHGH 1GI0A 1O39A 2W7UA 3E6PH 4GCHF 3UNRA 2BLVA 3SZNA 1QL8A 8KME2 3F6UH 1PYTD 5A0BA 2BLQA 2XBXA 3UOPA 1IQEA 1C1VH 5EXLA 1O3HA 4YM9A 3MNBA 3A82A 4GLYA 4AX9H 4H42U 1YCPH 1KTSB 2FOMB 1Y3XA 1O5AB 1AY6H 1JWTA 1J14A 4MNYA 1EXFA 3STIA 3SNAA 4O9VA 1Y5UT 1AU8A 1ZRBA 1D6RA 1FY4A 2FTMA 1YPHC 2PKAA 2A4OA 2ZCKP 3E90B 3SBKA 1P06A 2SNVA 1SSXA 3SW2B 1T8MA 3ZVCA 3P70B 1MTNC 1FY3A 3TGKE 4O3TA 3UNSA 2G8TA 1SGYE 2G4TA 2GMTC 1C1OA 2PUQH 1BTHH 1SGQE 1XUGA 1XM1A 6GCHG 1DXPA 5FCRA 1O3GA 1QJ7B 3S9BA 3H5CB 1P10A 1FN6A 5EODA 5JBCS 1ELDE 3URDA 4AOQA 4P00A 1O32A 3RXEA 1GBFA 2J98B 1D3DB 4FUGA 3PMJA 2VWLA 3F0PA 3AAUA 2XOKD 3HK6B 2AIPA 1P2NA 1TA2A 2GZ8A 1UJ1A 1F0RA 2H9TH 5E2PA 4OGYA 4NZLA 4IMZA 1HAVA 1O3MA 2WYGA 1NU9A 5GXPA 1C1RA 1GMCG 4X0WU 3GCHC 5F8ZA 4R8TB 1NY22 2AIQA 4ZKOU 1BTWA 2VIVA 4IGDA 3MOCA 1ZGVA 2BD8A 3PTNA 1BTUA 2BY5X 1W7XH 2ZU2A 4A92A 1D4PB 1YPEH 1HFDA 1ZSLA 1C2FA 3MYWA 1V3XA 4I8LA 1QBVH 1J16A 1D3PB 2XC4A 3ODDA 2ZU3A 4GCHG 3W94A 2J4IA 1MD8A 1CBWB 1VR1H 1EP6A 1GJCB 4IW4E 4IC5A 1O3AA 2YMSD 1BRAA 1PFXC 3U8TH 1GJ6A 1F5KU 1PPGE 3M3VA 1YF4A 4XBCA 3OFND 1O2XA 1H9IE 5F8XA 3RXRA 5J4SA 3S7HB 4Q4LA 2ASUB 4A7IB 1QIXB 5HIZA 1IQLA 1HPGA 1A5HA 5GPIB 4J2YB 4WY3A 1GBMA 3IWMA 1TB6H 1Z8RA 2G5VA 1ZSJA 1MKXK 4AGKA 4ISNA 4MVNA 4ABGA 5EU8A 3BIUH 3UOUA 3MI4A 2VIQA 3RXGA 5SGAE 1BZXE 1IHSH 4MPVA 3SJOA 3SJKA 1V2QT 3ZYDA 1CE5A 3PO1C 1DM4B 1Y3YA 1TX7A 2BY8X 1KXFA 3M5NA 1F0SA 4Y11E 1W7GH 4HG6A 3KQEA 1HDTH 3FN8A 1K22H 1CVWH 3D65E 2HPPH 2SNWA 1TLDA 3ZV8A 2OC7A 2PKSB 3M37A 1ID5H 4BAHB 3V3MA 3UWIA 4IC6A 5EQQA 1E79D 2XWBI 4E7RG 2FOGA 1RXPA 1NPMA 1BT7A 3FP7E 1CU1A 1P57B 2CV3A 3RP2A 3DHKH 3OE7D 3SJ9A 1YCPM 3RLWH 5TCAA 1YPJH 2B0FA 3AW0A 5T6GA 2JJ2D 1W2KH 