1F0UA

Bovine trypsin complexed with rpr128515
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of human factor Xa complexed with potent inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0uA02
2QY0B 3RXGA 5BRRE 3GYLB 1J15A 1FY5A 2B5TB 3SNEA 1BZXE 5C67A 2J4IA 3OY5U 2PGQB 2QGRA 1HGTH 3P17H 2OBQA 1ANBA 2M5TA 1UVPA 4Y71A 3D23A 4MNVA 1NU7B 4X6PA 1O31A 1QCPA 1VCWA 4YTAA 3ATKA 2ALPA 2BY7X 1G2MA 3ZVGA 1O3EA 1EZUC 3ZYEA 2BDCA 1S83A 2HWLB 3MTYA 1V2OT 1AVWA 3KNXA 2AERH 1O5GH 3ZZCA 3LGWA 3UWIA 2PKAB 2HOBA 3MH6A 4WXVA 1HB0B 1NTPA 1TNHA 2TIOA 3EE0B 1EZQA 2F9VA 4DY7B 1J16A 1MQ5A 1ANEA 2C8YB 1GJ4H 1LVYA 3GY7A 3QUMP 1ABJH 3P70B 3ATMA 1TX6A 3F6UH 1UJ1A 1NRNH 4O97A 3OSYA 4THNH 4QT8C 1OWEA 2BY5X 5DG6A 1INCA 3BG4B 3T27A 4X6OA 2AMQA 3H7TA 4HI3A 1HAGE 1O2VA 3SUEA 3S9BA 4GHTA 3RC5A 1GI7B 1IHTH 1L4ZA 5TCAA 3SU5A 4WF8A 1P2QA 4SGBE 3UNSA 1HAZB 1L0ZA 3KEEA 3STIA 1S81A 1QJ1B 2VB0A 5FPTA 1O2QA 4E06H 4AN7A 1YGCH 1ZZZA 1AGJA 2EI8A 4NFFA 4NZLA 3D49H 2BDHA 3TK5A 2EA3A 4D8NA 1ZPZA 1QL8A 1FPCH 1NN6A 1MAXA 1L1NA 1UCYK 3LDXH 1CQQA 1SGFA 4OGXA 3Q00A 1EZSC 5LPRA 2ZQ2A 1YYY1 4KKDA 3RXVA 1BTUA 1SQOA 1HV7A 1O2RA 2AMDA 2BMGB 1O3LA 3E3TA 5GPIB 5EOKA 4K8BA 3QZQA 1W7XH 1AO5A 4Y6DA 1KXCA 2RDLA 3PO1C 4ABBA 2A4OA 3RMMH 2BZ6H 4IN2A 1GWAA 1WCZA 1K1PA 2GCHF 1AVGH 3NKKA 2PSXA 1GJ9B 4FUGA 3L6PA 2ZKSA 2HGTH 3MU1A 4K60A 4ISOA 3CS7A 1GI3A 1Y5AT 1PQ7A 4Y10E 4BAHB 4X1RU 3U8OH 2D1JA 4GSOA 2WPHS 5IDKA 3TJVA 2ZCKP 2OTVA 1WYKA 4DW2U 1EKBB 2JKHA 2XXLA 5CE1A 1SSXA 3PB1E 1SL3A 5EPYA 2Y7XA 1E38B 1IQNA 2PW8H 1SB1H 1A4WH 1THRH 2STAE 4OS2A 2Z9JA 3RXIA 2Y7ZA 3CP7A 2JETB 1PJPA 1QB9A 4H42U 5JBBS 4YM9A 5EXMA 1MKWH 2WPJS 3BTDE 5C2ZA 2G52A 3O8CA 2W5EA 2XBYA 3W95A 1UO6A 2BOHB 2AEIH 2B7DH 4AYYB 3E16B 3HK6B 1QL9A 4JZFH 1G3BA 3D62A 5DJ7A 1BITA 1QA7A 3RXUA 4VGCB 2XCNA 3ZVFA 1RGQA 1BBRE 3RXRA 2J92A 4E7NA 3P8GA 5C1UA 1HBTH 1A1RA 3T62A 1BT7A 1HPGA 4Y7BA 2PHBA 1A0HB 3KGPA 2P94A 1MMJN 2GZ9A 2J2UA 2ZGBH 1KTTB 3ZZ7A 4DG4A 4TPYA 3ZZBA 5DO4H 1ANCA 1BTWA 1T8OA 3VFEA 1CT4E 2ALVA 5ESBA 1ZSKA 3GY4A 5EQRA 2YNAA 4DJZB 3ZVCA 3SORA 1ZJDA 2C93B 4DURA 1GBTA 3N7OA 4B76A 1NT1A 3EA7A 5HGGA 1N1LA 4UEHH 1WV7H 3BTQE 1B0EA 3MYWA 4ABIA 1SHHB 1GHVH 3K65B 4MPXA 1HIAB 5J4SA 1P2JA 1GBIA 2PKAA 1P2IA 4BTUB 1C1WH 2UWLA 1GVKB 1AD8H 1CVWH 3TPIZ 5EW1H 4I33A 4PROA 4GPGA 3AW0A 2A32A 1BMAA 5CMXH 5AFZH 3R3GB 4UFFH 1YC0A 2P16A 1Y3YA 1EX3A 2FS8A 1DANH 4MDSA 2F9OA 4NA8A 1G3DA 1TOCB 1HJ9A 3SU1A 5GDSH 4X0WU 1ZTJA 1Z1JA 1GBFA 3UREA 1Q31A 2BY6X 1P0SH 3A87A 1O3KA 1OXGA 2ZNKH 4FU9A 1HYLA 4KGAA 1AI8H 2BD5A 2GV6A 2AGIX 1QB1A 8KME2 1DITH 2ODQA 3SNAA 1ZPBA 1MBQA 2VIQA 2ZECA 1DUAA 1ETRH 3RXPA 3SJKA 1W10U 2GCTB 3PMAB 1QA0A 5DP5A 1NFUA 4CBOA 1AN1E 3RMOH 4ABFA 1BQYA 1C1NA 3U8TH 2FESH 1FPHH 4ZKSU 1VITG 3ITIA 2H9TH 2PSYA 5A0BA 1ZYOA 1SLWB 3M3VA 1QJ7B 1GMCG 4LK4A 1Q3XA 2FOCA 1A61H 1TX7A 1P8VC 4NIWA 1IQMA 1RXPA 2W7SA 3IITA 2ZGJA 2ASUB 2OLGA 1WUNH 1D3TB 4WY3A 1QJ6B 4ABHA 1GHYH 2DUCA 2HPPH 1YF4A 2BD2A 3SV8A 3MO6A 1GJ5H 4INKA 2W3KA 1XXDA 1Y5BT 4GCHG 2AIPA 2FLRH 2D2DA 1EAUA 1TGCA 4R0IA 5JDUB 2TBSA 3QDZB 3BF6H 3UWJH 2VWOA 5FAHA 6GCHG 1A0JA 4H4FA 2ZDNA 1EQ9A 4FUJA 2OCVB 1CHGA 1TPSA 1O2GH 1MU8B 4GAWA 3M5NA 1N6YA 2PV9B 1FAXA 1K2I1 1GGDC 5GJ4B 3TITA 2QXIA 2ZTXA 1C1TA 1GI9B 1ELAA 1HXEH 1TFXA 3BSQA 2A4GA 4BXWA 2F91A 1OYQA 2HALA 2WPLS 4LXBH 3SGBE 4DIHH 2H9EH 5FX5A 1O2KA 2W3IA 5T6DA 4I8KA 3UQOA 2ZU4A 5CHAC 1DM4B 1TX8A 4ZAEA 1FN6A 5A8YA 1GI6A 1UTJA 3E0NB 6LPRA 1OP8A 1HAIH 3K2UA 1OWJA 4Y8XA 4BTIB 3PTNA 5AFYH 1EASA 1P03A 3LGYA 1H4WA 1V2NT 2ZPRA 3O8RA 4Y8ZA 2ZA5A 2XC0A 3ATIA 1HAOH 3A8CA 1RTKA 4YOJA 3TJOA 1GDUA 4I8JA 1BB0B 4TPIZ 3OTJE 2V0BA 1KDQB 1DXWA 3F9EA 1SGNE 1UMAH 2QN5T 4ZROA 4AZ2B 4FUDA 3SJ8A 3KIDU 1BRCE 1AZZA 1XXFA 3DD2H 1F0SA 1P02A 3TGIE 1BHXF 4H6SB 1FY3A 1CT2E 1GJ6A 5DP7A 2Q6DA 1W2KH 1Y3XA 1B0FA 1VITH 1QBOA 2GD4B 1XMNB 4E05H 4K3JA 3A7WA 1RIWC 4E7RG 5GIBA 1IAUA 2FI3E 4F49A 3RXKA 4B2CA 2OXSA 1GJBB 1MQ6A 3RXTA 2FTMA 4D9QA 3WY8A 1EXFA 3A8AA 1QRWA 1GI2A 1ACBE 2QCYA 1O5DH 7GCHG 1AY6H 2ZDVH 1Z6EA 1Z8IB 5E0HA 1Z8GA 4GLYA 1BBRH 3K6YA 2C90B 1K1MA 1SGPE 1WOFA 2Z9GA 2G55A 3LH3A 1Z1IA 1C2EA 1V2JT 1A0LA 2XYAA 4ISHH 4NIVA 1F0RA 1OOKB 2ZPQA 9ESTA 2CF8H 4NIXA 5DP3A 1JRTA 7KMEH 2GZ7A 2ZF0H 2D8WA 3TVJB 1JOUB 3BG8A 4ISLA 1Z8RA 2G4UA 1RFNA 4NG9H 1KXFA 5F8XA 4A7IB 4YT7H 2B8OH 1TRNA 1T8LA 1CE5A 2Q6GA 4B2AA 3A7ZA 2W26A 3SU0A 2VWMA 2ZDAH 2ANWA 3UNQA 2PGBB 1ZTKA 1CO7E 4X2WA 2UUKB 1QQUA 2FMJA 1G3CA 2WPMS 4INHA 1UTNA 2GX4A 2FOAA 3A83A 3KN2A 4IC6A 3SJIA 3TLOA 1SC8U 1C1QA 3LC3A 4D7GA 4AOQA 4O3UA 1GL0E 3M5MA 4IC5A 2SGQE 1EOLA 4U01A 4BAOB 1V2LT 4X8TH 4IBLH 1CGIE 1O5BB 1O35A 1SGRE 5DP9A 3ODDA 1V2KT 2TRMA 1UHBB 1D3PB 2GMTC 3MH4A 1KSNA 1B7XB 3RXBA 3P92A 1TONA 2A5KA 3LT3A 1LKAA 4X1PU 2HNTC 2O8MA 4CHAB 3I77A 4DCDA 1C5YB 4AYVB 1SMFE 5DK1A 3GCHB 1YPJH 1MKXK 4MNWA 5F8ZA 4Q7YA 1C5NH 2QF3A 3PYHA 3LC5A 4IS5A 1KXDA 4XDEA 2FI4E 1GBCA 3ODFA 5I46H 1ARCA 2ULLA 3MU4A 1AE5A 2V3HH 2CV3A 2FIRH 4YESB 3RXOA 1NRSH 1QNJA 2ZGXH 3QTVH 1DWBH 2ZGHA 3I29A 1EAIA 1CHOG 2Q6FA 3L3TA 1EZXC 1VR1H 