1F0UA

Bovine trypsin complexed with rpr128515
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human factor Xa complexed with potent inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0uA02
1C5ZB 2GD4B 1QL7A 2I6QA 1KYNA 5JBBS 1MCVA 5HMAA 3UWIA 4U32A 2BQWB 1Z8RA 1GVZA 1E37B 1GWAA 1LMWB 1QB6A 4AN7A 1GI6A 2CV3A 2GT7A 2XWAA 4NA7A 1L4ZA 1FY3A 4X6NA 1C4U2 1B0FA 3R0FA 1FPCH 1TE0A 1HAXB 1ZOMA 1EZSC 1ANCA 2TGPZ 1CGHA 1GJAB 3S9CA 1AY6H 2OQUA 2ZGXH 3V12A 4TWYA 3SJOA 4I8JA 1GG6B 1Y3VA 3Q3KA 4FXGH 2XW9A 2HNTE 1MTVA 3SU1A 1L1NA 3KF2A 3LKWA 2QAAA 5GIBA 2ZFFH 4HI3A 3RXDA 1HAOH 2ASUB 1Y59T 1B7XB 2ODQA 2Q1JA 4XE4A 4NWKA 2CJIA 3CP7A 1F7ZA 3OSYA 4Y7BA 5FX6A 2Q6DA 1QBVH 5A09A 5C1YA 1HDTH 2BOKA 3NCLA 1C5XB 2AMQA 9ESTA 1QBOA 1Y5AT 4FUEA 5F03A 2C8XB 2RDLA 3RU4E 1DY9A 1SLVB 3A7WA 1YC0A 4JYUH 2QA9E 1GBLA 2ZTYA 2GP9B 3L3TA 4X2WA 3GCHB 3QTOH 1GHZA 3EAJA 3MNCA 2YNBA 2A7JA 1ELGA 1AN1E 2V3OH 1GBBA 1A3BH 2XBXA 4Q7XA 1C5SA 4FU8A 4JMYA 1MUEB 3FZDA 3ESTA 3HK3B 3QTVH 4RKJB 2BD4A 3FFGA 3PO1C 2D1JA 2VIQA 1S85A 3MU1A 4MPUA 1FLEE 4D7FA 5FHTA 3OY5U 1YKTA 1ZMLA 4X2VA 1ORFA 1AGJA 3DHKH 1TNLA 1TMBH 3A8BA 1K1JA 3QZRA 5EPNA 1GI2A 1J9CH 2YNAA 1QJ7B 2B9LA 5EOKA 1HAVA 1DLEA 1K9OE 1LVMA 1MCTA 2R3YA 2Z3EA 1VJAU 2C93B 1JMOH 2BY9X 4K5ZA 2BY8X 2B8OH 1XMNB 2XC0A 2ZU2A 2PFEA 1ZHRA 2BX4A 2J38A 3S9AA 4HZHA 2O8TA 1FMGA 1O2NA 4PROA 3M37A 2P94A 3LDXH 3HKJB 2BOHB 1GHVH 1P2NA 1GJ5H 1TB6H 4NCYA 3BTGE 4OGYA 3UWJH 3UQVA 1GMHF 2PKAB 4X6MA 7GCHF 1HXFH 2XYAA 1MAXA 2TIOA 3QLPH 4LZ4B 4BAKB 1A0HB 1KLJH 1A7SA 1GVKB 1FY1A 1ELBA 2EC9H 4B2BA 1Z8IB 2TPIZ 1FY4A 1BZXE 4CHAC 4Z6AH 2FOGA 1WYKA 2BD5A 2ZFSA 5HM2A 2O9QA 2XBWA 1O5FH 5FBEA 1WOFA 1WTHD 4IGDA 1NRQH 1SVPA 3VPKA 1OP2A 1C5WB 1AWFH 3QO6A 1C1NA 2PSXA 1ANDA 1NROH 1O3GA 2RA3A 3H7TA 3M61U 4WH6A 2C8WB 1GG6C 1HFDA 1YPJH 3EA7A 5LPEA 2A0QB 1BBRE 1KXAA 1GBAA 1P2OA 2IPHA 2GX4A 2XCNA 4GHTA 3E3TA 5JB8S 4X6PA 2HNTF 3S0NA 1SQTA 3VFEA 1UCYE 3SGBE 1RIWB 3KL6A 1O2XA 1TOCB 1Y5UT 1KTSB 5JPMH 2SGDE 1ARBA 2BQ7B 2ZFQH 1TPOA 1DE7H 1TQ0B 4UFDH 4X1QU 1O2TA 2R2WU 1OP8A 5FPYA 3M5MA 3RXOA 1QQUA 4HFPB 1AD8H 4B2AA 1GI5A 5LPRA 4MTBA 3UR9A 1CGIE 1PQ8A 3ZZ4A 1C5PA 1BTZA 5E2OA 1AU8A 3KQCA 3F6UH 3GY7A 2AFQB 1A5GH 2THFB 3GY5A 2QY0B 4UONA 2B5TB 1XXFA 4MNYA 4B1TA 1KIGH 1SG8B 1LHGH 3NUMA 2ILNA 1CT4E 3SI3H 2XBVA 3GY6A 2SNWA 3PROA 5AFYH 5HGGA 2FIRH 4CBOA 2STAE 1Y3UA 3MO3A 5E0GA 3M35A 3PWCA 2CHAB 2H9TH 3E8LA 2Z9IA 5T3HA 5C5OA 1P9UA 1J17T 2RA0A 1GBKA 3SN8A 1T31A 3TJVA 4BXWA 4WJG2 4AORA 1XXDA 1NT1A 4B74A 4UDWH 4ISHH 5L2YH 3M3VA 1C5RA 4NSVA 3PLKA 2ZDMA 1B0EA 1F2SE 4BXSA 2KAIA 3U1IB 3BTTE 1IQEA 3RXMA 2BD8A 1EOJA 3QWCH 1GHBF 4DOQA 1E35B 2OBQA 1UVOA 2ZA5A 4LK4A 4IBLH 1FN6A 1WU1A 3MU5A 2PGQB 1IQHA 1OWKA 2FYQA 1GMCG 5JBAS 4BAMB 1LHDH 1TBRH 5DP6A 3P70B 2Y7ZA 1AE8H 2O8MA 3MYWA 1VCQA 2BD7A 5JBCS 2G5NA 1IQNA 5A8ZA 1QNJA 1YPHE 4F49A 4UE7H 1Y3YA 3OX7U 1QL9A 1T8LA 2FPZA 4X8UH 4ABEA 3P17H 1AB9C 4E7RG 2Y5GA 1C1PA 2UWOA 2OP9A 1ETRH 1D9IA 1O2SA 3TVJB 2Q6GA 3RXCA 1P03A 1AZZA 2JH5D 1C5NH 1BJVA 4WWYA 5DG6A 1LPZB 4AB8A 1GBDA 1DXWA 2BD9A 5I46H 1FY8E 4YOJA 2BYAX 3BTFE 1QB9A 1NY22 5DP3A 2VIVA 3HKIB 2ZHEH 4JK5A 2HWLB 1AB9B 1O2PA 3E90B 8LPRA 1A3EH 1W11U 1PFXC 3F9EA 3LGVA 1C1RA 3UUZA 3M7TA 2SGPE 2PGBB 1WQVH 5EQQA 4BTIB 4JYTA 3QUMP 3SI4H 1W7GH 1MQ5A 1HAIH 1C9TA 1BCUH 1GJDB 4K1EA 2F9BH 2OC8A 2QCYA 3SHCH 1O2HA 1GDQA 3QDZB 1B5GH 1IHTH 2GGVB 2Z3CA 1BTHH 1V2VT 4Y8ZA 3UTUH 1DWDH 1K2I1 2J94A 4VGCB 1C9PA 2ZHQH 3A85A 2PTCE 4MNXA 1W12U 2WINI 1NFXA 1W7XH 1XUGA 1ANEA 1F5RA 1CVWH 4ISNA 3U8OH 3DFLA 2R0KA 5HM9A 1ELFA 1QHRB 3BG4B 2H5CA 1A0JA 1F5KU 4ZUHA 3RC6A 1V2LT 5JBTA 5ABWA 2J2UA 2ZPQA 4X2YA 1OS8A 3RXFA 3RU4D 3SOSA 1G32B 3BTME 3O8DA 1TQ7B 3UNRA 3P95A 1ELTA 1WQSA 5HXFA 3A8AA 2H2ZA 2WUBA 1CO7E 3OTJE 1KXCA 4CREA 1CBWC 1LVYA 4XSKU 3GCTF 2J92A 3PMAB 5GJ4B 1WBGB 4Z0KA 4AFQA 4INLA 1A5IA 4YZUA 3BTKE 3P6ZB 2A32A 3ZZ5A 1O37A 2Y7XA 2ALVA 4XBCA 4K60A 4I8GA 1N8OB 3ZV8A 3M5LA 3RLWH 3S9BA 4U2WA 3O8CA 1G9IE 3TH2H 4A6LA 2STBE 5ESTE 3KN2A 1SOZA 1O3AA 3V0XA 1W2KH 2GV7A 4JZ1A 5DGJA 2ZHDA 3E0PB 1YCPM 2Y80A 4I8HA 1WV7H 3EYDA 4IW4E 2EA3A 4BOHA 1XUHA 2C3SA 3NPSA 2ZHWH 2ZU3A 4A1TA 3V3MA 1TGNA 2XRCA 1IQGA 5IDKA 1GCTC 1EJAA 1BHXF 4GUXA 4K8BA 3IITA 2WUCA 1L2EA 4MVNA 2GDEH 4F4OC 3W95A 1SR5C 4TPYA 3SUDA 4H6SB 3QK1A 4I31A 1ZGVA 1SGIB 1AVWA 1HJAB 1SFIA 1UTMA 4QT8C 4UEHH 2ZNKH 1UO6A 5L6NH 2O8LA 4A1VA 3LGTA 9LPRA 3EA8A 4ZKSU 1GJ7B 1KXDA 2BLQA 2F83A 1FXYA 2G51A 3GYMA 4X1SU 1RS0A 1ZSLA 1SQAA 1EPTC 1TPAE 3RXSA 2W26A 1MTWA 5E0HA 1TOMH 2ODYB 4KTUA 1AFEH 3A84A 2D26C 1FI8A 1PPBH 1NRRH 1K1IA 1V2NT 1AFQC 4D7GA 3MU8A 4SGBE 4TY7A 3AAUA 1UTNA 1ELDE 1EB1H 1W0YH 1DICA 1HIAB 1XVMA 1IQFA 2Z9LA 3LH1A 4H6TA 3RU4T 5SGAE 1SOTA 1BTXA 3TGKE 3TGIE 1RTKA 1O3JA 4AFUA 3ENSB 1P11E 4Q80A 3QZQA 2VVUA 4KP0A 4AG2A 4OS1A 3GDVA 2JKHA 4DJZB 6CHAC 1TA6A 5FX5A 3FP7E 3K9XB 1BJUA 1AUTC 3RXKA 3SW2B 4YTAA 1BTPA 2BX3A 1UMAH 2HPPH 2ZP0H 3KQBA 6ESTA 5GCHG 4R8TB 2IJOB 1DVAH 1HNEE 1Y3XA 1GCDA 1BUIA 5C5NA 2OXSA 1MZAA 1ID5H 1FZZA 2CF8H 2ZU4A 1HAGE 1IHSH 2FTLE 3F9FA 3LPRA 