1F0YA

L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and nad+
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequestration of the active site by interdomain shifting. Crystallographic and spectroscopic evidence for distinct conformations of L-3-hydroxyacyl-CoA dehydrogenase.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-3-HYDROXYACYL-COA DEHYDROGENASE
total genus 116
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1f0yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1f0yA01
4ALMA 2Q1SA 3QJ5A 2F1KA 4R5HA 3FNHA 4PG7A 2DAPA 3VPHA 3TJRA 1RPNA 3U09A 4B8ZA 4ND2A 1PL6A 3CUKA 1I3NA 4WK6A 4ITUA 1JU9A 1C0LA 1WMAA 1HE4A 5A05A 2WDZA 4JX8A 1NBOA 2OBNA 2VYND 3PLRA 2NACA 4TRJA 3WB9A 4GSLA 4N7RA 4R9SA 4TVBA 2VWPA 4Q3NA 1LLUA 3DOCA 1E3EA 1OFGA 4BNWA 5KWEA 2CDBA 1BXGB 4O5OA 5L40A 1H6AA 1OZAA 4W6ZA 5G2OA 3BMNA 1HYGA 5DP1A 1N1EA 1H6BA 5IJZA 3H7AA 4D46A 2WD8A 3C1TA 3PWKA 4RLSA 2ZB7A 3DEYX 2HMSA 3Q2IA 4Q3BA 2NM0A 3D5QA 1TB4A 4XZ3A 3CZMA 4E21A 5JW6A 2C82A 1B8UA 2EF1A 4R41A 4TZTA 4CJXA 3IKTA 1DHTA 1TT5B 2OUIA 2HJRA 1CEQA 3C7CB 3NTOA 5JSFA 1I10A 1BTOA 2YYYA 5FF9A 4UVIA 3KZVA 2FWMX 4E5PA 3RJ5A 3E5MA 4HKTA 2AXQA 3OBBA 4GH5A 4L74A 4LRSB 3DZKA 3CMMA 2E48A 3MOIA 2VTEA 4XYGA 2Q3EA 4GI2A 3D3EA 1YDEA 2X0IA 3MEQA 3KBOA 3PJEA 1NQOA 1BDBA 1P1KA 2VWHA 4UUPA 2FP4A 3G17A 1YGYA 4P4LA 5JYEA 3ZHXA 4HV4A 3ZHYA 2B4TO 4BV9A 1ZUD1 4P4NA 1LSOA 2JL1A 3MWDB 1YRLA 1JWBB 4OHUA 3HDJA 1PJSA 3ZU5A 1NPDA 1YQGA 2J6IA 2ZCUA 5G0SA 1XQ1A 3E9NA 2ILTA 3RUAA 1KVTA 3M2PA 1M75A 3QWFA 4YT4A 2OL4A 2CDCA 4IJVA 3KRTA 3TOZA 1QXSA 2HMVA 4ND4A 4CQLA 3MTJA 9LDTA 4GL4A 2JD1A 3LZ6A 3WSWA 5IAAA 1EDZA 4EEXA 1R12A 4ZJUA 3E1KA 5B1YA 1WW8A 4GX1A 5JAIA 5TX7A 3JQ8B 1QV6A 3CPSA 4GMGA 4IDGA 3T7CA 3H8VA 1QYWA 1ISGA 1J49A 4KUGA 4LSMA 3WIEA 2C5AA 3NV9A 3E6AA 4GKBA 4NK5A 4IDAA 2O2SA 4PLTA 1CRWG 2XXBA 1CJCA 1GUZA 3RC2A 4BGIA 1Q0QA 2I67A 1T2CA 1Y9EA 3QWBA 1O89A 4ZVVA 2Q2VA 3WGTA 5JXWA 3F9IA 4XGKA 2HUNA 2W2LD 5U1PA 1HTBA 2VQ3A 4FN4A 3HB5X 4NH4A 5JAZA 2X9VA 3D3WB 2ZTVA 3E9MA 2VZ8A 4TSKA 5H82A 2OO5A 3ETGA 2IEBA 4CMBA 2WE8A 2GGSA 2DTDA 4BL5A 4BUCA 2JFFA 5DZSA 2H9IA 4BQPA 3PEFA 4YRBA 1GZ4A 1C3VA 2PNFA 5DBGA 3C24A 5HTOA 4DBVO 4E0BA 5KOIA 4FJ0A 4E5KA 3SX2A 4CM4B 3UCXA 1NWHA 1I3KA 4ZRMA 3WG9A 1Q7GA 3DAGA 3Q9UA 1K6IA 4RVUA 1BSVA 1DBVO 4QEDA 1PZHA 1D1TA 1U3VA 2PV7A 1I01A 2P9CA 1HDCA 2OORA 2VZ9A 2DFVA 2WYVA 3B6ZA 1YBVA 2JAPA 4YT5A 1UZNA 2BD0A 4HNHA 1JAYA 3DWFA 1DFGA 4I5FA 1DJNA 4I5DA 3ZWXA 3RUCA 5DNAA 3G0OA 2HMTA 3TZHA 4I5GA 3KYDA 2VT3A 2WYUA 2JCVA 3U4DA 2Y67A 3UFXA 3O03A 3N7UA 5KVSA 3A06A 2C2XA 3ROMA 3ZV3A 4F3YA 2HO5A 4CR8A 1VJTA 1ZIDA 1IL0A 1IPEA 1F06A 4IPTA 1EQ2A 3PJGA 1DFIA 3OQ1A 2DT5A 5CPFA 1W0CA 3ADPA 5C7LO 4AJHA 4PG8A 2E49A 2JHFA 4PLGA 4LVCA 4MIOA 1LEHA 4DIOA 1HXHA 3S2IA 2B5VA 1LJ8A 2VHXA 4K1LA 1ENYA 1E6WA 1GUFA 4TRNA 1WXDA 4E33A 1HYEA 4CMJA 1XWFA 2BRUA 1H2HA 4E3ZA 4XJTA 3X2FA 1EUDA 3VH4A 5T57A 4DRYA 1PEDA 1G0OA 3U4IA 1Y9AA 4AJEA 3FNGA 2CY0A 4NK4A 2HK7A 3EUWA 1GDHA 1E7RA 3O9ZA 1ZXLA 3RUIA 3QW2A 3GHHA 4JP3A 1SO8A 4R16A 4AICA 2A35A 4Z3KA 3ZHBA 5MGBA 1K0UA 2GDZA 4MVJH 4IIVA 1E3IA 1EEHA 1MG0A 3NEPX 4RL6A 4B4VA 1HL3A 3MZ0A 4TRMA 3F4LA 2PK3A 1LC0A 1HDRA 1Y8QB 3WQQA 2FZEA 3I9NA 3UCEA 3AM4A 4E2XA 4L9RA 1ZCJA 1N7GA 1A72A 1CF2O 3D4PA 4R68A 3QWAA 2J3IA 3GEMA 4XRRA 2DC1A 2JD0A 2VNSA 2VYVA 1X13A 3MJCA 2GO1A 4NG5A 5CEJA 1VJ0A 4BGVA 1J6UA 3NDRA 4B4WA 2ZB4A 5BSGA 1K2WA 3P7MA 1WZEA 2YV3A 3WGGA 3QVOA 1U5CA 5ILOA 2OP1A 3OJ0A 3ICCA 1Z6ZA 4S1VA 1Y6JA 3JD3A 1U5AA 1FF9A 3FHLA 1BG6A 3HG7A 4IIUA 1BXKA 4M54A 1ZSYA 5KIAA 4E30A 1K3TA 4Y98A 4UAGA 3PYMA 4GX2A 1WP4A 4XYBA 1BVUA 5CDTA 3IOYA 1F12A 4CM7A 3UF0A 4Q39A 4AJKA 4PLZA 5TGDA 4OQYA 4GVLA 4R9RA 3WBFA 5CG1A 2G5CA 1ZJZA 1YXMA 3QLJA 3C1AA 3DOOA 5DF1A 4FIZA 2DTXA 2C2YA 3KSZO 4LK3A 5J23A 2GCGA 3U3XA 3MWEB 4D41A 2I99A 4BO0A 4XQEA 3MJ4A 3WJAA 3ZWOA 5KTKA 5IG2A 3W1VA 2W8ZA 2VZ0A 1BHSA 4YJFA 4A73A 3ZDFA 5BR7A 2FN7A 2XF8A 1ADGA 4CMIB 1PZEA 3IP3A 3K5PA 4QFDA 3DBHA 3GA0A 5JDCC 1Y81A 1AE1A 1ZFNA 3DBLA 3KXDA 3TQHA 1GYPA 3RIHA 3U4CA 3LC7O 2Q99A 2QRLA 3AY3A 4DIFA 4QO8A 4W4TA 4ZHSA 4J9UE 4I5EA 4J7UA 1EK6A 4E2YA 4BNYA 3CXRA 3IJPA 3IQDB 1I2ZA 3AUTA 4AJLA 4CM6A 4FGSA 3R0IA 1PL7A 1EMDA 1LSJA 1XU9A 2ZYDA 2VT2A 4BNIA 1I5RA 2DPHA 4GX5A 1H9AA 4KDEA 3JQ6A 2EKLA 4BMVA 2AG8A 1E77A 1Z82A 4HFRA 2Y1DA 2C29D 3SC6A 1DLIA 1PZGA 3ZWBA 1PS8A 3ZCXA 4DUPA 4NU5A 2IXAA 2LDBA 4BNZA 1P0FA 5IXSA 3EY4A 3WS7A 1QYXA 4WKGA 6LDHA 4DVJA 1M67A 4DLLA 1NNUA 2V7PA 4XWYA 3I6QA 1OBFO 3DONA 4J9VA 1XA0A 2FHSA 1Y8RA 1WPQA 2Y93A 1RWBA 3VPGA 5BT9A 4Y8VA 1ULSA 3P2OA 4GGPA 2EWMA 4R4JA 4E12A 3RUHA 4X54A 5TJHA 3P5SA 5CPBA 2C59A 3IC5A 3FR8A 1WWKA 3E18A 5ER9A 7ADHA 1HT0A 3PYXA 4ZQFA 1GEEA 5HWSA 1LLDA 3PWZA 3U9LA 5CDYA 4OJNA 4ZA2A 3PTZA 1YL5A 1PS0A 3PQEA 1P1FA 4DC1A 2V6FA 2NLOA 1Q7BA 1KEPA 2FOIA 1LXCA 1JVBA 1TI7A 1W4ZA 1GTMA 3ZU3A 2NSDA 4BO8A 1KVRA 3I9MA 2VUSA 1DEHA 1EBUA 1JA9A 3KHUA 3BMOB 1FJHA 3GGGA 4CMEA 4CQMB 3TFOA 2RBEA 1E3SA 1V6AA 1EFKA 1LI4A 4OQZA 5GMOA 4KOAA 3GZ4A 4BMSA 3PZBA 1CWUA 4XIJA 3DBHB 1F14A 4XIYA 4Q3EA 2VRCA 