1F12A

L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDECVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequestration of the active site by interdomain shifting. Crystallographic and spectroscopic evidence for distinct conformations of L-3-hydroxyacyl-CoA dehydrogenase.
pubmed rcsb
molecule keywords L-3-HYDROXYACYL-COA DEHYDROGENASE
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1f12A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1f12A01
4K9DA 1GEEA 2XPCA 4MKRA 4DL9A 4EJ0A 3HUDA 1EUDA 4N5MA 2OGUA 4ZQFA 3OMLA 2FR0A 4NFSA 2RHRA 4OOFA 3TZHA 4WJZA 2RBEA 4RL6A 2P2SA 1ISIA 3GG9A 1T2EA 8ADHA 1Y5RA 1M6HA 4F6CA 4K6CA 4KMSA 4CUJA 1YQGA 1GTMA 5CPBA 5FEUA 1HE5A 4TSKA 3WYEA 1O94A 3U09A 2GRAA 4RPKA 4NU5A 2HU2A 4LRSB 1U5AA 4YEDA 3RUFA 3LF2A 1DIRA 4L0QA 3ABIA 4B3IA 1WMBA 3RSHA 4WLNA 4FOOA 1B3RA 1Y1PA 1X14A 3IDSA 5CG1A 4LCJA 2NVUA 1YGYA 1X0XA 3HNPA 3DOJA 1HDXA 1C1DA 1ZEJA 3TF5A 3VOSA 2IZ0A 3EVTA 3JQAA 1ZKMA 2DVMA 4CQMD 3ANNA 4DBZA 4W6ZA 2VHZA 1ZSYA 2OP1A 4GLLA 3W8EA 2C07A 3ZHBA 4P4NA 3WGZA 4FC7A 1NWCA 5HTOA 4H16A 2QYTA 3AK4A 4II2A 2D59A 4EI2A 5T64A 1F12A 4CMIB 1VLLA 1LC0A 4Z0HO 2WDZA 3I3OA 4JLWA 3KM0A 2HMWA 4B7XA 1ISMA 4BGVA 4YT5A 2FP4A 2VRBA 1H6DA 4URFA 2WEKA 3PK0A 4J7UA 3K31A 4FS3A 2F00A 3SC4A 1BDMA 3OM9A 5EL0A 5ITWA 4RVUA 4CPDA 1IUKA 3QV1A 3MJCA 1QXSA 1PIWA 3S2GA 3WB9A 3ZNQA 1JWAB 1PJBA 1Y6JA 2NU9A 4JQCA 4D3SA 5A3VA 2B69A 1ZZEA 1V0JA 1NFQA 3I6QA 1I8TA 3I4FA 4R41A 2VUSA 1JU9A 2GZ1A 1XKQA 3MJTA 4HWKA 3WGGA 4IJKA 2CD9A 3FNFA 3KXDA 3DAPA 4WLVA 3WLEA 3GNTA 1RJWA 4YRBA 5HBRA 1YWGO 1AHHA 4YAEA 1I3LA 1VJ1A 1EBFA 1RM0A 1HDCA 4BVAA 3L9XA 4MVJG 4PG5A 3HHPA 3ZWMA 4XYLA 3AOEC 3DONA 3CH6A 1GQ2A 5KOIA 1QYVA 4E30A 3WLFA 1B0AA 3SJ7A 1GYPA 1BVRA 4BO8A 1KEPA 2I3GA 4GKBA 4JJGA 3Q2IA 2C2XA 4OYRA 3H5RA 2FPGA 4B3JA 2O3UA 3JQCA 5IZ4A 4PLVA 3IJPA 2YFHA 5GZ1A 5DP2A 4HFJA 2ZIZA 5T6BA 3V1TC 5COBA 3HFGA 4XYMA 4O1MA 4ND5A 4BB5A 4BNNA 4OGWA 2ZK7A 3D7LA 4RF2A 3OF2A 2ZKLA 2C59A 5CPFA 3WWYA 1LDYA 2XOXA 1LC3A 4UEOA 4EGFA 4RVSA 1LLDA 4XQGA 2O3JA 5A5FA 5DP1A 3KYBA 1C0IA 3TWOA 3LT2A 5FF9A 4ALKA 4OSPA 2QRKA 3L77A 4TQGA 3QWAA 2EGGA 3ASVA 4MKXA 2B35A 1K89A 2DTDA 4BNYA 1DRUA 3HG7A 4LW8A 3WMXA 2RIRA 4B4OA 1SPXA 1DRVA 3WFIA 3H5NA 4WCDA 1PJ3A 1IHXA 5AXBA 1ONNA 1AXGA 2V7PA 4Z3KA 3IAHA 3DO5A 2EW8A 4FJ0A 5C37A 3U4DA 1YOVB 5TGDA 3ZV6A 3ZU5A 3MJEA 4QSMA 4RVHA 4GLOA 4XD2A 1ZNQO 4CM8B 1YXMA 3NKLA 5HA5A 3DTTA 5C7IO 1SB8A 3KYCB 4IJVA 1UAGA 4E21A 4BGIA 3D4PA 2WD8A 4RLSA 2O2YA 4L9RA 5IAAA 3PI7A 4R54A 2GO1A 2Q46A 1ZSVA 1H6CA 5KWEA 3NT4A 1DIBA 5LDGA 4R1NA 1NBOA 1PZEA 3VDQA 2GUGA 1LQUA 1LLUA 3WQQA 3MTJA 5ER6A 4CLEA 2OMEA 3C85A 4LGVA 3GEGA 3SX2A 2I65A 5TC4A 3H3JA 4FSHA 4B4VA 2JL1A 1VKOA 1NPDA 1GFSA 1GU7A 1WVGA 3Q11A 1R0SA 1C0PA 3ZHXA 5G0SA 2BFOA 4YRDA 2NWQA 4RF4A 1ZSNA 2VT2A 3AY6A 4CM3A 4CMIA 3RKUA 2AQ8A 5TQVA 1HEUA 4BO0A 2ZTLA 4MO2A 1FXSA 1N92A 1VSUA 2FZWA 1VE9A 3JQ6A 4PRKA 2C54A 5L4LA 3IQDB 4I9HA 3VC7A 3MOGA 4JBIA 3L6EA 1LXCA 3B6ZA 2HSDA 1ZJYA 3C8MA 3RFVA 3EK2A 3KLPX 3GGPA 3I9JA 3WGTA 1IOLA 3GF4A 3LU1A 1E1NA 5DBIA 1H9AA 3ZDFA 1NX6A 1M66A 4FFLA 1YL5A 5A02A 1EEHA 3GVHA 1AHIA 1GDHA 3ZU2A 4Y67A 1J0XO 3NRCA 3UFXA 4H7PA 1ENZA 1O6ZA 2EHDA 3DL2A 3IMFA 4NPCA 2HK9A 2VWQA 1KETA 2ZATA 1YL6A 4PZCA 2OBNA 4IQ0A 4XGNA 3FN4A 4AJ1A 3AI3A 3GPIA 1DIAA 1FDWA 1TB4A 2I76A 2NU7A 5F1OA 3K9QO 1I33A 3KSDO 3H4VA 4L76A 1RKXA 3ZV3A 1BXGA 4MIEA 2VCYA 2DAPA 2YHIA 1PGQA 1VC2A 4FD3A 4TVBA 4WEOA 3VKUA 4YVFA 4BKQA 2BFPA 4XJSA 1YONA 3EC7A 1Q1NA 4JIGA 2CF6A 4I9UA 1RM4A 4J43A 4PLZA 4P38A 3X2EA 4ALMA 1HSZA 3JQEA 2P9GA 5L4NA 3AJRA 5U1PA 1OI7A 1GPJA 2PGJA 4GPD1 5JAMA 1BWSA 3QVSA 4XA8A 3F47A 3ORFA 4EUFA 3F9IA 4CM7A 2DTXA 4OQZA 4N5LA 4R9RA 1PR3A 1E7YA 3E1KA 1SMKA 3R3SA 1G1AA 1QLHA 1XHLA 5F21A 2PA3A 3D5TA 1UP6A 4E13A 3VPGA 3E03A 2BFMA 4IQGA 4GAEA 1U1IA 3AOEA 4CM5A 1KEUA 3CEAA 5EINA 1ZVMA 2NTNA 4TKLA 1LUAA 1LRJA 3PYLA 3KO8A 4FGSA 3I9MA 3PGJA 3I23A 3EHEA 1C14A 5LDHA 5G0WA 2HMSA 3O03A 4A7PA 1E1LA 4CM1A 4DPMA 5L4SA 2RH4A 2YV2A 2DC1A 3IL2A 2G76A 1KVRA 3LT4A 5JDCA 4CV3A 2C0CA 2Q1TA 4GX2A 5L3ZA 3F6YA 1CEQA 1V8BA 3GN2A 3JD1A 4F6LA 2VYVA 1DB3A 4FB5A 5I7FA 1SB9A 4C7JA 3KB6A 1PJQA 2UYYA 1E7SA 2ZCUA 4QO7A 3ZV4A 3WNQA 3DFUA 3NT5A 1NR7A 4RV9A 4CODB 9LDBA 2JFGA 1I32A 1YOVA 1LU9A 4LMRA 4IJWA 2A35A 4YPOA 2J5QA 2VRCD 2VTEA 1UR5A 3GZNA 4LSMA 4M54A 4CM8A 3TZQA 5JNLA 4HFNA 4O6VA 3WIDA 4RVGA 3CMMA 1WP4A 4P22A 4KQWA 3KYCA 3LLSA 3GLQA 4RZIA 2Q4EA 1JA9A 4CUKA 2IRWA 1I5RA 5CG2A 2NQTA 4MVJF 1BHSA 3HDJA 2BGMA 4RVFA 1EVIA 4FJ2A 4Q3DA 5A9RA 4TRMA 1LSUA 4C4OA 1GL3A 4I5FA 4MP8A 4K26A 4NHEA 4FIZA 1I0ZA 4M89A 4MINA 4Q3EA 1YE3A 2GR9A 4LRTB 1I01A 1E6WA 1FJHA 4EBFA 3N58A 2HDHA 1A7KA 1IZ0A 1KY5A 4MDHA 3BMQB 3Q6IA 3R0IA 3AI2A 2DTEA 3DZKA 3KEOA 1Y7TA 1AN9A 4D41A 3ZHYA 4TROA 3FTNA 3S55A 1H2BA 3MJ4A 1KEVA 1PEDA 1WAMA 4RF5A 3BHMA 5B37A 2Q45A 3GGOA 4OM8A 4NFHA 4WECA 3BTOA 3Q2KA 1EUZA 4I08A 3WYCA 3VPSA 3PIDA 4NFYA 4YAGA 1D3AA 3MWDB 4XEHA 2UDPA 2GD1O 4P8RA 3CKYA 3QWHA 1WLYA 8LDHA 1B7GO 4JP2A 2V6MA 4JNKA 4JX8A 1DC5A 3HDHA 4ZRNA 1X1TA 3RFXA 1I3KA 2ZYAA 