3HKJB 2VWOA 4ISHH 1OPHB 1YKTA 1SPJA 1DLEA 4FUCA 2P95A 1MQ5A 1S84A 1ARBA 4Q7XA 2ZTXA 1N6XA 3TPIZ 1O3BA 1PPZA 1CO7E 1XKBC 5F6MA 1AKSA 4CRFA 1Y3UA 1BB0B 2HVXA 4O97A 3OX7U 4DJZB 5A2MH 1QCPA 3GS9A 1DICA 1IHTH 3FFGA 3F68H 2KR7A 1OSSA 1XUHA 2PGBB 3SJIA 1K1OA 1GHAF 3MHWU 4Y0YE 1GHYH 1ELVA 1GHBF 3SUDA 1O2ZA 2AMDA 1BTPA 4NFEA 4FU7A 4P02A 2UUFB 2C8YB 1SGEE 4CBOA 2OC8A 4IN1A 5CHAC 2A7CA 3PRBA 3A8BA 2W3IA 1TBQH 4YO9A 2P93A 1DUEA 1QBNA 2W6JD 1C9PA 3VB4A 4U2WA 1O3CA 1RJXB 3TH3H 3N7OA 5KEDA 1JMOH 2DE9A 3F3BA 1SI5H 2OK5A 1FIWA 4NSVA 3URCA 3SV9A 1AB9C 1KXCA 2JDID 3T62A 1P02A 1WSSH 1XUIA 4Z0KA 3QTVH 3MTYA 2QY0B 3RXQA 2ANKH 2P59A 1N8OC 1GDNA 4I32A 1UVUH 1O30A 2OLGA 2BDIA 5K7RA 5HMAA 1GMDF 1C5SA 2Z3CA 3BEFB 4MNVA 1O2TA 1NC6A 3ENSB 1ZLRA 3OAAD 4Q80A 3U9AH 4BAMB 1QTFA 4TT3D 4WH8A 1SL3A 2VU8E 1TONA 2BDCA 1RTLA 2KZ4A 3A7YA 1TQ0B 3BTFE 3FZDA 1E35B 4CRAA 1T8LA 1HJ8A 1O2YA 2BOHB 1ZRKA 5DP3A 3TH4H 1FZZA 1GMHG 1NN6A 5GCHF 1KXDA 3K6ZA 4OM9A 3U8RH 3RU4T 1W3CA 1UO6A 5E0HA 3SHCH 5FPSA 5GJ4B 1UVTH 2B7DH 3F1SB 1N6YA 2C8ZB 2GZ7A 2VVVA 4Y71A 1C2LA 1HNEE 2BVRH 1GHAG 1LO6A 2R0KA 1O2OA 4IBLH 2XCNA 1GHBG 3BEUA 5FCKA 3BTHE 4MPUA 1O38A 4X6OA 1UCYE 4BTTB 5L30H 4BTUB 3M5MA 3VB7A 1HGTH 2QXHA 3F0OA 4ZKRU 3MFJA 5C0TA 3RXCA 1SFIA 1INCA 5EJLA 1P2QA 2Q6GA 3VXEH 1ZPBA 1QRXA 4NCYA 1EB2A 1C2HA 3P8FA 3ELAH 3JZ2B 2CHAB 3FZZA 1GI6A 4FUFA 4ISIH 2VNTA 3LGUA 4FVBA 2YMSB 4F55A 1SLXB 1W0ZU 1L1NA 3GY5A 1FUJA 5E8EH 1O5GH 4VGCB 1ESAA 1GJAB 5L2ZH 4M9FA 2ZDVH 2HVYB 5T6DA 1VGCB 4Y8XA 1G9IE 1QURH 3M61U 3ZVAA 3EE0B 2GZ9A 1DDJA 4KTUA 3NCLA 3R0FA 3RMNH 3PMBB 4LZ4B 2BD7A 3DSGA 1XUFA 1LPGB 3NZIA 2QXIA 1COWD 2FI4E 1L1GA 1ARCA 1C5LH 2HRVA 1EP5A 2J2UA 3TK6A 4AC9A 1HIAA 1D6WA 2GT7A 