1FY1A 1GBKA 2P93A 4ZKNU 2QIQA 3BIUH 3SJ9A 3ZZ6A 3Q77A 2G00A 1Y3VA 1JBUH 5EQSA 1JRSA 2VIDA 1J8AA 2ZFQH 1OWDA 2BDGA 1C5RA 3ZZ5A 2WYGA 3BEUA 3AVZA 4NIYA 3ZVEA 4X6NA 1DICA 4AGKA 1P11E 1P01A 2PKSB 3AAUA 1O3OA 4Y11E 1F5KU 4SGAE 3UR9A 1GBDA 3ZZ9A 4BOHA 2BD7A 1XUFA 1ZR0A 3UR6A 2BHGA 2G4TA 6CHAC 3ZVAA 1LPGB 3RC6A 4K5ZA 2ZG0H 1ELVA 1MD8A 1YKTA 2Z9LA 3DFJA 2ZDKA 3RXHA 4JYVH 1EJAA 2BYAX 1YCPM 1AB9C 2PLXA 2VU8E 1EATA 3PROA 3LGIA 3DHKH 4K1TA 3VXEH 3TGKE 2EEKA 3A8DA 1AUTC 1OS8A 5EPNA 1QGFA 3D65E 1DT2A 4XBDA 1K28D 2Y82A 2P3TB 3RXDA 3RXCA 3TK6A 5DP8A 2FLBH 1WSSH 3R0FA 3KL6A 1EP5A 1EOJA 2A7JA 4ABEA 1O2MA 1KXAA 3F1SB 4X6MA 3BTGE 5F8TA 1Z6JH 1NRRH 1OPHB 4ISIH 1W0ZU 1HAPH 5A0CA 4H6TA 1C5MD 2FOBA 3SU4A 3KQCA 4AFQA 2P8OC 1MTNB 3SU2A 4BANB 1JIMA 2FTLE 1YLDA 4Y76A 1EAWA 1HAHH 1HJ8A 3Q3KA 3A84A 4CRFA 1DLKB 3BTWE 2Z6BD 3S0NA 1SGDE 1EPTC 1SGFG 3H7OA 3U69H 1F5RA 2J9NA 1F7ZA 1CA0C 4TY6A 3M3TA 1IQGA 2O8TA 1O39A 2VINA 3LONA 4XBCA 3SW2B 1GHBG 4ESTE 1QY6A 2QF0A 2VIPA 4X1SU 1LVBA 1WAYB 1P57B 3E0PB 1UTQA 4J2YB 3GOVB 1BJVA 1HFDA 1GGDB 4Q7XA 4K1SA 1T8NA 1A7SA 2ZTYA 3VGCC 1C2GA 2BX4A 1UHBA 2RCEA 2FX6A 1RRKA 2A1DB 1Z71A 2V35A 2JH6D 3S7HB 3TJUA 1QR3E 3UOPA 2WV5A 1SI5H 1C1UH 1AKSB 3TNTA 1SHYA 3GDVA 3MH5A 2THFB 1X7AC 1GHXH 1JXPA 3SUFA 1AFEH 2NWNA 1ESAA 5JBCS 4FUBA 1O2PA 5K7RA 2TPIZ 4Z0KA 4CRBA 2FYQA 1VZQH 2G8TA 1D4PB 5FBIA 1P10A 2ODPA 2BD9A 1O2XA 2ZHQH 1EB2A 3M5OA 1O2LA 1GI0A 1YP9A 4X1QU 3PLBA 3FZDA 5ETXA 1A5HA 2WUBA 3TIUA 1ANDA 2H5DA 4DT7B 3T2NA 1NO9H 3TK9A 1GJ7B 3MO9A 4K69A 3RLWH 2FXRA 2QXHA 1LPKB 2QC2A 2ZTZA 1GBBA 2LPRA 4ZHLU 2F9BH 1Y5UT 4B1TA 3P8NA 1CA8B 2XWBI 3QX5H 1G32B 5EODA 5EU8A 1QQ4A 5AVDA 1LDTT 2PFEA 1A5IA 2OC7A 1THSH 2ZFPH 3MH7A 1VITF 1FAKH 5FCKA 3HGPA 5GCHG 2JH5D 1GI4A 1MCTA 1GMCF 1T8MA 2Y6TA 1LVOA 3DFLA 2Z9IA 1Q2WA 3RXQA 2Z7FE 3TH3H 1C4V2 3U9AH 1SQAA 3S9CA 1HCGA 1U6QA 1RIWB 1S0RA 2BVXH 2SFAA 3GCTG 3E8LA 3A81A 1TQ0B 2A7CA 3GY2A 1K1LA 2H9HA 3VB7A 4AFUA 4GCHF 3GY6A 2FYRA 2GTBA 1VGCC 2PUXB 1UTOA 1YBWA 4UFGH 4YOIA 1ELFA 1HAXB 1SFQB 2QXJA 1G30B 6GCHF 3S69A 2NU0E 2HVXA 4XBBA 1WQSA 2F9NA 1C2LA 3MNSA 5EGMA 2BOKA 1CBWB 1C5WB 1GG6C 1VJ9U 2ZO3H 4I7YH 1MU6B 1PYTD 1DOJA 1TOMH 3E91A 4YLUA 2ODYB 3C1KA 1S5SA 4I32A 4BXSA 1F5LA 2A2XH 3QGNB 4UE7H 1N6XA 1NFYA 3QLPH 4AG1A 4WMEA 3NZIA 1EAXA 2TGDA 1C5UA 5C1XA 2XBVA 1C5VA 1ELCA 1E34B 2RA3A 4NSVA 4OS6A 2EC9H 4KTSA 5B6OA 3ZVDA 3HK3B 4FUIA 1YCPH 1AHTH 3EDXB 3JZ2B 1OX1A 1K1OA 6ESTA 1AU8A 1AIXH 1Z7KA 1A3EH 1JWTA 1MBMA 2R2WU 2H5CA 2P59A 5E8EH 3C27B 1Y3UA 4I8HA 3SV2H 1TBZH 3O8DA 1LCYA 1GMDG 4U30A 4CREA 4WJG2 2GMTB 3MNXA 4B71A 3U98H 1BIOA 2XTTB 2GT7A 1ZLRA 3ZZDA 1K1JA 2HNTE 2RG3A 2J38A 4B73A 1BUIA 2FOGA 2FP7B 1TRMA 1NROH 1AKSA 1ARBA 1QB6A 4FXGH 1P3CA 3FP8E 1K21H 1J14A 1SLXB 3RXMA 1C1SA 3MI4A 3Q3YA 5DPAA 4Y0ZE 1E0FD 3KCGH 1DPOA 1WBGB 2B0FA 4ZKRU 4ZKOU 4X2YA 5ESTE 4JK6A 1H8DH 5L2YH 1TMUH 1BMMH 1G9IE 1V2WT 1ZHRA 2BM2A 4I8LA 4CH8B 3ZYDA 1F2SE 7GCHF 2CXVA 2O8WA 1O2JA 2A5IA 4U32A 3RC4A 1P9SA 3VB4A 4MQAA 1O3BA 4YZUA 4DVAU 1C1VH 1V2TT 1O2WA 2UWOA 3RXAA 1PYTC 1IQJA 1QBNA 4WVPE 1AFQC 2OINA 4D7FA 1O3NA 1XVMA 3NXPA 1V3XA 1NS3A 4ISNA 3F9HA 4ZMAH 1PQAA 1TNKA 5C5NA 3KQDA 4KTUA 3V13A 1CU1A 3GCOA 1IQLA 1GVLA 1FI8A 1C5XB 2AGEX 2R3YA 2BDAA 3KQEA 1G37A 1O3MA 2BVRH 3BTTE 2WPIS 3TH4H 5HM2A 2NU3E 3A7YA 2ANYA 3BG4C 3MFJA 3L33A 1YPLH 1VCPA 3SI4H 2J95A 2NU4E 5JBAS 4BTTB 5A8XA 4CRCA 1OSSA 3MNBA 2RA0A 4HFPB 2FEQH 2A5AA 1JIRA 1C5ZB 1O32A 2PTNA 1BRAA 4UDWH 4DGJA 1IHSH 2XNIA 4A1TA 1C4U2 1BRUP 5EW2H 2ZCLP 1NU9A 1GI1A 3SQEE 3QZRA 4IMQA 1ZGVA 2WUCA 2XBXA 1XUHA 1JMOH 1Z8JB 2OP9A 1ID5H 3HPTB 1FN8A 2A4RA 1GBLA 4YO9A 3M37A 4B75A 5LGOA 1IQKA 3EQ0H 4IW4E 4JK5A 1C5TA 4WMDA 1TPOA 1VJAU 3A86A 1W0YH 2Z3DA 5I25A 3T5FH 2ZHFH 3QN7A 2PUQH 2IJOB 3P6ZB 5DGJA 1LO6A 4OS4A 2BD4A 4A92A 4MPWA 4Q7ZA 4RSPA 5T6GA 5AHGH 4DOQA 1XKAC 1MTWA 2BVSH 1EPTB 2C4FH 2ZFRH 2Z9KA 1YPHC 1SFIA 2ZGCA 5FXLA 4NGAH 2Y5FA 1CA0B 1QIXB 4GHQA 1BJUA 1TQ7B 4JCNA 1MKWK 1C5PA 1MTUA 1CHOF 2XBWA 1LQDB 2GKVE 1GCDA 1MTVA 2UUYA 1PPCE 1UK3A 3K9XB 3VPKA 5E2OA 3GDSA 3RM2H 1O3FA 4O9VA 1ZSJA 1SGYE 1BDAA 2JETC 5DKMA 8LPRA 2LNCA 1TPAE 3M7TA 2G5VA 2FOMB 1N8OC 1LHCH 1TA6A 3O8BA 3MWIU 4Z6AH 2IN2A 2J94A 4VGCC 1TYNA 4A6LA 4NWLA 2J34A 3FANA 1GL1A 1P9UA 1V2PT 3SBKA 2GVFA 3LGVA 1KY9A 2ZFFH 2TGPZ 1DE7H 1AMHA 4NSYA 1GHAG 3MHWU 2XRCA 3DUXH 2C8WB 3SGAE 2C3SA 3RM0H 1BTPA 2ZP0H 3PO1B 1O3CA 1UVSH 1UTKA 3E1XB 1UCYH 2P95A 3SU6A 1NFWA 2BQ7B 2OC8A 3MNCA 2VIWA 1TMBH 5HM9A 1IQIA 1O3AA 2VGCC 2GT8A 4U2WA 4YT6H 3G01A 3B8JA 3URDA 2ESTE 1P2NA 2BX3A 2XC4A 1O5AB 5J4QA 1KXEA 2AS9A 1SGQE 1ZTLA 3RU4D 2SNWA 3TH2H 1OWIA 3BTHE 4I31A 1PFXC 1MD7A 1O3GA 1AVXA 4ABJA 1NZQH 3E6PH 2D26C 1O3JA 1O2ZA 1S85A 3RXSA 2KAIB 1LHEH 1GMHG 1UVOA 1XVOA 4NCYA 2ZC9H 4CRAA 1TLDA 2GDEH 2FO9A 3STJA 1BTXA 1O5FH 1GVZA 3OY6U 4I8GA 1GJ8B 3RP2A 4A1XA 4B2BA 1BRBE 2SGAA 4IGDA 1F0TA 3BV9B 3U1IB 1C2HA 2ZHDA 1DWDH 1C2FA 1S84A 3ESTA 2VVCA 1T32A 1EUFA 4HZHA 1C2MA 5DP6A 2R0LA 3MOCA 2PTCE 2ZFTA 1SLVB 1HAYB 1ZHMA 3PMBB 3TJNA 1MH0A 1VGCB 3HATH 1GHBF 2GP9B 3RMNH 5C5OA 2P3FH 