3PPIA 3WGQA 1NTOA 2YV3A 3DOOA 3JTMA 1UUFA 4NZ9A 4J90A 4H15A 3NGXA 2PD4A 1AGNA 5TLSA 1GYQA 4ZJUA 1BG6A 1B8PA 4UUMA 4DXHA 2XXJA 1T2DA 3QJ5A 4J1TA 2X86A 2FPPA 2X0JA 2GF2A 2XXBA 5EIOA 5I9MA 3ZU4A 5IDWA 1SOVA 4XRRA 1Q2XA 3TZKA 3UH1A 2OL4A 2J8ZA 3ETGA 1NHGA 1EFLA 2AXQA 3G17A 2XAAA 3PWKA 5CAEA 1HZZA 3GG2A 2X6TA 4UUPA 1QG6A 1T24A 2GN4A 1SEVA 1W8DA 2A4KA 2G17A 1P0CA 2ZJ1A 1BMDA 1ONPA 4AJKA 3GEDA 1N9GB 2BI7A 4JJFA 4NDNE 4CUZA 2BI8A 4ZQGA 1E7WA 3T4EA 2VQ3A 4GX0A 2ZTUA 2AEMA 1M2WA 3JV7A 2PZMA 3DHYA 5L40A 3SC6A 5CDGA 4LVUA 4CR7A 2ZYGA 1HT0A 4D45A 1Q0HA 1N8KA 3WGHA 4DQXA 1I2CA 3TQHA 1YBMA 3BIOA 4J9VA 1V3VA 4Q3BA 3QVTA 4R4JA 1LDBA 3FNEA 3UICA 4U7WA 4XYEA 5ADHA 3QY9A 4IXTA 1P33A 3KYDA 3ZWAA 3F1LA 1UZLA 1CDOA 3ANLA 1PJ4A 4BKRA 3LK7A 1K2WA 5JAQA 3H2SA 4WLEA 5T67A 2VN8A 2ZYDA 2RAFA 5IXYA 3IC5A 3WQSB 1WPQA 2BELA 5I8WA 4S1VA 3CZRA 1H0KA 2X9NA 2GLXA 4TRJA 3K92A 3S2EA 1XELA 3S8MA 4IBOA 4TZKA 2P5UA 5JY1A 3AUTA 3B1KA 4OXKA 1E7MA 5COAA 2B36A 2PTGA 5DBFA 3QWIA 3RC2A 3ZW9A 3WS7A 1OZAA 1IHYA 4IDBA 3V8BA 5U4QA 1MA0A 2VTDA 2ZJ0A 1I2BA 3ULKA 1KY4A 4DIOA 3O9ZA 1S7CA 1VL8A 2E82A 1F0YA 2O7QA 4BKUA 3I1JA 2CVZA 3DDNA 4CL8A 1MB4A 2P68A 2PD6A 1Z82A 3AWDA 3ONEA 1BGVA 4ZQHA 4BMSA 3H9JA 4CV0A 3HN7A 4KTTE 4IINA 3UKOA 3BMQA 4GSKA 1VRWA 3F4BA 1E3WA 4L74A 1PGOA 4GVLA 4AICA 3BA1A 2OO5A 5TJ9A 1E3LA 4GKVA 4CQMA 2IE0A 3VH3A 3CXRA 4BNGA 5KVCA 4TKMA 3W4IA 5C7OO 1CQJA 1KEWA 3HFSA 4NR0A 2EJWA 3ZGYA 4YCAA 2B4TO 1HKUA 2FHSA 4MVJA 5T8KC 2BGKA 2X9VA 1R0KA 2EERA 4J4BA 3GVXA 1NQ5A 2YUTA 4NG5A 1D8AA 2Y1FA 1U28A 2VOJA 5JPIA 3NYWA 2Y1CA 2P91A 5IN4A 1ZO8A 2W90A 3WJAA 3KSZO 2D2IA 2Q4BA 5G2OA 1YH3A 4AJEA 1Z7BA 3BHIA 3E9NA 1VJTA 1DC4A 3NTRA 1ADCA 2AMFA 1GUYA 2C7VA 4H3VA 2C2YA 2IEBA 2C5EA 4IMPA 5DULA 1T4DA 4BV8A 3FRJA 3IOYA 4CMBA 4XIJA 4NMHA 3BMNB 1EUCA 4OKIA 1Y8RA 3IUSA 1NNUA 4PG8A 2JCYA 4JBHA 4E5KA 4OHUA 1PJCA 3QE3A 2WJPA 3WX0A 2Q2QA 4MVJH 3RU7A 3BXXA 3HSKA 3OIFA 1BW9B 2A94A 1PJTA 1ZK1A 4Q3AA 4J6FA 1ULSA 3N74A 3I9OA 7ADHA 2PY6A 4NJOA 5KCZA 4UUNA 4FFOA 2PLAA 3DEYX 1K6JA 1KBZA 1XGKA 3HDYA 2GGSA 3GMSA 3ZCXA 2EF1A 1DIGA 3EAGA 5JFOA 4BQRA 3L4SO 5TRTA 3TOZA 4YWJA 3DZFA 1DSSG 2Y0DA 3IKVA 3JD4A 1LTHR 2X1HA 3UW3A 5DN9A 3GAFA 3V2HA 1N7GA 1EK5A 3CTMA 3QIVA 1GYRA 3F5QA 1B15A 4OXYA 3RJ5A 3S2IA 3V2GA 3OQBA 3PJFA 1U8FO 5KKCA 1A5ZA 2GCGA 3VH2A 1DIHA 3M2PA 4BUCA 3E18A 4NK4A 2FSVA 4ND2A 3RUDA 2H6EA 3WYBA 1A4UA 4W99A 3LC2O 2X7HA 1R4NB 1E6EA 2NQ8A 2PD3A 3GA0A 3UCXA 4BNVA 1QV6A 1EVYA 4R69A 2O23A 2NU6A 2EV9A 3FNHA 3EW7A 1L1FA 4E5YA 1FK8A 5JS6A 4DPLA 4PGFA 5TNXA 3RC7A 2UUOA 2VZ8A 3W6ZA 1ZIDA 3WG9A 3GGGA 3MJSA 1B3BA 2X23A 3WQRA 1I30A 3VPHA 2X58A 4YBZA 1EQ2A 4GX5A 4P4LA 2ZTMA 1ADFA 1OC2A 2CMDA 1BXKA 1UXHA 3ADOA 4PRLA 1EE9A 4ZVVA 4F3YA 1P74A 1RYDA 1H5QA 4CLHA 1X7HA 1PJSA 2V65A 2G0TA 2EKPA 3JQ9C 3EDMA 4XQ9A 1EBUA 3GVCA 4J2HA 2VWHA 4O5OA 1C0KA 4RQUA 4XZ3A 3KEQA 2OBYA 1KIFA 3U9LA 4IIVA 3BAZA 2CZCA 3PYXA 3S1LA 2BHLA 3PHIA 2E49A 3TL2A 4BNTA 2PV7A 2GZ3A 1R12A 3W4JA 1MFPA 2HLPA 1ZJZA 1SNYA 4B8WA 3UXYA 4CR6A 4LCEA 1E92A 5BT9A 3RU9A 1U3TA 5GMOA 4ALJA 3LDHA 5B1YA 1RYEA 1WXDA 4G81A 3P19A 4QQRA 5ILGA 2B83A 1BSVA 3FWNA 1ZUD1 4AVYA 4GI2A 4PZDA 4A03A 3RIHA 2Z1MA 3I4CA 3CINA 3NT2A 5L7WA 1WWKA 1BXGB 3GNQA 2YHIB 5I8ZA 3GRKA 4OL9A 3EZYA 4FOSA 5KNLA 4R1SA 4CL3A 1B16A 1QKIA 2QG4A 2O4UX 2GSDA 3JQ8A 3F5SA 3RC1A 3L6DA 1PR9A 4DQUA 4EEXA 5B12A 6LDHA 5HRUA 4EJ6A 3AW9A 1J49A 4G5HA 2O3RA 2OORA 1LDEA 4YQYA 1KVQA 3VTZA 4XGKA 4RVDA 1SEPA 1ENPA 4FN4A 1VJ0A 4Y6PA 4JJIA 1LSJA 1UDCA 1D7OA 3JYLA 4N18A 4WLUA 5JDCC 1K6IA 3VVCA 3LYLA 5GZ6A 1SBYA 4ND1A 5I7EA 4UEJA 3GHHA 1H9BA 3H8VA 5T8KA 1P1JA 4DLBA 4XB2A 2YYYA 1DAPA 1DC3A 3BMNA 4II3A 3H9EO 3WGOA 4BO7A 4U6QA 5G0TA 2JKVA 3FPLA 3GN1A 3K5PA 2FZEA 1K5HA 4TRNA 4FC6A 3KHUA 3PQEA 5DZSA 4ALIA 3U4CA 4K6FA 4GMGA 4DLLA 3W6UA 1BW9A 4U0KA 3NV9A 5A4DA 4M1QA 1O95A 3MOIA 2J3JA 4GWKA 1ONOA 1N5DA 1W4ZA 2VNSA 4RPHA 3NUGA 2O4CA 3OBBA 5CP8A 4WKGA 3M1AA 4BGEA 5TT1A 2D3TA 3JYPA 7MDHA 4IXWA 5AQ1A 3GOHA 3EY4A 1GPDG 3FR7A 1XWFA 1QLJA 3ETDA 3ICCA 2EKLA 3ETEA 3FHLA 4IY1A 4XJTA 1GUFA 1CRWG 1HE2A 1JWBB 2AEFA 4XIYA 2UV8A 1E6UA 3K6JA 4CLDA 2BF7A 4EITA 4EW6A 2FSSA 2LDXA 3NTQA 3ZI0A 3OQ1A 5IF3A 3GZNB 1ISFA 4PVCA 2V6GA 1P1IA 3ZWNA 5CEJA 3QVWA 2GN6A 3LSYA 3JQAD 3WBBA 2DLDA 1VM6A 5BNIA 4N54A 3QSGA 3E82A 2YJZA 5LC1A 3I6IA 3GC6A 3PLNA 1R4NA 4MP6A 3PGXA 4RGBA 3GFBA 4XR9A 1IZ9A 3INGA 1H94A 1G6KA 3IJRA 2H1SA 3FTPA 4OKNA 4RO0A 1PS9A 3C24A 3ROPA 2R00C 2NSDA 1FMCA 5IDXA 4RZHA 4XYBA 3H6KA 4MVJE 4CLRB 3Q9NA 4J0EA 4MIYA 2GN8A 3KLMX 4EUHA 1R4MB 2ZB8A 1A27A 3JQGA 3OA2A 1F8GA 5G4KA 1LSOA 1P0FA 1W6UA 2DFDA 1KVSA 4MJLA 5TS3A 3RBXA 1RM3A 1U4SA 1JTVA 1RWBA 1DHTA 5CEFA 2X4GA 2EJVA 2DBQA 4QXMA 4B79A 4CMAA 3DB2A 4MP3A 5I7VA 2WD7A 1HTBA 3RJ9A 5CDUA 4ZHSA 1Q0LA 2Q1UA 3VTFA 5DCWA 3GK3A 4E33A 1UP4A 3A9WA 2GDZA 3MJVA 4DIBA 2EXXA 5CFZA 3RWBA 1H6BA 1WMAA 4BGUA 4O0LA 2C82A 2CFCA 5G0UA 4KUGA 4GMFA 2BH9A 4KDEA 2VHYA 3JD0A 1XLTA 2NLOA 5GZ3A 3ZWPA 1XU7A 4J91A 2GYYA 3LVFO 2Q2VA 1YB4A 1OOEA 2OFPA 2O3TA 5L45A 1ENYA 2Q3EA 3PHJA 2AE2A 4QFDA 2X8LA 3RAJA 1PJLA 3JQ9A 