2NUAA 2GERA 3GR6A 4I8XA 5DULA 3D7LA 4XR9A 4R54A 5FI3A 4YXFA 1B16A 3QV1A 5EN4A 1G0NA 2HK9A 1YOVB 2NTNA 1ZNQO 3RJ9A 4CMKA 1KEWA 1KIFA 4B3HA 5F1OA 4CL8A 2NTVA 1YDWA 1S7CA 2PR2A 1VSUA 5TT0A 4Z9FA 1UXJA 1KVSA 1GU7A 4FPXA 4BKPA 3VVCA 4PZEA 4MVJP 4IZHA 3IP1A 4CUZA 4NDNE 4HNGA 1PJ3A 3RVDA 1FDWA 2ZK7A 3F6YA 1GYRA 3S1LA 3GG9A 3RI3A 4YEDA 2X8LA 1B3BA 3A4VA 2RCYA 1E1LA 5EQDA 1VSVA 2X22A 2X9NA 2DLDA 3JQBC 1M66A 3MJSA 5L53A 3BTUA 3GPIA 3WGIA 1PWZA 1PX0A 1GQ2A 1C1XB 5JY6A 1NFFA 3H5RA 4D3FA 2Q2WA 4FFMA 4EITA 4MINA 4QO7A 5JCJD 2E82A 2PY6A 2ZIZA 2O3UA 4WLFA 1N1GA 1VE9A 4RVSA 1I2CA 1UXIA 2NADA 4DYDA 3ITDA 2W2KA 4GKVA 4Z0PA 1ULUA 1CERA 3O4RA 2Y1FA 1FXSA 2O3QA 1SZJG 1QR6A 1A4IA 3PI7A 2D0IA 1PQUA 4K9DA 5A9SA 1PSDA 4PG5A 4R3NA 5ITWA 2WMDA 4U8GA 1DRWA 4YA6A 2CVQA 2ZQYA 3VKVA 4NBVA 2G1UA 2IDZA 1YVEI 4XDYA 3PFFA 2I9PA 3GC6A 3H9GA 4BIIA 5DP2A 3NYWA 1VM6A 4YACA 4ROSA 5HM8A 3GN1A 4DBZA 1DHRA 4O1MA 5DN9A 3ZNQA 1IE3A 3OIFA 4BNJA 4BKQA 4BNMA 3KLMX 4DGSA 4CLXA 1L1FA 2CDAA 2C7GA 3D0OA 3AWDA 3LK7A 1NFRA 4BNTA 2CFCA 3FWNA 4NIMA 3I52A 4FDAA 4UUNA 4HY3A 5F21A 1X1EA 2CF5A 1SPXA 4MJLA 3ROKA 4WEOA 5K9ZA 2Y0DA 4UULA 1YO6A 2VTDA 4YBZA 1K6XA 5A04A 2YY7A 1PJCA 2BFAA 2EJVA 2EHDA 4WEQA 3V2UA 1NM5A 2AMFA 3GEDA 4OOFA 5JCXA 4RORA 4IZIA 2PGDA 1Z74A 1UDAA 1LRKA 1IULA 2O7SA 2O3JA 3K2BA 3QIVA 1NFQA 4IQ0A 5L7YA 5CFZA 2J5RA 1T4BA 3HFGA 3K73O 2OGUA 3MJVA 3VZSA 4FBGA 2D8AA 4U6SA 1I36A 3UHAA 3S8MA 1EUZA 1R37A 3M1LA 3F4BA 1SMKA 3TN7A 4FR5A 4QFCA 5FEUA 1AGNA 3QVXA 1MFPA 1P1JA 2HSDA 3VKUA 3GMDA 1DO8A 4N5MA 2UUPA 2XOXA 3WOHA 4JIGA 4YTEA 2RIRA 3C85A 1X1TA 1TEHA 1C1XA 2ZCVA 3ZNNA 3IAHA 7MDHA 4JLWA 1FDVA 3F5SA 5TSDA 3KLPX 1PL8A 2VUUA 2AE2A 2BGLA 2D2IA 3C8MA 3EVNA 4JCOA 4MOWA 4JROA 3P19A 4J4BA 3UH1A 4PZDA 1ZW1A 3HDQA 4YB8A 5T8KA 4CR7A 1AHIA 1ZXBA 4BGEA 4L75A 1V8BA 4NJMA 2QW8A 1A27A 4K28A 4NFHA 3ICPA 4WGGA 5I9LA 4W99A 4UVHA 3FR7A 5KKCA 3AI2A 5A02A 1H5QA 1TXGA 1P31A 4BGUA 1P0CA 2I66A 4WLNA 2EW2A 1DIGA 5GZ6A 4IM7A 4DQXA 4YYZA 2PKQO 3OECA 1NHGA 4CM3A 1LSSA 1U4OA 3GOHA 4RPKA 1PJTA 2OBYA 5BNIA 3RFTA 2Y05A 3ZV6A 3AU9A 3LC2O 1UDBA 3LT4A 1ZBQA 1UAYA 2HRZA 4HFMA 3TF5A 2PFGA 3ZWPA 3VDRA 2PLAA 4CV1A 3RUEA 1LA2A 3IMFA 1MP0A 1LDGA 1OI7A 4NBUA 3KVOA 3R3SA 4IJWA 1Z75A 3NJ4A 3FN4A 3TL2A 1GQQA 4HUJA 4NNJA 4IQGA 3DZGA 5GZ3A 3KO8A 2J3HA 3FNEA 3PIIA 4OXYA 4A03A 3DBLB 3G1TA 3Q9NA 5F5LA 4J2OA 3D64A 1SEPA 3IL2A 2PGJA 1ZVMA 5I8WA 2X0RA 1MXFA 3R6DA 3QHAA 1V3TA 1XGKA 2FZWA 2GD1O 4LN1A 2VWGA 2BI8A 4YJFB 1ISJA 1RM0A 3KV3O 3DZHA 3BXXA 1F8FA 2QG4A 1VC2A 3A1NA 1I2BA 4FFNA 1FMCA 1HZJA 1PWXA 3ETDA 1B26A 3K31A 1PJBA 4FGWA 1E1MA 3COSA 3ITKA 2QIOA 3JQFA 5BSEA 4CLRB 1XSEA 2YV1A 3V5NA 4YAIA 1PR9A 1LX6A 3C1OA 4BO4A 1ISFA 5CDSA 3ZH2A 1OC2A 4M86A 4RF5A 4DYVA 5KCZA 1YE3A 2RHRA 3G3EA 5CDGA 5K6AA 2P4HX 1DPGA 3GAZA 3PWSA 3VZRA 3RAJA 4U0JA 3ORFA 1EVJA 1LQTA 4G5HA 3LSYA 4Y6SA 4RPJA 4C4OA 3KOUA 5JNLA 4BO6A 1H2BA 3PPIA 4EUEA 2X9GA 1GCUA 3VH3A 3DAPA 4BB6A 3QY9A 3KYCA 4J3FA 4OAQA 3TOXA 1JKJA 4RVGA 3AK4A 1FK8A 3G79A 1E5LA 3CE6A 3OJEA 3AM3A 1UUFA 3EMKA 4OO3A 5BSFA 5KJFA 1FDTA 1NAHA 4PG6A 4OXKA 3DAFA 2VN8A 2DKNA 2NU7A 4I9UA 2WE7A 5AYVA 2B83A 3H9QA 3OIGA 4IDEA 3GVCA 1DDOA 3VPXA 3T7EA 4FFRA 4W9NC 3BMNB 1KVQA 5FYDA 3PFWO 3B70A 1YH3A 2DU8A 3V1YA 5A1TA 3EHEA 1LDEA 1NX6A 2Q4BA 2HU2A 2R2GA 3OA0A 2UVDA 3I1JA 4NFSA 4YJGA 1R4NA 4IBOA 1MX3A 1LBEA 1YJQA 1E7YA 3E82A 2AQHA 1P74A 4Z3DA 4XGNA 4RQTA 1ID1A 3INRA 3OM9A 3K9QO 1N9GA 2NWQA 1U3WA 2H63A 4RZHA 3PIDA 4ZN6A 4FFLA 4GSKA 2DBVO 3WLEA 3I9JA 2ZKLA 4AJPA 5KJCA 3WGZA 2CZCA 1PQPA 1BW9A 1WNTA 3R3JA 2AEJA 4UEKA 3LLVA 1GPDG 3OH8A 3WMXA 1ML3A 4EUHA 1XG5A 1MFZA 3Q1LA 4DA9A 1BRMA 5L51A 3V1TC 3UVEA 3BTSA 4ESOA 4DQUA 4GLOA 3K2EA 1U9JA 2O2YA 3C3XA 3S2FA 3WWYA 3PJFA 1HEUA 3RCBA 5TLSA 4DQVA 5JLAA 4P8RA 3FBGA 1XEAA 2PZLA 2ET6A 4NQZA 5ILGA 3LQFA 4UVEA 3NGXA 4PGFA 4RLHA 4TKMA 2X7HA 2UAGA 1ZK4A 3ASUA 3F1LA 3PHLA 5DDIP 3CINA 3RUDA 4BNGA 5THQA 3WJ7A 1DC5A 2ZJ1A 1E7QA 5ES3A 1YJ8A 4YJDA 1E6EA 1M6WA 1AHHA 4GWGA 2PZJA 4PLWA 1EBFA 1GZ3A 3ZZNA 2A9FA 4KWIA 1R66A 1PR3A 3DC2A 1XR3A 5IDXA 3GFGA 1Z7EA 1E3LA 2I5PO 2X0JA 3GVHA 2PWZA 3VHRA 3NTQA 1IHYA 1KETA 1SCUA 2EIHA 2WJPA 1GUYA 3FTPA 5A3VA 4AJOA 3RC9A 3JQ7B 4MDHA 4O0LA 3TZKA 5F3RA 4JGBA 1QP8A 2O3SA 4F6LA 3F5QA 1HSZA 2QZ9A 1LDMA 2DFDA 2CNBA 1QLHA 3GRPA 3TZCA 3H5AA 4NJOA 1ZEJA 2IE0A 1BXGA 1IZ9A 4RPHA 4YT8A 3CIFA 4IINA 4EEZA 2W98A 3HQ4O 2FSVA 3STHA 4BNNA 1QG6A 4DIBA 1A5ZA 3NGLA 5G0UA 5L95A 2P5UA 2R6JA 3GDOA 1UDCA 3D4OA 4DREA 1IZ0A 4IS2A 4RGBA 4HBGA 1YB1A 2XAAA 3WMWA 3P2YA 2VYNA 4J6FA 4K6FA 1B2LA 4DLAA 3PHGA 4IGFA 4BNXA 1N9GB 2G17A 5CEFA 3DL2A 3L9WA 4CLDA 1V35A 2IZZA 1DC3A 4Z0HO 1XIVA 1B8PA 2GSDA 1D8AA 1HRDA 1SNYA 3NTRA 2FRDA 4PRKA 2X86A 1LDYA 4GAEA 1QKIA 4F46A 3AFMA 4C7JA 1DOHA 3NKLA 2NVBA 3NDJA 1VL8A 1V3VA 1TVEA 4WE3A 3GT0A 4OKNA 2PKQP 4PRLA 1GAEO 3PRJA 5COAA 3GNQA 1LTHR 5BQFA 4B7CA 1LDNA 3DBRB 4MKZA 4JP2A 3WNQA 5JC8A 2GN4A 2D1YA 3BA1A 2I65A 4E13A 2Y1EA 2UYYA 3BYZA 1ZH8A 3JYOA 1H93A 3E9QA 1T2DA 4EZBA 4L76A 4OIMA 4Y6PA 1EUCA 3JTMA 3ENNA 3UXYA 1EQUA 3ETEA 3O8QB 1E1KA 3UUWA 1DAOA 3VZQA 