1E1RD 2GV6A 1GL0E 1O5EH 4B71A 5ABWA 3LONA 2ZQ2A 2FP7B 2D8WA 3I78A 1C4V2 2JH0D 3MH5A 2KM0A 1PPFE 5FPYA 1UTLM 2RA0A 1TRNA 1GCDA 3Q00A 1ZTKA 2FOBA 1QB9A 3PV2A 5GCHG 4AFQA 3LH3A 2QN5T 5FBIA 1MABB 3U1IB 1IQNA 1BMNH 3STJA 3P6ZB 3T25A 1W8BH 4BTIB 1H8HD 2RG3A 2WUCA 3A7TA 2B9LA 4PROA 1JRSA 1P2MA 3QGNB 1O2QA 1DVAH 1QL9A 2JETC 2XBVA 4WMFA 1AE8H 1QBOA 2A2XH 3SO3A 1TAWA 3OSYA 3E1XB 2HNTE 1ZOMA 4INHA 3QUMP 1TMTH 1W0JD 2CJIA 1BCUH 1O2LA 5HIYA 2OCVB 1KYNA 3G01A 1PPBH 3SV6A 1O2WA 2J98A 3K6YA 2G55A 3A80A 3I77A 1DS2E 4TY6A 3DSOA 1XVMA 2ZHDA 1YM0A 1MKWH 1QA0A 1ABJH 3BF6H 2HNTF 2QF5A 2UWLA 1FLEE 1TNKA 1FAXA 1IQKA 4FUJA 2PFEA 4ISLA 4NWKA 3UY9A 1DUAA 1NTPA 4XD7D 3SGBE 1LCYA 2QV1A 1HAOH 3RMLH 4UFGH 4JZ1A 2CN0H 1VKYA 1BRBE 1RD3B 1BIOA 1GDQA 3T5FH 1OYTH 1T4VH 1V2KT 1J15A 4O3UA 1ETTH 5B6OA 2BZAA 4YOJA 1KXAA 5DO4H 1C2EA 2O8TA 1LVMA 5PTPA 4DT7B 1TALA 3QO6A 5EQSA 1P9UA 2TBSA 2CXVA 3UREA 1A5GH 2OUAA 1G37A 2BY9X 1CQQA 1QQ4A 1AFQB 2EI7A 1GVKB 3MU5A 1OXGA 2AERH 4ZKSU 3O8BA 1SC8U 3SI4H 4X1QU 1NFUA 4E7NA 2IJD1 3RXKA 3TGJE 1KXBA 4AGJA 3KN2A 4X8UH 2NU3E 3HPTB 4A1XA 1ZTLA 3ATMA 4Y79A 3QWCH 2HLDD 1AGJA 3P8OA 4INKA 1HAXB 2A4QA 3FANA 2ZP0H 2KCPA 4KTCA 4Q7ZA 1NFWA 2PSYA 3V13A 5F8TA 2KFWA 1NBMD 2EI6A 4AORA 5L2YH 2FODA 4RKJB 2ZIQH 1P09A 4DGJA 3MQKC 5T6FA 2GVFA 2QGRA 4TSFD 4BXSA 4BAKB 1MU8B 1W0YH 1TPAE 4Y6DA 4ZXYH 5C17A 1D3TB 1U6QA 3M3TA 2EQNA 4UDWH 1C1TA 1QZ8A 1SLWB 1T4UH 2XC5A 1MAYA 2JJ1D 2YNBA 3A7XA 3RU4D 1KDQA 1C2MA 3HGPA 4ZMAH 2NU1E 4F49A 1BRUP 1HAYB 2QF0A 1H8ED 3SGQE 1TOMH 1VJ9U 3FOAA 4Y7AA 1TABE 4B6EA 1VCWA 4X8VH 4E06H 1IQMA 1O3DA 1GI8B 2GD4B 1EFRD 4K60A 4KGAA 2ZPQA 3T2NA 1WQVH 4HZHA 2VGCB 4FETA 2IN2A 1P05A 3EDXB 2BD3A 1PPEE 3GDSA 1KY9A 