3EGKH 3PMHB 5EXLA 5PTPA 3OYPA 1C4Y2 1ETTH 1HAVA 2FODA 1TAWA 1FXYA 5G4BA 5T6FA 1FUJA 4FUHA 1O2IA 1O2HA 3FZZA 4MG3A 2O9QA 2A31A 5H4IB 4Q2KA 4ABAA 5HMAA 2H6MA 3SUDA 5JB8S 2I6SA 1GBHA 1S0QA 9LPRA 2H1UA 4O3TA 4MPUA 1BOQA 1M9UA 4XFQA 4YLQH 1S6HA 1GDQA 1TB6H 1TNJA 1WU1A 1D6WA 2VIOA 5LH8A 1FY4A 1P2MA 4UFEH 5EG4A 1WTGH 2R2MB 4KTCA 2WINI 3GY5A 1HXFH 1EPTA 1G36A 1L2EA 4MLFB 2AMPA 5BPEA 2P3UB 3Q3XA 3ATLA 1F0UA 1Y3WA 4GUXA 1SVPA 2ZHWH 2ANMH 2XCFA 2FOEA 1Y8TA 3U8RH 3V7TA 4CBNA 1DX5M 1MTSA 1SOTA 4NA7A 4F4OC 1TABE 1MCVA 1ELDE 1T4VH 1TGTA 1C1RA 4ZH8A 2IOTA 1TNGA 5K0HA 4WWYA 3B9FH 1GBMA 1D3QB 1XUGA 3SU3A 2BXUH 3HGNA 3V12A 4D76A 4KP0A 4AB8A 5GCHF 3V3MA 1TALA 2BLQA 1DS2E 3SV7A 2NU2E 1FIWA 1RTFB 5C20A 5GWZA 2BD3A 2FM2A 3GCTF 3BTFE 4JYUH 4ZXYH 3JZ1B 3M61U 1YLCA 1LHFH 4TWWA 2A2QH 1O36A 3A7XA 3GYMA 4OGYA 1XM1A 1KTSB 4XSKU 2JH0D 1H9IE 4JMYA 3LH1A 4RN6A 1SG8B 4A5TS 3AW1A 1SR5C 1DFPA 3UFAA 1QHRB 1TPPA 1C2KA 1AFQB 4DIIH 1V6DA 5A2MH 2TGAA 4OS5A 1NESE 1GCTC 1O30A 4MNYA 2ZIQH 3SV6A 1UVTH 1W3CA 3LPRA 1T31A 3RMLH 1VCQA 1LQEA 1TE0A 4X8VH 2A7HA 4X8SH 1DXPA 4CR5A 1O2SA 2K1QA 2KAIA 1GDNA 3GICB 4NWKA 2SGFE 4Y7AA 1O3IA 8GCHG 1TNLA 1BBRK 2Y80A 2BZAA 2YNBA 1BMNH 2ZDLA 4TY7A 2VNTA 3S9AA 4ZHMU 3LU9B 3VB5A 3SV9A 1P06A 3SQHE 2GDDA 2QA9E 2CJIA 1UTMA 1HUTH 1LMWB 4NZQA 1EJMA 5CHAB 1O2YA 2ZU3A 3F9FA 4CRGA 1Y59T 1L1JA 5C1YA 3M35A 2FS9A 1GBJA 3EYDA 2G81E 1OWHA 1ZRKA 5F6MA 4ZUHA 3OX7U 3GISB 1WQVH 2YOLA 3IG6B 1QTFA 5FPYA 3ZZ4A 2SNVA 4LZ4B 1HJAC 1W12U 4FUCA 3BEFB 3A82A 1YPMH 1E35B 1GMDF 5A0AE 1B5GH 4FVBA 3EA9A 3HKJB 3SZNA 1TGSZ 1ZJKA 1LHDH 5L6NH 1C5SA 4WMFA 3LGTA 1AUJA 1ESTA 1QRZA 2ZHEH 2ZQ1A 4K1EA 1FY8E 3S7KB 5JB9S 1CSOE 1PPZA 4D9RA 5A09A 5IYTA 2F9UA 2HLCA 3NCLA 3RU4T 1YPHE 4AG2A 3PWBA 4ZHAA 3TNSA 3ATWA 1O37A 2UWPA 2A4QA 2Z94A 1PPHE 4M7GA 3PLKA 1FMGA 3PLPA 1YPGH 3ZZ3A 1TBQH 2ANKH 2HPQH 1DDJA 1SGTA 3M5LA 1UTPA 1OWKA 3BTEE 3PWCA 2CHAC 3ZZAA 2FX4A 2VH0A 1DWEH 1ZSLA 1H9HE 2ZDMA 3QK1A 1L1GA 1EP6A 4CR9A 3SHCH 4CHAC 3W94A 3A80A 3CS0A 3PMJA 1F92A 1C9PA 3GCHC 1AQ7A 1N8OB 5L2ZH 1O2TA 4Y8YA 3M36A 3A7VA 1NFXA 1IQHA 1A5GH 3ZV9A 1K22H 1S82A 3ZZ8A 2A45B 3AAVA 1K1NA 1GBEA 1J17T 1FQ3A 2CMYA 1W7GH 4HTCH 5LPEA 2FPZA 4TYDA 3A7TA 4Y79A 3EAJA 7LPRA 1LKBA 8ESTE 3BEIB 4MTBA 1UCYE 5L30H 4OS7A 2IPHA 1W13U 1C2JA 1E36B 1FLEE 3ZVBA 1TA2A 1LPZB 1HNEE 3P95A 2VGCB 3VXFH 1SGCA 1RS0A 1BCUH 5FHTA 1SBWA 4JYTA 2DE9A 1V2ST 1MZDA 3KF2A 2OUAA 3U1JB 1YPEH 3UIRA 4IN1A 4RKJB 2ZEBA 2QYIA 3SGQE 5E0JA 1O33A 4JZEH 2AH4X 1DVAH 2QV1A 4UFDH 3QGJA 4A1VA 4JZIA 1A46H 2PKSC 1SOZA 3LOXA 2CF9H 1QRXA 2BDBA 1O5CB 1V2RT 1W11U 3NWUA 3M7QA 4LOYH 3V0XA 5FBEA 4AGJA 2A0QB 2BB4A 1SQTA 2HNTF 1ZGIA 2VIVA 2VWNA 1YPKH 2Y81A 3ELAH 4X2VA 2UUJB 4MNXA 3M3SA 3RXFA 2FWWA 3LKWA 3SNBA 1NM6A 1AZ8A 1K1IA 2GCHG 1C2DA 1NRQH 1UTLM 2ZI2H 2ZZUH 2I6QA 1QL7A 1K9OE 4X8UH 1FDPA 2OQ5A 4X2XA 3T25A 5EQQA 3QWCH 4NFEA 1GHZA 1CGHA 3P8FA 3BN9A 2BXTH 3B23B 1XUJA 3A85A 1L4DA 5FPSA 4CRDA 2WPKS 1MKXH 1NPMA 1O5EH 3E90B 3QTOH 3PV4A 2ZPSA 2BD8A 1MAYA 4O03A 2QXGA 1E37B 1MTNC 2R3UA 3GY8A 2SGEE 4CH2B 2AIQA 1MZAA 3MU5A 2GZ8A 2BDIA 1ABIH 2VVUA 1TGBA 3MO3A 4FU8A 1PQ5A 4UD9H 1TMTH 4XE4A 2XW9A 1YM0A 3GCNA 1LTOA 4K8YA 2OQUA 2VJ1A 3OU0A 4FUFA 1C1OA 1KLJH 1V2UT 1GHAF 4BAQB 1TBRH 3PTBA 1V2VT 1ELEE 2Z3CA 3CENA 1IOEA 1QURH 2G5NA 5FCRA 2BDYA 1G2LA 5A8ZA 3ENSB 2QAAA 3BTKE 3BTME 3RU4E 1PPBH 2Z3EA 6CHAB 3FP6E 2UUFB 4HGCA 3SJOA 1W8BH 2V6NA 5JYIA 2F3CE 1BA8B 1GJDB 1AB9B 1OKXA 3RXJA 3FP7E 3GY3A 2W7UA 2WV4A 1ORFA 1T7CA 2V3OH 1OP0A 7ESTE 1HAVB 1HDTH 1DLEA 3FAOA 5ABWA 1OYTH 1P05A 1EB1H 1H1BA 2AYWA 1LHGH 1W14U 1GMHF 1EJNA 1RJXB 2AFQB 3SNCA 5JPMH 1V2MT 4AFZA 1AWHB 5FX6A 4ABDA 1FNIA 1C1MA 4JZ1A 1QBVH 2P8OB 5HYOA 4JZDH 1XUKA 3EA8A 1C5LH 1XX9A 3RXLA 2EI7A 3DT0H 2F83A 3URCA 5AF9H 3T26A 3IWMA 4KELA 1A2CH 1H9LB 4BAKB 3MU8A 4MVNA 3HKIB 3QO6A 3P8OA 1SGEE 3GDUA 3MMGA 2O8UA 2BLWA 1GI5A 1ESBA 3F68H 4LZ1H 2ZU1A 2CN0H 5C3NA 1ZRBA 1WTHD 3UPEA 1GCTB 1ZMLA 2VH6A 1J9CH 1SGIB 1FJSA 1HIAA 1XUIA 1BHXB 1ZHPA 1T4UH 4XOJA 1O2NA 1GBAA 3VB6A 1S6FA 2Q1JA 2DE8A 3UNRA 4AFSA 4J1YA 1O3PB 3SI3H 3VGCB 1PPGE 1HLTH 2H2ZA 1PPEE 2FDAA 2Y5HA 1ETSH 4BAMB 1CT0E 5JBTA 2C8ZB 2C8XB 3DA9B 4RKOB 2EI6A 1P09A 1KXBA 3A88A 4K2YA 2Y5GA 1DWCH 1GPZA 1GI8B 2FOFA 2VVVA 1FZZA 2XWAA 1TRYA 3Q76A 3UQVA 1D3DB 1BTZA 1HJAB 1FONA 1O3HA 1RTLA 1SLUB 3NK8A 1DY9A 2BLOA 1CBWC 4INLA 4WH8A 3TU7H 4IMZA 3TGJE 5EXNA 2BLVA 1IQFA 3SNDA 1YCPK 3I78A 3LGUA 2HRVA 4FVDA 1TWXB 1C5QA 1C2IA 1RD3B 2OC0A 2CGAA 2OBOA 2GGVB 3ZV8A 2VWLA 3SUGA 4AB9A 2BY8X 5TJXA 3SN8A 1KLIH 3RXEA 4R8TB 1TNIA 2BQWB 3VEQB 4WH6A 2TGTA 2WYJA 2XC5A 3T29A 1AE8H 1DUEA 3MU0A 1O3DA 1MUEB 3PM3A 4YOGA 4Q80A 2ZWLH 1DY8A 2FI5E 2R9PA 2PWXA 4AORA 3AASA 5F03A 1FIZA 3UUZA 1A3BH 4TWYA 1IQEA 2PR3A 5E2PA 3SHAH 1C9TA 2OD3B 1NC6A 1NRPH 2OC1A 3LJJA 2F9PA 3A89A 4OS1A 2CHAB 1DSUA 4WXIA 3RDZA 1BTYA 3NUMA 3KQBA 5E0GA 5LPFA 3M7UA 3VB3A 1G3EA 3H5CB 4B74A 4X1NU 2FZZA 2FOHA 1CGJE 1DSTA 1HRTH 2ZCHP 2G51A 1P2KA 3K6ZA 1UK4A 1GG6B 3BIVH 1P2OA 2GCTC 2STBE 1C1PA 3F9GA 8GCHF 1KLTA 1XKBC 2B9LA 3RUOA 2ZU5A 3FFGA 2GV7A 1GJAB 4FU7A 3SO3A 2BQ6B 1O0DH 3KHVA 4AX9H 2ILNA 3SOSA 1ELBA 1O2OA 2AGGX 2NU1E 1V2QT 3UOUA 1ZMNA 4UONA 1GJCB 2SGPE 4Y0YE 4ASHA 1BMLA 3T28A 1UVUH 2R0KA 1TGNA 1FV9A 1PPFE 1AWFH 2SGDE 5TCCA 2ZU2A 4FUEA 3UTUH 1C5OH 1O34A 1KDQA 1PQ8A 1GHWH 4MPVA 5SGAE 4ABGA 3UY9A 1QFKH 3FVFB 1UK2A 1ZMJA 4GVUA 2BTCE 3RLYH 1ZOMA 2BY9X 1NY22 5DP4A 4ZXXH 1ELGA 1BTHH 1OP2A 3LIWA 1D9IA 1KIGH 1KYNA 1P3EA 1THPB 1ELTA 1H8IH 1O2UA 1D6RA 1P12E 5HXFA 1O38A 1SPJA 3LJOA 3A8BA 2ZFSA 1LVMA 5GXPA 2O8LA 3NPSA 1TIOA 1ZPCA 5T3HA 4BNRA 4NA9H 1P04A