5CDUA 1DIBA 2DQ4A 3PYLA 2PD6A 4OSPA 4NPCA 2H1SA 1KY4A 3ZHZA 3GRKA 3ROQA 4L8VA 4BHTA 5KJ1A 3IUPA 2CVZA 4QSMA 3QWIA 4R1SA 2C20A 3AOGA 1YL7A 3NUGA 2FSSA 1ZMOA 1X7GA 3ZW8A 4CM8A 1HWYA 1KERA 4YJGB 2GN9A 2I76A 1VPDA 1LU9A 3GVIA 1PJ4A 4BO1A 3HFSA 1PS9A 4RF2A 3GK3A 3L9XA 4WPGA 4R5MA 4WJZA 5L45A 1ZJYA 2X5OA 2BH9A 2HMWA 4A2CA 1EFLA 3IJRA 2B36A 2AEMA 2NQ8A 5JDIA 4GX0A 2C07A 5B4VA 4F45A 3V2HA 1DIHA 1XLTA 2EJWA 3I9LA 4RPGA 1NR7A 2O23A 3OQ6A 4D3SA 3LDHA 3WGQA 1NQAO 2EG9A 1BXZA 4CV0A 4D45A 4JBIA 4XYMA 2P68A 2EGHA 2LDXA 5CAEA 4XYLA 4R1TA 4XRGA 2EP7A 5AQ1A 1NPTO 2VOEA 5BSHA 4TWRA 4NI5A 1NP3A 2YV2A 3K92A 4AJJA 3K96A 1X7DA 2W2KB 3HSKA 4MO2A 4Z9XA 4NJMB 3S2GA 1UXHA 2SCUA 2YQ4A 3QA9A 4WASA 3SC4A 1LQUA 2C5EA 1GZ6A 2POQX 3CZRA 3DMTC 3FF4A 4R3WA 4YAKA 3GDGA 3B1KA 4CR6A 4LW8A 4RJTA 4U7WA 3KUXA 1J0XO 5L3ZA 3ZV5A 1L7DA 3E48A 1CQIA 1Q0HA 4CMEC 1QRRA 2IZ1A 4ALIA 2Q4EA 4BKUA 3NJ8A 1MXHA 4GLLA 3LT2A 3GLQA 3PXXA 1V0JA 3HJAA 4LRTB 3QQPA 4Q3AA 4CM9A 4EBFA 1JKFA 3FRJA 5G0TA 4IUYA 3DZIA 4XKJA 2AG5A 2DBRA 2E37A 1B14A 2X4GA 4LMPA 4Q3DA 1EVZA 5G0WA 4JQCA 4O59O 3E5RA 5IDWA 1EDOA 3KETA 3ZV4A 3ZGYA 1F0YA 3B1JA 3W8FA 5KJ6A 1AXGA 1E7MA 3ZN2A 3FNFA 3ABIA 5EESA 3CTMA 3V8BA 3INGA 4LMRA 1DIAA 2G76A 3ZI0A 1XU7A 1GEGA 1IYZA 2UUOA 3BTVA 2Y66A 3VTZA 3EK2A 3FI9A 3T4XA 3VOSA 4BNFA 3M1AA 1P1HA 4LSWA 1F8GA 4CLEA 2RH8A 3VPFA 3TRIA 3RD5A 3EW7A 2AHRA 2GASA 2UDPA 4QQRA 3OJOA 1NQTA 4CMAA 4CODB 1XKQA 1H9BA 1SAYA 4A5OA 2GN6A 3PDJA 2YUTA 4MKRA 4U6QA 3W8DA 2CSUA 4BO2A 2DTEA 3GZNB 1NVGA 3W4IA 3JD1A 3FWZA 4E4YA 5HS4A 4MVJA 3L6OO 2BELA 4D0RA 3CSDA 1QLJA 4EW6A 3PDUA 4WCDA 4ZGWA 3K8ZA 2Q50A 3PQDA 4I9NA 4P22A 5IF3A 2VWQA 3GPDG 4NFYA 1C0PA 4F6CA 1U8FO 2AQ8A 2B37A 2GZ3A 4NZ9A 4PLHA 3QWHA 4MP3A 5I7EA 3KM0A 3TPCA 5JAQA 4H15A 5B4UA 4RF4A 1H6DA 2ZB8A 4OSOA 4HFNA 3PJDA 4BO3A 4FSHA 2O3TA 3PHIA 4A26A 4J1QA 1PIWA 4ZQHA 5G4KB 3NT5A 3QVSA 3QE3A 1MA0A 1E6UA 2BFPA 3EC7A 3DTYA 2JHGA 3SXPA 5LDHA 3LF2A 4AL4A 2PH3A 4JNKA 1SEVA 1HETA 2BMAA 4BOYA 4PCVA 4DTIA 3H65A 4JBGA 5I7FA 2AW5A 4CM1A 4E32A 1PJQA 1RYEA 2BGMA 4LGVA 1VI2A 2D5CA 3OA2A 2IODA 4BKOA 3EDMA 1LSUA 2VOJA 4M55A 4AFNA 5JBIA 3KB6A 4IMPA 4CUJA 1QYCA 4YAJA 4GVXA 5T5QA 2E6UX 3PGJA 5EINA 4OM8A 2DPGA 4MVJM 4OXNA 2OOSA 5F1KA 4CM5A 2PZMA 3L4BA 1WMBA 4YT2A 3BTOA 1GPJA 2A94A 1K89A 1MB4A 3JYLA 2OP0A 3AJRA 4H7PA 3ZU4A 4RVHA 4Z9YA 3SJ7A 2ZTMA 1R0KA 5TS3A 1B15A 2VUTA 3JQCA 1NR1A 3GVXA 3BMQB 2BI7A 3BMOA 2GLXA 4MVJE 4OMUA 3H3JA 2O4CA 2R00A 1BMDA 1WDMA 1E1NA 3O8QA 3RROA 4E2WA 2HDHA 1UZLA 4RDHA 5CHEA 4PG4A 3H3FA 1YL6A 3AUUA 3VVBA 4CMCA 1L7EA 4Z0TA 4BNUA 1N92A 5IDQA 4J4HA 4O63O 2BFMA 1HDGO 2O7QA 3DBRA 5ENDA 3F1KA 1GADO 3GN2A 4WNIA 5L4NA 1PJ2A 3WTBA 4DMLA 2QRJA 5ADHA 3HADA 3Q3CA 3NT2A 3EGOA 3GY0A 4J16A 4JJGA 4KMSA 4YDRA 4E31A 1XDWA 3PK0A 1O95A 2E4AA 3JQAD 3NAQA 4XQGA 2A4KA 3UAGA 3RKRA 2NU8A 3AOEA 3S55A 3UCFA 1JN0A 2IEDA 2D4AA 4N5LA 1G1AA 1ZSVA 4BO9A 4A27A 1DC6A 3AY6A 3ONDA 4WLVA 1E7SA 1LLCA 2PGLA 4RDIA 4CL3A 4EI2A 1I30A 4MVJI 1BW9B 4ALKA 5C5IA 3ADOA 1AXEA 1ISMA 2HJSA 2X6TA 1UP6A 4EJ6A 2AQKA 3JQ9A 1E3JA 2ZATA 1ENZA 1U4SA 5KVQA 4XB1A 3H2ZA 1T2EA 2WYWA 3HE3A 4D42A 5K6AC 3RBZA 4DXHA 5B37A 4FFPA 1UP4A 3LT1A 5C37A 1GYQA 5JPIA 1YONA 3PHHA 2QRKA 4K6CA 1M2WA 5C7IO 2NU9A 2WTBA 1GR0A 3L4SO 2D59A 1HKUA 3BHMA 1QYDA 3UOGA 2YHIA 2QZZA 4LCJA 4RPLA 4EDFA 4CQLB 2CUKA 5DBFA 3EAGA 4CMHA 2QQ5A 5AXBA 1E92A 1I33A 4Y9DA 1KOLA 2EEZA 1JDJA 3I3OA 4J49A 1UP7A 3GDFA 1HSOA 3JD0A 5FI5A 5IZCC 3TFQA 4E5YA 5JC1A 3GGOA 4ZRNA 1SC6A 1HLPA 1W73A 2EERA 4M87A 2W2LA 3TL3A 1Z73A 2H5LA 1HE2A 3DHEA 3WGHA 2IRWA 3L0DA 4NBWA 2Q1UA 3OHSX 4OL9A 4KDFA 3JQGA 5T6BA 3ZU2A 1E5QA 1YBAA 2GZ2A 4D44A 2PA3A 3OP4A 4TQGA 1HDYA 4WCFC 1T1SA 3RU9A 3X2EA 1HDZA 2Y1CA 4TZKA 2DBZA 2Q1WA 1AN9A 1CDOA 3Q0EA 1K6JA 1U7HA 3AW9A 5AXAA 4H16A 1OC4A 2I6TA 3WFJA 4U5QA 1GCOA 1C1DB 3ZWNA 2Y0CA 2YDXA 4DPMA 3W4KA 1P9LA 3HN2A 3RC1A 1ISHA 2OMEA 4NMHA 1FDSA 3GNTA 4N54A 3H5NA 3E8XA 3HN7A 3KYDB 2B4RO 2YQ5A 2NVUB 3LC1O 3PVZA 4WUVA 1W8DA 4FJ2A 5JAMA 3OMLA 5A3JA 5C3MA 4PLCA 5IN5A 1ZK2A 5BNTA 1A71A 4L4SA 2PD4A 5FWNA 3TZ6A 3JYPA 1A7KA 4E5NA 3WX0A 4OKIA 3AU8A 1D3AA 1JQBA 2VHVA 3U49A 3I9KA 5H81A 4Z6KA 2YFHA 4MP6A 4FB5A 3AFNA 3W6UA 4BNLA 5A5EA 5B12A 3GNSA 1W6UA 2P9EA 4B8WA 1P44A 4YVFA 3ONEA 2W90A 1QV7A 2C54A 5ICMA 2BFOA 3DZJA 5A9TA 2B0JA 2GPTA 5TJ9A 4DWVA 3D1LA 2HLPA 1PZFA 3AUSA 1DIRA 1PGPA 1V9LA 4PZCA 4E2ZA 3I9OA 5A06A 4BB5A 3A14A 3GH3A 1HYHA 4WECA 3WIDA 1MC4A 1OAAA 4II2A 4D0SA 4KWHA 1Y5RA 3U5TA 3WGOA 3HZZA 1TT5A 5DOZA 3PHJA 4KUHA 2P5YA 3RWBA 4UREA 2FY8A 3ZNOA 4UEJA 4TMFA 3D4NA 4J1SA 3SLKA 2OZPA 3SVTA 3RSHA 3JQAB 4ZQEA 5K0ZA 3F3SA 5A4DA 3I4FA 1P45A 4IMRA 1U28A 4TVOA 1KC3A 2PKRA 3BMCA 4XYEA 2QHXA 4NR0A 3KSUA 4CQMD 3M2TA 3WTCA 5AVOA 3RQSA 1GQYA 2ZQZA 4H3VA 4K26A 1OOEA 5ICSA 1DLJA 1SB8A 1UXKA 3MTGA 2X5JO 4J1TA 3C7DB 4YAEA 5TF4A 1R6DA 1PGOA 3AY7A 5L4SA 2V6BA 4EJ0A 1B3RA 4L4XA 4G65A 5COBA 1YQXA 3KTDA 3TWOA 3C7AA 4GQAA 1ZKMA 2X1HA 3NDIA 2GYYA 1ENOA 3AUAA 2ZTLA 4ZD6A 1UZMA 3VPSA 3CKYA 3PQFA 4L0QA 4LISA 4I08A 4M49A 1GD1O 1JWAB 1JAXA 4KTVE 4CLRA 3I4CA 4M8SA 4QECA 4IQ8A 