2I9PA 1TEHA 3D4NA 2R6JA 1A4IA 4IPTA 1V9LA 4WGGA 4ILKA 4FBGA 2ILTA 5AXCA 2ZB4A 3GEMA 1LRKA 4JCOA 4TRRA 4BB6A 1EMDA 4WUVA 4DWVA 1UJMA 4W7IA 1HE3A 1MGOA 5JCJA 3L4BC 3FSRA 4XQCA 2D0IA 3O4RA 4EZBA 3RUHA 1U9JA 4I1IA 4ZD6A 2EKQA 3QHAA 1P9LA 3A4VA 2POQX 4CV2A 1R37A 3VAZA 2X0RA 3C1OA 2Y68A 1UDBA 4NK5A 1IPEA 4KOAA 4PG4A 4N7RA 1LNQA 2E4AA 2J3IA 4KWIA 5I7SA 3MCVA 2DUWA 3GPDG 3KRTA 2BMAA 5KVQA 1ISGA 3A1NA 4DYDA 3O38A 2W4QA 3DBHB 4OMUA 3T4XA 4AJOA 3DHEA 4OQYA 3CMCO 5EMHA 3CUKA 3AOGA 3C7DB 1QRRA 1C1XB 1HYEA 1XQ1A 1P3DA 4M86A 4WASA 2Q50A 1E3EA 1LQTA 3H5AA 3NJ8A 1CERA 1JKFA 4PLTA 2DT5A 2HAEA 2Y99A 2HMTA 3V2UA 2A92A 2FRDA 1ZH8A 2VYNA 3K2EA 3KYDB 4YRAA 3NTOA 5TIIA 2PGLA 3AM4A 2IYOA 3MZ0A 2WWRA 3EVNA 5A03A 3Q1LA 1NR1A 3D5QA 4HADA 1DO8A 3OJFA 3CE6A 3P2OA 3PHHA 1HWYA 1NP3A 1Y9EA 4LK3A 2O50A 4J0FA 1PZGA 2CDCA 4NI5A 1UH5A 1I24A 2PZLA 3L0DA 4W82A 3PYMA 4DTIA 2X5KO 1MXFA 1QMGA 1P1HA 2HRBA 1P1KA 1D1TA 3F46A 3JQBA 4ESOA 3G1UA 4G2NA 1Q0QA 1IE3A 1TT7A 3EZLA 1W73A 2W98A 1LSSA 5CDSA 2Q2WA 4NU6A 1A9YA 2G82A 5KJCA 4JGBA 1Q7GA 1Z73A 4Z3DA 2GZ2A 3FNGA 3CSDA 4E2ZA 1ISHA 5JSFA 2BLLA 1UZNA 4PLPA 1R6DA 2P5YA 5TJHA 1DLIA 3PJGA 1T1RA 3HE3A 4Q39A 1PL8A 4BNMA 1QP8A 1O5IA 1YRLA 4CLRA 1E3WB 4E31A 1ENOA 3JD2A 5JY6A 1R4MA 1CF2O 1NAHA 3UCEA 3WICA 4CQMB 3N7UA 3F3SA 1ULUA 3PP8A 2I99A 3IKTA 1I3MA 1YBAA 3OJOA 3UF0A 3ZU3A 4A26A 4NQZA 5AVOA 2OUIA 4OJNA 3SXPA 3GDOA 3WTCA 5JW6A 1J6UA 1FDSA 1BTOA 2WMDA 4DVJA 4AL4A 2GERA 3SEFA 5G4LA 4CMEC 3I5MA 2GASA 4CMHA 5TT0A 1M67A 2HCTA 3UAGA 3WSWA 2R00A 3OEWA 3RUAA 2PZKA 3PQFA 4J7CA 4BHTA 3ZZNA 2DPHA 4LVCA 3RUEA 4NBTA 3DZGA 3DTYA 3GVIA 1GQYA 4GVXA 3VH1A 4F45A 5H82A 2AQHA 3PIIA 3LC1O 3OFSA 2W2KB 1DPGA 4ZRMA 1GCUA 3LT0A 2WYUA 5B4UA 4UVDA 1F06A 1HDZA 1G0OA 1GAEO 1PZHA 3AY7A 4ZGWA 1Y8RB 1NHWA 2WE8A 4QT0A 1H6AA 1NPYA 1P77A 3IUPA 1HYHA 3QWBA 4J4HA 1Y81A 3U4HA 4BL5A 4BNLA 4CMGA 1DBVO 1MC4A 4YJHB 5EJ2A 1Z74A 3PWZA 1HDGO 4W9NC 1XQ6A 1HYGA 1EFKA 4E2XA 3WGIA 1VSVA 3U62A 5IDQA 4IDAA 2EP5A 1QYCA 4Q9NA 4U6SA 1R16A 1ZK2A 2H63A 3VDRA 5A04A 2VHWA 3OIDA 4XKJA 1YJQA 4CM9A 2O2SA 3FBGA 4AG3A 2DFVA 1XDWA 5JLAA 2IYPA 1PQWA 2H9IA 3AY3A 5T57A 3CTVA 1KERA 2X5OA 3E48A 2PNFA 4CMKA 2YZ7A 2DBZA 1YO6A 3H65A 3WJ7A 5JMPA 2EW2A 3UCFA 1NXQA 3DBHA 2NVBA 4J16A 1GV0A 2B4RO 2VYVD 3K2BA 1C1XA 5A9TA 3I52A 3L4BA 3OEYA 3TNLA 5DNAA 5ILOA 4YR9A 5JAIA 3TJRA 1F17A 1B14A 3BHJA 1T26A 4BIIA 5HS6A 4UAGA 4D43A 1E3JA 3INRA 4BNUA 4BQPA 4WK6A 2YDYA 2YHUA 3ICPA 1E7RA 1OBFO 2OHXA 2PKRA 3GT0A 1GZ6A 4J3FA 3TZCA 3G3EA 3I83A 4INAA 1RM5A 3W8DA 1Z75A 4B4WA 2J6IA 4QUKA 4PLGA 2JAPA 1GQQA 2PGDA 1JVBA 3BTSA 2BKAA 2SCUA 3RD5A 2O48X 5A9SB 2JCXA 3Q9UA 4J7XA 3VZPA 4NBVA 1X1EA 1CQIA 1T1SA 3GQVA 1X13A 3UN1A 2NTJA 2G1UA 4LSWA 3DHNA 1U3VA 1O9BA 1UXJA 3ZWOA 4BMNA 3FD8A 1YQDA 2AEJA 3SLKA 1M6WA 2NNLD 4DC0A 2WYVA 4X54A 3HJAA 1TVEA 1WZIA 2Y05A 4XGIA 4YJGA 1ZFNA 1BRMA 3D3WA 1ZK4A 3WBFA 5KJEA 4OXNA 1VL0A 1JVSA 3OETA 2B0JA 3LT1A 4Z0TA 1LX6A 4PLCA 4CQLB 3W4KA 3I9NA 3TPCA 1NAIA 4S3MA 3WOHA 4D0RA 4WE3A 4TVOA 3D3EA 1EDOA 2JHGA 4RORA 3GDFA 3K30A 4CLXA 2FMUA 3RI3A 1C3VA 1Z6ZA 4Y6SA 5HWSA 4NBRA 4WCFC 4YAIA 2FR1A 3VPFA 4YA6A 1ZXBA 2EG9A 1GD1O 3RUIA 5KVSA 3EYWA 3TFOA 1EVZA 3B1FA 4YT2A 5FWNA 4RJTA 3IS3A 2ZB7A 4OOEA 4B3HA 3NDRA 3PDJA 1XIVA 4D3FA 3L9WA 1LBEA 2J3KA 3WTBA 1J4AA 1Q7BA 2CSUA 4RPGA 3JQ8B 3PWSA 3NDIA 3H9UA 2VOEA 4ALNA 5EN4A 5F3RA 4YJFA 3K73O 3ONFA 2VNAA 4D3DA 2W8ZA 4BO1A 1FF9A 4WCFB 2HKIA 2W2KA 4J49A 2IODA 2OOSA 5L7YA 5KJ6A 1E3SA 3ZW8A 1Y8QB 3ITKA 4AJPA 3OA0A 1ARZA 4YB8A 4RF3A 4Z9FA 2PFGA 4M8SA 3WMWA 4IDEA 2O7SA 2C5AA 2VWGA 4CMEA 2CDAA 2YY7A 3AFNA 4YJHA 3NEPX 1C0LA 4RQTA 2I67A 3WSVA 3T7EA 1QYWA 1HXHA 3ON5A 5IXSA 3PZBA 2W2LD 1U2GA 3KOUA 3GVPA 1AE1A 1PU2A 4LMPA 4YYZA 4KDFA 4XX0A 3IIEA 3OH8A 2QRJA 3GFGA 4IIUA 1H93A 4A73A 5JYEA 3GUCA 3A06A 2CUKA 3AUUA 1WNTA 4E6PA 4I5EA 3DZJA 1EDZA 2VWPA 1AXEA 1VKNA 3PHGA 1HLDA 1NVMB 1YB5A 2NVWA 3HN2A 5HM8A 4GWGA 3QP9A 4QECA 3D0OA 4MPDA 1PZFA 1YBVA 1KC3A 1SCUA 2VHVA 2X5JO 1DXYA 4W9NA 1Y5MA 2YQ4A 3GHYA 2VZ9A 3ZWVA 2EP7A 2HUNA 4E5MA 4XWYA 1ZK3A 2JD0A 2PZJA 3GZ4A 1IB6A 3GDGA 3ROMA 4DMLA 1PWZA 3AU8A 5KJ1A 4L75A 4BMVA 1EVJA 4IS2A 2HMUA 1AUPA 4D7AA 2WSBA 5KJFA 1U3UA 3G79A 3BZUA 5A5EA 2QHXA 1UXKA 5JC1A 3OICA 4WOJA 4E2YA 3C7AA 5BSGA 3ITDA 2J3HA 5A9SA 3PRJA 2P4QA 2XF8A 2DPGA 4J4TA 4F46A 4GBJA 3F4LA 2IXAA 5JO0A 1GR0A 4E3ZA 4IDFA 4R1TA 3DQPA 2AQIA 1LRLA 1XR3A 3JQGB 5TSDA 1DC6A 1P1RA 4XQEA 5G4KB 1HDYA 3PZRA 3HB4X 4WOKA 3T7CA 2E6UX 2OZPA 1E3IA 2PKQO 4UVIA 5IZCC 5FYDA 1NPTO 5JMWA 1E1MA 3V5NA 4ZU3A 4DLAA 2HO5A 4RLHA 3ZV5A 1GCOA 1YS4A 3C7CB 1ADGA 2PH5A 2WD7B 1U7TA 2X22A 3B1JA 3G49A 4ONEA 4BNIA 4CQLA 1VI2A 1BXZA 4MVJD 3WR5A 3PFFA 1XG5A 4IS3A 1TLTA 2QQ5A 4DA9A 4FCCA 3UOGA 3H7AA 5EERA 5DOVA 1YB1A 3B70A 1TA4A 2JJYA 5JAZA 1DRWA 1GY8A 3LQFA 3O8QB 4Z9XA 4Z9YA 1PGNA 2FN7A 3ZHZA 2EEZA 4P4GA 3U49A 1M76A 2OXIA 1VL6A 1K3TA 4DPKA 4HX5A 3LF1A 5EQFA 1DLJA 2Y67A 4Z6KA 1SOWA 4AJ2A 2B37A 3JYQA 5FFFA 4IDGA 5B4TA 5C3MA 4M87A 5BNTA 3L6OO 2CVQA 2QZ9A 3E6AA 5T5QA 1YQXA 1XSEA 2NUAA 4GSLA 1P1FA 1E1KA 3H2ZA 3VVBA 5CDYA 5EQDA 