1F12A

L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDECVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-HYDROXYACYL-COA DEHYDROGENASE
publication title Sequestration of the active site by interdomain shifting. Crystallographic and spectroscopic evidence for distinct conformations of L-3-hydroxyacyl-CoA dehydrogenase.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1f12A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1f12A01
5I8ZA 5BNIA 1HTBA 2GD1O 5ER9A 1HEUA 1PR3A 1XCBA 3JQGB 3LT1A 1ZO8A 4NG5A 4YBZA 3ZW9A 1D4FA 1EZ4A 3PIIA 4FGWA 3DAPA 3GNSA 1D3AA 1CIVA 4R4JA 8LDHA 1GZ4A 3CMCO 3H6KA 1GPJA 1KVQA 4BO2A 3A4VA 2BFOA 3GPIA 5DCUA 2VCYA 4J2OA 4R1TA 1HDYA 1E1KA 2EIHA 2I65A 2J3JA 3RBVA 1C0KA 4PZDA 1XIVA 5DZSA 2JHFA 1YQDA 1K6JA 1PEDA 1ZXBA 2Q4BA 5GZ1A 5DOVA 1LDMA 4PLHA 5FFFA 5AXAA 1JVBA 2ZJ1A 4NHEA 4IGEA 8ADHA 1A7KA 3M6IA 4BKRA 4B4VA 5HWSA 1B7GO 3F6YA 3IOYA 3L9XA 3KETA 4OXKA 3DDNA 2HRZA 3ASVA 4INAA 3TFQA 3JQ9A 3INRA 3WYCA 1CETA 5C7OO 2BRUA 4ROSA 3TWOA 2NADA 4MO2A 3H2ZA 1IL0A 2DUUA 5A9SA 1BSVA 3HDYA 4BB5A 4NU6A 2IEBA 4JJFA 3W8EA 1R16A 4O5OA 4GL4A 4BKQA 3VKUA 1LSSA 1FF9A 3BTVA 5DN9A 3AUTA 3AI3A 3JV7A 3MWDB 1R66A 2PKRA 4M54A 2X7HA 1LLUA 1UXIA 3G3EA 4R3NA 4RVSA 2LDXA 2YDXA 2D4AA 3ZWXA 1Y6JA 4YJHB 3PQEA 1W4ZA 1I0ZA 5EMHA 1U8FO 3ONDA 4L76A 2ZTLA 2Q2QA 1Z73A 2E6UX 1AUPA 4J4HA 1X7DA 4AJLA 2QIOA 2W2LD 7MDHA 3ZV6A 4JN6B 2WE8A 1P44A 3EZYA 4PG8A 1JWAB 1A4IA 3ROKA 5IDWA 2RAFA 3RKRA 1HLDA 3WIEA 1PGOA 3LT2A 4KTTE 4JBIA 1XLTA 5KCZA 4W7HA 1MP0A 3GLQA 3OFSA 2HMSA 1AXEA 4IJVA 3QQPA 3ENNA 3FTPA 1ONNA 1ONOA 1MFZA 3ZDFA 5KWEA 3V2UA 1VLLA 4XYLA 4L9RA 3O4RA 2IXBA 2VTDA 3U9LA 2FWMX 1Z82A 4RPHA 3MJTA 1UUFA 1YL5A 3F4LA 4RVHA 3G49A 3V5NA 1WLYA 3INTA 4W99A 4XKJA 4RQUA 1EEHA 5JCJD 4ALKA 1P77A 1U7TA 4BNTA 4NJMB 3AFMA 5TX7A 5JDCC 3RQSA 