1LKBA 3U69H 3RP2A 5TCCA 2ZQ2A 3FP8E 1TX7A 1FQ3A 1V2JT 5TCAA 1H9IE 1HV7A 3ZVAA 1AUJA 1K28D 1KDQB 3BEUA 1YCPH 4O97A 4TY6A 2FDAA 4X8SH 1C5TA 1V6DA 3B9FH 4DT7B 5ETXA 5ESBA 1ZJDA 3SV6A 4AGKA 3T25A 3MTYA 3PTBA 3VGCB 1NRNH 3DUXH 1P06A 2VJ1A 2Z9KA 1NESE 2P16A 2BY7X 1UHBB 2BHGA 1MAYA 4Q7YA 3FANA 3ZVFA 2ZFRH 1UK4A 4X1NU 3SU3A 2G4UA 4IC5A 4RSPA 1DPOA 5EG4A 3GCNA 1BMNH 1UJ1A 2ZPSA 3GY4A 5K0HA 1CHOG 2K1QA 1IQJA 1PPGE 1TONA 6GCHF 1C1OA 4O3UA 1THSH 1EP6A 1X7AC 5EQSA 4I8LA 3U8TH 2GCTB 2PKSB 2FODA 2HNTC 4MDSA 4OS2A 2VWOA 1TGSZ 1G2LA 1FIZA 1RD3B 1ZZZA 3UFAA 3TGJE 4DW2U 4D76A 3LH3A 1DDJA 4X8TH 1TABE 4ABDA 1C2FA 3UOPA 1CSOE 1GJCB 3KHVA 2VH6A 3C1KA 5JYIA 1EAWA 1M9UA 1P12E 4HGCA 4ZXYH 2B0FA 2RCEA 1TFXA 1O5GH 2P3TB 2F9PA 4M7GA 1O3LA 4I33A 3MU0A 7LPRA 3LIWA 1GPZA 4MPXA 2BM2A 1O3MA 1DUEA 3V7TA 1ELEE 1G3CA 2ZDLA 1GI4A 1S5SA 2XXLA 3RM2H 3RMNH 1GHAF 2JH0D 1U6QA 1ZTLA 5AHGH 2ODPA 4ABGA 3A7ZA 5C20A 1GHBG 2GMTC 4NZQA 4ZKOU 3BG4C 4D9QA 1P2IA 1LVOA 1CQQA 2GZ7A 2ZZUH 4GSOA 2TBSA 1GHXH 1MBMA 1DWEH 1TA2A 4YLUA 1ESTA 1SL3A 2ZFTA 4Y10E 1GDUA 5FCRA 3B23B 6GCHG 1MMJN 4ZMAH 3GOVB 4ZHLU 4WMFA 3PLPA 2VGCB 2ZGCA 3TJOA 1VGCB 4WY3A 3URCA 2VWNA 3HGNA 2NU4E 1JIRA 2R3UA 2P8OC 2FOAA 4D8NA 1J16A 1V3XA 1HXEH 1KTTB 1ZTJA 4FUBA 1EZXC 1DFPA 5AFZH 3SGAE 1PQAA 3SNEA 3MHWU 1AO5A 1L1JA 4WF8A 1OXGA 2P95A 2R9PA 3CS7A 2ZG0H 4ZH8A 2VWLA 4KKDA 3UNSA 2GVFA 1VJ9U 3MO9A 4GAWA 1TGTA 4GLYA 2OD3B 4B2CA 3GICB 3L6PA 3UQOA 1D6WA 2PTNA 2ZO3H 2NU1E 1O3KA 2FYRA 1BMAA 3U98H 1KXFA 5BRRE 3STIA 1DITH 1PJPA 5CHAB 1ANBA 2A31A 2F9VA 2ZDVH 4WXVA 5DKMA 5A8YA 1RRKA 1XUIA 3PB1E 3A89A 1GI8B 1LVBA 3BIVH 1HAVB 1AKSB 1XVOA 1MKXH 1ZSKA 1BQYA 3A86A 1O3IA 4BTTB 1TRYA 2FP7B 3K6YA 5T6DA 1SHYA 3RXBA 2BDAA 1DSUA 6CHAB 2Z3DA 1PYTC 1YP9A 5TJXA 2UWPA 5DO4H 5JDUB 3GDUA 1BRUP 1C2IA 3SV2H 4Y7AA 1NC6A 3KQDA 4ISOA 1EATA 1K21H 1SGNE 2GKVE 4AOQA 1ACBE 1O36A 1ZMNA 3VB3A 1C5YB 1BDAA 1OYTH 1OWHA 1SGEE 5EODA 2BZAA 3C27B 2C8YB 2ZEBA 1UTKA 3UOUA 4CRDA 1O3HA 5EW2H 1HIAA 4YLQH 3P8OA 2BY6X 3ATIA 3STJA 3EDXB 1QURH 1GI0A 1O3NA 4YM9A 2FWWA 1EP5A 2BDIA 1A5HA 1QA7A 2DUCA 2UUJB 1LQEA 2ZGJA 1J14A 1ZTKA 3D62A 3GISB 2AYWA 1UTQA 1BRAA 1O39A 1O3FA 3TK6A 1S84A 2BXUH 1QIXB 3PYHA 2FS8A 1UVTH 1YPHC 2AIPA 1SMFE 4ZHMU 1O2YA 3WY8A 2PR3A 3LGUA 2WPLS 5DPAA 3FVFB 2CGAA 1H9HE 3P8FA 1TNGA 3SU6A 4ISLA 3UIRA 1MBQA 4ASHA 4X2XA 4X6OA 3E16B 1OX1A 4ABFA 1HUTH 2A5KA 2GV6A 2F91A 2BD3A 1SB1H 1P2QA 1O0DH 1PQ5A 1BBRK 4CRFA 5F8TA 4OS6A 4GPGA 2BMGB 5EU8A 2ZKSA 2IN2A 1D3TB 3QX5H 1H8DH 4CRBA 3RXRA 3MH4A 1GMCF 3SQHE 4ESTE 1FPHH 1GI9B 1RGQA 2H9HA 3ZZ7A 2XWBI 3EGKH 5CMXH 5F6MA 1TGCA 1SLUB 1GBHA 1DS2E 5B6OA 1SLWB 2LPRA 1K1OA 1UHBA 3GY2A 2PSYA 1SGTA 3ATWA 3TJUA 3L33A 3K2UA 1ZR0A 3PM3A 1BTWA 2VGCC 3NWUA 4XBBA 1NFYA 1MTNC 1WAYB 3DFJA 3BIUH 3LC3A 2G8TA 4TYDA 1NU9A 1TX8A 3BTEE 3TU7H 3W94A 2BDYA 1YPEH 4U30A 1TIOA 1TMTH 2CN0H 2BY5X 2J34A 3I78A 1C1TA 3TLOA 3SNDA 1T8MA 1AWHB 1SFQB 2QIQA 1HAHH 2VINA 1O31A 1O2IA 2WPJS 2TGAA 3JZ1B 3F68H 1QL8A 1T32A 2BDGA 2BDHA 2CMYA 1O2JA 3ZZ3A 1EPTA 1F0TA 2BXTH 1RJXB 8GCHG 3A7YA 3BG8A 1FDPA 2ZGHA 2ZGBH 1C4Y2 1BTUA 1A61H 1CGJE 2H9EH 2Y81A 4MPVA 1GBMA 3E1XB 2ZIQH 2BTCE 2P59A 1C1QA 4CRCA 1NU7B 2OLGA 4KTCA 2KAIB 1OWEA 3T26A 1EOLA 2EI8A 2W7SA 3RMLH 1EB2A 1UK3A 3PMBB 1YPGH 1MU6B 1PPEE 1FAXA 1FIWA 3LJOA 2P3UB 2OCVB 1F92A 1XM1A 4AFZA 2WYJA 1GMHG 1QJ6B 2C8ZB 4XFQA 5C3NA 3H5CB 1F0UA 3SUFA 3QN7A 1SPJA 4ZXXH 4DY7B 1C2DA 1MU8B 7KMEH 2FI5E 2JETC 2ZCLP 3A7XA 2AEIH 3PMHB 2XNIA 1T8OA 2QGRA 3S69A 2ZWLH 2W5EA 1D3PB 1SLXB 1GHAG 2D8WA 1W13U 2NU3E 1W10U 4MG3A 1ARCA 1DT2A 4IS5A 1SGQE 2EI6A 1EKBB 5IYTA 4Y0ZE 1CT2E 5LH8A 1NS3A 3SORA 1OP0A 1BITA 1PPHE 2PHBA 1O2LA 3TH4H 1TAWA 1T4VH 1BOQA 4CHAB 1Q3XA 4UFEH 3B8JA 1Z71A 1S0RA 2BD2A 2IOTA 3F9GA 1O5BB 4B73A 3SU0A 2P93A 1EZUC 3M7UA 2FMJA 3U1JB 2O8UA 2VWMA 2ZDNA 1TRNA 1ABIH 2TGTA 2AGIX 2FLBH 1MH0A 1HJ8A 2VVCA 3ZYEA 3TPIZ 4ABHA 3GDSA 4ABBA 3A88A 4D9RA 1P2JA 3BEFB 3GCHC 1KLIH 3RMOH 1O2QA 2OC0A 3ZZDA 2ZCKP 3A87A 4X1RU 2FO9A 5A0CA 1JRTA 3EE0B 3RDZA 8ESTE 1NRSH 1C5MD 2JETB 1VITF 2I6SA 2R0LA 1PPZA 4NIVA 2A4RA 1V2QT 5PTPA 4E06H 2TGDA 1Q2WA 1Y5BT 2GCHG 1V2RT 2FXRA 3TK9A 4YT6H 3VB5A 1GMDG 1HAZB 1K1NA 1O2GH 1S81A 2PV9B 1QJ1B 3KCGH 2UUYA 1MD8A 4BAHB 3RXGA 1A0LA 7GCHG 2ALPA 4O3TA 2GTBA 3K65B 5CHAC 2AS9A 3U9AH 3TH3H 1D6RA 2H5DA 1JWTA 1G3EA 1NRPH 2AMDA 3SZNA 2BQ6B 3RXTA 1DWCH 2QV1A 3T5FH 1QQ4A 4CR5A 3NK8A 1C1VH 2JH6D 2BDBA 2ZCHP 4NIYA 4ABJA 2OINA 2SNVA 3O8BA 3PV4A 1ABJH 4AG1A 4A7IB 4AYVB 1QTFA 1O3PB 2PLXA 4B71A 4OGXA 1ETSH 4I32A 4H42U 2ANMH 4Q7ZA 1OWJA 4FU7A 2BVXH 1AVXA 2BLOA 3MMGA 3SBKA 1TNJA 2OC7A 2GCTC 4KELA 4IC6A 1GJ4H 4DIHH 1GL1A 5LPFA 2FM2A 1H4WA 2AGEX 2ZC9H 1E36B 4B76A 1EAXA 1IQKA 2F9UA 5HYOA 1CE5A 1K1PA 2XC5A 3E0NB 4NA9H 4DURA 4NFFA 2EI7A 2J4IA 1DOJA 3CENA 4WMDA 1GBFA 2F3CE 4UFFH 3A83A 3MFJA 1JOUB 1LQDB 2RG3A 2FTMA 4BAOB 1OSSA 3VXEH 1NZQH 1GJ6A 3URDA 2A4QA 4KGAA 4R0IA 5T6GA 1ZRBA 4AX9H 4NA8A 3EQ0H 2ANWA 3P8GA 2H6MA 1XKAC 1GCTB 4Y76A 1FY5A 1IQMA 3GY3A 3D49H 2HLCA 1N1LA 1MTSA 2OC1A 4YESB 1C1WH 1FNIA 3MWIU 3T27A 1G36A 