1BVUA 4ZQEA 1HDOA 1PWXA 3DMYA 3PJEA 1JKIA 4YAKA 5B4VA 4OO3A 3A14A 4L4XA 3I9KA 3WXBA 5JBIA 1NFRA 9LDTA 1V35A 2B4QA 2WTBA 3JD3A 1JAXA 1ZXLA 4GGPA 4WCFA 4YDRA 3V1YA 4NJMB 3VH4A 1X0VA 4PLHA 5BQFA 1XU9A 3UVEA 1T2FA 3ROQA 1QYXA 1Y8QA 4Q3NA 1ADBA 5DF1A 1T25A 4E32A 3QLJA 4I9NA 4CMJA 5A3JA 4Y6RA 3NAQA 4FJ1A 3RC9A 1HE4A 2I3AA 2QW8A 4GGOA 1N1GA 3UUWA 2PR2A 4TZTA 3JQBC 3VZSA 4AJNA 5AOVA 4BNHA 3NGLA 4J1NA 2CF5A 3RCBA 4AJIA 2D5AA 5TF4A 5C5IA 2VUTA 1N1EA 4E2WA 1CJCA 1MG0A 2HJRA 3ST7A 5FI5A 3QA9A 3CIFA 4M55A 3ADPA 2DM6A 4FFNA 5K0ZA 3DZBA 4BNZA 2AE1A 4U5QA 1IL0A 4XB1A 3TZ6A 2JCVA 1B26A 4PIVA 1D4FA 4CV1A 2Z95A 4HP8A 4IQ8A 3DAFA 1WZEA 4EYEA 2B5VA 4HBGA 3K96A 3JCZA 1E5QA 1ML3A 3H9GA 4DIFA 5IDYA 3ASUA 3HB5X 1OC4A 4J9UE 2NACA 3B20A 2DBVO 3H9QA 3LZ6A 1Z7EA 4I5GA 1SZJG 1VPDA 4DQVA 1LJ8A 3DFZA 1ZBQA 2AA3A 3FWZA 2TMGA 2P4HX 2C29D 5KVVA 3WGYA 4WEQA 2Y93A 4R16A 1ZCJA 3KV3O 3E5RA 4JP3A 4BO2A 3DAGA 2JHFA 2Z1NA 1ISJA 4AJ4A 3GRPA 1HL3A 4B4UA 2Z5LA 3X2FA 3NJ4A 3UHAA 4RCVA 2FY8A 4ITUA 5DCYA 3RBZA 2PKQP 3RBVA 4QFCA 1V3TA 4PLWA 5H83A 3DXFA 4CR8A 2ZTVA 1GZ3A 1LEHA 2VRCA 1HDRA 3AUSA 5IG2A 2HRZA 2CNBA 4JXKA 1NVGA 4BNKA 2RCYA 1K0UA 1UP7A 3G1TA 4Y98A 4E12A 4HFMA 4A10A 3C1TA 3AI1A 1JAYA 4J1SA 1YDWA 1PSDA 4UVGA 1SO8A 2D8AA 5JC8A 5HS4A 4DBVO 5AYVA 4L73A 1XCBA 4AFNA 1UAYA 1MC5A 2IDZA 4GQAA 2QYSA 3VPXA 4CJXA 2YQ5A 2AHRA 4FFPA 3O8QA 4Y8VA 1HLPA 1KOLA 1GUZA 1U8XX 3F1KA 4R9SA 3S2FA 2VUUA 3KUXA 5THQA 2IXBA 3DZIA 4EUEA 2PK3A 5GY7A 4CMCA 5JDIC 2ET6A 4BO9A 5IZCA 2WE7A 4QEDA 2WM3A 5DCUA 4A0SA 3MEQA 5IN5A 3QVOA 4ND3A 3TN7A 4IMRA 2ZCVA 2BGLA 3JSAA 5BNFA 1NFFA 2NADA 4IUYA 4KP7A 4EEZA 1N2SA 2Y1GA 2IZZA 2GN9A 4OAQA 5F1KA 4W7HA 2DUUA 1F14A 4B8ZA 1PS0A 3E9QA 2EIHA 2VZ0A 1HETA 2NM0A 1LLQA 1O89A 5MDHA 1BDBA 3M2TA 4DUPA 2F1KA 3JQFC 4DGSA 4WNIA 2HMVA 3ZN2A 1IYZA 3DMTC 4RPLA 4NNJA 3FI9A 4NJMA 3VZQA 5AXAA 1NQOA 3OIGA 3A28A 3EGOA 5C7LO 3U5TA 3LLVA 1LDGA 3QQPA 4YXFA 3JQDA 2C7GA 3BYZA 3DBLB 1TXGA 1EZ4A 3EUWA 3WWZA 4CLOB 2Q99A 2QZZA 2Y0CA 1QV7A 4BNWA 1TT5B 4HKTA 4TWRA 4RDIA 1UZMA 3MWEB 1JW9B 1I3NA 2RH8A 3GR6A 3C3XA 4HNGA 4Z0PA 5L95A 4KTVE 3OECA 2QRLA 2AW5A 4HXYA 2QIOA 3BMOB 1IY8A 4Y9DA 3ENNA 3ZWBA 5U9CA 4BV9A 4XRGA 4R5HA 2HJSA 2YV1A 1PGJA 5CEEA 5F5NA 4QTZA 4I5DA 4GX1A 3ROKA 3SLGA 3TSCA 1X15A 3ZH2A 3G0OA 5ITVA 4NBWA 5AXDA 5KKAA 1A71A 4FPXA 1GV1A 1K6XA 4BKOA 1RPNA 4Q3CA 1S6YA 3Q0EA 5KTKA 2E37A 3D1LA 3GH3A 3JQ7B 5LCXA 5L9AA 4PFJA 5DDIP 4HUJA 4RDHA 2QX7A 1W0CA 3R6DA 2YW9A 1MXHA 3M6IA 3C1AA 4ID9A 1WDKA 2AQKA 3U4IA 1OFGA 2EGHA 1HF3A 1NM5A 3BMCB 3IP3A 1FDVA 4U0JA 2JAHA 4LISA 3AU9A 1PX0A 5ENDA 1Z45A 4JROA 4XR4A 3SJUA 1R15A 4E5NA 2VHXA 3AFMA 1FDUA 4YJGB 5JO9A 2D1YA 3D3WB 2IZ1A 3P5SA 2ZB3A 4YQZA 1YDEA 4DMMA 3ZNNA 3ZWXA 4BNJA 4D79A 3GNSA 3OJLA 3TDKA 3BTVA 4ZN6A 2Q49A 3DBRB 4W4TA 3PXXA 2PWZA 1X7DA 4RPJA 3GY0A 2ZQZA 2HQ1A 1EQUA 3KTDA 3NX4A 1IULA 1ORRA 4OH1A 2O3SA 5K6AC 2D4AA 2PH3A 4LN1A 5ICSA 5JYDA 1CYDA 3EMKA 3R1IA 2P9EA 3DWFA 2X0IA 1KVTA 2LDBA 2ZQYA 4G65A 4K1LA 2UVDA 1G0NA 3ENKA 4O59O 5BSEA 4A5OA 5K9ZA 2A9FA 4PVDA 4FFMA 4IGEA 1CETA 2GPTA 1LA2A 2I66A 2O3QA 1KVUA 3COSA 4NBUA 4XCVA 3RASA 1A7AA 1I10A 3OQ6A 3STHA 3U3XA 1LDMA 2D5CA 1U5CA 5EPOA 2J5KA 3CPSA 3HDQA 4UVEA 1UXIA 3SBOA 4QX6A 5CDTA 1CWUA 1DOHA 1MFZA 1XA0A 1PQUA 4J1QA 3O26A 3INTA 4UUOA 4MVJP 4ZICA 3RQSA 1U2DA 3E8XA 4WLFA 3W1VA 1B8VA 3QW2A 6ADHA 3ZWWA 4YJFB 5A06A 2JD1A 1NVTA 1T2CA 4R5MA 4YTEA 1T4BA 1M75A 2NU8A 1UDAA 2JFHA 3RVDA 3UGKA 1DFGA 1J5PA 1T2AA 1V3UA 5FI3A 5JCJD 3MTGA 2RHCA 3ANMA 4C7KA 4BS9A 2H5LA 5G0VA 4ND4A 4NIMA 1A72A 4IDCA 1YL7A 4XYGA 3AM3A 3TFQA 1O8CA 1QYDA 3KETA 2AG8A 3RKRA 4KQXA 4KUEA 3DR3A 5BSFA 2FPIA 1QR6A 4EDFA 1JDJA 3WNVA 3DZHA 1NASA 1NQAO 3ZNOA 5JXWA 1ID1A 2I6TA 4TMFA 1V6AA 3HADA 1PJ2A 3VZRA 4HNHA 2YFQA 3PVZA 4WPGA 1DEHA 1DJNA 1YKFA 4R68A 4CM4B 3DBLA 4KZPA 4FDAA 5JDIA 3HQ4O 3R3JA 5ES3A 1H2HA 1I2ZA 4CLOA 4U8GA 5KIAA 2FWMX 4BNXA 5CHEA 4BO6A 2NV6A 1P31A 1TT5A 2E48A 2R2GA 3KBOA 3QVXA 2VYND 4WNCA 1ZW1A 2I5PO 3OP4A 4MVJM 4MOWA 3K8ZA 1B2LA 5L51A 1PGPA 1PL6A 4B7CA 4EJMA 2BRUA 1O0SA 1I36A 1D1SA 1KYQA 2FOIA 3M1LA 3ZWYA 4CM6A 2Y0EA 3BMOA 5ER9A 4E5PA 5J23A 1NWHA 5L53A 1DFHA 1P44A 1QSGA 3JQFA 3QWFA 4FW8A 4MKZA 4R3WA 1U7HA 3KVOA 4YAJA 2Q1WA 3DC2A 3DMTA 4AJHA 3FBTA 4YACA 1OMOA 4R1UA 2W2LA 2OP0A 1MP0A 2DQ4A 2AG5A 1E77A 3HWRA 1GZ4A 3FCOA 1F8FA 1U3WA 4PZEA 2UUPA 4BO5A 1MLDA 3ONDA 1JN0A 3JQ7A 2V6BA 4L4RA 4A27A 4PCVA 4DC1A 3RFTA 4R3NA 4DYVA 1CIVA 2P9CA 4I8XA 3KZVA 1DAOA 1PS8A 2FR8A 4R01A 3PQDA 3BMCA 4YT8A 4MIOA 4KUHA 1R0LA 2WYWA 1WDLA 1PTJA 3PHLA 5EESA 4PLFA 5DBGA 5DT9A 1N7HA 2Q1SA 5ICMA 3QRWA 1GEGA 3U0BA 3DOCA 1JLLA 4IJUA 1EK6A 4JK3A 1GADO 5DOZA 4OIMA 2NVUB 3WDSA 3PEFA 1P45A 1LI4A 2HK8A 2VT3A 1C1DB 1R66A 1TI7A 3D4OA 3H3FA 1QORA 3P7MA 1X7GA 3JQAB 2Y66A 3OJ0A 2GNAA 1XYGA 1MV8A 5JE8A 1B8UA 1E5LA 1HSOA 5ENVA 4HV4A 3DBRA 5I9LA 5L7TA 4UULA 1EE2A 2DU8A 3PDUA 4FGWA 3VHRA 4BO3A 1SAYA 5F5LA 1DFIA 4JN6B 4ROSA 1LLCA 1XEAA 3D64A 4L8VA 3ZWCA 3OSUA 1OAAA 4BOYA 3LC7O 4L4SA 1JQBA 1HRDA 4BNFA 4PLYA 3JYOA 1FDTA 4AJLA 4GH5A 4XDYA 3W8FA 3WFJA 3OJEA 2HK7A 3E9MA 4D0SA 