2AGIX 1O3PB 5KECA 3KIDU 3CS0A 2C4FH 1JIMA 3SU5A 1AZ8A 1WU1A 2D1JA 4OS5A 1SMFE 2ZGBH 1AO5A 3IG6B 1A0JA 1DY8A 2VH6A 3UQOA 5EW2H 4X6NA 3C1KA 5EOKA 2A45B 1Y5BT 2O8WA 5TJXA 1BITA 2A4RA 2Y7ZA 3ZZ6A 1RTFB 3VGCC 5J4QA 2A32A 5AF9H 2BD5A 1V2ST 3BTQE 2Z9IA 5JPMH 5DP4A 4CH2B 4KELA 2R0LA 4ZHLU 5FXLA 1O5FH 4X1RU 3A86A 2FO9A 3GOVB 3S9CA 1GHWH 3B23B 3A87A 2P3FH 1GJ5H 3ZIAD 1ZMNA 1UCYH 1MTNB 3QDZB 4JMYA 4JYVH 3MO9A 4I8GA 3M5OA 1BTXA 5LPFA 2AHME 3SU0A 1XXDA 1CA0C 3L33A 2V6NA 4DY7B 4INLA 2C8XB 1E1QD 3EA9A 4H6SB 2F9UA 2ZHQH 4JK5A 2BZ6H 1GHZA 4K2YA 4YOIA 1BBRK 3DD2H 2PHBA 1TYNA 1O2GH
chains in the Genus database with same CATH topology
1GBKA 2VIWA 1EJNA 1O2SA 5GWZA 4ZROA 1TMUH 2ZTYA 1HJAB 4D9QA 5DP9A 1YLCA 2GP9B 2RCEA 2V35A 2AS9A 2UUYA 3AASA 2ZFSA 1O3FA 4X6MA 2HNTC 2BB4A 4UE7H 3RXJA 3P92A 3RXIA 2FLRH 5FX6A 1MAXA 2ANMH 2FEQH 1O34A 1Q3XA 1OP2A 4M7GA 1F2SE 1GI1A 1C4Y2 1ZR0A 2Y82A 2UWPA 2AGEX 3SNBA 3UFAA 4U30A 1MMJN 1DX5M 1EAIA 1RS0A 2Z6BD 4CRDA 8GCHG 2P8OB 3GDUA 3LGTA 3GY3A 2PSXA 1UVOA 4AB8A 5EGMA 2AYWA 2ZU5A 3SUEA 2I6SA 1OWIA 1C5XB 5HGGA 2W26A 1ESBA 3KQBA 1ANDA 2OQUA 1C5QA 1G3DA 2J38A 1LVBA 1C5WB 1PPCE 1ZPZA 4Y7BA 1YYY1 1EZSC 4JZFH 2BTCE 1FNIA 1O2IA 3RLYH 3SU3A 2QYIA 4OS7A 1HAIH 3B9FH 3NPSA 4X8SH 3Q77A 1KLIH 4X2YA 4FU9A 1AD8H 1UHBB 3CP7A 4FUHA 2H1UA 4HTCH 4KP0A 1Q31A 1GBBA 2ZG0H 2Y5FA 4AFZA 2A4GA 1SQOA 1O31A 4WVPE 2IOTA 1SGDE 4MTBA 4X8TH 1SHYA 2R3UA 3SORA 1HAPH 3LT3A 7GCHF 2FDAA 4NG9H 4X1PU 3PMHB 2ZNKH 3RXHA 1ANEA 4JZIA 3MU1A 1HAZB 4MLFB 5JBBS 1HCGA 2F9OA 4GUXA 4JCNA 1RTKA 4BOHA 1C5UA 3KCGH 2FWWA 3TH2H 1TMBH 1GWAA 1EPTB 3SV7A 4MPWA 1L4DA 1ZYOA 1GJ9B 2JH5D 3TK5A 2TRMA 2Z3EA 1C5YB 1FMGA 1DLKB 1EAUA 1SGFA 1YPMH 2FYQA 3T26A 