4XQCA 5HBRA 4IDCA 5A03A 2OHXA 2W4QA 5IZCA 5TQVA 1EVYA 1E3WA 3ZWAA 4RZIA 1O5IA 5HRUA 5DCWA 4A10A 2GF2A 1B0AA 1HE3A 4J91A 3JQDA 5IXYA 4M1QA 2P91A 2G82A 3SEFA 2VHWA 4ONEA 4UUMA 3MOGA 3OETA 4PLVA 2VRBA 4IXWA 2X23A 2FPPA 1I0ZA 1KYQA 1DAPA 1PQWA 2NU6A 1Q1NA 3IKVA 1ZK0A 2WEKA 4P38A 2PD3A 4G2NA 3ZWVA 4KTTE 1DB3A 3HB4X 3OIDA 3F47A 3OJLA 3VTFA 1ONNA 2HK8A 4XDZA 2HAEA 3WICA 1HF3A 3ZWCA 3O38A 2DUUA 4PLYA 3W8EA 5CEEA 1ZZEA 3KYBA 2BHLA 4WNCA 1EK5A 1YOVA 2Z5LA 5BNFA 4OOEA 2TMGA 1LLQA 4J0FA 4E6PA 3RKUA 1KY5A 4RVFA 1N8KA 5ITVA 2ZYGA 5A5FA 1LUAA 1YS4A 1GV0A 3WYBA 1R16A 1H94A 2P4QA 1IB6A 4AG3A 1T26A 1RJWA 3ROPA 3H9JA 4HWKA 2WWRA 3WSVA 4WLOA 1YB5A 2F00A 5H83A 5ENVA 1ADCA 3GUYA 4FFOA 4EYEA 3AOEC 1T2FA 2IZ0A 2FR8A 4NU6A 3R1IA 4RO0A 3IS3A 3WDSA 5JDIC 1VKOA 3H4VA 1NYTA 5U4QA 3ANMA 1MLDA 1X0VA 5T64A 5I9NA 2V6GA 5L9AA 4QUKA 5DBIA 2B35A 4ILKA 1O0SA 1YBMA 1A9ZA 1NHWA 3TDKA 4J7CA 4W7IA 1KS9A 4HXYA 4R51A 3AI3A 2ZTUA 3T4EA 2Y68A 1D1SA 5EQFA 1NASA 3BMCB 4ZQBA 4XCVA 4M89A 4A7PA 5EIOA 1P77A 4ALNA 3MJEA 3SJUA 5IZ4A 1UH5A 1MC5A 3CH6A 1HDOA 3W4JA 1YQDA 1TLTA 3PZRA 2EKPA 4UVGA 4EGFA 4JBHA 1KBZA 1NWCA 3PGXA 1D4FA 3W6ZA 1T1RA 2VHZA 3RFXA 2J8ZA 3L6DA 4DPKA 4BNKA 1F17A 1JW9B 1LC3A 1R4MA 4Y67A 2DUWA 3HNPA 4YQZA 1QMGA 1DFHA 2V6MA 4I9HA 1DC4A 3JQEA 1IPFA 1HE5A 1I24A 1LDBA 3LT0A 4PVCA 3LF1A 4IDDA 5EPOA 3DFUA 1DXYA 4Q3CA 1JKIA 4N18A 1XQ6A 1PJLA 1IOLA 1DSSG 5T67A 4FC6A 1C14A 1I32A 3IIEA 5G4LA 5LCXA 4FC7A 1MGOA 3S2EA 2QYSA 3RC7A 2BLLA 4J90A 3SBOA 1TA4A 1GV1A 1VLLA 1IY8A 3ULKA 1ZK1A 2Q49A 4W82A 2RHCA 1ORRA 5T8KC 2D5AA 8LDHA 1CIVA 3JD2A 5I9MA 4JK3A 2X58A 1MV8A 3LVFO 3RU7A 1HZZA 1Y1PA 3L77A 2NQTA 2OXIA 1WZIA 4FCCA 3EYWA 1FDUA 5DCYA 5IDYA 3ST7A 5B4TA 1LNQA 4OYRA 3OQBA 4Y6RA 3UN1A 1AUPA 3VH1A 3VC7A 1N5DA 4MP8A 5COQA 4AJNA 5EJ2A 4JXKA 2WD7B 5JS6A 1T4DA 1B8VA 1PGNA 5AOVA 5GY7A 2P2SA 4Q9NA 5KKAA 4AJ4A 2BF7A 1O94A 3QSGA 3BHIA 3K6JA 1NAIA 2VRCD 3DZBA 1M6HA 1Y7TA 4YRDA 1ISIA 4IDFA 1R15A 4QT0A 4FW8A 3V1UA 4UVDA 4CM9D 4YR9A 3BMQA 2GZ1A 4PLFA 4IY1A 1BWSA 5EL0A 1ARZA 3HDHA 3QRWA 4N5NA 2O50A 2OFPA 1SOVA 3ZW9A 2GRAA 3OF2A 5TIIA 2X0NA 3FSRA 4MVJG 3UICA 2Q45A 3Q11A 2PZKA 2YHUA 1VJ1A 3UGKA 4D79A 4NHEA 3DQPA 3HUDA 3WR5A 1I3MA 1SOWA 5AXCA 5JDCA 5AXDA 2BGKA 4B4UA 2IYOA 5G4KA 1TT7A 2FPIA 4WOKA 3DOJA 4CM4A 1S6YA 3H9UA 2J5QA 5EMHA 1J5PA 1N7HA 1DRVA 3WGYA 5KVCA 3N74A 3ZNPA 4CV2A 3WWZA 2V65A 3WQSB 1XELA 2O3RA 3L07A 1Z45A 1WDLA 2Y99A 3HHPA 4IJKA 5JY1A 2AE1A 2JFHA 3RBVA 4BV8A 5THKA 4ALJA 3WQRA 3D5TA 4MPDA 1UXGA 4B79A 4W7HA 1VL0A 1RM3A 3D3WA 2C0CA 2HKIA 4CUKA 4NBRA 4PFJA 4RQUA 2UV8A 4TKLA 4HADA 5G0VA 5JYDA 2Q1TA 3DB2A 2I3GA 2B5WA 1QYVA 4B7XA 3G49A 5GZ1A 2HCTA 1C0IA 3U0BA 3HWRA 3O26A 5KVVA 4J43A 1ZMTA 2JJYA 3VAZA 1YB4A 2DM6A 3FPLA 4IS3A 1V3UA 4ZQGA 4BKRA 1U3UA 1X7HA 4XA8A 1CQJA 3JV7A 4INAA 2EW8A 1IHXA 1NQ5A 2EXXA 3FD8A 3LU1A 4ND5A 4XEHA 3DMTA 3TZQA 1Y5MA 1RM4A 2X5KO 2J3JA 3RBXA 2NV6A 2EGGA 5MDHA 5TNXA 3L6EA 5ER6A 3WYCA 3OSUA 1HLDA 4KQXA 3BAZA 4DPLA 1WDKA 3DZFA 4XR4A 5CG2A 4J7XA 1XCBA 4FOOA 3INTA 4KQWA 3JQ7A 4D43A 5JO0A 1BGVA 2NVUA 4MVJF 3GAFA 2YDYA 1UR5A 4II3A 4P4GA 3Q2KA 2AQIA 3JQBA 3RASA 2XXJA 4W9NA 3PLNA 4D3DA 1NTOA 2FR0A 5L4LA 2YFQA 4L73A 3BIOA 3WNVA 1Y8RB 1EE9A 1IUKA 4D7AA 3A9WA 3OEWA 4E5MA 4I1IA 4XB2A 1P1IA 3GGPA 2VYVD 3TNLA 1XYGA 5JE8A 2CF6A 4J1NA 1VRWA 4YAGA 3QVTA 2HRBA 4ALLA 4TROA 5FFFA 4YWJA 3WYEA 4MIEA 4L4RA 3F46A 3LLSA 4UEOA 3WXBA 2JFGA 1A4UA 1R0SA 3FBTA 1ZO8A 8ADHA 2RH4A 2HQ1A 1KEVA 2JAHA 1PGQA 1RM5A 4U0KA 4NBTA 2AA3A 2A92A 3DHNA 2Q2QA 2PTGA 3EZYA 3UW3A 6ADHA 2JKVA 1WVGA 4IXTA 1U3TA 1NPYA 4WLEA 3ONFA 2B69A 3ZWWA 2PH5A 4JN6B 3OFSA 4RVDA 3WBBA 3M6IA 4J2HA 5DCUA 3NRCA 1JVSA 5I7VA 4B4OA 4KZPA 4HX5A 3DFZA 3JQAA 2P9GA 1NVTA 3OJFA 3GFBA 2B4QA 4JJFA 5LDGA 4BS9A 3ON5A 3KEOA 4A0SA 3DO5A 1OMOA 2Z1NA 1E0DA 3OICA 4XQ9A 4GPD1 3EVTA 4CM8B 2CVOA 4GMFA 1Q2XA 3GEGA 4B3JA 3JYQA 5I7SA 1CETA 2Y1GA 3JCZA 1I3LA 1DRUA 4AJ2A 1U2DA 1A9YA 2GNAA 2J3KA 2HMUA 2R00C 3GF4A 4LVUA 3DXFA 9LDBA 4AVYA 3ZWMA 3UKOA 4FOSA 4BMNA 3SLGA 4CMGA 2EV9A 1Q0LA 4QTZA 5KNLA 2DBQA 1SB9A 1JLLA 4FQ8A 3G1UA 3CMCO 1ADFA 4TRRA 4URFA 5KJEA 5TC4A 1EE2A 1T24A 4FS3A 2VNAA 3H9EO 4R1UA 1U7TA 4WLUA 3LYLA 4RCVA 2NVWA 2RAFA 1X14A 3L4BC 3I6IA 2H6EA 5L7TA 4EUFA 4DC0A 3DR3A 2Y0EA 4HFJA 1RKXA 5A9RA 1QORA 4MKXA 1H0KA 4FJ1A 1ONPA 5DOVA 5IFLA 3H6KA 4CMIA 3JD4A 3E03A 4WCFB 1MG5A 2YJZA 5JO9A 3DTTA 1X0XA 3IUSA 3CEAA 3JYNA 2YW9A 3A28A 4UUOA 1Q7CA 1U2GA 2YZ7A 1GL3A 4RF3A 4BO5A 4ZICA 2GUGA 4MIYA 3OEYA 4YJHA 1DJQA 3U62A 2NTJA 4XX0A 2G0TA 3BZUA 1P1RA 1K5HA 1XHLA 5JFOA 2Q46A 4BNVA 5JMWA 1I8TA 1MUUA 1UJMA 3PP8A 3B1FA 4GGOA 1B7GO 3VZPA 4FD3A 3ZWYA 4YRAA 1G6KA 5A9SB 1SBYA 3DBVO 4YPOA 1GFSA 1O9BA 3WFIA 3CTVA 2DVMA 3ENKA 4YCAA 1P33A 3IDSA 4ND3A 5I8ZA 4R01A 3DMYA 1T25A 3GMSA 1C0KA 3AM5A 3HDYA 1Y8QA 2FMUA 1PTJA 1VKNA 4BO7A 5LC1A 2CD9A 4KUEA 1EVIA 2VHYA 3I83A 4CV3A 1WLYA 1T2AA 5HA5A 4CLHA 3DDNA 1R0LA 4PLPA 5C7OO 1R4NB 4J4TA 3KYCB 3ANNA 3Q6IA 1LRJA 3BHJA 3U4HA 4O6VA 1N2SA 4HP8A 4WCFA 2IXBA 1PU2A 4RV9A 1YKFA 4DMMA 1U1IA 2Y1OA 1M76A 5HS6A 2IYPA 1ZK3A 1HDXA 4XD2A 3QVWA 3AI1A 