1TNHA 1MTNB 4BAQB 3PTNA 1IAUA 3UREA 2PWXA 1BRBE 4A5TS 1QRXA 1SGYE 2C4FH 1PYTD 3MNBA 1YBWA 3IG6B 3ITIA 1FJSA 1NM6A 1TGBA 2OBOA 1ZLRA 3ZVDA 2PW8H 2W7UA 1TX6A 1BMMH 3ZVGA 3KIDU 1AMHA 1O2UA 1TNKA 1OOKB 2HGTH 1G37A 1WCZA 3M36A 1VR1H 4NSYA 3QGJA 1O3OA 2VIPA 3I29A 3T62A 3RXLA 3D65E 3BSQA 1UTJA 1YCPK 2G81E 3LC5A 2P3FH 5E0JA 1SQOA 3SGQE 1V2OT 1A4WH 2QXHA 4K8YA 3BTQE 4Y0YE 3RMMH 2V6NA 1NN6A 4IMZA 2WV5A 3PO1B 4KTSA 1QBNA 5F8ZA 1Y8TA 3TITA 1JRSA 4K1SA 1GBCA 3TNSA 1K22H 4OS5A 1EAIA 1VCPA 1EPTB 2QC2A 3SV9A 1KLTA 1DANH 1FN8A 1A2CH 1SGRE 1O2KA 2VH0A 5F8XA 4CRAA 4DCDA 1G3BA 4OS7A 1O35A 3KNXA 1H8IH 2SFAA 1O2MA 1YLDA 3KEEA 3RXUA 3Q3YA 3DA9B 3A80A 1ZPBA 1V2TT 2ZDKA 2FOFA 5DP8A 1DLKB 1O2OA 3A82A 1VZQH 4H4FA 1GGDC 1T8NA 1TMUH 2VNTA 3RXAA 1EASA 2AIQA 3KGPA 1ELCA 3BN9A 1ZHMA 4CR9A 3E6PH 3RC4A 2HOBA 1NO9H 3SU2A 2FOMB 1P3EA 2ZFPH 1C2KA 5EGMA 2A4OA 2W3IA 3RXHA 3MI4A 1O2VA 2XTTB 1HBTH 4NGAH 1PPCE 1OPHB 4A92A 1QY6A 1XX9A 1K1LA 1S82A 4O03A 3UY9A 1WUNH 3HK6B 2BLVA 2ESTE 3TNTA 3MNSA 1D3QB 3S7KB 5C2ZA 1BTYA 1SGCA 3SJ8A 3ATMA 1A1RA 3RXVA 1TPPA 4CH2B 1H1BA 2Z94A 1FONA 1LTOA 1YF4A 4THNH 3SNAA 1JBUH 2OTVA 1O2ZA 2GZ9A 1CT0E 2G00A 1HJAC 1V2PT 3A8CA 3SNCA 3MOCA 1KY9A 1D3DB 4Y71A 3ZZ8A 3LONA 1IOEA 3OY6U 1WTGH 4CBNA 4DG4A 4TPIZ 3LT3A 5FPTA 2AERH 4JYVH 4DIIH 3ZVCA 1F5LA 1HYLA 2G52A 1Z6EA 2QYIA 2R2MB 4Y8XA 4WXIA 1GL0E 2UUKB 3SV7A 2GZ8A 2NU0E 4FUHA 3RXQA 3SHAH 1CA8B 1CBWB 2FOEA 4NIXA 3TK5A 1MD7A 4K1TA 5J4QA 2ZF0H 3SJ9A 5AF9H 3ELAH 1O33A 3SV8A 1P10A 2QXJA 2AH4X 2BVRH 3G01A 1V2UT 1OYQA 3P92A 1UVPA 4FUFA 3T28A 2EEKA 3MNXA 1XUFA 1UTOA 1C2JA 3M7QA 2Y6TA 2VIWA 5EQRA 2Z9GA 1FUJA 1EX3A 2HPQH 1TBZH 3P8NA 2AMPA 1BBRH 5JB9S 2OUAA 2A5IA 1F0SA 1GMDF 1P02A 1O34A 2AGGX 4TWWA 2HALA 5FAHA 1YYY1 1MQ6A 3GCTG 1C2MA 4IN2A 1IQIA 1N6YA 1O5AB 3HPTB 4A1XA 1SBWA 1DSTA 1C2GA 1XUJA 3BTHE 4YO9A 1GI1A 1F0RA 1YPKH 1G2MA 1UK2A 1Z8JB 4B75A 1ETTH 1QCPA 3SQEE 2ZDAH 3OU0A 2WPIS 2XBYA 3BV9B 1O30A 3HATH 4JZFH 3ATLA 5EXLA 4DVAU 5L2ZH 1O2RA 5K7RA 1YGCH 3A7TA 3RC5A 1KXEA 3RXJA 1CA0B 2A7HA 1SGDE 3MH7A 4J1YA 1P57B 3JZ2B 1SHHB 3I77A 8GCHF 3Q76A 3EA9A 1DX5M 1LCYA 4ABIA 4VGCC 2FOHA 4ZHAA 2Q6FA 3IWMA 5FXLA 1EXFA 2VVVA 4X1PU 3F1SB 1AQ7A 3Q00A 2WV4A 1NFWA 1V2KT 3ODDA 5E8EH 1AI8H 1TWXB 3M5OA 1Z1JA 5FPSA 1HJ9A 2Z9JA 3OYPA 3ATKA 1DXPA 1NPMA 4DGJA 3T29A 1C5QA 1QR3E 2ZECA 1Z7KA 1RTFB 1AVGH 4JCNA 4OS4A 4K69A 2V3HH 4BTUB 1W0ZU 3LGIA 2FOCA 5A0BA 4XBDA 2XCFA 1HPGA 2A5AA 4E05H 3ZVBA 2BZ6H 4GVUA 2QF0A 3KQEA 3SNBA 1J15A 3NKKA 2Y82A 3LOXA 3MH6A 1HRTH 3QGNB 4AGJA 4CH8B 1P09A 5AVDA 1BMLA 3M3SA 4Y79A 1SSXA 2ZTZA 1E34B 3RM0H 1ELVA 2ZU1A 3Q3XA 4XOJA 2FI3E 3VB4A 2QXIA 5EW1H 3GCOA 1QGFA 2D2DA 1GBEA 3VGCC 2FESH 1GBJA 1TRMA 3SJKA 6LPRA 1ZHPA 1DY8A 1S83A 3SJIA 3F9HA 1CHOF 1AKSA 5H4IB 1LPGB 3VEQB 2DE9A 3V13A 2LNCA 2BDCA 1VITH 3O8RA 1T7CA 1BT7A 5GWZA 2VIDA 1RXPA 2OQ5A 1MTUA 2M5TA 1CA0C 3VXFH 5C67A 1L0ZA 2Y5HA 4JZIA 3N7OA 2CHAC 1ESBA 1AHTH 5FBIA 1P3CA 1UVSH 2YOLA 1W3CA 3RUOA 1E38B 2FX6A 1GI3A 1TBQH 4YOGA 1OWDA 4RKOB 1UCYH 1CHGA 1INCA 2J95A 4Y8YA 4K3JA 4YOIA 3FZZA 1GGDB 1P01A 4FUIA 4MLFB 1ZPCA 1EQ9A 2ZQ1A 5EXMA 5BPEA 2QXGA 1P0SH 1HGTH 1TPSA 1Z8GA 2DE8A 3ZVEA 3M3TA 1NTPA 1O32A 4ZKRU 4NIWA 3UPEA 1TALA 3ZZAA 2GCHF 3FP6E 1ELAA 1AE5A 1C1SA 2HVXA 3UR6A 4X8VH 1GJ9B 1GHWH 1S6HA 4E7NA 4I8KA 1GHYH 3LU9B 3BEIB 1ZSJA 1KSNA 3AAVA 1P8VC 4UFGH 1G3DA 1SGPE 1UVUH 1JXPA 4ABAA 1LKAA 3LGWA 4WH8A 8KME2 1C5VA 5GCHF 5T6FA 1ESAA 1T4UH 2FI4E 3R3GB 3RXPA 3TIUA 3GYLB 2VB0A 5DK1A 4FVDA 2XC4A 5DP7A 1YPMH 1LPKB 1J8AA 2ZTXA 3Q77A 1HAYB 1L4DA 2Y5FA 1DM4B 1P2MA 1WSSH 2F9OA 4J2YB 2VU8E 2ULLA 1FV9A 1UTPA 1BIOA 1YM0A 3FAOA 4MNWA 3ZZCA 5J4SA 1MKWH 1AIXH 5I25A 1O5DH 1AZ8A 2CXVA 5L30H 1EUFA 1JIMA 4FUDA 4GHQA 5A2MH 4LZ1H 1LHEH 2UUFB 2SGAA 3PLBA 1BRCE 3SU5A 3BF6H 3NXPA 1GJBB 5E2PA 4LOYH 1N8OC 2Z7FE 4UD9H 1W8BH 4JK6A 1THRH 3RXEA 2A2QH 1BB0B 1Z6JH 3AVZA 1HB0B 2SGEE 1XUKA 1RIWC 1BA8B 1O38A 1G30B 4ZROA 2PUQH 1D4PB 1ZPZA 2A1DB 2GT8A 4INKA 4INHA 4I7YH 1ZGIA 4ISIH 1OWIA 2G4TA 1LDTT 1K1MA 1ZRKA 2FOBA 3H7OA 2ZI2H 1MKWK 4X0WU 5EPYA 2J9NA 3DT0H 2G5VA 1C4V2 2A45B 1TNIA 1UCYK 1A46H 1V2MT 1ZJKA 4K2YA 3ZZBA 4YT7H 2FX4A 1GBTA 1YPLH 4WMEA 5DP9A 3LJJA 2WYGA 1N6XA 1C5LH 2HRVA 1C2LA 3ZV9A 1QFKH 1SGFA 3SU4A 1C1UH 2W3KA 1QB1A 1HAPH 4SGAE 3ZZ6A 2BLWA 2PKAA 2SGQE 2ZHFH 4NG9H 3ZYDA 1Q31A 3A8DA 3D23A 1MKXK 4GCHG 1LHFH 1ZMJA 1KXBA 2B7DH 4FU9A 4MQAA 1O3EA 5DP5A 3CS0A 1S0QA 1IQLA 2BB4A 4IN1A 3AW1A 1ZYOA 5EXNA 3MO6A 3U8RH 3VB6A 2P8OB 2UWLA 1VITG 7ESTE 4FUCA 1Y3WA 1YLCA 5FCKA 5G4BA 1H9LB 1SGFG 2SGFE 2WPHS 2V35A 2QF3A 3NZIA 1LO6A 2TRMA 3HGPA 1TYNA 3K6ZA 1AFQB 3UNQA 1C2EA 1GBIA 2ZPRA 1L1GA 3SO3A 1RTLA 1C2HA 1EJNA 1C1MA 2F9NA 1OKXA 1HLTH 3M5NA 3PMJA 2FLRH 1FAKH 2ANYA 1O3DA 1O3CA 1TLDA 1DUAA 4XDEA 3RXIA 1NFUA 3A81A 1KDQA 3BTWE 3ODFA 3PWBA 4LXBH 4ZAEA 4GCHF 4NZLA 2A4GA 2O8WA 4Y6DA 3MU4A 2QN5T 4BANB 2WPMS 3T2NA 1RFNA 3MH5A 1QRWA 5GDSH 3TJNA 3SUEA 5GXPA 4Y11E 1SI5H 2CF9H 5A8XA 2A7CA 1PPFE 4Q2KA 1DWBH 5A0AE 1E0FD 3VB7A 1W14U 1QA0A 1EJMA 2NWNA 2ANKH 2C90B 4JZEH 4ZKNU 5DP4A 3GY8A 5LGOA 4JZDH 4AZ2B 1EZQA 4FUGA 2GMTB 4RN6A 3LGYA 1V2ST 1O5CB 4NFEA 4IMQA 4AFSA 1P2KA 1C5UA 1GDNA 5CE1A 2GDDA 4NWLA 4BNRA 5DJ7A 1QRZA 2Z6BD 3E91A 1MZDA 3S7HB 1HCGA 2FZZA 1UTLM 2FS9A 4MNVA 1GVLA 2PUXB 1VGCC 1O2WA 1CU1A 1P05A 4FUJA 1V2WT 1VCWA 5C1UA 2A2XH 1GJ8B 3AW0A 1P04A 2WPKS 1P9SA 2NU2E 4AB9A 1O3BA 1EAUA 2H1UA 1GI7B 4FVBA 4O9VA 3A7VA 4CRGA 3ZZ9A 1S6FA 4WVPE 1XKBC 5GPIB 2G55A 3DD2H 2ZU5A 1BHXB 1PQ7A 2V0BA 2VIOA 3BTDE 4AYYB 1C5OH 4MPWA 1LHCH 4U01A 4HTCH 1O5EH 5C1XA 2FEQH 1Z1IA 3AASA 3SUGA 1SC8U 3RLYH 2BVSH 2PKSC 1THPB