2X0NA 3HZZA 4J2OA 3JYNA 1LDNA 3PFWO 4ZA2A 2B5WA 3I9LA 2X9GA 1YVEI 3TL3A 2V6FA 4M49A 1ZMTA 3Q3CA 3PJDA 4IZHA 5BSHA 5IFLA 4UVHA 1WW8A 4KWHA 4D46A 1YJ8A 1KC1A 3GMDA 3CZMA 1WDMA 4UREA 5MGBA 4D44A 3NDJA 4JBGA 4AJJA 2Y1DA 5TX7A 4B7UA 4MVJI 4E0BA 1KS9A 2TMDA 5K6AA 1NQTA 1DDOA 4K28A 2Y1OA 5BR7A 2BD0A 3VKVA 1NYTA 4BO4A 4IZIA 4D42A 1ZEMA 4N5NA 1ZMOA 5IJZA 3AM5A 4NH4A 3TOXA 2IEDA 2BFAA 2CVOA 1HZJA 4FR5A 4QO8A 5THKA 4DREA 2EWMA 4WLOA 3PLRA 2G5CA 3GAZA 2UAGA 1Q7CA 2CY0A 1U4OA 3FF4A 5A05A 2CDBA 4XDZA 1Y9AA 4FQ8A 4GL4A 1JKJA 1L7EA 3P2YA 4PG7A 1MUUA 4CM9D 4DRYA 4BKPA 4ZQBA 2YDXA 3KSUA 3L07A 1MX3A 3AUAA 4YJDA 3WIEA 4R51A 4ALLA 2J5RA 5A1TA 3E5MA 3V1UA 1UXGA 4IM7A 2DBRA 3FPCA 4OSOA 1L7DA 2Y1EA 1A9ZA 4O63O 5JCXA 4HFRA 5COQA 5H81A 1IPFA 4IGFA 1DHRA 1SC6A 4PN3A 1E0DA 4A2CA 4CM4A 4E4YA 3BTUA 1PL7A 3DBVO 2NTVA 4IDDA 1MG5A 1E7QA 4FFRA 3RROA 3RUCA 1DJQA 3PTZA 3OHSX 3ZNPA 1ZK0A 5F1PA 4PG6A 4HY3A 3TRIA 5I9NA 1N9GA 1PQPA 2JFFA 3GUYA 3SVTA 2C20A 4YT4A 4UEKA 3IP1A 2DKNA 2JD2A 3FR8A
chains in the Genus database with same CATH superfamily
4DL9A 3SQOA 4FDLA 3E7FA 3L8MA 1K7YA 1KXZA 2H2GA 2ZVPX 3BFVA 5AKYA 4CCSA 5HZKA 1W59A 3TDNA 3GOQA 1QQ5A 1H8HA 4G1CA 1TAQA 1O03A 3PSHA 4OOFA 4QDJA 1C9NA 1M1NA 4ZO4A 4IF6A 1XLWA 4BJ1A 4P7FA 1HEYA 3DXZA 3IJEB 1W1WA 3CZ9A 3H1FA 2IL1A 3MWKA 4HNVA 4O4LA 4KMSA 4CUJA 4ND8B 4C6TA 4DZRA 2VH5R 3RKSA 2I1WA 3CUEF 2Q8PA 1GTMA 1XDDA 3X1JA 4EO7A 1VIVA 1HE5A 4N6OA 4ISCA 4OHBA 3WYEA 3O8BA 1RQ2A 2CNLA 4RPKA 4NU5A 5AVQA 3DT9A 3AR2A 1JQ5A 2X3YA 4DHWA 5HJ7A 1OPRA 2NZ8A 3BCHA 2BM9A 1HNXB 2Y9MB 3KOMA 1WMBA 2QTBA 3R24A 4LE2A 4REMA 4K7JA 1XNRB 4HDMA 1Y1PA 5ALOA 4OHKA 1KZ7B 1QE5A 1SU4A 1VE6A 1PJZA 3EQZA 4P08A 4B8YA 5HZGA 4JDPA 5CRIA 3FDJA 1SUCA 3DOJA 1R0WA 1ZEJA 1C1DA 2F62A 2ODBA 1NV9A 3U2QA 1EVKA 3VOSA 4DBZA 4CQMD 3KWJA 3D7SA 5JS1A 2JB9A 1TPYA 3V4LA 4MI6A 3QE9Y 2OP1A 3DE5X 1E4YA 3QBDA 4EGSA 4FC7A 1NWCA 4WX2B 3KVRA 4K05A 1IJBA 4EI2A 2E5WA 4ZT3A 1NY5A 2HBRA 3MBIA 4URUR 4IWYA 5HCNA 3L7IA 1M6EX 5IARA 3I3OA 3V4OA 2P79A 4MHOA 1U9IC 4BFUA 4XWOA 4AY2A 2HMWA 4DDWA 2XE6A 3BB1A 1ZHFA 4BGVA 4RL4A 2VRBA 4LJRA 1H2XA 3UAOA 4F7DA 3H42B 4WZBE 2GEVA 3IIJA 4E6EA 2PO7A 3MUNA 4Q7QA 3SC4A 4TXNA 1OZGA 4NVRA 1GPNA 5DVZA 3TPFA 3MJCA 5FWYA 1MB0A 1QXSA 2CLFB 3S2GA 3DR5A 2VJLA 4M1MA 4LY9A 1DVRA 2W0SA 1JWAB 1OKKD 1Y6JA 3VXKA 4ZYZA 4D3SA 1YRWA 5A3VA 1Z0KA 1ZZEA 2B69A 1V0JA 1XMSA 3VKGA 1I8TA 1OBCA 1DAEA 2Q3MA 3I4FA 3PFNA 2OQRA 4ITVA 3JQRA 1A8SA 1L5FA 3L6RA 5L6MB 3JZAA 3TIIA 1G55A 2PWBA 2IUFA 1NLYA 3DAPA 2BTQB 1MV5A 1OJLA 2WF8A 5HIIA 2E1PA 1ODLA 4WLVA 1ZZGA 1RJWA 3HVRA 5HBRA 3P9CA 2P65A 1AHHA 1VB3A 3AUFA 4R71A 3L6BA 1U7OA 1I3LA 5IXJA 1SUPA 1EBFA 2A59A 1BX1A 2WC1A 3CZPA 5IP5A 1XJQA 3MB8A 1OU0A 4Y2TA 5CH3A 1O3YA 4MR8B 3DONA 3RYFA 5ESRA 1GQ2A 1VGRA 2I4IA 1YK1A 1HO3A 3G2OA 4WIAA 3WZ2A 4E30A 4LTDA 3UJAA 4KAJA 3H86A 1JIIA 3WLFA 1CE8A 2MINB 1UC4B 1V47A 1GPWB 1YHNA 1GYPA 2GHTA 2OM6A 1W4CA 3LVBA 2JNWA 1AIPA 2J9FB 1M6NA 3BE8A 3EZFA 4ZAYA 3ZDDA 4QVIA 4OYRA 1YZTA 2WTXA 2ZT6A 3H5RA 3TXAA 1XZNA 3BWCA 2G8LA 5GAJA 3TVTA 3A3KA 2MYTA 1UBLS 3FPHA 4E1AA 4DV2B 5G40A 3IJPA 1KAOA 2G83A 3IQIX 3LDFA 5D3ZA 2XT0A 3HMQA 4W1PA 2XYPA 4Z9BA 2WT4A 1T5BA 3OJCA 4GD3Q 2FUEA 2AXNA 3OT1B 4MV7A 3HJCA 5COBA 1F7UA 5EKDA 2GBIA 2FQXA 3CRMA 4RF2A 2ZKLA 3N3AC 3WWYA 4YXWD 1LDYA 1IY1A 1LC3A 4CKZA 5JNUA 4UCQA 2PANA 4G5RA 4EGFA 5IH7A 3CVYA 1I5OA 2D6FA 2G36A 4FNAA 1UK6A 1P5JA 3FNRA 2DJIA 3G82C 3K9WA 2VEOA 2VPZA 2J0SA 4UQOA 3CRNA 3KYBA 4IILA 3TR6A 3TWOA 3LT2A 3S44A 4BMYA 4OSPA 4RTOA 2FDXA 4Y0AA 4Q9IA 2A5YB 3T0GA 3T7SA 4BLRA 2BFDA 2IV3A 5BWMA 2HQBA 2VAPA 3ACCA 1TK3A 4WOBA 5K1ZA 4EQ6B 3TQOA 2C9BA 5SY6A 2XZLA 1K89A 3JZFA 2OG1A 5F7ZA 3HG7A 1DZ3A 4DR3B 3N3BC 4TYWA 2RIRA 1HQDA 2DOKA 3A2MA 4U39A 4JT4A 1JL3A 4L5BA 4NAVA 1T5HX 3H5NA 3HJNA 2ORVA 4WCDA 1IHXA 2FWAA 3U3RA 3VSEA 5FBVB 1BE6A 1CR0A 1ZD4A 2QMZA 1LNSA 4Z3KA 2D4HA 4BQFA 5LZ4A 1RWQA 3IAHA 3BUSA 3SQMA 1CUFA 4HL6A 1AZLA 1V2HE 1VG1A 2OHFA 2PGOA 4ZMRA 4F4CA 3SY8A 2ZI6A 4UM5A 2QGFA 4QPCA 2BUBA 2RJ3A 3ZV6A 4MPRA 1Z18A 3A9UA 2IPOA 4GLOA 4GVPA 4RVHA 2GTHA 4DQDA 1VI5A 3DTTA 1QRSA 4JHXA 5KHAA 4ZI7F 5HW0A 2ALJA 2JGDB 1JEQA 1LW6E 4RLSA 2O2YA 2WIKA 5DX1A 1JTFA 5IAAA 3LHKA 4EA9A 1TW2A 4S2UA 2WT8A 2GO1A 4QFBA 3KZCA 1YR3A 3K1AB 3RVSA 1SVMA 2AIRA 1E3QA 2O57A 2VBCA 1JSCA 2ROQA 5CA0A 1QX4A 2CEAA 3SSAA 2GCNA 4WUTA 3PKIA 2J4DA 3OAAA 5BN4A 2NO6A 1K06A 4ZHQF 3DLBA 1LS1A 2Z57A 4K3VA 1TUGA 4OFXA 1OLSB 1QO0A 3C85A 4DR4B 1M0WA 3ZPXA 5G53C 4FSHA 1SBCA 4HAOA 1KR2A 1NPDA 1GU7A 5DNVA 1UDRA 1C0PA 1TO2E 3ZHXA 2EZ9A 4RV5A 4YRDA 4ZALA 3RS5A 2NWQA 3O4IA 5L3QA 5DSZA 5I47A 1LI7A 4PONA 1ZSNA 3O47A 1VBNA 2IU0A 5HX7A 2QAGB 2RARA 3AY6A 3IVAA 1BHO1 2XWJI 4JI1B 1DXOA 1NW5A 1R0XA 2PEYA 4RHYA 3RKUA 2VTKA 1T5IA 4RDCA 5AVWA 1IK6A 2Q9BA 3ZCSA 3N0XA 1NYRA 3BWMA 3R6GA 4S05A 4RX1A 1J39A 1AQ6A 3LQYA 3U7FB 3RSQA 1RAAA 4J1TC 1S2LA 2C54A 1WS6A 5L4LA 2YWBA 3VC7A 2JIBA 1XC7A 2REOA 2REBA 3O0DA 5EIBC 3AETB 2F7SA 3Q3VA 3C8MA 1XZPA 3CUYA 3D1VA 2GO7A 4YO7A 2R84A 3EK2A 3KLPX 2GTIA 1JR3E 5EKXA 3WGTA 5EIWA 3GF4A 1SUBA 3BXGA 4LVNA 1RCUA 