3EYDA 4ZKNU 2P94A 4X2WA 1V2MT 1DT2A 4GAWA 1LHFH 4CRGA 1P03A 1GI3A 1W10U 1G2LA 2OP9A 5E0GA 1XXFA 2R9PA 2BXTH 4BNRA 1QB6A 3GISB 1DOJA 3LJOA 2FI5E 1T32A 2O8LA 1V2JT 5CHAB 1O5CB 4H4FA 4Y10E 4BXWA 1DPOA 1C1SA 1OWDA 3F9GA 1SGRE 1E37B 2B5TB 2Y5HA 2Q6DA 3M7TA 1TE0A 3P8NA 2IJOB 3SN8A 9ESTA 2A5KA 4DW2U 3BTEE 3SI3H 4D9RA 1AB9B 4AB9A 7GCHG 2BY7X 1TGBA 1QHRB 2PTCE 3VB3A 3ZZ8A 2CF9H 2D2DA 1ANBA 4TPIZ 3ZZ4A 1GBDA 1Q2WA 2NU4E 1N8OB 1B0EA 2O9QA 3DFLA 3QZRA 1GBJA 2RDLA 6CHAB 3TJUA 1LPKB 3TJVA 4DCDA 1Z6JH 5HM2A 3D62A 1AFEH 1BOQA 2I6QA 1L4ZA 1OKXA 3VB5A 2ZZUH 1K1PA 2FOHA 3LGWA 1AN1E 1FAKH 3MMGA 4BANB 1FXYA 1K21H 1P8VC 1UVSH 2ZTZA 3TU7H 3SJ8A 2ZDNA 5DJ7A 4D7FA 4E05H 1NRSH 5AFZH 3SOSA 2KAIB 1P9SA 1Z8GA 2WV4A 1O36A 2ZKSA 3M5LA 4JYUH 1XUJA 5JB8S 3A83A 2TGTA 1GVZA 2VWNA 1A4WH 2DE8A 1S5SA 1EX3A 1DXWA 1V2TT 1QR3E 2ZGHA 4GSOA 2ZDAH 3EA8A 1E0FD 1Y3VA 2A5AA 1LHDH 1UTKA 4YZUA 3LGYA 3NK8A 1NT1A 1RGQA 1IAUA 1OS8A 2SGFE 2BX4A 1TRMA 2VB0A 3LJJA 2QAAA 1BHXF 1CGJE 2Y5GA 5C1XA 1MH0A 5E0JA 3U69H 5LGOA 1WYKA 1OWHA 1GI2A 1SLUB 5DP6A 5C1YA 1IQIA 1YPKH 2BLOA 1CGIE 2WPMS 3K65B 1SGNE 1G3BA 3LU9B 3LGVA 2PKAB 4UEHH 1V2OT 3SQHE 1GGDC 1WAYB 1XVOA 1TOCB 4A1TA 4XE4A 1JOUB 2W3KA 1BTZA 3LH1A 5FPTA 1K1IA 1A61H 2AGGX 3A85A 3TJOA 1DWEH 2WPKS 2GCHF 1FONA 8LPRA 4K8BA 4Y0ZE 5C2ZA 1MBQA 1MCVA 1QJ6B 4SGBE 4RKOB 3QX5H 1A3EH 1O0DH 3PLBA 1BMMH 3T28A 4KTSA 3ZZ5A 2XW9A 1BDAA 4CH8B 1NRRH 4FXGH 1TFXA 1GBEA 1B7XB 1K1LA 3V12A 4F4OC 1SHHB 3S9AA 4K5ZA 2YOLA 1HAVB 1D3QB 1GJ4H 4AZ2B 1IQGA 4WXIA 4WH6A 4FUIA 2ZHWH 6ESTA 3BTWE 3LC5A 1TA6A 4D76A 1JBUH 3K9XB 4B2CA 1ANCA 1OP0A 1LQDB 4X2XA 3ITIA 4B2BA 1HXFH 1G3EA 3ESTA 1GMDG 1ZHRA 3BG8A 3L3TA 2WPJS 4K1TA 2BQ6B 1GCTC 7LPRA 3HKIB 