chains in the Genus database with same CATH superfamily
1C5ZB 2GD4B 1QL7A 2I6QA 1KYNA 5JBBS 1MCVA 5HMAA 3UWIA 4U32A 2BQWB 1Z8RA 1GVZA 1E37B 1GWAA 1LMWB 1QB6A 4AN7A 1GI6A 2CV3A 2GT7A 2XWAA 4NA7A 1L4ZA 1FY3A 4X6NA 1C4U2 1B0FA 3R0FA 1FPCH 1TE0A 1HAXB 1ZOMA 1EZSC 2KCOA 1ANCA 2TGPZ 2KM0A 1CGHA 1GJAB 3S9CA 1AY6H 2OQUA 2ZGXH 3V12A 4TWYA 3SJOA 4I8JA 1GG6B 1Y3VA 3Q3KA 4FXGH 2XW9A 2HNTE 1MTVA 3SU1A 1L1NA 3KF2A 3LKWA 2QAAA 5GIBA 2ZFFH 4HI3A 3RXDA 1HAOH 2ASUB 1Y59T 1B7XB 2ODQA 2Q1JA 4XE4A 4NWKA 3PV5A 2CJIA 3CP7A 1F7ZA 3OSYA 4Y7BA 5FX6A 2Q6DA 1QBVH 5A09A 5C1YA 1HDTH 2BOKA 3NCLA 1C5XB 2AMQA 9ESTA 1QBOA 1Y5AT 4FUEA 5F03A 4ACBA 2RFKC 2C8XB 2RDLA 3RU4E 1DY9A 1SLVB 3A7WA 1YC0A 4JYUH 2QA9E 1GBLA 2ZTYA 2GP9B 4OM9A 3L3TA 4X2WA 2JDID 3GCHB 3QTOH 1GHZA 3EAJA 3MNCA 2YNBA 2A7JA 1ELGA 1AN1E 2V3OH 1GBBA 1A3BH 2XBXA 4Q7XA 1C5SA 4FU8A 4JMYA 1MUEB 3FZDA 3ESTA 3HK3B 3QTVH 4RKJB 5EIYA 2BD4A 3FFGA 3PO1C 2D1JA 2VIQA 1S85A 3MU1A 4MPUA 1FLEE 5KGOA 4D7FA 5FHTA 3OY5U 1YKTA 1ZMLA 4X2VA 1ORFA 1AGJA 3DHKH 1TNLA 1TMBH 3A8BA 1K1JA 3QZRA 5EPNA 1GI2A 1J9CH 2YNAA 1QJ7B 2B9LA 5EOKA 1HAVA 1DLEA 1K9OE 1LVMA 1MCTA 2R3YA 3DSPA 2Z3EA 1VJAU 3GS9A 2C93B 1JMOH 2BY9X 3NRLA 4K5ZA 2BY8X 3F0PA 2B8OH 2KCYA 1XMNB 2XC0A 2ZU2A 2PFEA 1ZHRA 3F2HA 2BX4A 2J38A 3S9AA 4HZHA 2O8TA 1FMGA 1O2NA 4PROA 3M37A 2P94A 3LDXH 3HKJB 2BOHB 1GHVH 1P2NA 1GJ5H 1TB6H 4NCYA 3BTGE 4OGYA 3UWJH 3UQVA 1GMHF 2PKAB 4X6MA 7GCHF 1HXFH 2XYAA 3EE7A 1MAXA 2TIOA 2K0QA 3QLPH 4LZ4B 4BAKB 1A0HB 1KLJH 1A7SA 1GVKB 1FY1A 1ELBA 1VKYA 2EC9H 4B2BA 1Z8IB 2TPIZ 1FY4A 1BZXE 4CHAC 4Z6AH 2FOGA 1WYKA 2BD5A 2ZFSA 3OEHD 5HM2A 2O9QA 2XBWA 1O5FH 5FBEA 1WOFA 1WTHD 4IGDA 1NRQH 1SVPA 3VPKA 1OP2A 1C5WB 1AWFH 3AK5A 3QO6A 1C1NA 2PSXA 1ANDA 1NROH 1O3GA 2RA3A 3H7TA 3M61U 4WH6A 2C8WB 1GG6C 1HFDA 1YPJH 3EA7A 5LPEA 2A0QB 1BBRE 1KXAA 1GBAA 1P2OA 5KECA 2IPHA 2GX4A 2XCNA 4GHTA 3E3TA 5JB8S 4X6PA 2HNTF 3S0NA 1SQTA 3VFEA 1UCYE 3SGBE 1RIWB 3KL6A 1O2XA 1TOCB 1YLNA 1Y5UT 1KTSB 5JPMH 2SGDE 1ARBA 2BQ7B 2ZFQH 4F48B 1TPOA 1DE7H 4P02A 4XD7D 1TQ0B 4UFDH 4X1QU 1O2TA 2R2WU 1OP8A 5FPYA 3M5MA 3RXOA 1QQUA 2LP6A 4HFPB 1AD8H 4B2AA 1GI5A 5LPRA 4MTBA 5FL7D 3UR9A 1CGIE 1PQ8A 3ZZ4A 1C5PA 1BTZA 5E2OA 1AU8A 4ACAA 3KQCA 3F6UH 3GY7A 2AFQB 3OEED 1A5GH 2THFB 3GY5A 2QY0B 4UONA 2B5TB 1XXFA 4MNYA 4B1TA 1KIGH 1SG8B 1LHGH 3NUMA 2ILNA 1CT4E 2KCAA 3SI3H 2XBVA 3GY6A 5C0UA 2SNWA 5IK2D 3PROA 5AFYH 5HGGA 2FIRH 4CBOA 2STAE 1Y3UA 3MO3A 5E0GA 3M35A 3PWCA 2CHAB 2H9TH 3E8LA 2Z9IA 5T3HA 5C5OA 1P9UA 1J17T 2RA0A 1GBKA 3SN8A 1T31A 3TJVA 4BXWA 4WJG2 4AORA 1XXDA 1NT1A 4B74A 4UDWH 4ISHH 5L2YH 3M3VA 1C5RA 4NSVA 2HLDD 3PLKA 2ZDMA 1B0EA 1F2SE 4BXSA 2KAIA 3U1IB 3BTTE 1IQEA 3RXMA 2BD8A 1EOJA 3QWCH 1GHBF 4DOQA 1E35B 1S6LA 2OBQA 1UVOA 2ZA5A 4LK4A 3FO8D 4IBLH 1FN6A 1WU1A 3MU5A 2PGQB 1IQHA 1OWKA 2FYQA 3CNRA 1GMCG 5JBAS 4BAMB 1LHDH 1TBRH 5DP6A 3P70B 2Y7ZA 1AE8H 2O8MA 3MYWA 1VCQA 2BD7A 5JBCS 1YWUA 1IQNA 2G5NA 1QNJA 5A8ZA 1YPHE 4F49A 4UE7H 1Y3YA 3OX7U 1QL9A 1T8LA 2FPZA 4X8UH 1WXRA 4ABEA 4AC9A 3P17H 1AB9C 4E7RG 2Y5GA 1C1PA 2UWOA 3SYJA 2M2AA 2OP9A 1ETRH 1D9IA 1O2SA 3TVJB 2Q6GA 3RXCA 1P03A 1AZZA 2JH5D 1C5NH 1BJVA 4WWYA 1UW7A 2V7QD 5C0TA 5DG6A 1LPZB 4AB8A 1GBDA 3UB0A 1DXWA 2BD9A 5I46H 1FY8E 2WSSD 4YOJA 2BYAX 4RT0A 3BTFE 1QB9A 1NY22 5DP3A 2VIVA 3HKIB 2ZHEH 4JK5A 2HWLB 1AB9B 1O2PA 3E90B 8LPRA 5CHBA 1A3EH 1W11U 1PFXC 3F9EA 3LGVA 2W6JD 1C1RA 3UUZA 3M7TA 2SGPE 2PGBB 1WQVH 5EQQA 4BTIB 1K0HA 4JYTA 5HIYA 3QUMP 3SI4H 2J97A 1W7GH 1MQ5A 1HAIH 1C9TA 1BCUH 1GJDB 4K1EA 2F9BH 2OC8A 2QCYA 3SHCH 1O2HA 1GDQA 3DCLA 3QDZB 1B5GH 1IHTH 2GGVB 2Z3CA 1BTHH 1V2VT 4Y8ZA 3UTUH 1DWDH 1K2I1 2J94A 4VGCB 1C9PA 2ZHQH 3A85A 2PTCE 4MNXA 1W12U 2WINI 1NFXA 1W7XH 1XUGA 1ANEA 1F5RA 1CVWH 4ISNA 3U8OH 3DFLA 2R0KA 5HM9A 1ELFA 1QHRB 3BG4B 2H5CA 1A0JA 3DSOA 1F5KU 4ZUHA 3RC6A 1W0JD 1V2LT 5JBTA 5ABWA 2J2UA 2ZPQA 4X2YA 1YY3A 1OS8A 3RXFA 3RU4D 3SOSA 1G32B 3BTME 3O8DA 1TQ7B 3UNRA 3P95A 1ELTA 1WQSA 5HXFA 3A8AA 2H2ZA 2WUBA 1CO7E 3OTJE 5KEDA 1KXCA 4CREA 1CBWC 1LVYA 4XSKU 3GCTF 2J92A 3F3BA 3PMAB 5GJ4B 1WBGB 4Z0KA 4AFQA 4INLA 1A5IA 4YZUA 3BTKE 3P6ZB 2A32A 2JIZD 3ZZ5A 1O37A 2Y7XA 2ALVA 4XBCA 4K60A 4I8GA 1N8OB 3ZV8A 3UAIC 3M5LA 3RLWH 3S9BA 4U2WA 3O8CA 1G9IE 3TH2H 4A6LA 2STBE 5ESTE 3KN2A 1SOZA 1O3AA 3V0XA 1W2KH 2GV7A 4JZ1A 5DGJA 2ZHDA 3E0PB 1YCPM 2Y80A 4I8HA 1WV7H 3EYDA 4IW4E 2EA3A 4BOHA 1XUHA 2C3SA 3NPSA 2ZHWH 2ZU3A 4A1TA 2YMSB 3V3MA 1TGNA 2XRCA 1IQGA 5IDKA 1GCTC 1EJAA 1BHXF 3OTPA 4GUXA 2LELA 4K8BA 3IITA 2WUCA 1L2EA 4MVNA 4HG6A 2GDEH 2KR7A 