chains in the Genus database with same CATH superfamily
5EJ1A 2QY0B 3RXGA 5BRRE 3GYLB 1J15A 1FY5A 2B5TB 3SNEA 1BZXE 5C67A 2J4IA 3OY5U 2PGQB 2QGRA 1HGTH 3P17H 2OBQA 3F2FA 1ANBA 2M5TA 1UVPA 4Y71A 3D23A 4MNVA 1NU7B 4X6PA 1O31A 1QCPA 1VCWA 4YTAA 3ATKA 2ALPA 2IJD1 2BY7X 2W6JD 1G2MA 3ZVGA 1O3EA 1EZUC 3ZYEA 2BDCA 1S83A 2HWLB 3MTYA 1V2OT 1AVWA 3KNXA 2AERH 1O5GH 3ZZCA 3LGWA 3UWIA 2PKAB 2HOBA 3MH6A 4WXVA 1HB0B 1NTPA 1TNHA 2TIOA 3EE0B 1EZQA 2F9VA 4DY7B 1J16A 1MQ5A 1ANEA 2C8YB 1GJ4H 4DT4A 1LVYA 3GY7A 3QUMP 1ABJH 3P70B 3ATMA 3SZEA 1TX6A 3F6UH 1UJ1A 1NRNH 4O97A 3OSYA 4THNH 4QT8C 1OWEA 2BY5X 5DG6A 1INCA 3BG4B 2KCAA 3T27A 4X6OA 2AMQA 3H7TA 4HI3A 1HAGE 1O2VA 3SUEA 3S9BA 4GHTA 3RC5A 1GI7B 1IHTH 1L4ZA 5TCAA 3SU5A 4WF8A 1P2QA 4SGBE 3UNSA 1HAZB 1L0ZA 3DSGA 3KEEA 3STIA 1S81A 1QJ1B 2VB0A 5FPTA 1O2QA 4E06H 4AN7A 1YGCH 1ZZZA 1AGJA 2EI8A 3FN8A 4NFFA 3D49H 4NZLA 2BDHA 3TK5A 2EA3A 4D8NA 1ZPZA 1QL8A 1FPCH 5B6LA 1NN6A 1YY3A 1MAXA 2KZ4A 1L1NA 1UCYK 3LDXH 1CQQA 1SGFA 4OGXA 3Q00A 1EZSC 5LPRA 2ZQ2A 1YYY1 4KKDA 3RXVA 1BTUA 1SQOA 1HV7A 1O2RA 2AMDA 2BMGB 1O3LA 3E3TA 5GPIB 5EOKA 4K8BA 3QZQA 1W7XH 1AO5A 4Y6DA 1KXCA 2RDLA 3PO1C 4ABBA 2A4OA 3RMMH 2BZ6H 4IN2A 1GWAA 1WCZA 1K1PA 2GCHF 1AVGH 3NKKA 2PSXA 1GJ9B 4FUGA 3L6PA 2ZKSA 2HGTH 3MU1A 4K60A 2HLDD 4ISOA 3CS7A 1GI3A 1Y5AT 1PQ7A 4Y10E 4BAHB 4X1RU 3U8OH 2D1JA 4GSOA 2WPHS 5IDKA 3TJVA 2ZCKP 2OTVA 1WYKA 4DW2U 1EKBB 2JKHA 2XXLA 5CE1A 1SSXA 3PB1E 1SL3A 5EPYA 3U28C 2Y7XA 1E38B 1IQNA 2PW8H 1SB1H 4P00A 1A4WH 1THRH 2STAE 4OS2A 2Z9JA 3RXIA 2Y7ZA 3CP7A 2JETB 1PJPA 1QB9A 4H42U 5JBBS 4YM9A 3PV2A 5EXMA 1MKWH 2WPJS 3BTDE 5C2ZA 2G52A 3O8CA 2W5EA 2XBYA 3W95A 1UO6A 2BOHB 2AEIH 2B7DH 4AYYB 3E16B 3HK6B 1QL9A 4JZFH 1G3BA 3D62A 5DJ7A 1BITA 1QA7A 3RXUA 4VGCB 2XCNA 3ZVFA 1RGQA 4XD7D 1BBRE 5C0TA 3RXRA 2J92A 4E7NA 3P8GA 5C1UA 3MQKC 1HBTH 1A1RA 3T62A 1BT7A 1HPGA 4Y7BA 2PHBA 1A0HB 3KGPA 2P94A 1MMJN 2GZ9A 2J2UA 2ZGBH 1KTTB 3ZZ7A 4DG4A 4TPYA 3ZZBA 5DO4H 1ANCA 1BTWA 1T8OA 3VFEA 1CT4E 2ALVA 5ESBA 1ZSKA 3GY4A 5EQRA 2YNAA 4DJZB 3ZVCA 3SORA 1ZJDA 2C93B 4DURA 1GBTA 3N7OA 4B76A 1NT1A 3EA7A 5HGGA 1N1LA 4UEHH 1WV7H 3BTQE 1B0EA 3MYWA 4ABIA 1SHHB 1GHVH 3K65B 4MPXA 1HIAB 5J4SA 1P2JA 1GBIA 2PKAA 1P2IA 4BTUB 1C1WH 2UWLA 1GVKB 1AD8H 1CVWH 3TPIZ 5EW1H 4I33A 4PROA 4GPGA 5CHBA 3AW0A 3H09A 2A32A 1BMAA 5CMXH 2XNDD 3R3GB 5AFZH 4UFFH 1YC0A 2P16A 1W0JD 1Y3YA 1EX3A 2FS8A 1DANH 4MDSA 2F9OA 4NA8A 1G3DA 5C17A 1TOCB 1HJ9A 3SU1A 5GDSH 4X0WU 1ZTJA 1Z1JA 1GBFA 3UREA 1Q31A 1UW7A 2BY6X 1P0SH 3A87A 1O3KA 1OXGA 2ZNKH 4FU9A 3N99A 1HYLA 4KGAA 1AI8H 2BD5A 2GV6A 2AGIX 1QB1A 8KME2 1DITH 2ODQA 3SNAA 1ZPBA 1MBQA 2VIQA 2ZECA 1DUAA 1ETRH 3RXPA 3SJKA 1W10U 2GCTB 3PMAB 1QA0A 5DP5A 1NFUA 4CBOA 1AN1E 3RMOH 4ABFA 3N7EA 1BQYA 1C1NA 3U8TH 2FESH 1FPHH 3CNRA 4ZKSU 1VITG 3ITIA 2H9TH 2PSYA 3FO8D 5A0BA 1ZYOA 1SLWB 3M3VA 1QJ7B 1GMCG 4LK4A 1Q3XA 2FOCA 1A61H 1TX7A 1P8VC 4NIWA 1IQMA 1RXPA 2J98B 3IITA 2W7SA 2ZGJA 2ASUB 2OLGA 1WUNH 1D3TB 4WY3A 1QJ6B 4ABHA 1GHYH 2DUCA 2HPPH 1YF4A 2BD2A 3SV8A 3MO6A 1GJ5H 4INKA 2W3KA 1XXDA 1Y5BT 4GCHG 4F55A 2AIPA 2FLRH 2D2DA 4Z1MD 1EAUA 1TGCA 4R0IA 5JDUB 2TBSA 3QDZB 3BF6H 3UWJH 2VWOA 5FAHA 6GCHG 1A0JA 4H4FA 2ZDNA 1EQ9A 4FUJA 2OCVB 4TT3D 1CHGA 1TPSA 1O2GH 1MU8B 4GAWA 3M5NA 1N6YA 2PV9B 1FAXA 1K2I1 1GGDC 5GJ4B 3TITA 2QXIA 2ZTXA 1C1TA 1GI9B 1ELAA 1HXEH 1TFXA 3BSQA 2A4GA 4BXWA 2F91A 1OYQA 2HALA 2WPLS 4LXBH 3SGBE 4DIHH 2H9EH 5FX5A 1O2KA 2W3IA 5T6DA 4I8KA 3UQOA 2ZU4A 5CHAC 4RT0A 1DM4B 1TX8A 4ZAEA 1FN6A 5A8YA 1GI6A 1UTJA 3E0NB 6LPRA 1OP8A 1HAIH 3K2UA 1OWJA 4Y8XA 4BTIB 3PTNA 5AFYH 1EASA 1P03A 3LGYA 1H4WA 1V2NT 2ZPRA 3O8RA 4Y8ZA 2ZA5A 2XC0A 3ATIA 2WPDD 1HAOH 3A8CA 1RTKA 4YOJA 3TJOA 1GDUA 4I8JA 1BB0B 4TPIZ 3OTJE 2V0BA 1KDQB 1DXWA 3NRLA 3F9EA 1SGNE 1UMAH 2QN5T 4ZROA 4AZ2B 4FUDA 3SJ8A 3KIDU 1BRCE 1AZZA 1XXFA 3DD2H 1F0SA 1P02A 3TGIE 1BHXF 4H6SB 2KCOA 1FY3A 1CT2E 1GJ6A 5DP7A 2Q6DA 1W2KH 1Y3XA 1B0FA 1VITH 3KQ5A 1QBOA 2GD4B 1XMNB 4E05H 4K3JA 3A7WA 1RIWC 4E7RG 5GIBA 1IAUA 2FI3E 4F49A 3RXKA 4B2CA 2OXSA 1GJBB 1MQ6A 3RXTA 2FTMA 4D9QA 3WY8A 1EXFA 3A8AA 1QRWA 1GI2A 1ACBE 2QCYA 1O5DH 7GCHG 1AY6H 2ZDVH 1Z6EA 2EY4C 1Z8IB 5E0HA 1Z8GA 4GLYA 1BBRH 3K6YA 1QZ8A 2C90B 2JJ1D 1K1MA 1W0KD 1SGPE 1WOFA 2Z9GA 2G55A 3LH3A 1Z1IA 1C2EA 1V2JT 1A0LA 2XYAA 4ISHH 4NIVA 1F0RA 1OOKB 2ZPQA 9ESTA 2CF8H 1OHHD 4NIXA 5DP3A 1JRTA 7KMEH 2GZ7A 2ZF0H 2D8WA 3TVJB 1JOUB 3BG8A 4ISLA 1Z8RA 2G4UA 1RFNA 4NG9H 1KXFA 5F8XA 4A7IB 4YT7H 2B8OH 1TRNA 1T8LA 1CE5A 2Q6GA 4B2AA 3A7ZA 2W26A 3SU0A 2VWMA 2ZDAH 2ANWA 