3H7OA 4TWYA 3M7UA 1W14U 2G5NA 2F9NA 5C5NA 1G32B 1HJ9A 1MZAA 1O3LA 2J34A 4Z6AH 2V0BA 4K8YA 2EA3A 2H2ZA 2ZCHP 4I7YH 1TGTA 4LK4A 1V2WT 5C20A 3TNSA 1GVLA 3VPKA 3F9FA 2Z9LA 3RXMA 1LKBA 1H9LB 2GTBA 3UNQA 1BRCE 1IQFA 3BG4C 2BXUH 2YNAA 1C5OH 1KXEA 3TNTA 2Z7FE 1YBWA 5A0AE 1TPSA 5IDKA 2NWNA 1GHVH 1L1JA 2FPZA 1C5VA 5FAHA 1OWJA 3MH7A 2GCHG 2XRCA 3PM3A 2ZPRA 4NA9H 2LPRA 3SV8A 4Q7YA 1SB1H 1C1MA 1O2UA 3K2UA 1RIWC 1TX8A 2A7HA 1YCPK 3BTME 1O2JA 1EOJA 3M36A 4CRCA 1BA8B 4WXVA 4YT7H 5DK1A 2Z3DA 1C1PA 1GJ8B 3RC4A 3RXSA 1QFKH 1EJAA 1MU6B 3L6PA 2ZO3H 1YPLH 2R2WU 4CHAC 1P12E 4B75A 3GY4A 2F9BH 1Z7KA 1GJBB 5JDUB 4XFQA 3HK3B 3OY5U 4OS4A 1CT2E 3MO3A 2FX6A 1S6HA 1SGCA 2GDEH 2SGAA 1T31A 1UMAH 2OTVA 1P2OA 2JH6D 4MNXA 4UD9H 3HGNA 1ELBA 3DA9B 2EC9H 3UIRA 1QRWA 2FS9A 1NM6A 1J17T 4J1YA 4JZDH 2WINI 2J95A 1SR5C 2QXJA 1A1RA 2GKVE 1SG8B 2PLXA 2FS8A 4I33A 3CENA 5L6NH 5TCCA 1K28D 1AKSB 1E38B 3BSQA 2BYAX 3JZ1B 1MTUA 1FDPA 1PQ8A 3MWIU 1O33A 2VH0A 1VCPA 2VVCA 3ZZ3A 3NXPA 3A88A 1NESE 1C1QA 1O3NA 1QA7A 4I31A 2BDYA 3FP6E 1C2IA 2G00A 1O2RA 1ESTA 1T8NA 1LPZB 4MG3A 2M5TA 1B5GH 3MU0A 2J92A 4MQAA 1T7CA 2QC2A 3EA7A 3ZYEA 3RC6A 2Y6TA 1EPTA 1TPOA 4TY7A 4WJG2 1PQAA 3GCTF 2HLCA 4NA8A 1XUKA 3OTJE 3RXTA 2VIPA 2Z94A 1O3OA 2XXLA 1H1BA 4DG4A 1S82A 2Y80A 2PGQB 1ETRH 2O8UA 1AWHB 2P16A 4LZ1H 1OP8A 2BVSH 2BDBA 1Z71A 4DOQA 3VGCB 4CR9A 4NFFA 2UWOA 4D7GA 2BD2A 1FY8E 1AVGH 2XYAA 2A2QH 1PPHE 3RM0H 1AQ7A 1A3BH 4ZHAA 1SOZA 3H7TA 2PWXA 1HYLA 2PR3A 5DP7A 1S81A 1VITH 1X7AC 1GI4A 1BMLA 1SGPE 2GX4A 2J9NA 1P0SH 2P3TB 3A8AA 1HV7A 1UK4A 3KEEA 2OXSA 1GI5A 4NIWA 5DKMA 2ODQA 3RM2H 5CE1A 1DITH 1EZQA 2B8OH 1SGTA 1GL1A 1V2VT 2ZQ1A 3FP8E 2ALVA 1PQ5A 2SFAA 4B76A 1S83A 1BTYA 4LXBH 1MQ6A 