4F4OC 3W95A 5C94A 1SR5C 4TPYA 3SUDA 4H6SB 3QK1A 4I31A 1ZGVA 1SGIB 1AVWA 1HJAB 1SFIA 1UTMA 4QT8C 4UEHH 2ZNKH 5C17A 1UO6A 5L6NH 2O8LA 4A1VA 3LGTA 9LPRA 3EA8A 4ZKSU 1GJ7B 1KXDA 2BLQA 2F83A 1FXYA 2G51A 3FN8A 3GYMA 4X1SU 1RS0A 1ZSLA 5HIZA 1SQAA 1EPTC 1TPAE 3RXSA 2W26A 1MTWA 5E0HA 1TOMH 2ODYB 4KTUA 1AFEH 3A84A 2D26C 1FI8A 1PPBH 1NRRH 1K1IA 1V2NT 1AFQC 4D7GA 3MU8A 4SGBE 4TY7A 3AAUA 1UTNA 1ELDE 1EB1H 1W0YH 1DICA 4FOUC 1HIAB 1XVMA 1IQFA 2Z9LA 3LH1A 4H6TA 3RU4T 5SGAE 1SOTA 1BTXA 3TGKE 3TGIE 1RTKA 1O3JA 4AFUA 3ENSB 1P11E 4Q80A 3QZQA 2VVUA 4KP0A 4AG2A 4OS1A 3GDVA 2JKHA 4DJZB 6CHAC 1TA6A 2WV9A 5FX5A 3FP7E 3K9XB 1BJUA 1OHHD 1AUTC 3RXKA 3SW2B 4YTAA 1BTPA 2BX3A 1UMAH 2HPPH 2ZP0H 3KQBA 6ESTA 5GCHG 4R8TB 2IJOB 1DVAH 1HNEE 1Y3XA 1GCDA 1BUIA 5C5NA 2OXSA 1MZAA 1ID5H 1FZZA 2CF8H 2ZU4A 1HAGE 2WHXA 1IHSH 2FTLE 3F9FA 3LPRA 1LKBA 3U69H 3RP2A 5TCCA 2ZQ2A 3FP8E 1TX7A 1FQ3A 1V2JT 5TCAA 1H9IE 1HV7A 3ZVAA 1AUJA 1K28D 1KDQB 3BEUA 1YCPH 4O97A 4TY6A 2FDAA 4X8SH 1C5TA 1V6DA 3B9FH 4DT7B 5ETXA 5ESBA 1ZJDA 3SV6A 4AGKA 3T25A 3MTYA 2F43B 3PTBA 3VGCB 1NRNH 3DUXH 1P06A 2VJ1A 2Z9KA 1NESE 2P16A 2BY7X 1UHBB 2BHGA 1MAYA 4Q7YA 3FANA 3ZVFA 2ZFRH 1UK4A 4X1NU 3SU3A 2G4UA 4IC5A 4RSPA 1DPOA 5EG4A 3GCNA 1BMNH 1UJ1A 2ZPSA 3GY4A 3KYGA 5K0HA 1CHOG 2K1QA 1IQJA 4TSFD 1PPGE 1TONA 6GCHF 1C1OA 4O3UA 1THSH 1EP6A 1X7AC 1KMHB 3OAAD 5EQSA 4I8LA 3U8TH 2GCTB 2PKSB 2FODA 2HNTC 4MDSA 4OS2A 1TGSZ 2VWOA 1G2LA 1FIZA 1RD3B 1ZZZA 3UFAA 3TGJE 4DW2U 4D76A 3LH3A 1DDJA 4X8TH 1TABE 2QF4A 4ABDA 1C2FA 3UOPA 1CSOE 1GJCB 3KHVA 2VH6A 3C1KA 5JYIA 2GJGA 1EAWA 1M9UA 1P12E 4HGCA 4ZXYH 2B0FA 2RCEA 1TFXA 1O5GH 2P3TB 2F9PA 4M7GA 1O3LA 4I33A 3MU0A 7LPRA 3LIWA 1GPZA 4MPXA 2BM2A 1O3MA 1DUEA 3V7TA 1ELEE 1G3CA 2ZDLA 1GI4A 1S5SA 2XXLA 3RM2H 3RMNH 1GHAF 2JH0D 1U6QA 1ZTLA 5AHGH 2EQNA 2ODPA 4ABGA 3A7ZA 5C20A 1GHBG 2GMTC 4NZQA 4ZKOU 3BG4C 4D9QA 1P2IA 1LVOA 1CQQA 2GZ7A 2JJ1D 2ZZUH 4GSOA 2TBSA 1GHXH 1MBMA 1FX0B 1DWEH 1TA2A 4YLUA 1ESTA 1SL3A 2ZFTA 4Y10E 1GDUA 5FCRA 3B23B 6GCHG 1MMJN 4ZMAH 3GOVB 4ZHLU 4WMFA 3PLPA 2VGCB 2ZGCA 3TJOA 1VGCB 4WY3A 3URCA 2VWNA 3HGNA 2NU4E 1JIRA 2R3UA 2P8OC 2FOAA 4D8NA 1J16A 1V3XA 1HXEH 1KTTB 1ZTJA 4FUBA 1EZXC 2J5UA 1DFPA 5AFZH 3SGAE 1H8HD 1PQAA 3SNEA 3MHWU 1AO5A 1L1JA 4WF8A 1OXGA 2P95A 2R9PA 3CS7A 2ZG0H 4ZH8A 2VWLA 4KKDA 3UNSA 2GVFA 1VJ9U 3MO9A 4GAWA 1TGTA 4GLYA 2OD3B 4B2CA 3GICB 3L6PA 3UQOA 1D6WA 2PTNA 2ZO3H 2NU1E 1O3KA 2FYRA 1BMAA 3U98H 1KXFA 5BRRE 3STIA 1DITH 1PJPA 5CHAB 1ANBA 2A31A 2F9VA 2ZDVH 4WXVA 5DKMA 5A8YA 1RRKA 1XUIA 3PB1E 3A89A 1GI8B 1LVBA 3BIVH 1HAVB 4Q4LA 1AKSB 1XVOA 1MKXH 1ZSKA 1BQYA 3A86A 1O3IA 4BTTB 1TRYA 2FP7B 3K6YA 5T6DA 1SHYA 3RXBA 3MQKC 2BDAA 1DSUA 6CHAB 2Z3DA 1PYTC 1YP9A 5TJXA 2UWPA 5DO4H 5JDUB 3GDUA 1BRUP 1C2IA 3SV2H 4Y7AA 1NC6A 2W6ID 3KQDA 4ISOA 1EATA 1K21H 1SGNE 2GKVE 4AOQA 1H8ED 1ACBE 1O36A 1ZMNA 1NBME 3VB3A 1C5YB 1BDAA 1OYTH 1OWHA 1SGEE 2PP6A 5EODA 2BZAA 2KZ4A 3C27B 4TT3D 2C8YB 2ZEBA 1UTKA 3UOUA 2OK5A 1O3HA 4CRDA 5EW2H 1HIAA 4YLQH 3P8OA 2BY6X 3ATIA 3STJA 3EDXB 1QURH 1GI0A 1O3NA 4YM9A 2FWWA 1EP5A 2BDIA 1A5HA 1QA7A 2DUCA 2UUJB 1LQEA 2ZGJA 1J14A 1ZTKA 3D62A 1E79D 3GISB 1WDIA 2AYWA 1UTQA 1BRAA 1O39A 1O3FA 3TK6A 1S84A 2BXUH 1QIXB 3PYHA 2FS8A 1UVTH 1YPHC 2AIPA 1SMFE 4ZHMU 1O2YA 3WY8A 2PR3A 3LGUA 2WPLS 5DPAA 3FVFB 2CGAA 1H9HE 3P8FA 1TNGA 3SU6A 4ISLA 3UIRA 1MBQA 4ASHA 4X2XA 4X6OA 3E16B 2J98B 5CDFE 1OX1A 4ABFA 1HUTH 2A5KA 2GV6A 2F91A 2BD3A 1SB1H 1P2QA 1O0DH 1PQ5A 1BBRK 4CRFA 5F8TA 4OS6A 4GPGA 2BMGB 5EU8A 2ZKSA 2IN2A 1D3TB 3QX5H 1H8DH 4CRBA 3RXRA 3MH4A 1GMCF 3SQHE 4ESTE 1FPHH 1GI9B 1RGQA 4ZCNA 2H9HA 3ZZ7A 2XWBI 3EGKH 5CMXH 5F6MA 1TGCA 1SLUB 2L6OA 1GBHA 1DS2E 5B6OA 5F53A 1SLWB 2LPRA 1K1OA 1UHBA 3GY2A 2PSYA 1SGTA 3ATWA 3TJUA 3L33A 3K2UA 1ZR0A 3PM3A 1BTWA 2VGCC 3NWUA 4XBBA 1NFYA 1MTNC 1WAYB 3DFJA 3BIUH 3LC3A 2G8TA 4TYDA 1NU9A 1TX8A 3BTEE 3TU7H 3W94A 2BDYA 5DN6D 1YPEH 4U30A 1TIOA 1TMTH 2CN0H 2BY5X 2J34A 3I78A 1C1TA 3TLOA 3SNDA 1T8MA 1AWHB 1SFQB 2QIQA 1HAHH 2VINA 1O31A 1O2IA 3KQ5A 2WPJS 2TGAA 3JZ1B 3F68H 1QL8A 1T32A 2BDGA 2BDHA 2CMYA 1O2JA 3ZZ3A 1EPTA 1F0TA 4Q63A 2BXTH 1RJXB 8GCHG 3A7YA 3BG8A 1FDPA 2ZGHA 2ZGBH 1C4Y2 1BTUA 1A61H 1CGJE 2H9EH 2Y81A 4MPVA 1GBMA 3E1XB 2ZIQH 2BTCE 2EY4C 2P59A 1C1QA 2KFWA 2V3MA 4CRCA 1NU7B 2OLGA 4KTCA 2KAIB 1OWEA 3T26A 1EOLA 2EI8A 2W7SA 3RMLH 1EB2A 1UK3A 3PMBB 1YPGH 1MU6B 1PPEE 2HVYB 1FAXA 1FIWA 3LJOA 2P3UB 2OCVB 1F92A 1XM1A 4AFZA 4FETA 2WYJA 1GMHG 1QJ6B 2C8ZB 4XFQA 5C3NA 3H5CB 1F0UA 3SUFA 3QN7A 1SPJA 4ZXXH 4DY7B 1C2DA 1MU8B 7KMEH 2FI5E 2JETC 2ZCLP 3A7XA 2AEIH 3PMHB 2XNIA 1T8OA 2QGRA 3S69A 2ZWLH 3FOAA 5EJLA 2W5EA 1D3PB 1SLXB 1GHAG 2D8WA 1W13U 2NU3E 1W10U 4MG3A 1ARCA 1DT2A 4IS5A 2L74A 1SGQE 2EI6A 1EKBB 5IYTA 4Y0ZE 1CT2E 5LH8A 3PRBA 1NS3A 3SORA 1OP0A 1BITA 1PPHE 2PHBA 1O2LA 3TH4H 1TAWA 1T4VH 1BOQA 4CHAB 1Q3XA 4UFEH 3B8JA 1Z71A 1S0RA 2BD2A 2IOTA 3F9GA 1O5BB 4B73A 3SU0A 2P93A 1EZUC 3M7UA 2FMJA 3U1JB 2O8UA 2VWMA 2ZDNA 1TRNA 1ABIH 2TGTA 2AGIX 2FLBH 1MH0A 1HJ8A 2VVCA 3ZYEA 3TPIZ 4ABHA 3GDSA 4ABBA 3A88A 4D9RA 1P2JA 3BEFB 3GCHC 1KLIH 3RMOH 