3AL3A 5CLHA 5JEEA 1B8OA 1H9AA 3E7DA 3ANTA 1NX6A 1N57A 4XD7D 4B35A 1XMPA 3T3MB 4F6RB 2YASA 3ZU2A 4Y67A 2VAWA 3NRCA 5AJYA 3UFXA 1RE1A 2C96A 3SBEA 1LNZA 1P2SA 2EHDA 1LF5A 4IQ0A 1YL6A 4PZCA 4XFDA 4YRCA 5H16A 3FN4A 2DUMA 3AI3A 3UT0A 4ARZA 4JQSA 1UKVY 3KJGA 1A97A 1U9IA 1VKZA 1Z5OA 1GKKA 2X14A 3K9QO 3N1UA 3TVYA 1Z39A 2AI1A 3PKJA 3UB2A 4KX5A 4WBNF 1RKXA 2IW1A 3BRWD 3FYDA 4PINA 1BXGA 1EFVB 1REQA 1YZVA 2G5GX 2A4MA 2FPPB 2OV1A 2VCYA 1E2HA 1JJ7A 2YHIA 3A1EA 1VC2A 3DUWA 1NW6A 4ZANA 1L5WA 4XJSA 1Q1NA 3MINA 2PMKA 4JIGA 4I9UA 4YV2A 3DH0A 3LYUA 4PLZA 5T4HA 1UMBA 1Z7WA 3UT6A 3X2EA 1U1CA 3ZDAA 1ZIOA 3BMXA 1SC9A 3ANXA 3FHJA 3K0AA 3CKKA 1G3MA 3SHFA 1JA1A 2IYYA 1DAIA 1WY5A 2MSWA 2P4SA 2X3UA 4L5CA 2BKXA 3T34A 3TNYA 3H2YA 2NSYA 4JKOA 4PE5B 3DEAA 3F47A 3NAZA 4HVAA 4EUFA 2J0EA 3PE6A 4AKHA 4CIAA 4XTCS 2ZJ4A 2YY5A 2GARA 4CM7A 4YP5A 3CPEA 2ZS8A 3EUAA 5E0OA 2DTXA 3EISA 10MHA 4N5LA 3P9QA 4QARA 3PCXA 4KITB 4RK7A 5ALQA 1V43A 2DMRA 4R9RA 5BWBA 4HVLA 3JWEA 1SMKA 3A3NA 3BXEA 1EI9A 3OCJA 2IZOA 1IQ0A 3IH5A 2PPLA 4LOJA 1QLHA 5IVIA 3ZJ4A 5FOXA 1AZTA 1IB0A 1XHLA 2YXNA 1W0KD 4YHBA 3FVQA 3CF6R 2R4TA 2VP6A 3QEAZ 3FCCA 1U1IA 4JHLA 3ROZA 5TQJA 3LXRA 4R05A 4CM5A 3SYRA 3ELYA 4TKLA 5JZVA 4UOZA 3BKWA 1RHMA 3CY6A 1II8B 2FFHA 3TS1A 4JU9A 3UV3A 1L9XA 1AM4D 3I9MA 1WXFA 3EHEA 4BFTA 5GOZA 3RC8A 2A0UA 1OXTA 2HMSA 3O03A 4A7PA 1E1LA 2V97A 4CM1A 1H8EA 5JZ9A 5C8VA 2YV2A 2M98A 2V9CA 2G76A 3LT4A 4JXJA 4H7JA 2C0CA 4DDMA 2WBLC 2C2HA 1XU4A 4GX2A 3C1UA 1PT9A 4BN5A 4UPVA 3K9GA 2GWHA 3QOXA 1V7PC 4F6LA 1KORA 2VYVA 3N8HA 3O83A 5K0SA 3R5TA 4BECA 2GJKA 3OKCA 5I7FA 2HZ7A 3ZV4A 3IRVA 4Z4QA 3IP9A 1T0BA 9LDBA 5LWHA 1I32A 1YOVA 3OZTA 3CRQA 3ILVA 4IJWA 4ZV7A 3CNOA 1WZCA 1Q3HA 4J0DA 3B1VA 4CM8A 4MGHA 3MGGA 4KO1S 1RAEA 1G19A 1R50A 2P2CA 4A6PA 4IJMA 4E11A 3N7AA 3IERA 5CK5A 3ZDYB 5ED0A 3RDPA 1QG4A 4B7ZA 4JQZA 2NQTA 3WV4A 4KE7A 1YRAA 3CS3A 2IDMA 1LPBB 3C5VA 2F43A 4DY4A 1U6KA 3PC2A 2DHRA 4UM9D 2F3RA 2XUQA 4MVCA 3LL4A 1FSPA 4MP8A 4NHEA 1L4MA 4K26A 5IC6A 1I0ZA 2COEA 4FYXA 1WSAA 1XALA 2PS1A 4FXOA 1YE3A 4GXQA 3QUBA 4LRTB 1XPOA 1YB2A 3AFIA 5E3JA 5EVCA 3TR0A 1XZJA 3UTCA 3O31A 1IZ0A 2ZI5A 1R88A 4M83A 4S04A 3R0IA 3A6GA 2DTEA 1N6IA 4HEQA 4WZZA 3DZKA 4C78A 1R8QA 2EARA 1E1RD 3ZHYA 4QGAA 3ZJ5A 5B7NA 4RMHA 1GG2A 5AR1A 2PXHA 2H85A 1B00A 2X1LA 5ALZA 1PEDA 1L7OA 1N6NA 1KE1A 4BBPA 3BHMA 5B37A 3VZBA 1WPXA 5IM4F 1YK0A 4OM8A 2NTEA 4KN9S 4OTZA 4B3BA 3BZBA 3BTOA 3DC7A 5D3QA 2BDEA 2EVWX 3IR6A 1UJ6A 3G9TA 5FLXA 3MWDB 4OLAA 5C7YA 4I2NA 1WLYA 2IEZA 2OBXA 3K9NA 3IBFA 2A9KA 3U56A 1B7GO 2A1TS 1RPZA 4MQ5A 3TZLA 3LX8A 3O3OB 3L06A 4KB5A 4EAAA 2IA5A 4FUTA 4BJHB 2C4VA 1A5AB 4BRUA 3IAS1 3U48A 1Y4AE 3WGQA 1NTOA 4TL8A 3UAYA 4QPDA 2HADA 3JTMA 4LHZA 4NS4A 4CBVA 4QYWA 3S27A 3AEXA 2ZBFA 3JVVA 4G5OA 5EXDA 4LMAA 1DINA 3GEPA 3PX7A 2C3YA 3CPHA 2PD4A 4W5OA 4GICA 1ES9A 4YH1A 1TQ6A 3F7MA 4QNRA 4ZJUA 4GDFA 1NRJB 2XTZA 3JAKB 3QF4B 4X6UA 5C80A 2PO5A 4KWEA 1IXKA 2ZUCA 2HYIC 4I1RA 2XA1A 4TVKA 4LZZA 3BQ9A 4J1TA 4U9HS 3C6QA 3V8NA 2X0JA 2XXBA 5AM0A 3TW4A 3DW1X 2GEBA 4XRRA 4WINA 3UH1A 4BP3A 5AKEA 3OPMA 5ANRB 2OCIA 3ETGA 3IVMA 4CN8A 3BERA 2FNAA 2NYVA 3NHYA 2NO4A 3PWKA 4O2AF 4ZCMA 2EU8A 3HYNA 5J3JA 1U1FA 2HWKA 3PENA 1KEEB 3EZGA 2B0CA 3AR6A 2A4KA 1BCRA 1SU7A 1FNNA 1X1QA 1VA5A 2WM2A 2Y1WA 2Y71A 3C87A 4ANFA 3AVXA 3QELB 1RQRA 1UIMA 2BI7A 1R6VA 2BM0A 3ZHSA 1NZJA 3HGMA 2BI8A 3WIOA 3T4EA 1AKUA 2VQ3A 3NNDA 4UU8A 5BN5A 5LKRA 1RRFA 1VE7A 1OASA 2Q27A 1QZUA 1O8BA 2ZTUA 3DQZA 4NYIQ 3U6BA 1ABFA 1RVV1 2B3DA 1TLFA 4JKIA 1M2WA 2AK3A 1MENA 2FSVC 2MMCA 3JV7A 5IBQA 3OCUA 4CW7A 2WIDA 2XX3A 4F4FA 2FG6C 1P18A 4X3OA 5BVHB 2WKPA 2L17A 4DC9A 3FKSD 1L1RA 3QXJA 4LVUA 4CR7A 4F5DA 1HT0A 5KSOA 4D45A 1R6AA 3AVUA 1WCXA 2AFIB 4KVFA 1N8KA 4B31A 4FYJA 6REQA 2R6DA 2YIMA 1TK2A 2WKRA 3Q9SA 3WGHA 3WL7A 1CB7A 1I2CA 3MGBA 3DP9A 3C97A 3GLFB 1QHIA 4BVFA 4IIHA 2J09A 2HSEA 2R3SA 4N5IX 4U3JA 1YBMA 3BIOA 3P2KA 4B3CA 5KTOA 3E22B 4EB8A 3DM9B 4Q3BA 1UPUA 2D5LA 2QE7D 1V4NA 4R4JA 1VPLA 1E4EB 1H42A 2GJ8A 4KI7A 4XW2A 5EP1A 1HORA 3AQ4A 4U7WA 2JLVA 1RKUA 1VSBA 2YC4C 5JECA 3QY9A 3IAS6 4IXTA 3KYDA 1RT9A 1UZLA 1CDOA 3AC0A 4PICA 1ECGA 5AJUA 4Q82A 3DW3X 1ISSA 4KXNA 4Z9AA 4D80A 1EX7A 2P1RA 1XJ5A 3G8YA 2C31A 3VUFA 3EPRA 4YCNA 1XLUA 2PTHA 3QIAA 3WQSB 2HJWA 1A9RA 2H1OA 2YTZA 5I8WA 4DIKA 2NU6B 4TRJA 3S2EA 4XVUA 4LGYA 3AKYA 3HPQA 2ZUEA 2ZS7A 3KFVA 4TZKA 4EA6A 2P5UA 2II6A 4OK5A 1P5FA 2CV0A 5E4FA 2PX3A 4O1IA 5TQ2A 1RWPA 5CVDA 3LOUA 4OXKA 3RC2A 1XZQA 2BW0A 2PTGA 1XZEA 2QZSA 3QWIA 1EJ6A 4GW3A 4ZT5A 8ABPA 5JFGA 1GQSA 1YACA 3VHLB 4V03A 4MRVA 3N5KA 2VTDA 3OLVA 3DFKA 1UF9A 1PJAA 1CNFA 1JXQA 3ZBQA 4IIXA 3T06B 2EYQA 4HG2A 4WXYB 5AK0A 1VL8A 2O7QA 2ZRFA 4IW3B 4N0MA 4B76A 1X86B 5JPDA 2QTFA 4MW4A 5FPHA 2QD1A 2CVZA 3DDNA 1G8AA 3I1JA 2P68A 1DEKA 2I2WA 4J7AA 2OGSA 4NKRA 3RANA 4WCVA 2PGAA 3WWDA 3AWDA 4CKBA 2XCQA 2EDAA 1A9OA 2I2BA 4C6HA 4KTTE 3UKOA 3TLBA 4HGYA 4GYWA 4GSKA 3SBDA 3TRKA 4MPTA 2QSJA 3P0RA 5D3MA 3L40A 4BX3A 3B52X 4RPIA 1G4AE 2H5JA 4EG6A 2EQAA 1SQ6A 3VH3A 4A6DA 2AHOA 3V1LA 2CFRA 1NUUA 1RCTE 4R1QA 3HFSA 4FYVA 1NC3A 2VLBA 4RHCA 