2YHIB 1U8XX 2ZJ0A 3FPCA 2WSBA 1UAGA 1ENPA 3VDQA 4GWKA 2QYTA 3KSDO 1P3DA 2ZYAA 2BKAA 3VH2A 1QSGA 1RYDA 1NVMB 5JMPA 4B3IA 1VL6A 1O8CA 1ZEMA 3QP9A 4BVAA 4CLOA 5CP8A 3H2SA 1BVRA 4R69A 4KP7A 1E7WA 5DT9A 5U9CA 1JTVA 2EP5A 2NNLD 3GZNA 3V2GA 4XGIA 2EKQA 2JCYA 1GY8A 3N58A 2GN8A 1CYDA 3GG2A 4WOJA 4ZU3A 2FPGA 1ADBA 4B7UA 3TSCA 1H6CA 4YQYA 4DL9A 4ID9A 3GHYA 4S3MA 1KC1A 5JCJA 3K30A 2O4UX 4IGEA 4CQMA 1D7OA 2GR9A 1J4AA 5TRTA 4IJUA 4MVJD 4YJHB 5F5NA 4QX6A 4BNHA 3I23A 2TMDA 3MJTA 4EJMA 2JD2A 3GUCA 1R4MB 3JSAA 4GBJA 2I3AA 2CMDA 2QX7A 1C1DA 1YWGO 3GVPA 4CPDA 1PGJA 4C7KA 5IN4A 5L7WA 1KEUA 2AEFA 1BDMA 4JJIA 4PIVA 3JQ9C 1WAMA 3ASVA 4OGWA 4DLBA 4BQRA 4PN3A 2JCXA 4CLOB 1NXQA 2WD7A 3NX4A 3FTNA 4QXMA 4J0EA 1A7AA 3JQFC 5EERA 5F1PA 1ZSNA 1ONOA 4LCEA 4ND1A 1KVUA 1O6ZA 1EZ4A 4R1NA 2ZB3A 3B20A 3MCVA 3WLFA 4AJIA 2Z1MA 4AJ1A 3RFVA 1X15A 3JQGB 4IDBA 4PVDA 4OH1A 4G81A 1LRLA 4XJSA 3KEQA 2VCYA 2WM3A 2O48X 2J5KA 3GQVA 3ANLA 3RUFA 2FR1A 5TT1A 1Z7BA 2Z95A 3DHYA 2XPCA 2C7VA 2D3TA 3NT4A 3EZLA 3FCOA 3JQ8A 1E3WB 3I5MA
chains in the Genus database with same CATH superfamily
3IGFA 4HPJB 4W8GA 4AD8A 3TNJA 3OQPA 3EVZA 4DSNA 3AL2A 5DI3B 4GW3A 4PG7A 1H5NA 1GG9A 3LFUA 4YDHB 3TJRA 4OJKA 1ZRSA 4B8ZA 1P19A 3AETB 4E4TA 1PL6A 3CUKA 2CHGA 2EKZA 1O08A 1Y63A 3HKDB 1VCMA 4HJRA 5AKYA 4C89A 3JZIA 4RAQA 1KARA 1KP2A 2BEKA 2YMLA 4MUEA 1WMAA 3DUFB 2X8BA 1RNLA 2WDZA 3N2IA 4KAFA 2DLNA 1FTQA 2XWJI 3AYZB 1PD0A 1CJKC 3O8LA 3GD7A 3E9CA 3NBFA 3KJZA 1E3EA 1OFGA 1WNFA 4L28A 4D8YA 5KWEA 1Q0SA 2CDBA 2FMKA 4FHGA 1SKQA 4O5OA 5T4BA 2XDQB 3T41A 4HL6A 5I01A 3RODA 5KHLB 3O4HA 1QB7A 5GAJA 2Z04A 2R66A 3SK0A 3EVBA 5DHQA 1TLFA 3K0BA 3VVLA 3L93A 1N1EA 3NHSA 1SPBS 5IJZA 4DR1B 2WUGA 3PWKA 4I55A 3ET5A 3U7GA 4BB9A 3NIDB 4X61A 1FP1D 4CEHA 1DJLA 1CYEA 4F96A 3WGNA 3WK7A 3FG9A 3Q3IA 1GCIA 3FVWA 1JHYA 1XZBA 3DE1X 5H4HA 5LLSA 3VOTA 3LDGA 2OUIA 5EJEA 5KNBD 4QODA 2IS6A 4RANA 4R81A 1ZCZA 2K4MA 3U0VA 1DX4A 4DUGA 4X3OA 5I48A 2YYYA 5JSFA 3HJUA 4HN2A 2O8DB 1AQJA 2JGJA 1ZI9A 4HKTA 3FUUA 2P6PA 4RKQA 1O1YA 4DSTA 1X8KA 2WYOA 2BHSA 3MOIA 3I09A 4PSAA 2FUKA 5IH3A 3VYRB 2V96A 2G28A 1OLSA 1YDEA 2X0IA 4X8OA 4B73A 4QM6A 1W59A 1NQOA 4UUPA 2Z09A 2V8OA 3ZHYA 2AX3A 1GVNB 4MLZA 3K2QA 4P4NA 5KREA 3MWDB 1H8HA 1YRLA 2CMHA 1IUNA 1XJCA 1JWBB 1WPGA 5EJAA 3NS7A 3QU2A 4PQFA 3Q9LA 4D5EA 2D54A 4IZ6A 3THOA 1IWBB 1YQGA 2ZCUA 3COVA 1XQ1A 1GNVA 2W2PA 3RREA 1SUBA 3BA6A 5CD1A 2LIVA 2W6JD 3M2PA 2FQXA 4YV7A 4YT4A 3TAUA 1E20A 1XAIA 2CDCA 3TKAA 1P0MA 4CKWA 3HXMA 2AVDA 1E1YA 3PFBA 2GBLA 4PPFA 4B7AA 1FBNA 3O4FA 2AC4A 4Q7KA 3MTJA 3EMDA 4M1TA 4RH1A 3N2NA 4BP3A 5DBOA 5ECDA 9LDTA 1LNSA 5FV7A 2DUJA 3E3AA 1M34E 1G5PA 1QWOA 2GWRA 3A6KA 3GPCA 3KXLA 3N86A 2ASEA 4K0RA 4RJKA 1V6CA 1BHO1 1XZCA 3H6GA 4BV3A 1OFHA 2G7MC 1HT3A 1WW8A 1Z0KA 2QYHA 2W6QA 3GLVA 1HV8A 4G4IA 2OSBA 2C98A 1JB1A 1MAVA 2PUTA 3KOZA 1CE8A 4NNOA 3H8VA 4WNAA 1Q21A 1W36B 2FE1A 2FW6A 5DE3A 1UANA 4KUGA 5KNDA 4QPDA 1ONBA 4LSMA 1PN3A 2XQGA 3S8EA 3AR3A 3K09C 3LP6A 2JFOA 2JNWA 4Q16A 5LOVF 4WBXC 5G40A 3QHQA 5TPWA 2PAAA 2XXBA 4MHOA 1GUZA 5L6LB 2C77A 1NZFA 3TJZA 2TS1A 1CLUA 3QWBA 2Q2VA 1P9WA 3WGTA 4B5LA 2ZI4A 3JAKA 4HRAA 4XGKA 5HM6A 2PIAA 1BO6A 1O97C 2QAGC 2A1IA 2Y0BA 4KRFA 1IHUA 3WMFA 3C4JA 2PL3A 3UTCA 3L8GA 2UYOA 2H2AA 1H2WA 4DJ5X 2R8ZA 8GPBA 3V9AA 3BK2A 2XKJE 4PGHA 3FPFA 1GITA 4MI3A 3SS7X 621PA 2I7DA 4I50F 5AHRA 3AF0A 3ZKAA 2PXHA 3NEJA 4TUYF 4ZVTA 2ZT7A 3IO3A 1JJ7A 4RKFA 5DRYA 1BCSA 1V2GA 3DL7A 1EWQA 2C0QA 4FONA 4BUCA 4D56A 4R2XA 3PNVA 3HBLA 1MPTA 2V98A 1T3GA 1WA5A 5AI5A 3WISA 1FSFA 3C24A 3KZMA 5C1OA 1C5KA 2VP4A 5JH7B 5KOIA 2VDJA 4A23A 1DEOA 2R5WA 4PPNA 3KQMA 5ISMA 2B99A 3T3EA 3ZZMA 4P33A 1NWHA 4YONB 4C7VA 1TIBA 1JLMA 1ATIA 3CF6R 2NUPA 2PS3A 4NCIA 1VSQA 5E7QA 4BDSA 4EF4A 1QQAA 5ANRB 4ZC8A 2R11A 4LY6A 1UM9B 2OBBA 3T7IA 2NO0A 3GT7A 2PV7A 1SQFA 3PNQA 2R60A 2WYVA 2QMOA 2CV0A 2XCSB 1UZNA 4PHGA 1H2AS 4XFJA 2JCGA 3COZA 1DFGA 3LBAA 1M73E 1US8A 2YMPA 5AK3A 3HYSA 3B5IA 3IH5A 3QOYA 1DJNA 1L8QA 4L5CA 3E2IA 4LOAA 1G2QA 5EP4A 5EXEA 3SHFA 3ZWXA 5BN5A 3CNNA 3G0OA 3RTDA 3TZHA 4B3RB 4X95A 1Q3HA 4Q4AB 3BWYA 4JLAA 1WU8A 4FQ7A 5ALMA 1X7ZB 3O82A 2CLOB 5A7GA 5IT4A 1ABBA 2Y67A 4JWTA 3DCIA 4Q9KA 3F74A 4GMHA 3UFXA 3WAGA 3J81k 2RMKA 2GPYA 2WNIA 4PSUA 3RG2A 5KVSA 4PPQA 1G2OA 3A06A 3B9RA 3ROMA 4MRSA 3ZV3A 2HO5A 1ZRHA 3ZQUA 2FJPA 2ZPUA 4MS1B 4XWAA 2G3YA 3A8TA 3ZE7A 1IPEA 1SUFA 2IXGA 3VHQA 1PVVA 4LJSA 5KYYA 2DT5A 1CNEA 1JRLA 3BH7A 1V3QE 4PYQA 1G19A 4Q66C 4LVCA 5AKGA 4GP7A 1EIWA 2IPXA 4HYTA 4MW4A 1HFEL 1HXHA 3EXHB 1RHKA 4EO9A 5KO2A 2W9XA 4FOTA 1GUFA 3MS4A 4TRNA 1WXDA 2J08A 2G83A 4CMJA 1XWFA 2B6NA 3EB9A 5A5DA 4QLBA 4ARCA 3L7KA 4PBRA 1PZNA 1I7NA 3OEHD 1ZOIA 3VDXA 2E5LB 5T57A 4LXUA 1PEDA 2P6RA 4PICA 4Z8XA 1P4SA 3U4IA 3WRXC 1GNQA 1Y9AA 2AN3A 4AJEA 2A0YA 4EKNB 4GMXA 2Q2NA 4Z4QA 1M1NA 3MS2A 2ATXA 4NV1A 1XTTA 3EUWA 1IXRC 1E7RA 1ZXLA 3VKWA 5B3JC 3QW2A 3GHHA 2PT7A 3D7RA 4OXIA 4R16A 4Y2JA 2VJKA 1DQZA 2JH9A 2Z58A 4YN3A 4BU0A 2GDZA 4MVJH 1K6EA 1VZ2A 1EEHA 4RL6A 4ZYXA 5HCIA 2Q1XA 4WY8A 3QU5A 3ZYCA 3F4LA 4DLZA 2F3QA 3K9CA 4G25A 1WCYA 3T52A 1TCCA 2FZEA 1VE3A 