1O2QA 2OC0A 3ZZDA 2ZCKP 3A87A 4X1RU 2FO9A 5A0CA 1JRTA 3EE0B 3RDZA 8ESTE 1NRSH 1C5MD 2JETB 1VITF 2I6SA 2R0LA 1PPZA 4Z1MD 4NIVA 2A4RA 1V2QT 5PTPA 4E06H 2TGDA 1Q2WA 1Y5BT 2GCHG 1V2RT 2FXRA 3TK9A 4YT6H 3VB5A 1GMDG 1HAZB 1K1NA 1O2GH 1S81A 2PV9B 1QJ1B 3KCGH 2UUYA 1MD8A 4BAHB 3RXGA 1A0LA 7GCHG 2ALPA 4O3TA 2GTBA 2JJ2D 3K65B 5CHAC 2AS9A 3U9AH 3TH3H 1D6RA 2H5DA 1JWTA 1G3EA 1NRPH 2AMDA 3SZNA 2BQ6B 3RXTA 1DWCH 2QV1A 3T5FH 1QQ4A 4CR5A 3NK8A 1C1VH 2JH6D 2WZQA 2BDBA 2ZCHP 4NIYA 4ABJA 2OINA 2SNVA 3O8BA 3PV4A 1ABJH 4AG1A 4A7IB 4AYVB 1QTFA 1O3PB 2PLXA 4B71A 4OGXA 1ETSH 4I32A 4H42U 2ANMH 4Q7ZA 1OWJA 4FU7A 4XRNA 2BVXH 1AVXA 2BLOA 3MMGA 3SBKA 1TNJA 2OC7A 2GCTC 4KELA 1MABB 4IC6A 1GJ4H 5DSFA 4DIHH 1GL1A 5LPFA 2FM2A 1H4WA 2AGEX 2ZC9H 1E36B 4B76A 1EAXA 1IQKA 2F9UA 5HYOA 1CE5A 1K1PA 2XC5A 3E0NB 3N7DA 4NA9H 4DURA 1W0KD 2EI7A 4NFFA 2J4IA 1DOJA 3CENA 4WMDA 1GBFA 2F3CE 4B6FA 4UFFH 3A83A 3MFJA 1JOUB 1LQDB 2RG3A 2FTMA 4BAOB 1OSSA 3VXEH 1COWD 1NZQH 1GJ6A 3URDA 2A4QA 4KGAA 4R0IA 5T6GA 1ZRBA 4AX9H 4NA8A 3EQ0H 2ANWA 3P8GA 2H6MA 1XKAC 1GCTB 4Y76A 1FY5A 1IQMA 3GY3A 3D49H 2HLCA 1N1LA 1MTSA 2OC1A 4YESB 1C1WH 1FNIA 3MWIU 3T27A 1SKYE 1G36A 1TNHA 1MTNB 4BAQB 3PTNA 1IAUA 3W1EA 3UREA 2IPQX 1BRBE 2PWXA 1QRXA 4A5TS 1SGYE 2C4FH 1PYTD 3MNBA 1YBWA 3IG6B 3ITIA 1FJSA 1NM6A 1TGBA 2OBOA 1ZLRA 3ZVDA 2PW8H 2W7UA 4DT4A 1TX6A 1BMMH 3ZVGA 3KIDU 1AMHA 1O2UA 1TNKA 1OOKB 2HGTH 1G37A 1WCZA 3M36A 1VR1H 4NSYA 3QGJA 1O3OA 2VIPA 3I29A 3T62A 3RXLA 3D65E 3BSQA 1UTJA 1YCPK 2G81E 3LC5A 2P3FH 5E0JA 1SQOA 3SGQE 1V2OT 1A4WH 2QXHA 4K8YA 3BTQE 4Y0YE 3RMMH 2V6NA 1NN6A 4IMZA 2WV5A 3PO1B 4KTSA 1QBNA 5F8ZA 1Y8TA 3TITA 1JRSA 4K1SA 1GBCA 3TNSA 1K22H 4OS5A 1EAIA 1VCPA 1BMFD 1EPTB 2QC2A 3SV9A 1KLTA 2F4LA 1DANH 1FN8A 2KCPA 1A2CH 1SGRE 1O2KA 2VH0A 5F8XA 4CRAA 4DCDA 1G3BA 4OS7A 1O35A 3KNXA 1H8IH 2SFAA 1O2MA 1YLDA 3KEEA 3RXUA 3Q3YA 3DA9B 3A80A 1ZPBA 1V2TT 2ZDKA 2FOFA 2IJD1 5DP8A 1DLKB 1O2OA 3A82A 1VZQH 4H4FA 1GGDC 1T8NA 1TMUH 2VNTA 3RXAA 1EASA 2AIQA 3KGPA 1ELCA 3BN9A 1ZHMA 4CR9A 3E6PH 3RC4A 2HOBA 1NO9H 3SU2A 2FOMB 1P3EA 2ZFPH 1C2KA 5EGMA 2A4OA 2W3IA 3RXHA 3MI4A 1O2VA 1HBTH 2XTTB 4NGAH 1PPCE 1OPHB 4A92A 1QY6A 1XX9A 1K1LA 1S82A 4O03A 2CK3D 3PV2A 3UY9A 1WUNH 2YMSC 3SZEA 3HK6B 2BLVA 2ESTE 3TNTA 3MNSA 1D3QB 3S7KB 5C2ZA 1BTYA 1SGCA 3SJ8A 3ATMA 1A1RA 3N7EA 3RXVA 1TPPA 3WWFA 4CH2B 1H1BA 2Z94A 1FONA 1LTOA 1YF4A 4THNH 3SNAA 1JBUH 2OTVA 1O2ZA 2GZ9A 1CT0E 2G00A 1HJAC 1V2PT 3A8CA 3SNCA 3MOCA 1KY9A 1D3DB 4Y71A 3ZZ8A 3LONA 1IOEA 3OY6U 1WTGH 4CBNA 4DG4A 4TPIZ 3LT3A 5FPTA 2AERH 4JYVH 4DIIH 3ZVCA 1F5LA 1HYLA 2G52A 1Z6EA 2QYIA 2R2MB 2XNDD 4Y8XA 4WXIA 1GL0E 2UUKB 3SV7A 2GZ8A 2NU0E 4FUHA 3RXQA 3SHAH 1CA8B 1CBWB 2FOEA 4NIXA 3TK5A 1MD7A 4K1TA 5J4QA 2ZF0H 3SJ9A 5AF9H 3ELAH 1O33A 3SV8A 1P10A 2QXJA 2AH4X 2BVRH 3G01A 1V2UT 1QZ8A 1OYQA 3P92A 1UVPA 4FUFA 2AHME 3T28A 2EEKA 3ZIAD 3MNXA 1XUFA 1UTOA 1C2JA 3M7QA 2Y6TA 2VIWA 5EQRA 2Z9GA 1FUJA 1EX3A 2HPQH 1TBZH 3P8NA 2AMPA 1BBRH 5JB9S 2OUAA 2A5IA 1F0SA 1GMDF 1P02A 1O34A 2AGGX 4TWWA 2HALA 5FAHA 1YYY1 1MQ6A 3GCTG 1C2MA 4IN2A 1IQIA 1N6YA 1O5AB 3HPTB 4A1XA 1SBWA 1DSTA 1C2GA 1XUJA 3BTHE 4YO9A 1GI1A 1F0RA 1YPKH 1G2MA 1UK2A 1Z8JB 4B75A 1ETTH 3KYFA 1QCPA 3SQEE 2ZDAH 3OU0A 2XOKD 2WPIS 2XBYA 3BV9B 1O30A 3HATH 4JZFH 3ATLA 5EXLA 4DVAU 5L2ZH 1O2RA 5K7RA 1YGCH 3A7TA 3RC5A 1KXEA 3RXJA 1CA0B 2A7HA 1SGDE 3MH7A 4J1YA 1P57B 3JZ2B 1SHHB 3I77A 8GCHF 3Q76A 3EA9A 1DX5M 1LCYA 4ABIA 4VGCC 2FOHA 4ZHAA 2Q6FA 3IWMA 5FXLA 1EXFA 2VVVA 4X1PU 3F1SB 4ASUD 1AQ7A 3Q00A 2WV4A 1NFWA 1V2KT 3ODDA 5E8EH 1AI8H 1TWXB 3M5OA 1Z1JA 5FPSA 1E1QD 1HJ9A 2Z9JA 3OYPA 3ATKA 1DXPA 1NPMA 4DGJA 3VG8A 3T29A 1C5QA 1QR3E 2ZECA 1Z7KA 1RTFB 1AVGH 4JCNA 4OS4A 4K69A 1NBMD 3OFND 2V3HH 2KX4A 4BTUB 1W0ZU 3LGIA 2FOCA 5A0BA 4XBDA 2XCFA 1HPGA 2A5AA 4E05H 3ZVBA 2BZ6H 4GVUA 2QF0A 3KQEA 3SNBA 1J15A 3NKKA 2Y82A 3LOXA 3MH6A 1HRTH 3QGNB 4AGJA 4CH8B 1P09A 5AVDA 1BMLA 3M3SA 4Y79A 1SSXA 2ZTZA 1E34B 3RM0H 1ELVA 2ZU1A 3Q3XA 4XOJA 2FI3E 3VB4A 2QXIA 5EW1H 3GCOA 1QGFA 2D2DA 1GBEA 3VGCC 1SQRA 2FESH 1GBJA 1TRMA 4RI0A 3SJKA 6LPRA 1ZHPA 1DY8A 1S83A 3OE7D 3SJIA 3H09A 3F9HA 1CHOF 1AKSA 5H4IB 1LPGB 3VEQB 2DE9A 3V13A 2LNCA 2BDCA 1VITH 3O8RA 1T7CA 1BT7A 5GWZA 2VIDA 3DSGA 1RXPA 2OQ5A 1MTUA 2M5TA 1CA0C 3VXFH 5C67A 1L0ZA 2Y5HA 4JZIA 3N7OA 2CHAC 1ESBA 1AHTH 5FBIA 1P3CA 1UVSH 2YOLA 1W3CA 3RUOA 1E38B 2FX6A 1GI3A 1TBQH 4YOGA 1OWDA 4RKOB 1UCYH 1CHGA 1INCA 2J95A 4Y8YA 4K3JA 4YOIA 3U28C 3FZZA 1GGDB 1P01A 4FUIA 4MLFB 1ZPCA 1EQ9A 2ZQ1A 5EXMA 5BPEA 2QXGA 1P0SH 1HGTH 1TPSA 1Z8GA 2DE8A 5EJZA 3M3TA 3ZVEA 1NTPA 1O32A 3PRDA 4ZKRU 4NIWA 3UPEA 1TALA 3ZZAA 2GCHF 3FP6E 1ELAA 1AE5A 1C1SA 2HVXA 3UR6A 4X8VH 1GJ9B 1GHWH 1S6HA 4E7NA 4I8KA 1GHYH 3LU9B 3BEIB 1ZSJA 1KSNA 3AAVA 1P8VC 4UFGH 1G3DA 1SGPE 1UVUH 1JXPA 4ABAA 1LKAA 3LGWA 4WH8A 8KME2 1C5VA 5GCHF 5T6FA 1ESAA 1T4UH 2FI4E 3R3GB 3RXPA 3TIUA 3GYLB 2VB0A 5DK1A 2J98A 4FVDA 2XC4A 5DP7A 1YPMH 1LPKB 3F0OA 1J8AA 2ZTXA 3Q77A 2VBCA 1HAYB 1L4DA 2Y5FA 1DM4B 1P2MA 1WSSH 2F9OA 4J2YB 2VU8E 2ULLA 1FV9A 1UTPA 1BIOA 1YM0A 3FAOA 4MNWA 3ZZCA 5J4SA 