3UNQA 2PGBB 1ZTKA 1CO7E 4X2WA 2UUKB 1QQUA 1K0HA 2FMJA 1G3CA 2WPMS 4INHA 1UTNA 2GX4A 5T1VA 2FOAA 3A83A 2AHME 3KN2A 4IC6A 3SJIA 3TLOA 1SC8U 1C1QA 3LC3A 4D7GA 4AOQA 4O3UA 1GL0E 3M5MA 4IC5A 4P02A 2SGQE 1EOLA 4U01A 4BAOB 1V2LT 4X8TH 4IBLH 1CGIE 1O5BB 1O35A 1SGRE 5DP9A 3ODDA 1V2KT 2TRMA 1UHBB 1D3PB 2GMTC 3MH4A 1KSNA 2LELA 1B7XB 3RXBA 3P92A 1TONA 2A5KA 3LT3A 1LKAA 4X1PU 2HNTC 2O8MA 4CHAB 3I77A 4DCDA 1C5YB 4AYVB 1SMFE 5GNDA 5DK1A 3GCHB 1YPJH 2QF4A 1MKXK 4MNWA 5F8ZA 4Q7YA 1C5NH 3PRBA 2QF3A 3PYHA 3LC5A 4IS5A 1KXDA 4XDEA 2FI4E 1GBCA 3ODFA 5I46H 1ARCA 2ULLA 3MU4A 1AE5A 2V3HH 2CV3A 2FIRH 4YESB 3RXOA 1NRSH 1QNJA 2ZGXH 3QTVH 1DWBH 2ZGHA 3I29A 1EAIA 1CHOG 2Q6FA 3L3TA 1EZXC 1VR1H 1FY1A 1GBKA 2P93A 4ZKNU 2QIQA 3BIUH 3SJ9A 3ZZ6A 3Q77A 2G00A 1Y3VA 1JBUH 5EQSA 1JRSA 2VIDA 1J8AA 2ZFQH 1MABB 3FOAA 1OWDA 2BDGA 1C5RA 3ZZ5A 2WHXA 2WYGA 3BEUA 3AVZA 4NIYA 3ZVEA 3AK5A 4X6NA 1DICA 4AGKA 1P11E 1P01A 2PKSB 3AAUA 1O3OA 4Y11E 1E79D 3F0OA 1F5KU 4SGAE 3UR9A 1GBDA 3ZZ9A 4BOHA 2BD7A 1XUFA 1ZR0A 3UR6A 2BHGA 2G4TA 3F2GA 6CHAC 3ZVAA 1LPGB 3RC6A 4K5ZA 2ZG0H 1ELVA 1MD8A 1YKTA 2Z9LA 3DFJA 2ZDKA 3RXHA 4JYVH 1EJAA 2BYAX 1YCPM 1AB9C 2PLXA 2VU8E 1EATA 3PROA 3LGIA 3DHKH 4K1TA 3VXEH 3TGKE 2EEKA 3A8DA 1AUTC 1OS8A 5EPNA 1QGFA 3D65E 1DT2A 4XBDA 1K28D 2Y82A 2P3TB 3RXDA 3RXCA 3KYFA 3TK6A 5DP8A 2FLBH 1WSSH 3R0FA 2K8IA 3KL6A 1EP5A 1EOJA 2A7JA 4ABEA 1O2MA 1KXAA 3F1SB 4X6MA 3BTGE 5F8TA 1Z6JH 1NRRH 1OPHB 4ISIH 1W0ZU 1HAPH 5A0CA 4H6TA 1C5MD 2FOBA 3SU4A 3KQCA 4AFQA 2P8OC 1MTNB 3SU2A 4BANB 1JIMA 2FTLE 3OE7D 1YLDA 4Y76A 1EAWA 1HAHH 1HJ8A 3Q3KA 3A84A 4CRFA 1DLKB 2PP6A 3BTWE 2Z6BD 3S0NA 1SGDE 1EPTC 1SGFG 3H7OA 3U69H 1F5RA 2J9NA 5KECA 1F7ZA 1CA0C 4TY6A 3M3TA 1IQGA 2O8TA 1O39A 2VINA 3LONA 4XBCA 3SW2B 1GHBG 4ESTE 1QY6A 2QF0A 4YXWD 2VIPA 4X1SU 1LVBA 1WAYB 5EJZA 1P57B 3E0PB 1UTQA 4J2YB 3GOVB 1BJVA 5HKKD 2KX4A 1HFDA 1GGDB 4Q7XA 4K1SA 1T8NA 1A7SA 2ZTYA 3VGCC 1C2GA 2BX4A 1UHBA 2RCEA 2FX6A 1RRKA 2A1DB 1Z71A 2V35A 2JH6D 3S7HB 3TJUA 1QR3E 3UOPA 2WV5A 1SI5H 1C1UH 1AKSB 3TNTA 1SHYA 3GDVA 3MH5A 4RI0A 2THFB 1X7AC 1GHXH 1JXPA 3SUFA 1AFEH 2NWNA 1ESAA 5JBCS 4FUBA 1O2PA 5K7RA 2TPIZ 4Z0KA 4CRBA 2FYQA 1VZQH 2G8TA 1D4PB 5FBIA 3OEHD 1P10A 2ODPA 2BD9A 1O2XA 2ZHQH 5DSFA 1EB2A 3M5OA 1O2LA 1GI0A 1YP9A 4X1QU 3PLBA 3FZDA 5ETXA 1A5HA 2WUBA 3TIUA 1ANDA 2H5DA 4DT7B 3T2NA 1NO9H 3TK9A 1GJ7B 3MO9A 4K69A 3RLWH 2FXRA 2QXHA 1LPKB 2QC2A 2ZTZA 1GBBA 2LPRA 4ZHLU 2F9BH 1Y5UT 4B1TA 3P8NA 1CA8B 2XWBI 3QX5H 1G32B 5EODA 5EU8A 1QQ4A 5AVDA 1LDTT 2PFEA 1A5IA 2OC7A 1THSH 2ZFPH 3MH7A 2YMSD 1VITF 1FAKH 5FCKA 3HGPA 5GCHG 2JH5D 1GI4A 1MCTA 1GMCF 1T8MA 2Y6TA 1LVOA 3DFLA 2Z9IA 1Q2WA 3RXQA 2Z7FE 3TH3H 1C4V2 3U9AH 1SQAA 3S9CA 1HCGA 1U6QA 1RIWB 1S0RA 2BVXH 2SFAA 3GCTG 3E8LA 3A81A 1TQ0B 2A7CA 3GY2A 1K1LA 2H9HA 3VB7A 4AFUA 4GCHF 3GY6A 2FYRA 2GTBA 1VGCC 2PUXB 1UTOA 1YBWA 4UFGH 4YOIA 1ELFA 1HAXB 1SFQB 2QXJA 1G30B 2L6OA 6GCHF 3S69A 2NU0E 2HVXA 4XBBA 1WQSA 2F9NA 1C2LA 3MNSA 5EGMA 2BOKA 1CBWB 1C5WB 1GG6C 1VJ9U 2ZO3H 4I7YH 1MU6B 1PYTD 1DOJA 1TOMH 3E91A 4YLUA 2ODYB 3C1KA 1S5SA 4I32A 2XOKD 4BXSA 1F5LA 2A2XH 3QGNB 4UE7H 4Q63A 1N6XA 1NFYA 3QLPH 4AG1A 4WMEA 3NZIA 2VBCA 1EAXA 2TGDA 3PV5A 1C5UA 5C1XA 2XBVA 1C5VA 1ELCA 5EJLA 2OK5A 1E34B 2RA3A 4NSVA 4OS6A 2EC9H 4KTSA 5B6OA 3ZVDA 3HK3B 4FUIA 1YCPH 1AHTH 3EDXB 3JZ2B 1BMFD 1OX1A 1K1OA 6ESTA 1AU8A 1AIXH 1Z7KA 1A3EH 1JWTA 1MBMA 2R2WU 2H5CA 2P59A 5E8EH 3C27B 1Y3UA 4I8HA 3SV2H 4OM9A 1TBZH 3O8DA 1LCYA 1GMDG 4U30A 4CREA 4WJG2 2GMTB 2YMSC 3MNXA 3U98H 4B71A 1BIOA 2XTTB 2GT7A 1ZLRA 3ZZDA 1K1JA 4RT1A 2HNTE 2RG3A 2J38A 4B73A 1BUIA 2FOGA 2FP7B 1TRMA 1NROH 1AKSA 1ARBA 1QB6A 4FXGH 1P3CA 3FP8E 1K21H 1J14A 1SLXB 3RXMA 2KM0A 1C1SA 3MI4A 3Q3YA 1KMHB 3OEED 3PRDA 5DPAA 4Y0ZE 1E0FD 3KCGH 1DPOA 1WBGB 2B0FA 4ZKRU 4ZKOU 4X2YA 5ESTE 4JK6A 1H8DH 5L2YH 1TMUH 1BMMH 1G9IE 1V2WT 1ZHRA 2BM2A 4I8LA 4CH8B 3ZYDA 1F2SE 7GCHF 2CXVA 2O8WA 1O2JA 2A5IA 4U32A 3DCLA 3RC4A 1P9SA 3VB4A 4MQAA 1O3BA 4YZUA 4DVAU 1C1VH 1V2TT 1O2WA 2UWOA 3RXAA 1PYTC 1IQJA 1QBNA 3DSOA 1AFQC 4WVPE 2OINA 4D7FA 1O3NA 1XVMA 3NXPA 1V3XA 1NS3A 4ISNA 3F9HA 4ZMAH 1PQAA 1TNKA 5C5NA 3KQDA 4KTUA 3V13A 1CU1A 3GCOA 1IQLA 1GVLA 1FI8A 1C5XB 2AGEX 2R3YA 2BDAA 3KQEA 1G37A 1O3MA 2BVRH 3BTTE 2WPIS 3TH4H 5HM2A 2NU3E 3A7YA 2ANYA 3BG4C 3MFJA 3L33A 1YPLH 1VCPA 3SI4H 2J95A 2NU4E 5JBAS 4BTTB 2KR7A 2WV9A 4CRCA 5A8XA 1OSSA 3MNBA 2RA0A 2QE7D 4HFPB 2FEQH 2A5AA 1JIRA 1C5ZB 1O32A 2L74A 2PTNA 1BRAA 4UDWH 4DGJA 1IHSH 2XNIA 4A1TA 1C4U2 1BRUP 5EW2H 2GJGA 2ZCLP 1NU9A 1GI1A 3SQEE 3QZRA 4IMQA 1ZGVA 2WUCA 2XBXA 1XUHA 1JMOH 1Z8JB 2OP9A 1ID5H 3HPTB 1FN8A 2A4RA 1GBLA 4YO9A 3M37A 4B75A 5LGOA 1IQKA 3EQ0H 4IW4E 4JK5A 1C5TA 4WMDA 1TPOA 1VJAU 3A86A 1W0YH 2Z3DA 5HIZA 5I25A 3T5FH 2ZHFH 3QN7A 2PUQH 2IJOB 3P6ZB 5DGJA 1LO6A 4OS4A 3FKSD 2BD4A 4A92A 4MPWA 4Q7ZA 4RSPA 5T6GA 4ACBA 5FL7D 5AHGH 4DOQA 1XKAC 1MTWA 2BVSH 1EPTB 2C4FH 2ZFRH 2Z9KA 1YPHC 1SFIA 2ZGCA 5FXLA 4NGAH 2Y5FA 1CA0B 1QIXB 4GHQA 1BJUA 1TQ7B 4JCNA 1MKWK 1C5PA 1MTUA 1CHOF 2XBWA 3SYJA 1LQDB 2GKVE 1GCDA 1MTVA 2UUYA 1PPCE 1UK3A 3K9XB 3VPKA 5E2OA 