5F03A 4ZXXH 2HALA 3ZZBA 4NIXA 3RXOA 4U01A 2BDGA 4AG1A 1XX9A 1TGSZ 1BBRE 1GBLA 2OBOA 1DWBH 2C93B 2P3UB 4JZEH 1ZPCA 1DWDH 3KL6A 5EW1H 3F9EA 3GCTG 1QRZA 5C3NA 2OBQA 4ZUHA 5JBAS 3I29A 3T27A 1ZZZA 5I25A 4A1VA 4DIIH 2FYRA 2XNIA 2GMTB 1KTTB 4CR5A 4K1SA 1GG6C 3GY7A 1E36B 3T29A 5I46H 3A7VA 3ODFA 1TNIA 3NWUA 2FOFA 3EAJA 1UTNA 3EQ0H 1C5RA 1LDTT 1D9IA 2F9PA 2KAIA 4NWLA 3RXAA 3U8OH 1ABIH 1PJPA 2ZC9H 4D8NA 1CA8B 1F5RA 1G36A 2NU2E 2Y7XA 3RU4E 2GCTC 2XWAA 2TPIZ 1GJDB 4CREA 2BHGA 3VEQB 3MNCA 3KHVA 3ZZ9A 3E0PB 1QY6A 3GCHB 2SGQE 5LPEA 3U98H 2H5DA 2WPIS 1SQAA 1HIAB 5G4BA 1FN8A 1P11E 2VIOA 1A7SA 1C5MD 2CMYA 2XBWA 3LPRA 1NU7B 4CRBA 1UTOA 1ZJDA 4ABHA 4IS5A 1AMHA 3KQCA 1MTVA 3UR6A 1THSH 2HOBA 2TGAA 9LPRA 3U1JB 3M3SA 4Y8ZA 5EPYA 3DUXH 5FBEA 2STBE 1MTSA 5DPAA 1C2JA 3SUFA 1GBTA 4HI3A 4Q2KA 1G2MA 2DUCA 5JBTA 5K0HA 3A8CA 3D49H 2ZWLH 3MNXA 4U32A 4Y8YA 1EASA 2BDAA 4XBDA 1ELGA 3SNEA 1A0HB 1O3IA 3PWCA 2GT8A 4YOGA 1WV7H 3GYLB 1KSNA 3O8RA 2ANYA 2O8MA 1A46H 2QF3A 2AFQB 1MD7A 2XTTB 3NKKA 4DVAU 3PO1B 1HJAC 4YESB 2ZPSA 1SQTA 2J94A 3BEIB 3TK9A 1K1MA 3ZV9A 1MUEB 4X1SU 5A8ZA 1P01A 1UK3A 2BMGB 2XC0A 2K1QA 1TBZH 3E0NB 1AI8H 4BAOB 5DGJA 3VFEA 4NZQA 1BUIA 2TGPZ 4THNH 3SQEE 1C1UH 3A7WA 4FUEA 4UFFH 3MU8A 1UVPA 3EGKH 2BQWB 3ZVGA 2R2MB 3RMMH 1AHTH 1C5PA 1P3EA 2P8OC 5FHTA 1K2I1 3SU1A 1ELCA 1S0RA 2ZA5A 4GHTA 3UQVA 3A8DA 3ATKA 3PMAB 1Z8JB 1SGIB 1LHCH 2PV9B 1EAWA 3GY8A 1ELAA 1DWCH 3GY2A 2BLWA 1C2GA 2ZEBA 2BD4A 3SUGA 1LKAA 3SU6A 4K69A 3TIUA 2PUXB 1S6FA 2ODPA 1TX6A 1GI7B 1EATA 1EOLA 3IITA 3RXPA 5A09A 1QL7A 1O2KA 4I8JA 2ZFRH 3LDXH 2ZECA 2AH4X 1TNGA 4OS1A 2FOAA 4SGAE 3ATLA 2ZHFH 3A84A 1C2DA 2ZU1A 1AE5A 2ZDLA 1SBWA 1HBTH 3D23A 3GYMA 4TYDA 2G4UA 4H6TA 1E34B 2XCFA 