2I4NA 3HCRA 3ICVA 2GVNA 2R62A 3VSCA 4E2XA 4L9RA 4Q7JB 1N7GA 1TLLA 5EYPB 2D5LA 1W5FA 3QWAA 5E1DA 3PT9A 3G5LA 1VJCA 1YHZA 2XLBA 4DLVA 1MH1A 3BDAA 4DADA 5BMVF 4C76A 2W11A 2VNSA 4GXTA 1X13A 1XVTA 2FLWA 3MJCA 4NG5A 4YJ3A 1L5LA 3D8SA 1GXSA 4M6WB 2X0KA 3UJPA 4BGVA 4PGAA 2FVYA 3B9PA 4ZGBA 2R6DA 2DE0X 4HJXA 5ILOA 2NZ8A 4PQEA 3OJ0A 4FMCB 5D6OA 2A5GA 1CVRA 3AG5A 3C39A 4ZIRA 3TBKA 1L7VC 1Y6JA 2H4JA 2QTWB 3JD3A 3OO0A 1WL8A 1U5AA 1G4AE 4HDMB 3S44A 2IH2A 4CRWB 1BU5A 1Z5OA 5G41A 3RQIA 4BEWA 1M2FA 3OPMA 4IIUA 1BXKA 3QK7A 3QLUA 2C7PA 2C5BA 1T2NA 1T29A 2NQ2C 4M54A 1YQUA 1ZSYA 5HZKA 2Q4RA 4FYJA 3GRRA 3SJCA 4Y98A 5I3ZA 2L17A 4OHPA 2VP5A 2QGNA 2QNIA 4HWGA 1L9XA 2GAIA 1CUYA 1EXNA 1FMLA 3OIUA 1BVUA 4TSRA 4HDKB 5CDTA 2WFLA 3IOYA 1F12A 2WFAA 2JIPA 3AFGA 3JASB 4RENA 3I9V1 4FDVA 1NURA 2FQ1A 4OQYA 5TGDA 1R0ZA 2QP3A 3DMDA 4GRAA 2G5CA 1ZJZA 3GP3A 4LJ5A 4M8KA 1CW2B 1W0KD 2J85A 4IDNA 4LSGA 2PCJA 4KMMA 1GSIA 4AECA 4B6QA 1GIAA 2YXNA 4ZI7B 3DOOA 2FSVC 4RKRA 5BSTA 4MWTA 4HWSA 4YUZA 3DOEA 3WLRA 1FJGB 4MDFA 2HIGA 3ZE2B 1NLFA 3BBPA 4U00A 2KLHA 5MN4A 1VP3A 3ZWOA 4D6XA 2QJOA 3DEIA 4OQXA 3HCFA 3Q87B 3WHKA 5DNCA 5IG2A 4QWMA 3RTGA 3SOZA 3GGCA 2EW1A 3PUIA 4I6EA 2JKZA 2QM7A 4GD3Q 2XF8A 1YJCA 3LFHA 1ADGA 4L5IA 4F56A 1ZKDA 5B3LA 4G63A 1GTRA 1A9TA 2PJRA 4DLWA 1JHUA 3CZCA 3ZWQA 4NCNA 1E4OA 4BQQA 4QFDA 2H51A 3OQVA 4UDYX 2HN9A 3PGVA 3UG6A 1ZFNA 2CNWD 2H2HA 3DBLA 3KXDA 1COWD 4BZXA 4EYQA 1QP4A 3VU8A 2Q9CA 3J7TA 2AD5A 2N42A 3S2UA 2Q5EA 2QMYA 2ZVPX 3N8KA 2Z98A 2DPXA 3AETA 5E4JA 2W6IA 3UJAA 4QO8A 2SNIE 2E6KA 4IIBA 4J9UE 1AMNA 4S1TA 4E2YA 1RE1A 3EF3A 3GLUA 4BNYA 3X0DA 1VJGA 5LZ9A 4KAXA 1Z6YA 4TYQA 3VJKA 1JHRA 3GPLA 1I2ZA 1QBKC 5TB5A 4CM6A 1YCDA 2NNWB 1CQIB 2FZVA 4FGSA 3PL5A 2H2GA 3T5MA 4YYEA 4RACA 4UZEA 1LSJA 4BNIA 1TMGE 1EG2A 1I5RA 2DPHA 1F1BA 1CEXA 1ECBA 2QGZA 2ZIXA 1SHTX 1FFWA 3T35A 5TS2A 1J1ZA 1N0WA 2MR5A 1WW2A 4HFRA 4KLNA 1IVSA 1AK9A 3IIKA 2C9BA 1EJBA 1RJEA 5CVUA 1PZGA 1VYUA 1S2NA 4OYHA 1PS8A 1I3OA 3AI7A 1JEAA 2ZJ4A 1N9KA 5KYTA 1QYXA 3D4BA 5LP1A 2NSHA 3E53A 1KJQA 2C2GA 3PRYA 5D01A 3WVNA 2V7PA 3A4MA 1I2DA 1BEZA 5CEJA 1YASA 3DBOB 3EWIA 4J9VA 1XA0A 5JVDF 4NEGA 1WPQA 4XH9B 3EPHA 2XXAA 1JBKA 2G07A 4LV5B 1L4FA 1L6IA 1DBIA 1FFXA 1ULSA 2E9SA 2EWMA 3NWEA 2ZJ7A 4KX5A 5CMLA 1XLVA 2AC7A 3OWXA 3MWEA 2IV3A 2OBFA 3EC1A 2J0UB 5ER9A 4OQEA 2CZGA 2AN9A 1OT5A 4ZMSA 3CLRC 3PYXA 3B6IA 3QF7A 4Z9AA 4IWYA 4BLTA 1GEEA 2WNHA 5CM8B 1XKLA 3FOCA 3RU2A 3W2GA 1ZH2A 6PFKA 1SZPA 2ZUFA 2DH5A 1TO6A 1YL5A 2FMXA 1PS0A 4DC1A 2CW5A 2NLOA 3FPAA 4BFTA 1T1IA 1XZGA 1DBRA 2FOIA 2IH4A 1QC5A 1JVBA 2QUIA 4K0KB 1FSZA 1W4ZA 1GUDA 1GTMA 1NNLA 2NSDA 2Z2ZA 1CG6A 1NJ8A 1NUQA 3LXRA 4TXNA 3D5EA 5ALLA 5FQOA 1EBUA 3LAWA 2B92A 1ORIA 5CUQA 3ROTA 4JI3B 3SF8B 5DM70 2X1LA 2OBMA 3ETJA 4PX9A 1UOPA 4L02A 2DFTA 5B3JA 5CFQA 1LI4A 4OQZA 4GRDA 4HPWA 3FMOB 3ANSA 3AR4A 3BK7A 3GLHB 4TMZA 4Q9JA 4MR7B 4KREA 1CWUA 4XIJA 3DBHB 5FBRB 3S2YA 5ALVA 1F14A 3PC4A 2R6ZA 1Z0JA 4MKGA 3IBSA 2X19A 2PLNA 4RS3A 2GERA 1XF1A 3PPWA 5FP0A 2ZSBA 1KZ1A 3UXEA 4EJFA 1LQ2A 1Z2EA 2D0PB 3ZD8A 2JJMA 3GQBB 4EYKA 1B16A 3QV1A 5ESDA 4ZJYA 2G6TA 4LBVA 2HK9A 3J80A 4MW6A 2DXIA 4JSTA 1E1RD 3T95A 4IUDS 5LD2C 1YK1A 1BWRA 1KEWA 2IVFA 3T9FA 1MIHA 4B3HA 4YAFA 5EGNA 4IIDA 3ZJTA 1S7CA 4KRXA 1WSBA 4XX1A 5DBEX 1TK9A 4HGZA 4MQEA 4BLOA 1CU1A 4DIMA 4I55F 1UPXA 1YRAA 3Q4GA 1EFUA 3THWB 3D8RA 3LZDA 4IZHA 4MVJP 3T1NA 2XB9A 1T2VA 3TRDA 2D74A 3H7IA 4Q00A 4ZDIA 1PJ3A 4GE3A 5KB3A 1XRMA 2JVKA 2ZK7A 1GYRA 4JVMA 4Q37A 3GG9A 4PGGA 3RI3A 5K4AA 5J3JA 3I6BA 1O95C 3IDOA 5EQDA 5K3FB 1CS0A 1ZCFA 5FUWA 1JFRA 1M7GA 2CE2X 5K8LA 3MJSA 2PH1A 3B13B 3GPIA 1GQ2A 3MQFA 3CKLA 1SU7A 3OZCA 1O5TA 3IQEA 1NFFA 5EJ9A 3H5RA 2WJ3A 3CVYA 2DHCA 1M6EX 3N05A 3KYJB 3L0ZA 4G23A 3NIBA 1NV8A 2Q2WA 4EITA 4JFAA 4RHXA 1ELOA 2E82A 1U1DA 2PY6A 4WKPA 5JCJD 4Q4HB 4RVSA 1VE9A 3AL3A 3H5LA 3NPMA 3CVWA 1XPOA 3RIXA 3WIOA 1UXIA 4EX7A 4DYDA 2WIKA 3K94A 5KNCD 3K4HA 2FE4A 1CERA 3CLSC 3MT9A 2Y1FA 1OKKD 1FXSA 2MSKA 4FYVA 4X0EA 4AAYA 3H9CA 5I6DA 2D0IA 5ICCA 1SUWA 1PQUA 4LPSA 2ATCA 5A9SA 2JIMA 4EHAA 5BY2A 1PV4A 4PG5A 1J8VA 3COYA 4BTVA 1YHYA 1WZ2A 1ZMXA 1CUXA 2R7MA 4KQKA 3OCYA 5ABPA 2VDMB 4NBVA 2FEMA 2D0OB 4HLUA 5CNMA 3EDQA 5FTMA 4QBIA 1O2DA 3RS8A 4F38A 3ZHRA 3VR2D 3S27A 5LD2B 3H9GA 1O0CA 4QL3A 4FEEA 4QGHA 5BV0A 1E1QA 1VM6A 1N6HA 2FETA 3I8XA 4AWBA 4F5YA 3GN1A 2GTPA 5DM1A 3CZAA 3IDAA 2BFCB 3DFFA 5FWXB 3K71B 1BN6A 3ESRA 4F84A 1T9CA 1S7GA 2XBLA 4BNMA 4CLXA 3K5IA 2XUGA 2CDAA 4M1MA 2C7GA 4ZPJA 4ZZ1A 4JB0A 4P31A 2OPHA 2UXBB 2QF7A 2GPBA 3M33A 1WPRA 3FWNA 3VISA 3AJDA 3QFRA 2O1XA 1EDBA 3TTVA 5F21A 3RO7A 4K81B 1SPXA 1NOIA 2NXJA 4MJLA 4X1IB 3UMJA 4COKA 3HGQA 4U3JA 3OTOB 2DKFA 3DTVD 5FBHA 3OQMA 3UUFA 4JOCA 1NU6A 2GPJA 2CD7A 2JEZA 4HH1A 3UWSA 3SMVA 1UQRA 3GJ7A 1GSAA 3VZBA 3IBCA 4M0KA 1PR2A 2Y71A 2GCEA 2VPQA 3V2UA 3O8BA 1RJGA 2YY5A 3H2BA 2OGZA 4HUQA 4IZIA 1Z74A 3DFIA 2O7SA 3UAYA 5BVGB 3MOSA 3JAWB 2O3JA 1JEQA 1VP9A 3RLFA 4IQ0A 3EVEA 3K9LA 2J5RA 1KR5A 3G23A 4UM5A 3T5BA 3DZCA 1L7MA 3D8NA 1KPIA 2NZXA 2J31A 1DPFA 3ZU6A 4K8RB 3GJ6A 3K9FC 5CFOA 2GM3A 5GIPE 4TM8A 3R3YA 1SMKA 1R9GA 