1MKWH 1AIXH 5I25A 1O5DH 1AZ8A 2CXVA 5L30H 1EUFA 1JIMA 4FUDA 4GHQA 5A2MH 4LZ1H 1LHEH 2UUFB 2SGAA 3PLBA 1BRCE 3SU5A 3BF6H 3NXPA 1GJBB 5E2PA 4LOYH 1N8OC 2Z7FE 4UD9H 1W8BH 4JK6A 1THRH 3RXEA 2A2QH 1BB0B 1Z6JH 3AVZA 1HB0B 3F2GA 2SGEE 1XUKA 4M9FA 1RIWC 1BA8B 1O38A 1G30B 4ZROA 1EFRD 2PUQH 1D4PB 1ZPZA 2A1DB 2GT8A 4INKA 4INHA 3WWBA 1ZGIA 4I7YH 4ISIH 1OWIA 2G4TA 1LDTT 1K1MA 1ZRKA 2FOBA 3H7OA 2ZI2H 1MKWK 4X0WU 5EPYA 2J9NA 3DT0H 3N99A 2G5VA 1C4V2 2A45B 1TNIA 1UCYK 1A46H 1V2MT 1ZJKA 4K2YA 4P00A 3ZZBA 2FX4A 4YT7H 4YXWD 1GBTA 1YPLH 4WMEA 5DP9A 3LJJA 2WYGA 1N6XA 1C5LH 2HRVA 1C2LA 3ZV9A 1QFKH 1SGFA 3SU4A 1C1UH 2W3KA 5GNDA 5B6LA 1QB1A 1HAPH 4SGAE 3FKSD 3ZZ6A 2BLWA 2PKAA 2SGQE 2ZHFH 4NG9H 3ZYDA 1Q31A 3A8DA 3D23A 1MKXK 4GCHG 1LHFH 1ZMJA 1KXBA 2B7DH 4FU9A 4MQAA 1O3EA 5DP5A 3CS0A 1S0QA 1IQLA 2BB4A 4IN1A 3AW1A 1ZYOA 5EXNA 3MO6A 3U8RH 3VB6A 2P8OB 2UWLA 1VITG 7ESTE 4FUCA 1Y3WA 3WW7A 1YLCA 3F2FA 5FCKA 5G4BA 1H9LB 1SGFG 2SGFE 2WPHS 2V35A 2QF3A 3NZIA 1LO6A 2TRMA 3HGPA 4RT1A 1TYNA 3K6ZA 1AFQB 3UNQA 1C2EA 1GBIA 2ZPRA 1L1GA 3SO3A 1RTLA 1C2HA 1EJNA 1C1MA 2F9NA 1OKXA 1HLTH 3M5NA 3PMJA 2FLRH 1FAKH 2ANYA 1O3DA 1O3CA 1TLDA 1DUAA 4XDEA 3RXIA 1NFUA 3A81A 1KDQA 3BTWE 3ODFA 3PWBA 4LXBH 4ZAEA 4GCHF 4NZLA 4B6EA 2A4GA 2O8WA 4Y6DA 3MU4A 2QN5T 4BANB 4F55A 2WPMS 3T2NA 1RFNA 3MH5A 1QRWA 5GDSH 3TJNA 3SUEA 2K8IA 5GXPA 5T1VA 4Y11E 2QE7D 1SI5H 2CF9H 5A8XA 2A7CA 1PPFE 4Q2KA 1DWBH 5A0AE 1E0FD 3VB7A 5HKKD 1W14U 1QA0A 1EJMA 2NWNA 2ANKH 2C90B 4JZEH 4ZKNU 5DP4A 3GY8A 5LGOA 4JZDH 4AZ2B 1EZQA 4FUGA 2GMTB 4I86A 4RN6A 3LGYA 1V2ST 1O5CB 4NFEA 4IMQA 4AFSA 1P2KA 1C5UA 1GDNA 5CE1A 2GDDA 4NWLA 2QF5A 4BNRA 2YMSD 5DJ7A 1QRZA 2Z6BD 3E91A 1MZDA 3S7HB 1HCGA 2FZZA 1UTLM 2FS9A 4MNVA 1GVLA 2PUXB 1VGCC 1O2WA 1CU1A 1P05A 4FUJA 1V2WT 1VCWA 5C1UA 2A2XH 1GJ8B 3AW0A 1P04A 2WPKS 1P9SA 2NU2E 4AB9A 1O3BA 1EAUA 2H1UA 1GI7B 4FVBA 4O9VA 5EJ1A 2WPDD 3A7VA 4CRGA 3ZZ9A 1S6FA 4WVPE 1XKBC 5GPIB 2G55A 3DD2H 2ZU5A 1BHXB 1PQ7A 2V0BA 2VIOA 3BTDE 4AYYB 1C5OH 4MPWA 1LHCH 2RDEA 4U01A 4HTCH 1O5EH 5C1XA 2FEQH 1Z1IA 3AASA 3SUGA 1SC8U 3RLYH 1E1RD 2BVSH 2PKSC 1THPB
chains in the Genus database with same CATH topology
1C5ZB 2GD4B 1QL7A 2I6QA 1KYNA 5JBBS 1MCVA 5HMAA 3UWIA 4U32A 2BQWB 1Z8RA 1GVZA 1E37B 1GWAA 1LMWB 1QB6A 4AN7A 1GI6A 2CV3A 2GT7A 2XWAA 4NA7A 1L4ZA 1FY3A 4X6NA 1C4U2 1B0FA 3R0FA 1FPCH 1TE0A 1HAXB 1ZOMA 1EZSC 1ANCA 2TGPZ 1CGHA 1GJAB 3S9CA 1AY6H 2OQUA 2ZGXH 3V12A 4TWYA 3SJOA 4I8JA 1GG6B 1Y3VA 3Q3KA 4FXGH 2XW9A 2HNTE 1MTVA 3SU1A 1L1NA 3KF2A 3LKWA 2QAAA 5GIBA 2ZFFH 4HI3A 3RXDA 1HAOH 2ASUB 1Y59T 1B7XB 2ODQA 2Q1JA 4XE4A 4NWKA 2CJIA 3CP7A 1F7ZA 3OSYA 4Y7BA 5FX6A 2Q6DA 1QBVH 5A09A 5C1YA 1HDTH 2BOKA 3NCLA 1C5XB 2AMQA 9ESTA 1QBOA 1Y5AT 4FUEA 5F03A 2C8XB 2RDLA 3RU4E 1DY9A 1SLVB 3A7WA 1YC0A 4JYUH 2QA9E 1GBLA 2ZTYA 2GP9B 3L3TA 4X2WA 3GCHB 3QTOH 1GHZA 3EAJA 3MNCA 2YNBA 2A7JA 1ELGA 1AN1E 2V3OH 1GBBA 1A3BH 2XBXA 4Q7XA 1C5SA 4FU8A 4JMYA 1MUEB 3FZDA 3ESTA 3HK3B 3QTVH 4RKJB 2BD4A 3FFGA 3PO1C 2D1JA 2VIQA 1S85A 3MU1A 4MPUA 1FLEE 4D7FA 5FHTA 3OY5U 1YKTA 1ZMLA 4X2VA 1ORFA 1AGJA 3DHKH 1TNLA 1TMBH 3A8BA 1K1JA 3QZRA 5EPNA 1GI2A 1J9CH 2YNAA 1QJ7B 2B9LA 5EOKA 1HAVA 1DLEA 1K9OE 1LVMA 1MCTA 2R3YA 2Z3EA 1VJAU 2C93B 1JMOH 2BY9X 4K5ZA 2BY8X 2B8OH 1XMNB 2XC0A 2ZU2A 2PFEA 1ZHRA 2BX4A 2J38A 3S9AA 4HZHA 2O8TA 1FMGA 1O2NA 4PROA 3M37A 2P94A 3LDXH 3HKJB 2BOHB 1GHVH 1P2NA 1GJ5H 1TB6H 4NCYA 3BTGE 4OGYA 3UWJH 3UQVA 1GMHF 2PKAB 4X6MA 7GCHF 1HXFH 2XYAA 1MAXA 2TIOA 3QLPH 4LZ4B 4BAKB 1A0HB 1KLJH 1A7SA 1GVKB 1FY1A 1ELBA 2EC9H 4B2BA 1Z8IB 2TPIZ 1FY4A 1BZXE 4CHAC 4Z6AH 2FOGA 1WYKA 2BD5A 2ZFSA 5HM2A 2O9QA 2XBWA 1O5FH 5FBEA 1WOFA 1WTHD 4IGDA 1NRQH 1SVPA 3VPKA 1OP2A 1C5WB 1AWFH 3QO6A 1C1NA 2PSXA 1ANDA 1NROH 1O3GA 2RA3A 3H7TA 3M61U 4WH6A 2C8WB 1GG6C 1HFDA 1YPJH 3EA7A 5LPEA 2A0QB 1BBRE 1KXAA 1GBAA 1P2OA 2IPHA 2GX4A 2XCNA 4GHTA 3E3TA 5JB8S 4X6PA 2HNTF 3S0NA 1SQTA 3VFEA 1UCYE 3SGBE 1RIWB 3KL6A 1O2XA 1TOCB 1Y5UT 1KTSB 5JPMH 2SGDE 1ARBA 2BQ7B 2ZFQH 1TPOA 1DE7H 1TQ0B 4UFDH 4X1QU 1O2TA 2R2WU 1OP8A 5FPYA 3M5MA 3RXOA 1QQUA 4HFPB 1AD8H 4B2AA 1GI5A 5LPRA 4MTBA 3UR9A 1CGIE 1PQ8A 3ZZ4A 1C5PA 1BTZA 5E2OA 1AU8A 3KQCA 3F6UH 3GY7A 2AFQB 1A5GH 2THFB 3GY5A 2QY0B 4UONA 2B5TB 1XXFA 4MNYA 4B1TA 1KIGH 1SG8B 1LHGH 3NUMA 2ILNA 1CT4E 3SI3H 2XBVA 3GY6A 2SNWA 3PROA 5AFYH 5HGGA 2FIRH 4CBOA 2STAE 1Y3UA 3MO3A 5E0GA 3M35A 3PWCA 2CHAB 2H9TH 3E8LA 2Z9IA 5T3HA 5C5OA 1P9UA 1J17T 2RA0A 1GBKA 3SN8A 1T31A 3TJVA 4BXWA 4WJG2 4AORA 1XXDA 1NT1A 4B74A 4UDWH 4ISHH 5L2YH 3M3VA 1C5RA 4NSVA 3PLKA 2ZDMA 1B0EA 1F2SE 4BXSA 2KAIA 3U1IB 3BTTE 1IQEA 3RXMA 2BD8A 1EOJA 3QWCH 1GHBF 4DOQA 1E35B 2OBQA 1UVOA 2ZA5A 4LK4A 4IBLH 1FN6A 1WU1A 3MU5A 2PGQB 1IQHA 1OWKA 2FYQA 1GMCG 5JBAS 4BAMB 1LHDH 1TBRH 5DP6A 3P70B 2Y7ZA 1AE8H 2O8MA 3MYWA 1VCQA 2BD7A 5JBCS 2G5NA 1IQNA 5A8ZA 1QNJA 1YPHE 4F49A 4UE7H 1Y3YA 3OX7U 1QL9A 1T8LA 2FPZA 4X8UH 4ABEA 3P17H 1AB9C 4E7RG 2Y5GA 1C1PA 2UWOA 2OP9A 1ETRH 1D9IA 1O2SA 3TVJB 2Q6GA 3RXCA 1P03A 1AZZA 2JH5D 1C5NH 1BJVA 4WWYA 5DG6A 1LPZB 4AB8A 1GBDA 1DXWA 2BD9A 5I46H 1FY8E 4YOJA 