3KZOA 4TLEA 4UD2A 5EXTA 4BCCA 4OHVA 1LWNA 4WWHA 3OZVA 3K0CC 4XPIA 2EJWA 3B9BA 2VF4X 1T8WA 2IHBA 3RE1A 5B7QA 1WF3A 3HKDA 4DSAA 3HP7A 1C4KA 4Q12A 2X9VA 1U8ZA 3EIWA 1R0KA 2C9ZA 4Y6GB 5DHAA 2HPAA 3GVXA 4ZC1A 2YUTA 3SSOA 4B6PA 3ZGZA 1UBOS 2VOJA 5KMGA 1EESA 1UPAA 3REQB 2XGGA 4DUZB 3ESCA 1SVWA 2RCNA 2XXAB 1KJIA 2P91A 4XE5A 1O96A 3N9IA 1JBQA 3MQ2A 1AUVA 1F8XA 4FFBB 4EG8A 1OILA 2D2IA 5G2OA 5F1YA 2Q5IA 1P1CA 3AEZA 1A7JA 2RG1A 1NE7A 5L8VA 5FOTA 1QIEA 3SBXA 1ADCA 1OD6A 2C7VA 3OTWA 4H3VA 5CCXA 2G9RA 2C2YA 4IIEA 2OUKA 4PZAA 3IQGX 2C5EA 4ZAWA 3R44A 5AW9A 3D6MA 3JALB 1T4DA 3RSCA 1RKQA 5FWXA 4BV8A 5CFMA 3FRJA 4V1CA 2L2QA 4TPKA 1VLMA 2ZRMA 5AVZA 1SCJA 1E69A 3QVVA 4OKIA 1G18A 2YWJA 2YHBA 5H1YA 1GU0A 2X5NA 4PG8A 2XSZA 4JBHA 5HEKA 4JUCA 5FB3A 3QE3A 1NUQA 4AQYB 3FJ1A 1E2PA 3O8LA 1Z88A 3HCRA 1SXJC 3WX0A 4BRZA 3HSKA 3I0MA 3OIFA 1PSWA 2QR2A 1XNQB 4OHPA 5AK6A 1BW9B 2QENA 1PJTA 1LPSA 1GFWA 1ZK1A 2YZ2A 3PS9A 4Q3AA 4OQNA 3N74A 3DPIA 2PY6A 3HJGA 5E6UB 1K6JA 1NBEA 3USZA 1I4EB 5HSGA 1XGKA 3IDAA 3MYRA 3VRHA 2OFWA 5LIPA 3ZCXA 1QHGA 2J3EA 5JJIA 3EAGA 1NI3A 3NVKI 4BQRA 1QK4A 4QUHA 5DXAA 3Q8WA 4D9IA 2C99A 4QOJA 3TOZA 2HYDA 5CFOA 1BMFD 1ACMA 2XQVA 2WG0A 2Y0DA 3IKVA 4Y2PA 1LTHR 3PCTA 3DWGA 2DQYA 1DNPA 3HXQA 1ZCFA 3GAFA 1H5UA 3V2HA 1N7GA 1PR2A 3IBTA 3CTMA 5ESDA 4RIHA 3QU4A 1GYRA 1PYOA 3S2IA 3V2GA 3GRUA 2NSLA 4L8GA 2PG3A 2VJOA 3CE9A 1U8FO 1NIJA 4R0NA 1MRNA 2NGRA 1U81A 4WV3A 1L4UA 2L82A 1CS4C 3D8HA 3QPUA 1CJKC 4F3CA 5CHYA 1U04A 5KKCA 2AFHB 1NZFA 2GCGA 3MCZA 5AJXA 1YDHA 1F3LA 3D02A 1CDEA 1IEVA 2IY9A 2FSVA 4ND2A 1HG0A 1LK7A 1TYZA 1C30A 1VPTA 2FHPA 4PBTA 3DS8A 3H17A 5IBPA 2WU4A 3BSYA 3W6OA 2NQ8A 2PD3A 3NVMB 5KB3A 1EVYA 1E63A 2CJXA 4M38A 3DMNA 2EV9A 1F0NA 1QRTA 2R7KA 4HPWA 2Q4DA 4E4RA 1L1FA 1FK8A 4WVLA 2WP0A 4JBYA 3RC7A 3RVKA 2ZSIA 2VJCA 3W6ZA 1ZIDA 3KP1A 4KQ6A 4Q03A 1MEOA 3W8NA 3KT8A 1QDLB 3WG9A 5K0CA 3MJSA 1S0UA 4OK6A 4UASA 3VMMA 1GTSA 2N42A 4PS1A 4RV4A 3KTFA 1BVYF 5EJMA 2CL6X 4U7HA 4WJKB 1A0OA 1K0FA 1WUTA 3CNHA 2IOQA 4G4IA 5FP0A 1E18A 4P4LA 5NLLA 2ZTMA 2HLHA 4ND6A 3SYNA 1DXQA 2XWBF 2PE5A 2XA9A 3ZDCA 3ADOA 4M1KA 1NP7A 4ZVVA 2FMFA 1Z37A 2ISSD 1I2AA 3SFZA 3ZQKA 3MCTA 3ETCA 2BM1A 2J6CA 2WUGA 2ZW9A 3IUQA 3PRKE 2H4JA 2EKPA 3ILSA 4ZC8A 4B84A 5JSZA 1EBUA 2CCGA 2C98A 2DCUA 1Y6RA 1C0KA 3EULA 3QNMA 4J2HA 3KEQA 1C9YA 4RQUA 2A1TR 1E2MA 3FPBA 2SHKA 4KXMA 3HZRA 3S1LA 3TNFA 2XIJA 1RDFA 1L8XA 1B6RA 2M2IA 1A98A 1T3HA 2Q5HA 3TL2A 2PV7A 2YWEA 3VTKA 4BNTA 5LIRA 1MIOB 1SIWA 5FUYA 3OQVA 2ACKA 3K72B 1R12A 1MFPA 2MIIA 2MYPA 1OT5A 1MCZA 4P82A 4XOIA 3ZE9A 4AB1A 3DO6A 2FU5C 4LZAA 1TUBA 2AOUA 3FHTA 3M8KA 1E92A 5LMUB 3RU9A 4YIHA 5GMOA 4C7VA 3LDHA 5B1YA 4GZLA 1CRPA 2FRVA 2YRFA 4HTFB 2XTNA 3FUCA 2PEZA 4G81A 4NV0A 4QQRA 1KKUA 4ZVSA 3URKA 5HOQA 2CXHA 2QU7A 3BM5A 4AVYA 1FU4A 4YJ3F 5EXXA 2GLTA 4P4SB 2ZAOA 1Z8HA 5DLQC 3RIHA 4LDZA 3RREA 4DA8A 2PL1A 4D9HA 5LBUA 1VE3A 1V11B 1N5LA 1U0OC 3F3KA 4M8LA 3UJ6A 5I8ZA 1FVFA 4R2XA 2GUWA 4OL9A 3EZYA 1IH8A 4FOSA 4UXJA 4GR9A 4D8YA 3DMRA 4ZCTA 4R1SA 2Y6UA 4JI7B 3A4TA 3JQ8A 4DQUA 1SUSA 4RM2A 5F2EA 4I1YA 2PUWA 4XTRA 2H1WA 2X13A 1J49A 3II6X 3MJRA 1Z5VA 3MM4A 3TXXA 2X2FA 2GAIA 1W19A 3OLXA 4O2BB 3VTZA 4G67A 3VR3A 3GBVA 4FN4A 1MJFA 1OF1A 1UDCA 4WLUA 3L43A 3NRBA 5JDCC 3SK0A 5BUSA 3LYLA 1JEJA 1QX3A 3K0CA 4ND1A 4UEJA 1G7TA 2Y1KA 3A1DA 3H8VA 5DGTA 3RB8A 1DC3A 4UBOA 1MVOA 2PWAA 4BE4A 5TQ0B 2PIDA 1V7QA 5PNTA 5AVRA 3NOQA 4LUCA 3ZVKA 1G63A 1FZTA 4JC5A 4GOJA 2R0QC 3C48A 2FZEA 4EX7A 1Y5NA 3FSGA 5JG7A 3ZCRA 5C4IA 1NNI1 4K6FA 2HZBA 2ZUWA 4GMGA 3NDBB 3A10A 4TUYF 4PQEA 3W6UA 4RD4A 2I6SA 3TG8A 2NZWA 4E14A 4JBWA 2QN3A 4FSXA 4M1QA 4ZAFA 2WLSA 2O2EA 2H2HA 2RJOA 3QU5A 5JD4A 2OWDA 4GWKA 1ONOA 2D54A 3AF2A 2Z8XA 3GLTA 4GPEA 2WG1A 4QUAA 5FBRB 3O94A 5DYYA 2VNSA 2CXRA 1XZMA 3OEEA 2D0DA 2XUIA 5CP8A 3DL7A 2FEOA 2Z2JA 1N75A 3M1AA 4BGEA 3RLIA 1Z5GA 3JYPA 2Q8QA 3MRTA 3GOHA 1TIPA 3M82A 4D4LA 2WSLA 1T29A 2EKLA 3ETEA 4IY1A 1GUFA 1C1HA 1HE2A 1JWBB 3RO7A 3FB1A 2C8VA 3HXKA 4ESEA 4B9AA 3K32A 4WZAA 3NTQA 5LLSA 1FX0A 2VT6A 1P0MA 1I6KA 3GZNB 1TAUA 4AK9A 2G06A 5CT5A 2V6GA 1YMQA 2HGSA 3A1WA 3ZWNA 1U9CA 5REQA 1JNYA 5CEJA 1JSRA 4F4DA 4BJ3A 2HBZA 4P86A 4AF6A 2DLDA 5AI6A 4BMPB 1QHSA 1VM6A 2R4UA 1Z4OA 2JCSA 3N8DA 4N54A 3K0HA 4ARSA 5AVTA 1W30A 1GCIA 1CEYA 5LC1A 4YQEA 3GC6A 2QRZA 3QFFA 4MP6A 3E3MA 3EAFA 4XR9A 3RK4A 3EVGA 4TKUB 1CUJA 4Y9RA 5EUMA 4D5GA 1ZVVA 3HUEA 5KTMA 3TCNA 4AZWA 1SBNE 4LK2A 4XWTA 3ZU6A 2FV8A 2QA5A 4MRSA 3QPCA 4ZI5A 4W5RA 2VDVE 2O2CA 3E3OA 1L5MA 4CLRB 3EWAA 3KHKA 3VKFA 4ECEA 4J0EA 1MJ5A 4MIYA 3H5IA 3KLMX 4FMDF 1R4MB 2WSMA 1A27A 4EFLA 1DEOA 4M1EA 4OGGA 1QU3A 3TZBA 5G4KA 2K87A 4LAFA 4WT7A 4F71A 4DSNA 1OWMA 3L0IB 3GI1A 3AHFA 2DYKA 4MJLA 4MULA 5FXMA 1RM3A 1YMVA 1J56A 5B1IA 1N25A 3HBLA 2SKCA 2X4GA 4HZUA 4UD6A 4IL5A 3UWDA 5A6SA 1AMOA 3IT0A 3DB2A 4CF4A 4A0RA 1V1JA 4ZHSA 4XM0A 3HCNA 1EX6A 4JELA 4JU8A 4RTMA 1UP4A 3A9WA 5LQAA 3CX4A 5I4BA 1ZLXA 2EXXA 1YMUA 3CZ4A 3IXQA 3PBKA 1WMAA 3BREA 4YX9A 1SVKA 4QRDA 3FUVA 7YASA 2OO7A 4JXXA 3ZXSA 1QUEA 1JQAA 2FTKE 3GNLA 2I8CA 2V7VA 2VHYA 4QEKA 2NLOA 1HK7A 3B6KA 3RTDA 