3F0PA 3GDSA 5HIYA 3RM2H 4XRNA 3W1EA 1O3FA 4O9VA 1ZSJA 1SGYE 1BDAA 2JETC 5DKMA 8LPRA 2LNCA 1TPAE 3M7TA 2G5VA 2FOMB 1N8OC 1LHCH 1TA6A 1NBMD 5IK2D 3O8BA 3MWIU 4Z6AH 2IN2A 2J94A 4VGCC 1TYNA 4A6LA 4NWLA 2J34A 3FANA 1GL1A 1P9UA 1V2PT 3SBKA 2K0QA 2GVFA 3LGVA 4HG6A 1KY9A 2ZFFH 1SKYE 2TGPZ 1DE7H 1AMHA 4NSYA 1GHAG 3MHWU 2XRCA 3DUXH 2C8WB 3SGAE 2C3SA 3RM0H 1BTPA 2ZP0H 3PO1B 1O3CA 1UVSH 1UTKA 3E1XB 1UCYH 2P95A 3SU6A 1NFWA 2BQ7B 2OC8A 3MNCA 2VIWA 1TMBH 5HM9A 1IQIA 1O3AA 2VGCC 2GT8A 4U2WA 4YT6H 3G01A 3B8JA 4FETA 3URDA 2ESTE 1P2NA 2BX3A 2XC4A 1O5AB 5J4QA 1KXEA 3UAIC 2AS9A 1SGQE 1ZTLA 3RU4D 2SNWA 3TH2H 1OWIA 3BTHE 4I31A 1PFXC 1MD7A 2CK3D 1O3GA 1AVXA 4ABJA 1NZQH 3E6PH 2D26C 1O3JA 1O2ZA 1S85A 3RXSA 2KAIB 1LHEH 1GMHG 1UVOA 1XVOA 4NCYA 2ZC9H 4CRAA 1TLDA 2GDEH 2FO9A 3STJA 1BTXA 1O5FH 1GVZA 3OY6U 4I8GA 1GJ8B 3RP2A 4A1XA 4B2BA 1BRBE 2SGAA 4IGDA 1F0TA 3BV9B 4ASUD 3U1IB 1C2HA 2ZHDA 1DWDH 1C2FA 1S84A 3ESTA 2VVCA 1T32A 1EUFA 4HZHA 1C2MA 5DP6A 2R0LA 3MOCA 2PTCE 2ZFTA 1SLVB 1HAYB 1ZHMA 3PMBB 3TJNA 1MH0A 1VGCB 3HATH 3KYGA 1GHBF 2GP9B 3RMNH 5C5OA 4FOUC 2P3FH 3EGKH 3PMHB 5EXLA 5PTPA 3OYPA 1C4Y2 1ETTH 1HAVA 2FODA 1TAWA 1FXYA 5G4BA 5T6FA 1FUJA 4FUHA 1O2IA 1O2HA 3FZZA 4MG3A 2O9QA 2A31A 5H4IB 4Q2KA 4ABAA 5HMAA 2H6MA 3SUDA 2EQNA 5JB8S 2I6SA 1GBHA 1S0QA 9LPRA 2H1UA 4O3TA 4MPUA 1BOQA 2WSSD 1M9UA 4XFQA 4YLQH 1S6HA 1GDQA 1TB6H 1TNJA 1WU1A 1D6WA 2VIOA 5LH8A 1FY4A 1P2MA 4UFEH 5EG4A 1WTGH 2R2MB 4KTCA 2WINI 3GY5A 1HXFH 1EPTA 1G36A 1L2EA 4MLFB 2AMPA 5BPEA 3F3BA 2P3UB 3Q3XA 3ATLA 1F0UA 1Y3WA 4GUXA 1SVPA 2ZHWH 2ANMH 2XCFA 2FOEA 1Y8TA 3U8RH 3V7TA 4CBNA 1DX5M 1MTSA 1SOTA 4NA7A 4F4OC 1TABE 1MCVA 1ELDE 1T4VH 1TGTA 1C1RA 4ZH8A 2IOTA 1TNGA 5K0HA 2YMSB 4WWYA 3B9FH 1GBMA 1D3QB 1XUGA 3SU3A 2BXUH 3HGNA 3V12A 4D76A 4KP0A 4AB8A 5GCHF 3V3MA 1TALA 2BLQA 1DS2E 3GS9A 3SV7A 2NU2E 1FIWA 1RTFB 5C20A 5GWZA 2BD3A 2FM2A 3GCTF 3BTFE 4JYUH 4ZXYH 3JZ1B 3M61U 1YLCA 1EFRD 5EIYA 1LHFH 2RDEA 4TWWA 2A2QH 1O36A 3A7XA 3GYMA 4M9FA 4OGYA 1XM1A 3WWFA 1KTSB 3ZIAD 4XSKU 2JH0D 1H9IE 4JMYA 3LH1A 4RN6A 1SG8B 4A5TS 3AW1A 1SR5C 1DFPA 1WDIA 3UFAA 1QHRB 1TPPA 1C2KA 1AFQB 4DIIH 1V6DA 5A2MH 2TGAA 4OS5A 1NESE 1GCTC 1O30A 4MNYA 2ZIQH 4ACAA 3SV6A 1UVTH 1W3CA 3WW7A 3LPRA 1T31A 3RMLH 1VCQA 1LQEA 1TE0A 2WZQA 4X8VH 2A7HA 4X8SH 1H8HD 1DXPA 4CR5A 1WXRA 1O2SA 2K1QA 2KAIA 1GDNA 3GICB 4NWKA 2SGFE 4Y7AA 1O3IA 8GCHG 1TNLA 1BBRK 2Y80A 2BZAA 2YNBA 1BMNH 2ZDLA 1H8ED 4TY7A 2JIZD 2VNTA 3S9AA 4ZHMU 3LU9B 3VB5A 3SV9A 1P06A 3SQHE 3OAAD 2HVYB 2GDDA 2QA9E 1VKYA 2CJIA 1UTMA 1HUTH 1LMWB 4NZQA 4ZCNA 1EJMA 1COWD 5CHAB 1O2YA 2ZU3A 1SQRA 3F9FA 4CRGA 1Y59T 1L1JA 5C1YA 3M35A 2FS9A 1GBJA 3EYDA 2G81E 1OWHA 1ZRKA 5F6MA 4ZUHA 3OX7U 3GISB 1WQVH 2YOLA 3IG6B 1QTFA 5FPYA 3ZZ4A 2SNVA 4LZ4B 1HJAC 1W12U 4FUCA 3BEFB 3A82A 1YPMH 1E35B 1GMDF 5A0AE 1B5GH 4FVBA 3EA9A 3HKJB 3SZNA 1TGSZ 1E1RD 1ZJKA 1LHDH 5L6NH 1C5SA 4WMFA 3LGTA 1AUJA 1ESTA 1QRZA 2ZHEH 2ZQ1A 4K1EA 1FY8E 3S7KB 5JB9S 1CSOE 1PPZA 4D9RA 5A09A 5IYTA 2F9UA 2HLCA 3NCLA 3RU4T 1YPHE 4AG2A 3OTPA 3PWBA 4ZHAA 3TNSA 3ATWA 1O37A 2UWPA 2A4QA 1YLNA 2Z94A 1PPHE 4M7GA 3PLKA 1FMGA 3PLPA 1YPGH 3ZZ3A 1TBQH 2ANKH 2HPQH 1DDJA 1SGTA 3M5LA 1UTPA 1OWKA 3BTEE 3PWCA 2CHAC 2V7QD 3ZZAA 2FX4A 2VH0A 1DWEH 1ZSLA 1H9HE 2ZDMA 3QK1A 1L1GA 1EP6A 4CR9A 3SHCH 4CHAC 3W94A 3A80A 3CS0A 3PMJA 1F92A 1C9PA 3F2HA 3GCHC 5C0UA 1AQ7A 1N8OB 5L2ZH 1O2TA 4Y8YA 3M36A 3A7VA 1NFXA 1IQHA 1A5GH 3ZV9A 1K22H 1S82A 3ZZ8A 2A45B 3AAVA 1K1NA 1GBEA 1J17T 1FQ3A 2CMYA 1W7GH 4HTCH 5LPEA 2FPZA 2KCYA 4TYDA 3A7TA 4Y79A 3EAJA 7LPRA 1LKBA 8ESTE 3BEIB 4MTBA 1UCYE 5CDFE 5L30H 4OS7A 2IPHA 1W13U 1C2JA 1E36B 1FLEE 3ZVBA 1TA2A 1LPZB 1HNEE 3P95A 2VGCB 3VXFH 1SGCA 1RS0A 1BCUH 5FHTA 1SBWA 4JYTA 2DE9A 1V2ST 1MZDA 3KF2A 2OUAA 3U1JB 1YPEH 3UIRA 4IN1A 4RKJB 2ZEBA 2QYIA 2F4LA 3SGQE 5E0JA 1O33A 4JZEH 2AH4X 1DVAH 2QV1A 2M2AA 3QGJA 4UFDH 4A1VA 4JZIA 1A46H 2PKSC 1SOZA 3LOXA 2J5UA 2CF9H 1QRXA 2BDBA 1O5CB 1V2RT 1W11U 3NWUA 3M7QA 4LOYH 3V0XA 5FBEA 4AGJA 2A0QB 2BB4A 1SQTA 2HNTF 1ZGIA 2VIVA 2VWNA 1YPKH 2Y81A 3ELAH 4X2VA 2UUJB 4MNXA 3M3SA 3RXFA 2FWWA 3LKWA 3WWBA 3SNBA 1NM6A 2QF5A 1AZ8A 1K1IA 2GCHG 1C2DA 1NRQH 1UTLM 2ZI2H 2ZZUH 2I6QA 1QL7A 1K9OE 4X8UH 1FDPA 1FX0B 1S6LA 2KCPA 2OQ5A 4X2XA 3T25A 5EQQA 3QWCH 4NFEA 1GHZA 1CGHA 3P8FA 3BN9A 2BXTH 3B23B 1XUJA 3A85A 1L4DA 5FPSA 4CRDA 2WPKS 1MKXH 1NBME 1NPMA 1O5EH 3E90B 3QTOH 3PV4A 2ZPSA 2BD8A 1MAYA 4O03A 2QXGA 1E37B 1MTNC 2R3UA 3GY8A 2SGEE 4CH2B 2AIQA 1MZAA 3MU5A 2GZ8A 2BDIA 1ABIH 2VVUA 1TGBA 3MO3A 4FU8A 1PQ5A 2F43B 4UD9H 1TMTH 4XE4A 2XW9A 1YM0A 3GCNA 1LTOA 4K8YA 2OQUA 2VJ1A 3OU0A 4FUFA 1C1OA 1KLJH 1V2UT 1GHAF 4BAQB 1TBRH 3PTBA 1V2VT 1ELEE 2Z3CA 3CENA 1IOEA 3VG8A 1QURH 2G5NA 5FCRA 2BDYA 1G2LA 5A8ZA 3ENSB 2QAAA 3BTKE 3BTME 2J97A 4TSFD 3RU4E 1PPBH 2Z3EA 6CHAB 3FP6E 2UUFB 4HGCA 3SJOA 1W8BH 2V6NA 5JYIA 2F3CE 1BA8B 1GJDB 1AB9B 1OKXA 5KGOA 3RXJA 3FP7E 3GY3A 2W7UA 2WV4A 1ORFA 1T7CA 2V3OH 1OP0A 7ESTE 1HAVB 5DN6D 1HDTH 1DLEA 3FAOA 5ABWA 1OYTH 3UB0A 1P05A 1EB1H 1H1BA 2AYWA 1LHGH 1W14U 2V3MA 1GMHF 1EJNA 1RJXB 2AFQB 3SNCA 5JPMH 1V2MT 