2BYAX 3BTFE 1QB9A 1NY22 5DP3A 2VIVA 3HKIB 2ZHEH 4JK5A 2HWLB 1AB9B 1O2PA 3E90B 8LPRA 1A3EH 1W11U 1PFXC 3F9EA 3LGVA 1C1RA 3UUZA 3M7TA 2SGPE 2PGBB 1WQVH 5EQQA 4BTIB 4JYTA 3QUMP 3SI4H 1W7GH 1MQ5A 1HAIH 1C9TA 1BCUH 1GJDB 4K1EA 2F9BH 2OC8A 2QCYA 3SHCH 1O2HA 1GDQA 3QDZB 1B5GH 1IHTH 2GGVB 2Z3CA 1BTHH 1V2VT 4Y8ZA 3UTUH 1DWDH 1K2I1 2J94A 4VGCB 1C9PA 2ZHQH 3A85A 2PTCE 4MNXA 1W12U 2WINI 1NFXA 1W7XH 1XUGA 1ANEA 1F5RA 1CVWH 4ISNA 3U8OH 3DFLA 2R0KA 5HM9A 1ELFA 1QHRB 3BG4B 2H5CA 1A0JA 1F5KU 4ZUHA 3RC6A 1V2LT 5JBTA 5ABWA 2J2UA 2ZPQA 4X2YA 1OS8A 3RXFA 3RU4D 3SOSA 1G32B 3BTME 3O8DA 1TQ7B 3UNRA 3P95A 1ELTA 1WQSA 5HXFA 3A8AA 2H2ZA 2WUBA 1CO7E 3OTJE 1KXCA 4CREA 1CBWC 1LVYA 4XSKU 3GCTF 2J92A 3PMAB 5GJ4B 1WBGB 4Z0KA 4AFQA 4INLA 1A5IA 4YZUA 3BTKE 3P6ZB 2A32A 3ZZ5A 1O37A 2Y7XA 2ALVA 4XBCA 4K60A 4I8GA 1N8OB 3ZV8A 3M5LA 3RLWH 3S9BA 4U2WA 3O8CA 1G9IE 3TH2H 4A6LA 2STBE 5ESTE 3KN2A 1SOZA 1O3AA 3V0XA 1W2KH 2GV7A 4JZ1A 5DGJA 2ZHDA 3E0PB 1YCPM 2Y80A 4I8HA 1WV7H 3EYDA 4IW4E 2EA3A 4BOHA 1XUHA 2C3SA 3NPSA 2ZHWH 2ZU3A 4A1TA 3V3MA 1TGNA 2XRCA 1IQGA 5IDKA 1GCTC 1EJAA 1BHXF 4GUXA 4K8BA 3IITA 2WUCA 1L2EA 4MVNA 2GDEH 4F4OC 3W95A 1SR5C 4TPYA 3SUDA 4H6SB 3QK1A 4I31A 1ZGVA 1SGIB 1AVWA 1HJAB 1SFIA 1UTMA 4QT8C 4UEHH 2ZNKH 1UO6A 5L6NH 2O8LA 4A1VA 3LGTA 9LPRA 3EA8A 4ZKSU 1GJ7B 1KXDA 2BLQA 2F83A 1FXYA 2G51A 3GYMA 4X1SU 1RS0A 1ZSLA 1SQAA 1EPTC 1TPAE 3RXSA 2W26A 1MTWA 5E0HA 1TOMH 2ODYB 4KTUA 1AFEH 3A84A 2D26C 1FI8A 1PPBH 1NRRH 1K1IA 1V2NT 1AFQC 4D7GA 3MU8A 4SGBE 4TY7A 3AAUA 1UTNA 1ELDE 1EB1H 1W0YH 1DICA 1HIAB 1XVMA 1IQFA 2Z9LA 3LH1A 4H6TA 3RU4T 5SGAE 1SOTA 1BTXA 3TGKE 3TGIE 1RTKA 1O3JA 4AFUA 3ENSB 1P11E 4Q80A 3QZQA 2VVUA 4KP0A 4AG2A 4OS1A 3GDVA 2JKHA 4DJZB 6CHAC 1TA6A 5FX5A 3FP7E 3K9XB 1BJUA 1AUTC 3RXKA 3SW2B 4YTAA 1BTPA 2BX3A 1UMAH 2HPPH 2ZP0H 3KQBA 6ESTA 5GCHG 4R8TB 2IJOB 1DVAH 1HNEE 1Y3XA 1GCDA 1BUIA 5C5NA 2OXSA 1MZAA 1ID5H 1FZZA 2CF8H 2ZU4A 1HAGE 1IHSH 2FTLE 3F9FA 3LPRA 1LKBA 3U69H 3RP2A 5TCCA 2ZQ2A 3FP8E 1TX7A 1FQ3A 1V2JT 5TCAA 1H9IE 1HV7A 3ZVAA 1AUJA 1K28D 1KDQB 3BEUA 1YCPH 4O97A 4TY6A 2FDAA 4X8SH 1C5TA 1V6DA 3B9FH 4DT7B 5ETXA 5ESBA 1ZJDA 3SV6A 4AGKA 3T25A 3MTYA 3PTBA 3VGCB 1NRNH 3DUXH 1P06A 2VJ1A 2Z9KA 1NESE 2P16A 2BY7X 1UHBB 2BHGA 1MAYA 4Q7YA 3FANA 3ZVFA 2ZFRH 1UK4A 4X1NU 3SU3A 2G4UA 4IC5A 4RSPA 1DPOA 5EG4A 3GCNA 1BMNH 1UJ1A 2ZPSA 3GY4A 5K0HA 1CHOG 2K1QA 1IQJA 1PPGE 1TONA 6GCHF 1C1OA 4O3UA 1THSH 1EP6A 1X7AC 5EQSA 4I8LA 3U8TH 2GCTB 2PKSB 2FODA 2HNTC 4MDSA 4OS2A 2VWOA 1TGSZ 1G2LA 1FIZA 1RD3B 1ZZZA 3UFAA 3TGJE 4DW2U 4D76A 3LH3A 1DDJA 4X8TH 1TABE 4ABDA 1C2FA 3UOPA 1CSOE 1GJCB 3KHVA 2VH6A 3C1KA 5JYIA 1EAWA 1M9UA 1P12E 4HGCA 4ZXYH 2B0FA 2RCEA 1TFXA 1O5GH 2P3TB 2F9PA 4M7GA 1O3LA 4I33A 3MU0A 7LPRA 3LIWA 1GPZA 4MPXA 2BM2A 1O3MA 1DUEA 3V7TA 1ELEE 1G3CA 2ZDLA 1GI4A 1S5SA 2XXLA 3RM2H 3RMNH 1GHAF 2JH0D 1U6QA 1ZTLA 5AHGH 2ODPA 4ABGA 3A7ZA 5C20A 1GHBG 2GMTC 4NZQA 4ZKOU 3BG4C 4D9QA 1P2IA 1LVOA 1CQQA 2GZ7A 2ZZUH 4GSOA 2TBSA 1GHXH 1MBMA 1DWEH 1TA2A 4YLUA 1ESTA 1SL3A 2ZFTA 4Y10E 1GDUA 5FCRA 3B23B 6GCHG 1MMJN 4ZMAH 3GOVB 4ZHLU 4WMFA 3PLPA 2VGCB 2ZGCA 3TJOA 1VGCB 4WY3A 3URCA 2VWNA 3HGNA 2NU4E 1JIRA 2R3UA 2P8OC 2FOAA 4D8NA 1J16A 1V3XA 1HXEH 1KTTB 1ZTJA 4FUBA 1EZXC 1DFPA 5AFZH 3SGAE 1PQAA 3SNEA 3MHWU 1AO5A 1L1JA 4WF8A 1OXGA 2P95A 2R9PA 3CS7A 2ZG0H 4ZH8A 2VWLA 4KKDA 3UNSA 2GVFA 1VJ9U 3MO9A 4GAWA 1TGTA 4GLYA 2OD3B 4B2CA 3GICB 3L6PA 3UQOA 1D6WA 2PTNA 2ZO3H 2NU1E 1O3KA 2FYRA 1BMAA 3U98H 1KXFA 5BRRE 3STIA 1DITH 1PJPA 5CHAB 1ANBA 2A31A 2F9VA 2ZDVH 4WXVA 5DKMA 5A8YA 1RRKA 1XUIA 3PB1E 3A89A 1GI8B 1LVBA 3BIVH 1HAVB 1AKSB 1XVOA 1MKXH 1ZSKA 1BQYA 3A86A 1O3IA 4BTTB 1TRYA 2FP7B 3K6YA 5T6DA 1SHYA 3RXBA 2BDAA 1DSUA 6CHAB 2Z3DA 1PYTC 1YP9A 5TJXA 2UWPA 5DO4H 5JDUB 3GDUA 1BRUP 1C2IA 3SV2H 4Y7AA 1NC6A 3KQDA 4ISOA 1EATA 1K21H 1SGNE 2GKVE 4AOQA 1ACBE 1O36A 1ZMNA 3VB3A 1C5YB 1BDAA 1OYTH 1OWHA 1SGEE 5EODA 2BZAA 3C27B 2C8YB 2ZEBA 1UTKA 3UOUA 4CRDA 1O3HA 5EW2H 1HIAA 4YLQH 3P8OA 2BY6X 3ATIA 3STJA 3EDXB 1QURH 1GI0A 1O3NA 4YM9A 2FWWA 1EP5A 2BDIA 1A5HA 1QA7A 2DUCA 2UUJB 1LQEA 2ZGJA 1J14A 1ZTKA 3D62A 3GISB 2AYWA 1UTQA 1BRAA 1O39A 1O3FA 3TK6A 1S84A 2BXUH 1QIXB 3PYHA 2FS8A 1UVTH 1YPHC 2AIPA 1SMFE 4ZHMU 1O2YA 3WY8A 2PR3A 3LGUA 2WPLS 5DPAA 3FVFB 2CGAA 1H9HE 3P8FA 1TNGA 3SU6A 4ISLA 3UIRA 1MBQA 4ASHA 4X2XA 4X6OA 3E16B 1OX1A 4ABFA 1HUTH 2A5KA 2GV6A 2F91A 2BD3A 1SB1H 1P2QA 1O0DH 1PQ5A 1BBRK 4CRFA 5F8TA 4OS6A 4GPGA 2BMGB 5EU8A 2ZKSA 2IN2A 1D3TB 3QX5H 1H8DH 4CRBA 3RXRA 3MH4A 1GMCF 3SQHE 4ESTE 1FPHH 1GI9B 1RGQA 2H9HA 3ZZ7A 2XWBI 3EGKH 5CMXH 5F6MA 1TGCA 1SLUB 1GBHA 1DS2E 5B6OA 1SLWB 2LPRA 1K1OA 1UHBA 3GY2A 2PSYA 1SGTA 3ATWA 3TJUA 3L33A 3K2UA 1ZR0A 3PM3A 1BTWA 2VGCC 3NWUA 4XBBA 1NFYA 1MTNC 1WAYB 3DFJA 3BIUH 3LC3A 2G8TA 4TYDA 1NU9A 1TX8A 3BTEE 3TU7H 3W94A 2BDYA 1YPEH 4U30A 1TIOA 1TMTH 2CN0H 2BY5X 2J34A 3I78A 1C1TA 3TLOA 3SNDA 1T8MA 1AWHB 1SFQB 2QIQA 1HAHH 2VINA 1O31A 1O2IA 2WPJS 2TGAA 3JZ1B 3F68H 1QL8A 1T32A 2BDGA 2BDHA 2CMYA 1O2JA 3ZZ3A 1EPTA 1F0TA 2BXTH 1RJXB 8GCHG 3A7YA 3BG8A 1FDPA 2ZGHA 2ZGBH 1C4Y2