4J91A 3UC5A 3ZWPA 3LVFO 3W3AD 3UMFA 2KSQA 1OOEA 3EOAI 4NAUA 3H5OA 1VJCA 3V6MA 5DT2A 2AVDA 3D0RA 3LLUA 1ZX1A 2WTEA 3G7SA 3ERCA 2X8LA 3CLRD 1ZW6A 2ZJOA 1U11A 2V4UA 1TEHA 1EUYA 3KB8A 3M83A 5KYXA 3SS7X 4IPTA 4WGGA 3G0HA 4LF4B 4NYJQ 3T9BA 1QH9A 1TW3A 2R8XA 2VK1A 2ACWA 2WQZA 1EMDA 4J16C 3TLZA 4RK6A 1JJBA 1UJMA 2QNBA 3M6XA 1MGOA 4O2LA 5AKZA 2V7QA 3MLAA 4CN9A 1GTJ1 5AW3A 3FSRA 4PHTA 1SG0A 1L5SA 3WRWA 3EXHC 4NDAA 1U9JA 2I34A 3HCEA 4ON9A 4ZD6A 5FBLB 3QHAA 2HUPA 4IAOA 4Q21A 4C4RA 2Q5LA 4ZYTA 1JAZA 3SVZA 4G23A 5HXAA 4MWOA 3OZFA 2X0RA 1TC1A 2H57A 1MQ9A 2ZVQX 1PDOA 1IPEA 3FZNA 1OXXK 4EG3A 3T3NA 1Z0ZA 4KOAA 4LNAA 4TT3D 3SF0A 1SBIA 1BGXT 1X7ZA 1O97C 3GLIB 3MCVA 4DKJA 1PWEA 1X8JA 4OG2A 4AZVA 1IZ7A 1QBGA 1NJ8A 3KRTA 1C8BA 5FTJA 3UG7A 1MO2A 4QBHA 4JODA 1ATZA 2BMAA 1ZOIA 2RBGA 3D2AA 1EE1A 2YXDA 1VCMA 3EOBI 1RS0A 4KIFA 1AV6A 3V1TC 4ASUA 1OJ7A 2W4QA 3RVLA 2K5UA 5EJ8A 2XB4A 4LXUA 4AJOA 2FF5A 5JYCA 1GU1A 4CXMA 3CMCO 5DCLA 1JA0A 3W1EA 3FLEA 4MS4B 4RUKA 4ZGBA 3AOGA 3C7DB 3D6TB 1EGQA 3B12A 4Q9DA 4RADA 4M86A 1XQ1A 1IHDA 5FAXA 3ECCA 5FQOA 4PLTA 1LQTA 3NJ8A 4BJ5A 1CERA 2OK8A 3O1IC 2P69A 2ANCA 2A92A 3ZGLA 2QX8A 3K2EA 3QITA 4N3AA 4YRAA 3ZY6A 4CETA 2ORWA 1N2JA 1RQLA 1AD2A 3GU3A 3GJ4A 2Y1XA 1WPGA 4GOND 1WG8A 2I29A 3MZ0A 5D5PA 5C1DA 1PO7A 3WGMA 5A03A 1CX9B 4CNQA 1NR1A 2ZJAA 3D5QA 4HADA 4IIYA 1JHRA 5GM2A 4Z4GA 3CE6A 3P2OA 1EA5A 2ZYIA 3F6RA 1CLUA 3UZUA 3DV0A 5I3CA 4I4LA 5K3SA 4J8PA 1NOKA 1ICIA 3AF6A 4ETIA 2QT0A 2QRQA 3PXAA 5LL6P 3WC4A 1G8GA 4GLBA 1XK6A 2H4XA 5LP1A 1UH5A 2C95A 2BT4A 4DTIA 4KG7A 4FB4A 3SZ3A 1LBIA 1EHYA 1UZUA 2WWFA 1D1TA 2NZUG 1A3CA 3PFHA 1T5DX 3D8NA 3G1UA 1DWUA 1VLJA 3I1FA 3P9YA 1W73A 1BXRB 3IJ5A 3UPTA 3GWZA 3HDVA 4FIDA 5FPQA 2OXTA 1XL0A 4E5DA 1Z2NX 2H1FA 2G82A 2QL9A 2ZJ6A 4GQBA 5ELLA 2QRPA 1I7DA 2Z4RA 3FNGA 2VG8A 3CSDA 3BFPA 5JSFA 1HKHA 4CEHB 3IT1A 1NUTA 1R6DA 5JQWA 4Z0NA 2IX9A 1SVLA 4PYLA 1XVVA 3K6SA 4L5AA 3OFNA 5HIAA 2F17A 1CHDA 4KE6A 3ZCQA 4DLKA 1SG9A 4MCIA 4KPFC 1YNOA 1T1RA 5C18A 3RU3A 4OAOA 3QE0A 4N7BA 2QT1A 1CIJA 3EEFA 4Q4HA 3OEHA 2IQIA 1QP8A 1O5IA 1YRLA 1RXIA 1L7NA 3AJAA 3SR3A 1YZUA 2GAOA 3JD2A 4MUGA 3QGMA 4E31A 1Z38A 4EECA 3J81k 1GNPA 2IYEA 4KRYA 5CIWA 3UCEA 1Z5UA 3FB4A 4B5LA 4Q9LA 1JI0A 4Y18A 1JP7A 1ULUA 3CJTA 3QHPA 5ICEA 2AL7A 4G1FA 5CCBA 5HKBA 2WA2A 3OJOA 1NXOA 2H59A 4UEQA 4A26A 4UTVA 2PRJA 3GJ8A 5TXGA 1EXMA 2XECA 4HATA 5JOQA 1V16A 3GDOA 2QLMA 3WO1A 3LAWA 4RKEA 3E7WA 2AH5A 3G5LA 5C8XA 4FS8A 5LDDC 4AL4A 4YGYA 1G4UR 3RYCB 1GL9B 2CXXA 2EZ8A 1NULA 2R7LA 4G97A 3SEFA 1NRWA 2FYTA 1CS0A 1B93A 4MJ7A 2WNSA 5LYYA 2NPFA 5CM8B 1M67A 2HCTA 2WJHA 3LCRA 3RK1A 3UAGA 3WSWA 3WMGA 3LW7A 4MDEA 3C5WP 3PC3A 2PZKA 3PQFA 4ZFNA 1FNSA 1VSTA 3KJZA 5EMKA 3AV3A 1FFBA 2ZAYA 1MTOA 3KKEA 3MJHA 4LVCA 1T5SA 5IYZA 4JI8B 2BISA 1BNCA 2FX3A 3DZGA 2B3TA 3OZ7A 4L6CA 3GVIA 4PGHA 1GQYA 2ODWA 4WRRA 3TRJA 4DYHA 4UTPA 2AQHA 2UXBB 5F9FA 2E4ZA 2RHTA 2AJ8A 4LNHA 4U2BA 4ZRMA 4J07A 3L1KA 3BIFA 2JIZD 4KHZA 2GOYA 1G0OA 2QL5A 1PZHA 3AR5A 1EUCB 4OKSA 4UARA 3GROA 1FFSA 1JZTA 3VX4A 4B3FX 3AF3A 1H6AA 5EWLA 1IQUA 4JJEA 1NXXA 1V1MA 3BSFA 3U4HA 2J7PA 5DWQA 1QANA 1M8GA 4YJHB 4G0WA 1Z74A 1WX1A 3PWZA 2WD9A 1QFJA 3N70A 4A0GA 1XQ6A 1EFKA 4GU5A 4NTZA 4ER5A 3WGIA 3QOYA 5DM1A 2EZUA 4B43A 4M4SA 1XUOA 1ZK2A 2H63A 3MPUA 3NHAA 3VDRA 1R0BA 3K4HA 2ZI3A 2WSIA 2XMBA 1P4RA 2QRGA 4QATA 1PNQA 4LF8B 1FJ2A 1JIXA 1NI5A 3OIDA 1YJQA 3OFJA 5F51A 3FBGA 1A9PA 1XDWA 1PQWA 1X74A 2H9IA 3AHGA 3SS9X 1OZHA 1KERA 1SXJE 1VL2A 2EJTA 3E48A 3MFQA 4DCMA 1QOPB 2PT9A 3SQWA 3HB0A 2BP7A 2YZ7A 3EF3A 4CMKA 1FCJA 1IWOA 4QASA 5D3KA 3T4UA 3OQMA 1TZ2A 2P5SA 2EW2A 3EXG2 2VJMA 5DTEA 4LYHA 3DBHA 4IO1A 4YMIA 5BYKA 2NVBA 1C9EA 4J16A 4RTQA 1EXDA 4Z7JA 4C3ZA 2P1DA 3IDOA 3CVVA 5EKUA 1CK4A 2R48A 3I52A 1F6BA 3RSSA 1X1RA 1I2MA 1WZ2A 1FDIA 1W6RA 3THXA 5DNAA 4C7OB 2LR0A 2ZUTA 4H60A 3TJRA 1B14A 3BHJA 1T26A 3EXHA 4PCLA 4PAWA 1XRMA 1JEEA 2D5BA 4UMFA 4WK6A 3L1VA 3RS3A 1RC1A 1JFVA 3TW6A 2Z2ZA 4AROA 5BMVB 1ZM3A 4K2AA 1HMYA 5DIZA 2ZI7A 1E7RA 1C50A 2XMDA 3FYSA 4DQLA 5A62A 3S8YA 3KPVA 1NVFA 1F2DA 1XE3A 2DPYA 4HDNB 1RM5A 4INAA 3UXHA 3I8SA 4G8DA 4NICA 2H7XA 2VSNA 2O1EA 1YDMA 2VQ6A 3VR4A 3EQ6A 3UYLA 4BYGA 1NVWQ 1W88A 3DKPA 2JAPA 3QXCA 1JVNA 3KJIA 1GQQA 1YZFA 2I3ZA 4GM4A 4N0EA 2JCXA 4J7XA 1NW3A 3A2NA 4NBVA 1ZMRA 1W87A 1X1EA 1X7WB 1CQIA 3UN1A 3PD7A 4MR7A 2KX7A 1J8FA 1TJNA 4LSWA 5AVVA 2BFBA 4BMNA 4LRXA 4TOIA 1H2ZA 1YQDA 5CX4A 1DDIA 2AEJA 3IVXA 4PCUA 1IJEA 4QG3A 4G0ZA 3RT9A 5CD1A 2J08A 1QH8A 1M6WA 1C0EA 1II0A 5EJEA 5TMBA 1FQJA 2XMQA 3HJAA 4MS3A 4PSAA 4QXRA 5IDVA 1BCSA 4M46A 3KPUA 3TQTA 2W2QA 3CXUA 4PYQA 3O0TA 4BXOA 4HDRA 2E4XA 3WBFA 1VCNA 5KJEA 2HEGA 1VL0A 2VKTA 1JLRA 1J33A 2DF8A 4PLCA 3D8BA 1BS9A 4D4HA 1IXZA 3TPCA 1G5RA 5E38A 2WTUA 2XMPA 5KC8A 2VNJA 4S3MA 1V8OA 2HSZA 3FCXA 3JASA 1LPMA 3OO1A 4TVOA 2YWXA 4WE3A 4CKWA 2WYOA 2EL7A 3GRCA 1FS4A 4WN3A 2IXFA 3HACA 1DKQA 4ARVA 1Z6ZA 4X7PA 2XYVA 1RRPA 2Q6VA 2JEOA 4PANA 5EYPB 3VR4H 1AQLA 1U7PA 2FR1A 3EN0A 3H6GA 4X93A 5K2OA 1XZFA 2EG9A 4XM2A 2IWRA 4IGKA 3IXLA 5KVSA 3EYWA 2I2AA 3F8SA 5B58C 1FYFA 4EPRA 4YT2A 5BYJA 3IS3A 3KBBA