2C61A 1PT5A 1W46A 4FR5A 1NOKA 1VL1A 2G4CA 2ZIXB 3NYRA 3VKUA 1MFPA 2HSDA 3M83A 2HWUA 2DR2A 2GAFA 1N1MA 3GMDA 6CHYA 2XOXA 4MWOA 5DYNA 3BKXA 2DKOA 2YHBA 4JELA 2RIRA 4YTEA 4MB2A 4DCPA 1NNEA 3ICQB 4LJ4A 1F6BA 2YOFA 2ZCVA 4GR5A 3ZNNA 2IT1A 5E1OA 4UTZA 1JJFA 2OXCA 3AEUA 1RI1A 3EGVA 3PD7A 4IH1A 4JLWA 3ZK9A 4CHTA 5I51A 1P2SA 3F5SA 5TSDA 2RGGA 4FWTA 4IYRA 5U4XA 4CI9A 3AIKA 3WRVA 5AW1A 1W5BA 2AE2A 2BGLA 1IXZA 3GCZA 1DBPA 2HV9A 3ZUPA 4LJLA 2CMGA 4K05A 4XD7A 4PZDA 1B8NA 1KK3A 1ZW1A 2ACEA 3HDQA 3UH1A 3HABA 4FNAA 1TPZA 3QH4A 1P4GA 1C30B 1U31A 1V8BA 4IG9A 4KVZA 4K28A 5FLYA 4NFHA 3ESQA 3ICPA 4ZI7F 5I9LA 2FMHA 2WSSD 5M34A 1XPUA 5CYFA 5A02A 2WIBA 4U7FA 2VP9A 1W2GA 4JB3A 1QG2A 4PYLA 5LUBA 3U4QB 5ARCA 1S4QA 1TAUA 4EL5A 1OR8A 1IC6A 1N3IA 3GP8A 1K75A 1YZFA 1M0SA 1GFZA 2FFRA 2EW2A 3IRVA 1KDRA 5BMVB 1QP7A 1E0SA 4D4KA 1GZHB 2R85A 1ZL2A 1P17A 2IWRA 4E7OA 2GARA 4C5BA 4DV0B 4ZOAA 3O94A 1G21E 1QIGA 4QXPA 1QGZA 1SCBA 2H48A 5JJ5A 3W2TA 2XDWA 3NIWA 4X71A 1K8YB 1KDYA 3RFTA 3Q8MA 1PG5A 1FYWA 2EFYA 1UWVA 5HVNA 1UDBA 3LT4A 2ON6A 1FQJA 3G7NA 3VDRA 1NIPA 4B6JA 3E2MA 3O8DA 2JI8A 1DNPA 1ODTC 1N0VC 3DKVA 4LY0A 1LDGA 5M29A 2VDOB 4CFSA 4D96A 3IP9A 2V9ZA 3BN3A 4NBUA 5J1TB 3KVOA 1W7AA 3ZW7A 2BVNA 1JSZA 3ABOB 1ESCA 3O5AA 3WSTA 2DQSA 2PX0A 4S1OA 1HORA 4HUJA 2XQFA 3B3JA 3FZGA 3PFKA 5IAJA 5GZ3A 4F5WA 3E27A 3F2IA 1QR2A 2ZPAA 1TMOA 2H85A 4EK9A 3PXBA 5F23A 4A03A 3KJIA 4HCJA 2V55B 2XVAA 3FROA 1RPAA 1SEPA 1XZ8A 1NIJA 1NXVA 5EE0A 5AQEA 3IL2A 1LKZA 3ACCA 1YRQA 2ZRCA 4B46A 1H3FA 1CTQA 1FTWA 2HY7A 4ILEA 1CDZA 2VWGA 1LK7A 1EJ6A 1B42A 3OT1B 4LDQA 2AI1A 1LVUA 2C2ZA 3KV3O 4WBNA 2J7PD 3NDBB 4Q4JB 1H1LA 4JBXA 5K7SA 1SCNE 3A1NA 1I2BA 4FFNA 1PWXA 2PQ0A 4OHRA 4JDUA 2RK3A 1VA5A 3PX3A 3ITKA 1DKUA 2QIOA 3JQFA 1KMIY 1Y34E 2YV1A 4L95C 4PNZA 3ILVA 4QOSA 1GJRA 1PHRA 1ZINA 3IMCA 1J39A 5LBIA 3X1XA 4AMBA 4YMTA 4M86A 2XB6A 4MPJA 1GGJA 2RHRA 3LOPA 1UC5B 3PWSA 4TTRA 4XVHA 4IH9A 1EFVB 1ZIOA 1KGDA 3ORFA 1GKKA 4G5HA 4NX2A 3RAJA 4C4SA 1Q0RA 5JNLA 1HY3A 4WESB 2XUHA 5AJZA 1IK6A 1FUEA 2QD4A 5FWYB 5LA6A 1QGED 3VH3A 4BB6A 1P2BA 1SUIA 4B4DA 1P0QA 4J3FA 4LMBA 4GBGA 3ZTTA 4BU1A 4RVGA 5L3QB 3FSGD 5H5JA 4X5OA 2FSGA 5IAEA 5EJ7A 3BEOA 1H4VB 3OJEA 4D0LB 1UUFA 1VRCA 2V6IA 4FLMA 4TL7A 2H8GA 3TLAA 2GJ8A 4EABA 2D1QA 3REFA 4PG6A 2ZJFA 1QZ3A 1Q7RA 1NATA 1UC8A 1MW9X 4JJ7A 4BNDA 3CF4G 2R6HA 4MV7A 3P45A 4B2LA 4R0VA 5THXA 2P65A 4KZKA 2B83A 4MR9B 4ED9A 2EQAA 1CFZA 4IDEA 2N0SA 2WFMA 3HWSA 3T5CA 1IBCA 5HCNA 1PBTA 3W1WA 5JSUA 1OTXA 1PDWA 5I9IA 4NC9A 2A88A 5FYDA 3PFWO 1FXUA 1YH3A 3B70A 4QDOA 1IN1A 3CBQA 3CF0A 4AG5A 5A1TA 3KUDA 1D1PA 3PDCA 4IXDA 2R2GA 5KNBH 3H1GA 4IBOA 1DGQA 1V37A 2DFNA 1Y4UA 3K0FB 2WG0A 1E7YA 3E82A 4PNPA 2P4SA 4Z3DA 5ESRA 1U8ZA 1G3IA 1NYRA 3F3KA 3GJ3A 1ID1A 2W8BB 3OC6A 2HU8A 1NUSA 3AEKB 4HWOA 3PIDA 3H87A 4ZXPA 4ZN6A 1C3OB 1KHHA 3JATA 2DBVO 4P3OA 5HTKA 4B6GA 2A0FA 3BFXA 4EHLA 1E9CA 2BOVA 2QD5A 4CKWB 5H59A 1B1AA 2I6FA 3R3JA 1WNTA 2B8NA 2Z83A 4U7JA 3RS5A 1U9IC 2AEJA 2QWXA 1GPDG 2HF7A 3PKZA 4UEKA 1L8LA 3WMXA 4A6DA 4C04A 1NNSA 4EUHA 2GWHA 1MFZA 3Q1LA 2PVCA 1I7QB 3H1PA 3IV9A 5L51A 5FA6A 3V1TC 3WA6A 3JWEA 2EG5A 3IT1A 4ESOA 2VPIA 4DQUA 3WGLA 5BXQC 1K0FA 2O2YA 3AB7A 4KDRA 4OK5A 1APBA 4F9EA 3S2FA 2RAUA 3VR4A 4DQVA 5KYWA 4LE1A 4X94A 4AMYA 2VP3A 3OWOA 4NQZA 3TTSA 1TJNA 5HRAA 3LQFA 1UJ2A 3K1AA 1FFDA 3A6EA 4TKMA 4EW1A 3E1SA 1Y4SA 3A36A 1SWVA 3F1LA 2VHJA 1W30A 3CINA 2QAGA 2Y2VA 4S1NA 3HYRA 4BNGA 4EGJA 1T0UA 1XZQA 3I76A 3WJ7A 1SK8A 1UBUS 5TR9A 4D9GA 2W6NA 3UYLA 4MW7A 4OIFA 1M6WA 2Q5CA 1JHQA 2BY4A 1CJVC 2QS9A 3K0CC 2COUA 3LUGA 4PLWA 2REOA 1GZ3A 1VMDA 4YUYA 2BCEA 1KO7A 2G36A 1PR3A 4LXIA 2BSQA 3BXEA 3NNNA 4M83A 3GFGA 1YZVA 1Z7EA 2WI8A 3IAUA 3OAAD 3JWGA 3NTQA 4MA5A 1SCUA 2EIHA 4M9XA 1TIKA 4ZVUA 3AH8A 1GUYA 1HURA 3QYAA 4FMBB 5A3VA 3RC9A 2MMCA 2Z3ZA 3MQ2A 4MDHA 1VLHA 4O0LA 4RY9A 1N75A 1QU3A 4NF2A 4JGBA 1TTHA 1UMCB 2EP8A 4UEQA 1XPJA 5KTRA 5H3CA 1J07A 1FVOA 1Z8DA 2QZ9A 4FUQA 4UASA 3THXB 4P9NA 2FPXA 2CXRA 1E6MA 2VZEA 2C00A 4ZTZB 1A98A 1DL5A 4RPHA 4YT8A 5JH7F 4EEZA 4RKYA 5BYJA 2PFSA 2W98A 2C2MA 2NPIA 4JGIA 3STHA 3M3HA 4YUVA 1QG6A 4CFZA 1KTIA 1WU7A 4DIBA 5CIYA 2W42A 1EGMB 2QMEA 1RWNA 2VTKA 1QCDA 3CRNA 5HMMA 3S2ZA 1IZ0A 3PCRB 3MGAA 2DY0A 4RGBA 1PX2A 1YB1A 1MNAA 5KSPA 2O2IA 4C2AA 3IPCA 2VP2A 1A95A 2GLTA 4RTLA 2FEXA 1L7QA 1N5IA 3DA8A 3PHGA 1QFYA 4UCFA 3QBTA 4DMCA 1YR9A 4W5NA 2G17A 3U40A 2FPIB 3KR2A 5AHOA 3HI6A 1YZ3A 1TL7C 3AR5A 1B8PA 1KK1A 3LPDA 4IEIA 5DHPA 1MABA 4I1YA 3T3PB 1KL7A 2H5EA 1LDYA 4AP6A 3VNVA 4RZUA 1NUUA 2VDLB 4C7JA 3UJCA 1U2DC 3D8HA 3VR4H 2RK6A 5B2FA 1N3YA 3NKLA 1S2MA 4ZT2A 4B9AA 3AVYA 3A0UA 3RHFA 5AD1A 2P40A 1TM1E 1R8SA 1TVEA 2WZBA 4YIKA 1YJ5A 1OFTA 4OKNA 4B80A 1U2PA 2C2KA 1GAEO 2BAGA 3GNQA 1RC0A 2Y92A 4BMCA 2DCUA 5HXAA 1QQ5A 1DG3A 5CW2A 1DKRA 4MWSA 1XTJA 3M5CA 3MMSA 3QELB 1LDNA 3VPDA 4ZYTA 4JP2A 4NVRA 2AEEA 1ODIA 1V11A 3OCUA 3DF9A 1S96A 2D1YA 4IZOA 2I65A 4E13A 2Y1EA 6GPBA 3ABQB 4HUQB 2LD4A 3JYOA 3LRTA 1G18A 2I33A 3OZUA 3TIGA 1EFTA 4L76A 4C4YA 4RLFA 1EUCA 2I2FA 2J9ZB 3ENNA 1CUGA 1ZVKA 2R8PA 3CF4A 5CLGA 4ND7A 3UUWA 1DAOA 4DQ0A 