4AFZA 1AWHB 5FX6A 4ABDA 1FNIA 1C1MA 4JZ1A 1QBVH 2P8OB 5HYOA 4JZDH 1XUKA 3EA8A 1C5LH 1XX9A 3RXLA 2EI7A 3DT0H 2F83A 3URCA 5AF9H 3T26A 3IWMA 4KELA 1A2CH 1H9LB 4BAKB 3MU8A 4MVNA 3HKIB 3QO6A 3EE7A 3P8OA 1SGEE 3GDUA 3MMGA 2O8UA 2BLWA 1GI5A 1ESBA 3F68H 4LZ1H 2ZU1A 2CN0H 5C3NA 1ZRBA 1WTHD 3UPEA 1E1QD 1GCTB 1ZMLA 2VH6A 1J9CH 1SGIB 4B6FA 1FJSA 1HIAA 1XUIA 4I86A 1BHXB 1ZHPA 1T4UH 4XOJA 1O2NA 5C94A 1GBAA 3VB6A 1S6FA 2Q1JA 2DE8A 3UNRA 4AFSA 4J1YA 1O3PB 3SI3H 3VGCB 4AC9A 1PPGE 1HLTH 2H2ZA 1PPEE 2FDAA 2Y5HA 1ETSH 4BAMB 1CT0E 5JBTA 2C8ZB 2C8XB 3DA9B 3N7DA 4RKOB 2EI6A 1P09A 1KXBA 3A88A 2RFKC 4K2YA 2Y5GA 1DWCH 1GPZA 1GI8B 2FOFA 2VVVA 1FZZA 2XWAA 1TRYA 3Q76A 3UQVA 1D3DB 1BTZA 1HJAB 1FONA 1O3HA 1RTLA 1SLUB 3NK8A 1DY9A 2BLOA 1CBWC 4INLA 4WH8A 3TU7H 4IMZA 3TGJE 5EXNA 2BLVA 1IQFA 3SNDA 1YCPK 2KFWA 3I78A 3LGUA 2HRVA 4FVDA 1TWXB 1C5QA 1C2IA 1RD3B 2OC0A 2CGAA 2OBOA 2GGVB 3ZV8A 2VWLA 3SUGA 4AB9A 2BY8X 5TJXA 3SN8A 1KLIH 3RXEA 4R8TB 1TNIA 2BQWB 3VEQB 4WH6A 2TGTA 2WYJA 2JDID 2XC5A 2J98A 3T29A 1AE8H 1DUEA 3MU0A 1O3DA 1MUEB 3PM3A 4YOGA 4Q80A 2ZWLH 1DY8A 2FI5E 4F48B 2R9PA 2PWXA 4AORA 2IPQX 3AASA 5F03A 1FIZA 3UUZA 1A3BH 4TWYA 1IQEA 2PR3A 5E2PA 2W6ID 3SHAH 1C9TA 2OD3B 1NC6A 1NRPH 2OC1A 3LJJA 2F9PA 3A89A 4OS1A 2CHAB 1DSUA 4WXIA 3RDZA 1BTYA 2JJ2D 3NUMA 3KQBA 5E0GA 5LPFA 3M7UA 3VB3A 1G3EA 3H5CB 4B74A 4X1NU 2FZZA 4B6EA 2FOHA 1CGJE 1DSTA 1HRTH 2ZCHP 2G51A 1P2KA 3K6ZA 1UK4A 1GG6B 3BIVH 1P2OA 2GCTC 2STBE 1C1PA 3F9GA 8GCHF 1KLTA 1XKBC 2B9LA 3RUOA 2ZU5A 3FFGA 2GV7A 1GJAB 4FU7A 3SO3A 2BQ6B 1O0DH 3KHVA 4AX9H 2ILNA 3SOSA 1ELBA 1O2OA 2AGGX 2NU1E 1V2QT 3UOUA 1ZMNA 4UONA 1GJCB 2SGPE 4Y0YE 3DSPA 4ASHA 1BMLA 3T28A 1UVUH 2R0KA 1TGNA 1FV9A 1PPFE 1AWFH 2SGDE 5F53A 5TCCA 2ZU2A 4FUEA 3UTUH 1C5OH 1O34A 1KDQA 1PQ8A 1GHWH 4MPVA 5SGAE 4ABGA 5KEDA 3UY9A 1QFKH 3FVFB 1UK2A 1ZMJA 4GVUA 2BTCE 3RLYH 1ZOMA 2BY9X 1NY22 5DP4A 4ZXXH 1ELGA 1BTHH 2LP6A 1OP2A 3LIWA 1D9IA 1KIGH 1KYNA 1P3EA 1THPB 1ELTA 1H8IH 4Q4LA 1O2UA 1D6RA 1P12E 5HXFA 1O38A 1SPJA 3LJOA 3A8BA 2ZFSA 1LVMA 5GXPA 2O8LA 3NPSA 3OFND 1TIOA 1ZPCA 5T3HA 4BNRA 4NA9H 1P04A 1YWUA
chains in the Genus database with same CATH topology
2QY0B 3RXGA 5BRRE 3GYLB 1J15A 1FY5A 2B5TB 3SNEA 1BZXE 5C67A 2J4IA 3OY5U 2PGQB 2QGRA 1HGTH 3P17H 2OBQA 1ANBA 2M5TA 1UVPA 4Y71A 3D23A 4MNVA 1NU7B 4X6PA 1O31A 1QCPA 1VCWA 4YTAA 3ATKA 2ALPA 2BY7X 1G2MA 3ZVGA 1O3EA 1EZUC 3ZYEA 2BDCA 1S83A 2HWLB 3MTYA 1V2OT 1AVWA 3KNXA 2AERH 1O5GH 3ZZCA 3LGWA 3UWIA 2PKAB 2HOBA 3MH6A 4WXVA 1HB0B 1NTPA 1TNHA 2TIOA 3EE0B 1EZQA 2F9VA 4DY7B 1J16A 1MQ5A 1ANEA 2C8YB 1GJ4H 1LVYA 3GY7A 3QUMP 1ABJH 3P70B 3ATMA 1TX6A 3F6UH 1UJ1A 1NRNH 4O97A 3OSYA 4THNH 4QT8C 1OWEA 2BY5X 5DG6A 1INCA 3BG4B 3T27A 4X6OA 2AMQA 3H7TA 4HI3A 1HAGE 1O2VA 3SUEA 3S9BA 4GHTA 3RC5A 1GI7B 1IHTH 1L4ZA 5TCAA 3SU5A 4WF8A 1P2QA 4SGBE 3UNSA 1HAZB 1L0ZA 3KEEA 3STIA 1S81A 1QJ1B 2VB0A 5FPTA 1O2QA 4E06H 4AN7A 1YGCH 1ZZZA 1AGJA 2EI8A 4NFFA 4NZLA 3D49H 2BDHA 3TK5A 2EA3A 4D8NA 1ZPZA 1QL8A 1FPCH 1NN6A 1MAXA 1L1NA 1UCYK 3LDXH 1CQQA 1SGFA 4OGXA 3Q00A 1EZSC 5LPRA 2ZQ2A 1YYY1 4KKDA 3RXVA 1BTUA 1SQOA 1HV7A 1O2RA 2AMDA 2BMGB 1O3LA 3E3TA 5GPIB 5EOKA 4K8BA 3QZQA 1W7XH 1AO5A 4Y6DA 1KXCA 2RDLA 3PO1C 4ABBA 2A4OA 3RMMH 2BZ6H 4IN2A 1GWAA 1WCZA 1K1PA 2GCHF 1AVGH 3NKKA 2PSXA 1GJ9B 4FUGA 3L6PA 2ZKSA 2HGTH 3MU1A 4K60A 4ISOA 3CS7A 1GI3A 1Y5AT 1PQ7A 4Y10E 4BAHB 4X1RU 3U8OH 2D1JA 4GSOA 2WPHS 5IDKA 3TJVA 2ZCKP 2OTVA 1WYKA 4DW2U 1EKBB 2JKHA 2XXLA 5CE1A 1SSXA 3PB1E 1SL3A 5EPYA 2Y7XA 1E38B 1IQNA 2PW8H 1SB1H 1A4WH 1THRH 2STAE 4OS2A 2Z9JA 3RXIA 2Y7ZA 3CP7A 2JETB 1PJPA 1QB9A 4H42U 5JBBS 4YM9A 5EXMA 1MKWH 2WPJS 3BTDE 5C2ZA 2G52A 3O8CA 2W5EA 2XBYA 3W95A 1UO6A 2BOHB 2AEIH 2B7DH 4AYYB 3E16B 3HK6B 1QL9A 4JZFH 1G3BA 3D62A 5DJ7A 1BITA 1QA7A 3RXUA 4VGCB 2XCNA 3ZVFA 1RGQA 1BBRE 3RXRA 2J92A 4E7NA 3P8GA 5C1UA 1HBTH 1A1RA 3T62A 1BT7A 1HPGA 4Y7BA 2PHBA 1A0HB 3KGPA 2P94A 1MMJN 2GZ9A 2J2UA 2ZGBH 1KTTB 3ZZ7A 4DG4A 4TPYA 3ZZBA 5DO4H 1ANCA 1BTWA 1T8OA 3VFEA 1CT4E 2ALVA 5ESBA 1ZSKA 3GY4A 5EQRA 2YNAA 4DJZB 3ZVCA 3SORA 1ZJDA 2C93B 4DURA 1GBTA 3N7OA 4B76A 1NT1A 3EA7A 5HGGA 1N1LA 4UEHH 1WV7H 3BTQE 1B0EA 3MYWA 4ABIA 1SHHB 1GHVH 3K65B 4MPXA 1HIAB 5J4SA 1P2JA 1GBIA 2PKAA 1P2IA 4BTUB 1C1WH 2UWLA 1GVKB 1AD8H 1CVWH 3TPIZ 5EW1H 4I33A 4PROA 4GPGA 3AW0A 2A32A 1BMAA 5CMXH 5AFZH 3R3GB 4UFFH 1YC0A 2P16A 1Y3YA 1EX3A 2FS8A 1DANH 4MDSA 2F9OA 4NA8A 1G3DA 1TOCB 1HJ9A 3SU1A 5GDSH 4X0WU 1ZTJA 1Z1JA 1GBFA 3UREA 1Q31A 2BY6X 1P0SH 3A87A 1O3KA 1OXGA 2ZNKH 4FU9A 1HYLA 4KGAA 1AI8H 2BD5A 2GV6A 2AGIX 1QB1A 8KME2 1DITH 2ODQA 3SNAA 1ZPBA 1MBQA 2VIQA 2ZECA 1DUAA 1ETRH 3RXPA 3SJKA 1W10U 2GCTB 3PMAB 1QA0A 5DP5A 1NFUA 4CBOA 1AN1E 3RMOH 4ABFA 1BQYA 1C1NA 3U8TH 2FESH 1FPHH 4ZKSU 1VITG 3ITIA 2H9TH 2PSYA 5A0BA 1ZYOA 1SLWB 3M3VA 1QJ7B 1GMCG 4LK4A 1Q3XA 2FOCA 1A61H 1TX7A 1P8VC 4NIWA 1IQMA 1RXPA 2W7SA 3IITA 2ZGJA 2ASUB 2OLGA 1WUNH 1D3TB 4WY3A 1QJ6B 4ABHA 1GHYH 2DUCA 2HPPH 1YF4A 2BD2A 3SV8A 3MO6A 1GJ5H 4INKA 2W3KA 1XXDA 1Y5BT 4GCHG 2AIPA 2FLRH 2D2DA 1EAUA 1TGCA 4R0IA 5JDUB 2TBSA 3QDZB 3BF6H 3UWJH 