3DFJA 3Q3XA 1HAHH 1GBAA 1UTMA 1CBWC 1P2JA 1ACBE 1O2MA 1O37A 1VJAU 1ZTJA 1KDQB 3TLOA 3AVZA 1IOEA 2FESH 1F0TA 4B74A 1HRTH 3S7KB 3OU0A 1AUTC 3UPEA 1ELTA 3M35A 4GHQA 4DURA 1P2IA 1MCTA 3ZVBA 3GCNA 1AVXA 1G30B 5LH8A 5CMXH 1VZQH 1TNLA 1V2UT 1YGCH 3A89A 1CHGA 1FY1A 1UTJA 2TIOA 3Q3KA 1EPTC 2OC0A 1V2PT 1Y59T 1YLDA 4RSPA 1A0LA 5BPEA 2Q6FA 1MKWK 3RUOA 3RXFA 2Y81A 5AFYH 3SNCA 1RRKA 5GDSH 2WPLS 2CF8H 1T8OA 2ZU4A 2WPHS 2ZFQH 1GMHF 1O35A 5EXNA 2FLBH 5EQRA 1ZMLA 3P8GA 1RFNA 3MNSA 1TPPA 1FQ3A 3E91A 1TGNA 3KGPA 2ZGCA 2W5EA 2PKSC 4GPGA 1TIOA 3S0NA 3RC5A 1BBRH 1LQEA 2FX4A 3PTBA 1GGDB 2ZGJA 1QGFA 1C5ZB 1V6DA 4A6LA 1OX1A 3A7ZA 2F9VA 2A0QB 3SV2H 4QT8C 1O2HA 5JYIA 1K1NA 1QQUA 1XMNB 2BD9A 2WV5A 4DIHH 4GVUA 4MDSA 3AAVA 2D26C 2LNCA 4UONA 1SLVB 2NU0E 3FVFB 1JIRA 3SGAE 3QTOH 4ABEA 4B1TA 1MBMA 3UWJH 1C5TA 1GPZA 1TBRH 2IPHA 3MH4A 3ZZDA 2GV7A 2Z9GA 1WQSA 2HPQH 1LHEH 1NS3A 1J9CH 1GBIA 5DP5A 1FI8A 1TRYA 3E8LA 3PWBA 1ZGIA 3RXBA 1GBHA 2WUBA 2SGEE 1VITF 5AVDA 4AG2A 1FIZA 4WMDA 4X6PA 6CHAC 1GJ7B 2A7JA 3SU2A 1V2LT 2ESTE 2FI3E 3LIWA 4ZAEA 2ZHEH 1GCTB 3HATH 2VINA 5AHGH 3ZVDA 5IYTA 4TWWA 3OYPA 4FU8A 2XBYA 1DFPA 2PW8H 1GI9B 5ESTE 1BQYA 2ULLA 2QXGA 1YP9A 1PYTC 1NO9H 1DY9A 3O8DA 1OOKB 2THFB 2VWMA 2OINA 3UTUH 2ZF0H 1EKBB 3QLPH 3RXUA 1W11U 3SU4A 1AUJA 1YC0A 2SGDE 3BG4B 3PV4A 1O2PA 1TWXB 5GIBA 1KLJH 2STAE 3UR9A 1NZQH 2EEKA 1ZHPA 4IMQA 1L0ZA 2CGAA 1NRQH 3MO6A 1ZSKA 1TNJA 2JETB 3M7QA 4OGXA 1ZJKA 5ESBA 1O5DH 1HXEH 5HM9A 1RIWB 5A0CA 6LPRA 4OS2A 1ETSH 1SGFG 2HWLB 4XOJA 4WMEA 4AYVB 3RXLA 1OWEA 2H9HA 1FJSA 2ANWA 2V3OH 1CT0E 1UCYK 3KQDA 4CHAB 2ODYB 1CHOF 1NFYA 1MKXH 4XSKU 1H4WA 1S0QA 1THRH 5T3HA 3E16B 4AYYB 2G52A 2ZFFH 1WTHD 1VITG 3QK1A 3RXVA 5DG6A 3P17H