4EAQA 3U7HB 5KTOA 5EHZA 4DMKA 2BTQA 2I8AA 3NWPA 4Q4CA 4OSPA 2H1SA 3B1XA 1J2EA 3K6KA 4OEHA 4ECEA 4LQDA 4M4SA 3GRKA 4IWNA 5LWHA 2QLFA 1D9XA 1MF7A 5IJ9B 4MQ4A 5EY5B 5EE9A 2YWCA 3IUPA 3ECAA 1E1CA 3OU2A 2XT6A 3U7RA 3NUGA 4W5JA 3ZOKA 4Y9UA 3L84A 4CM8A 3TTUA 2GN9A 2IVZA 3HUEA 4QQFA 3RSGA 1BFDA 2CYCA 3WLOA 1LU9A 3GVIA 3VO2A 4C5AA 2QA5A 3B53X 3HFSA 1PS9A 4I4IA 2B94A 4UBKA 1Z4IA 4YV0A 5DW3A 3BWDD 3PCXA 2FZKA 2RG7A 1SCKA 5D3MB 1ZJYA 2QE7D 1VBKA 1T8TA 1EFLA 3IJRA 1CDDA 3BM5A 2IYYA 2C07A 2ODBA 3E23A 3T4PA 3VTKA 3V2HA 1N2ZA 1MN6A 2Y8EA 2EJWA 3W9UA 1JSCA 1YI1A 2O23A 2AFHB 5JV5A 2CHVA 2VL7A 3I28A 5KQGA 4JBIA 2QRVB 1FMJA 2EGHA 5AI6A 3ZE9A 1USWA 3QFSA 2COEA 3TW6A 1Z4NA 2E4XA 2VQ6A 1CE8B 1SHUX 1JDSA 1XP5A 4IV5A 4R8MA 5CAEA 1R1DA 1NPTO 2PLWA 2O0MA 3DFKA 5EMJA 3FDXA 3O73A 1CZLA 3G5UA 4AJJA 1NP3A 3O1HB 3K92A 3K96A 5JH7A 4IHKA 1E99A 1Q77A 4JLJA 3N76A 4Z7NB 1Q22A 2X4IA 1FVFA 1LQUA 3CZRA 3FIJA 1K4MA 2AJBA 3KFXA 3GDGA 4ANFA 4YAOA 4RJTA 3LDAA 4IG4A 4NYMQ 5KX5A 4KI0A 3K0SA 2PUFA 3KUXA 1J0XO 3QYPA 3ZV5A 1L7DA 4O2BB 5LP6C 5SZJA 2W2VA 3PITA 1QRRA 4XLLA 2IZ1A 1Q19A 1AQUA 1EM8A 4JFRA 4AZ3B 1QANA 3NJ8A 1GPLA 3GD5A 1EU1A 3CX7A 4GLLA 1DXOA 3DD5A 3QG5A 5DVZA 2GJ4A 2HX1A 5JD6A 3EVFA 3QQPA 3UK6A 3HA2A 3GFVA 4GT1A 3RVSA 1SVMA 1IG0A 3BMXA 5AVJA 5G0TA 4EO4A 3O8OA 4XKJA 2GPNA 4WXHA 4AKEA 4DCCA 2AG5A 1T6YA 5JRDS 4KK3A 2E1PA 1B14A 4INOA 4C01A 2WT8A 2FH5B 2YOGA 1XRNA 2PJDA 2QW1A 4HRXA 4N39A 3KETA 3FKJA 1F0YA 2IUEA 3B1JA 3W8FA 5KJ6A 1AXGA 4C78A 1TYDE 1IBRA 3ABIA 5EESA 3V1LA 2VJYA 5B57C 5DU2A 1UBCA 3UWPA 5T3YA 2G76A 2R1TB 1G9XA 5K5EA 1XU7A 3R7AA 1GEGA 4G41A 3IQHX 2GNPA 1TC2A 4NWIA 2UUOA 3BTVA 3LFTA 3DCNA 4R7TA 3EK2A 1UPTA 3FI9A 4DJDC 2VAPA 1MJFA 4MMXB 4EA9A 4XWOA 1K92A 1XZLA 1Z18A 3M1AA 2QMUA 2A9OA 4NMWA 4BNFA 4GZ3A 1KXZA 1EVQA 4QGBA 3A37A 3TRIA 3EW7A 1JS1X 1N3BA 4LXQA 1SKYB 2PLRA 2DFPA 3MMNA 3PA8A 1NQTA 4PTLA 4CMAA 1TPYA 4MKRA 1KK2A 2AMJA 2HA2A 1QTRA 3VO8A 2OCYC 2XCUA 1M0TA 3FWZA 3JD1A 4R2WA 4MVJA 4ERXA 4D0RA 3GV0A 1ONSA 1RZRD 4MICA 1U7PA 4WCDA 4QVKA 1BN7A 1BD4A 2A5YB 1EGAA 1IM8A 3C97A 3DNFA 4V0OA 1F2TA 2Q50A 2XNDA 1KK0A 3DF7A 1FYDA 1YB2A 2CNOA 3JZDA 4I9NA 4M9CA 4ZI5A 2W70A 4NFYA 1C0PA 5ALKA 4F6CA 1QFZA 2AQ8A 2YWFA 3RS4A 1ZPDA 4PLHA 4KVGA 3QWHA 4HXGA 1M8PA 4CXMA 4D9BA 4WFIA 1UMDB 3DDHA 2ZB8A 2JZNA 2UKDA 4LQ4A 4BE4A 2ZJ6A 1SXGA 2O05A 3EVDA 1X8XA 1ZGBA 3PJDA 4DV6B 4FSHA 3RE1A 2RGBA 2O8NA 5G4KB 3I45A 3EXEA 3QVSA 1RBZA 1OXKB 2CCJA 4WX2B 3HXPA 1E6UA 1XDUA 2BJWA 3DTYA 5KQPA 2OXTA 3A58B 5C1IA 1GGHA 4DNXA 5AT1A 1YUMA 1JG2A 2WJIA 4FFDA 4A27A 1HETA 4L08A 4NZOA 4JBNA 1T36A 4RA6B 4PCVA 4AZVA 4HAZA 5I7FA 3ER9A 1P0IA 2AW5A 2ZITA 2LTAA 4RVCA 4Q9LA 3ZDQA 1D1QA 2BGMA 4NCKA 4JY7A 1WRBA 1JG1A 5SY4A 2HB6A 2Z4TA 4BKOA 2YZ2A 2Q4TA 2JI4A 4M55A 3AX6A 2RC6A 3RS2A 1EWYA 4FYKA 4OX9B 2C3MA 3GYGA 1QYCA 1D8TA 4YAJA 1GDDA 5T5QA 2FW8A 3H75A 3PGJA 1QQTA 5EINA 2Q7OE 5HJ5A 3K20A 2JANA 4I4CA 4PC2A 3WWCA 1K7YA 1UJ4A 2OOSA 1V25A 2XYQA 2WPDA 3GCXA 4C0AC 2PZMA 4M1YA 1S2IA 5REQA 2A9JA 5HK9A 5KMGA 4RTOA 2QUZA 5AKZA 1NL3A 4KXUA 1LF5A 1MB4A 4Y2VA 4C06A 4TL8A 3W90A 3UWOA 1MEJA 4C4AA 3FOWA 1B0UA 2G80A 4Z9YA 2X7XA 1QJCA 1X38A 3SJ7A 1IJKA 1GN8A 1L5ZA 1SA0B 1A1SA 1R0KA 3EWNA 1B15A 2AN1A 2C5SA 3FHCB 4MUIA 1KYZA 1NW3A 3GVXA 2CEKA 4NE9A 2GM5A 1OH6A 4RJ2A 4UDXX 1USGA 1PNQA 2FX5A 2ECPA 3BMQB 1WZCA 2GLXA 3BHNA 3OEED 2SKCA 2R00A 2XZTA 1XCLA 4MVJE 1BMDA 1WDMA 4KG7A 4NENB 5T4EA 3RROA 3PKJA 4DLNA 3H42B 2HPAA 1Z07A 1SVWA 2WT4A 3YASA 1X7YB 4CMCA 4Z0TA 4C0HA 1DKPA 1N92A 4AO8A 2GXSA 3L7AA 4DM3A 1L7NA 2VDKB 4RZSA 1E1CB 1FFSA 2BFMA 2Z2KA 3FPEA 3PQ4A 4GO1A 2WJVA 1H66A 3FGPA 5CFNA 2O7QA 2D06A 3E9RA 5ENDA 4KQEA 1XDBA 2FZLA 3ZXIA 3GN2A 3IERA 5A4MS 1PJ2A 4QTXA 3EEIA 1LZLA 1H0HA 3W5SA 3VSBA 2BGRA 1C3LA 3FBWA 1IOZA 3C5HA 3GY0A 4DCSA 1JR4A 1AT1A 1W36C 3SSOA 3F6CA 2NV2B 2UUAB 1E60A 2BZ1A 3K9BA 4DJJA 3N0VA 2Q3MA 2E4AA 2XE7A 4XQGA 5CNIA 4AS1A 2ZB2A 2FPPB 3ZEAA 4RTRA 1H1LB 5K8UA 1M0EA 3C8DA 1FFGA 4AXXA 1QKKA 3WKAA 4DCNA 4D6YA 1K7XB 2AVNA 3B89A 1G1AA 4MS4B 3T15A 3TXYA 5IT0A 4OLJA 1AGRA 2A1UA 4BO9A 5KYXA 1CUCA 2RKOA 3BE6A 3PFIA 5DKFA 2TYSB 5AKEA 2X0EA 3Q6NA 1UWCA 1T8PA 1E7SA 5A4IS 2PGLA 2C9ZA 3C5WP 4IMJB 2GILA 4UQPA 2EWWA 1T34A 3O90A 1BW9B 4RSRA 4P35A 3ADOA 2A7QA 3EZFA 4H1UA 2VHUA 3AC0A 2IITA 5BSWA 2FPRA 2Y4NA 1XU4A 2P2YA 3ODGA 3JQ9A 4FWIB 4OMFG 5JRZA 2BMWA 4U2FA 2Z5GA 3H2ZA 3FUXA 1T2EA 1YIDA 3QEBZ 1DT3A 3KLNA 1Q11A 3M4XA 3THSA 3ZV7A 1NP6A 4DXHA 1OZHA 4YJ3B 5B37A 4FFPA 2JVIA 2LZ0A 3LT1A 4M6WA 4MRRA 3W5VA 4DA0A 4MDYA 4RK0A 1XTQA 5DI9A 3C7TA 1DV2A 2RBGA 2G77B 3MCZA 3F7MA 2Z4RA 3LQ1A 3BD7A 3ASYA 3UC9A 3I6MA 4NCHA 4DA4A 5IASA 1WX1A 3BGSA 4UD6A 1SY7A 1XTKA 1USIA 3L4SO 4G1BA 2BC9A 3UOGA 3MGCA 1OAKA 4RPLA 4EDFA 2YRXA 521PA 4CQLB 5DBFA 1XEXA 3B3FA 1PZMA 1YE8A 3MBOA 1RXCA 4P3XA 2QVZX 3ZTWA 1FXWF 3AHIA 1D4ZA 3GDFA 3JD0A 5AKKA 4P98A 2VBGA 4P3KA 3TFQA 2CBXA 1RTKA 3EXIA 2P0AA 2XTMA 3GGOA 3WZLA 1HLPA 3HBJA 5CA1B 2EERA 4M87A 2HRRA 1ISSA 1Z73A 3TL3A 2FUCA 2Z56A 3EFBA 4RDXA 2ZSEA 1ZGJA 1KDVA 1XYYA 5LL6P 1QX3A 3AFHA 1CY6A 4RS4A 3SXJA 3H2YA 3ACBA 4P7BA 3ZU2A <