2VWOA 5FAHA 6GCHG 1A0JA 4H4FA 2ZDNA 1EQ9A 4FUJA 2OCVB 1CHGA 1TPSA 1O2GH 1MU8B 4GAWA 3M5NA 1N6YA 2PV9B 1FAXA 1K2I1 1GGDC 5GJ4B 3TITA 2QXIA 2ZTXA 1C1TA 1GI9B 1ELAA 1HXEH 1TFXA 3BSQA 2A4GA 4BXWA 2F91A 1OYQA 2HALA 2WPLS 4LXBH 3SGBE 4DIHH 2H9EH 5FX5A 1O2KA 2W3IA 5T6DA 4I8KA 3UQOA 2ZU4A 5CHAC 1DM4B 1TX8A 4ZAEA 1FN6A 5A8YA 1GI6A 1UTJA 3E0NB 6LPRA 1OP8A 1HAIH 3K2UA 1OWJA 4Y8XA 4BTIB 3PTNA 5AFYH 1EASA 1P03A 3LGYA 1H4WA 1V2NT 2ZPRA 3O8RA 4Y8ZA 2ZA5A 2XC0A 3ATIA 1HAOH 3A8CA 1RTKA 4YOJA 3TJOA 1GDUA 4I8JA 1BB0B 4TPIZ 3OTJE 2V0BA 1KDQB 1DXWA 3F9EA 1SGNE 1UMAH 2QN5T 4ZROA 4AZ2B 4FUDA 3SJ8A 3KIDU 1BRCE 1AZZA 1XXFA 3DD2H 1F0SA 1P02A 3TGIE 1BHXF 4H6SB 1FY3A 1CT2E 1GJ6A 5DP7A 2Q6DA 1W2KH 1Y3XA 1B0FA 1VITH 1QBOA 2GD4B 1XMNB 4E05H 4K3JA 3A7WA 1RIWC 4E7RG 5GIBA 1IAUA 2FI3E 4F49A 3RXKA 4B2CA 2OXSA 1GJBB 1MQ6A 3RXTA 2FTMA 4D9QA 3WY8A 1EXFA 3A8AA 1QRWA 1GI2A 1ACBE 2QCYA 1O5DH 7GCHG 1AY6H 2ZDVH 1Z6EA 1Z8IB 5E0HA 1Z8GA 4GLYA 1BBRH 3K6YA 2C90B 1K1MA 1SGPE 1WOFA 2Z9GA 2G55A 3LH3A 1Z1IA 1C2EA 1V2JT 1A0LA 2XYAA 4ISHH 4NIVA 1F0RA 1OOKB 2ZPQA 9ESTA 2CF8H 4NIXA 5DP3A 1JRTA 7KMEH 2GZ7A 2ZF0H 2D8WA 3TVJB 1JOUB 3BG8A 4ISLA 1Z8RA 2G4UA 1RFNA 4NG9H 1KXFA 5F8XA 4A7IB 4YT7H 2B8OH 1TRNA 1T8LA 1CE5A 2Q6GA 4B2AA 3A7ZA 2W26A 3SU0A 2VWMA 2ZDAH 2ANWA 3UNQA 2PGBB 1ZTKA 1CO7E 4X2WA 2UUKB 1QQUA 2FMJA 1G3CA 2WPMS 4INHA 1UTNA 2GX4A 2FOAA 3A83A 3KN2A 4IC6A 3SJIA 3TLOA 1SC8U 1C1QA 3LC3A 4D7GA 4AOQA 4O3UA 1GL0E 3M5MA 4IC5A 2SGQE 1EOLA 4U01A 4BAOB 1V2LT 4X8TH 4IBLH 1CGIE 1O5BB 1O35A 1SGRE 5DP9A 3ODDA 1V2KT 2TRMA 1UHBB 1D3PB 2GMTC 3MH4A 1KSNA 1B7XB 3RXBA 3P92A 1TONA 2A5KA 3LT3A 1LKAA 4X1PU 2HNTC 2O8MA 4CHAB 3I77A 4DCDA 1C5YB 4AYVB 1SMFE 5DK1A 3GCHB 1YPJH 1MKXK 4MNWA 5F8ZA 4Q7YA 1C5NH 2QF3A 3PYHA 3LC5A 4IS5A 1KXDA 4XDEA 2FI4E 1GBCA 3ODFA 5I46H 1ARCA 2ULLA 3MU4A 1AE5A 2V3HH 2CV3A 2FIRH 4YESB 3RXOA 1NRSH 1QNJA 2ZGXH 3QTVH 1DWBH 2ZGHA 3I29A 1EAIA 1CHOG 2Q6FA 3L3TA 1EZXC 1VR1H 1FY1A 1GBKA 2P93A 4ZKNU 2QIQA 3BIUH 3SJ9A 3ZZ6A 3Q77A 2G00A 1Y3VA 1JBUH 5EQSA 1JRSA 2VIDA 1J8AA 2ZFQH 1OWDA 2BDGA 1C5RA 3ZZ5A 2WYGA 3BEUA 3AVZA 4NIYA 3ZVEA 4X6NA 1DICA 4AGKA 1P11E 1P01A 2PKSB 3AAUA 1O3OA 4Y11E 1F5KU 4SGAE 3UR9A 1GBDA 3ZZ9A 4BOHA 2BD7A 1XUFA 1ZR0A 3UR6A 2BHGA 2G4TA 6CHAC 3ZVAA 1LPGB 3RC6A 4K5ZA 2ZG0H 1ELVA 1MD8A 1YKTA 2Z9LA 3DFJA 2ZDKA 3RXHA 4JYVH 1EJAA 2BYAX 1YCPM 1AB9C 2PLXA 2VU8E 1EATA 3PROA 3LGIA 3DHKH 4K1TA 3VXEH 3TGKE 2EEKA 3A8DA 1AUTC 1OS8A 5EPNA 1QGFA 3D65E 1DT2A 4XBDA 1K28D 2Y82A 2P3TB 3RXDA 3RXCA 3TK6A 5DP8A 2FLBH 1WSSH 3R0FA 3KL6A 1EP5A 1EOJA 2A7JA 4ABEA 1O2MA 1KXAA 3F1SB 4X6MA 3BTGE 5F8TA 1Z6JH 1NRRH 1OPHB 4ISIH 1W0ZU 1HAPH 5A0CA 4H6TA 1C5MD 2FOBA 3SU4A 3KQCA 4AFQA 2P8OC 1MTNB 3SU2A 4BANB 1JIMA 2FTLE 1YLDA 4Y76A 1EAWA 1HAHH 1HJ8A 3Q3KA 3A84A 4CRFA 1DLKB 3BTWE 2Z6BD 3S0NA 1SGDE 1EPTC 1SGFG 3H7OA 3U69H 1F5RA 2J9NA 1F7ZA 1CA0C 4TY6A 3M3TA 1IQGA 2O8TA 1O39A 2VINA 3LONA 4XBCA 3SW2B 1GHBG 4ESTE 1QY6A 2QF0A 2VIPA 4X1SU 1LVBA 1WAYB 1P57B 3E0PB 1UTQA 4J2YB 3GOVB 1BJVA 1HFDA 1GGDB 4Q7XA 4K1SA 1T8NA 1A7SA 2ZTYA 3VGCC 1C2GA 2BX4A 1UHBA 2RCEA 2FX6A 1RRKA 2A1DB 1Z71A 2V35A 2JH6D 3S7HB 3TJUA 1QR3E 3UOPA 2WV5A 1SI5H 1C1UH 1AKSB 3TNTA 1SHYA 3GDVA 3MH5A 2THFB 1X7AC 1GHXH 1JXPA 3SUFA 1AFEH 2NWNA 1ESAA 5JBCS 4FUBA 1O2PA 5K7RA 2TPIZ 4Z0KA 4CRBA 2FYQA 1VZQH 2G8TA 1D4PB 5FBIA 1P10A 2ODPA 2BD9A 1O2XA 2ZHQH 1EB2A 3M5OA 1O2LA 1GI0A 1YP9A 4X1QU 3PLBA 3FZDA 5ETXA 1A5HA 2WUBA 3TIUA 1ANDA 2H5DA 4DT7B 3T2NA 1NO9H 3TK9A 1GJ7B 3MO9A 4K69A 3RLWH 2FXRA 2QXHA 1LPKB 2QC2A 2ZTZA 1GBBA 2LPRA 4ZHLU 2F9BH 1Y5UT 4B1TA 3P8NA 1CA8B 2XWBI 3QX5H 1G32B 5EODA 5EU8A 1QQ4A 5AVDA 1LDTT 2PFEA 1A5IA 2OC7A 1THSH 2ZFPH 3MH7A 1VITF 1FAKH 5FCKA 3HGPA 5GCHG 2JH5D 1GI4A 1MCTA 1GMCF 1T8MA 2Y6TA 1LVOA 3DFLA 2Z9IA 1Q2WA 3RXQA 2Z7FE 3TH3H 1C4V2 3U9AH 1SQAA 3S9CA 1HCGA 1U6QA 1RIWB 1S0RA 2BVXH 2SFAA 3GCTG 3E8LA 3A81A 1TQ0B 2A7CA 3GY2A 1K1LA 2H9HA 3VB7A 4AFUA 4GCHF 3GY6A 2FYRA 2GTBA 1VGCC 2PUXB 1UTOA 1YBWA 4UFGH 4YOIA 1ELFA 1HAXB 1SFQB 2QXJA 1G30B 6GCHF 3S69A 2NU0E 2HVXA 4XBBA 1WQSA 2F9NA 1C2LA 3MNSA 5EGMA 2BOKA 1CBWB 1C5WB 1GG6C 1VJ9U 2ZO3H 4I7YH 1MU6B 1PYTD 1DOJA 1TOMH 3E91A 4YLUA 2ODYB 3C1KA 1S5SA 4I32A 4BXSA 1F5LA 2A2XH 3QGNB 4UE7H 1N6XA 1NFYA 3QLPH 4AG1A 4WMEA 3NZIA 1EAXA 2TGDA 1C5UA 5C1XA 2XBVA 1C5VA 1ELCA 1E34B 2RA3A 4NSVA 4OS6A 2EC9H 4KTSA 5B6OA 3ZVDA 3HK3B 4FUIA 1YCPH 1AHTH 3EDXB 3JZ2B 1OX1A 1K1OA 6ESTA 1AU8A 1AIXH 1Z7KA 1A3EH 1JWTA 1MBMA 2R2WU 2H5CA 2P59A 5E8EH 3C27B 1Y3UA 4I8HA 3SV2H 1TBZH 3O8DA 1LCYA 1GMDG 4U30A 4CREA 4WJG2 2GMTB 3MNXA 4B71A 3U98H 1BIOA 2XTTB 2GT7A 1ZLRA 3ZZDA 1K1JA 2HNTE 2RG3A 2J38A 4B73A 1BUIA 2FOGA 2FP7B 1TRMA 1NROH 1AKSA 1ARBA 1QB6A 4FXGH 1P3CA 3FP8E 1K21H 1J14A 1SLXB 3RXMA 1C1SA 3MI4A 3Q3YA 5DPAA 4Y0ZE 1E0FD 3KCGH 1DPOA 1WBGB 2B0FA 4ZKRU 4ZKOU 4X2YA 5ESTE 4JK6A 1H8DH 5L2YH 1TMUH 1BMMH 1G9IE 1V2WT 1ZHRA 2BM2A 4I8LA 4CH8B 3ZYDA 1F2SE 7GCHF 2CXVA 2O8WA 1O2JA 2A5IA 4U32A 3RC4A 1P9SA 3VB4A 4MQAA 1O3BA 4YZUA 4DVAU 1C1VH 1V2TT 1O2WA 2UWOA 3RXAA 1PYTC 1IQJA 1QBNA 4WVPE 1AFQC 2OINA 4D7FA 1O3NA