4NH4A 5JYEA 2OFPA 1KEVA 1IHXA 4PLYA 3CZMA 4WLNA 2D3TA 1LQUA 4DBVO 1E3LA 3C1AA 2Q99A 2VRBA 3JTMA 1N9GB 4CMEC 5AQ1A 4LK3A 4O63O 3AM3A 3VDQA 3FNFA 2CD9A 3CTVA 2Y99A 4Q9NA 3CPSA 3ZI0A 2NQ8A 4M8SA 4W82A 4RF2A 3PGXA 4Q3BA 3WXBA 1EK5A 5F1OA 1BXZA 3B70A 2HJRA 3SLGA 3GEGA 4XDZA 1XHLA 1E7YA 3JQ7A 1Q0HA 6LDHA 5I9NA 3LC1O 4FB5A 3JQFA 5JW6A 5G4LA 5EQDA 4EDFA 4XRGA 1HZJA 3VPGA 2HRBA 2W2LA 5G0TA 3DOJA 2Y68A 4ZD6A 4AJJA 1YWGO 4LMRA 4PLPA 4PIVA 2CDAA 5AOVA 4XGIA 3RUEA 3U49A 2FR1A 4YTEA 4IZIA 4FFMA 4BKPA 2HMWA 1GTMA 3PEFA 3DMYA 2BGMA 1UDCA 3ROPA 2GYYA 3C3XA 5IN4A 2VNAA 5KIAA 4KUGA 1NPDA 3T7CA 3WB9A 2WMDA 4OM8A 1U3TA 4TRRA 3DBRB 3CZRA 3NDJA 1IZ0A 1BDMA 4FIZA 2W4QA 4KDFA 2CDCA 2XOXA 3QY9A 3DEYX 4FW8A 1R0KA 3QVWA 4CM3A 3EUWA 4H15A 1RKXA 4S1VA 4Q3DA 4GLLA 3ICPA 1TT7A 5H83A 1E3WB 2ZCUA 4RF3A 5JCJA 3OA0A 1PJ2A 2HDHA 2I99A 4KWIA 1DIRA 1UZLA 1GU7A 2A92A 3DHNA 5JLAA 3P19A 3D4PA 3COSA 1T25A 2A9FA 2B5WA 3VPXA 3WNQA 5G0SA 5JCXA 3ANMA 4II2A 4OIMA 2O3JA 3HQ4O 3ETDA 1S6YA 3OA2A 3SC6A 3JQ8B 1DFIA 4CM1A 4HFRA 4ALJA 1ZEMA 3AU9A 4FOSA 3D5TA 1CEQA 1JTVA 3GGOA 3SXPA 1MA0A 3LSYA 4BV9A 2B35A 3F3SA 4BO7A 1Y8QB 4QEDA 2HMVA 1FDVA 2X4GA 1E3IA 5IDYA 3GHHA 3VZQA 3PFWO 2VZ8A 1JW9B 5CEEA 1BW9A 3OIDA 4NPCA 1PJLA 2VTEA 3GDFA 5KJEA 3TOXA 5KTKA 2A35A 4AJ4A 2J8ZA 2I5PO 3VTZA 3UW3A 3ZHYA 2O2YA 3AY7A 1VPDA 2UYYA 1UXGA 4I9NA 4HFNA 1GUFA 1I3LA 3JYNA 3H9JA 2Q3EA 5BNTA 2C20A 1BXGA 1J49A 3H7AA 2YQ5A 4K26A 5L9AA 4CLRB 5BR7A 4R9SA 4E33A 5AXDA 4AICA 5ENVA 5FWNA 4CQLB 1GD1O 1QV7A 3KYBA 2AG5A 4IPTA 3V2HA 2EKPA 5DCYA 2ZB8A 4LW8A 4NFSA 1PJTA 2BHLA 1K3TA 3KRTA 5F1PA 4CMJA 4PCVA 2H5LA 3TDKA 4CQMD 4O0LA 3W6UA 4XYBA 3ONFA 4WKGA 4DWVA 3EGOA 2X9VA 1I2CA 3IUPA 4PVCA 1HF3A 4KWHA 4FQ8A 2OGUA 3IP3A 2O7QA 3ANLA 1QYXA 4DLBA 1UXJA 3BMNA 2I76A 3WLEA 2I67A 1L7DA 1VC2A 4IM7A 1HSOA 1CERA 2Q49A 4OXNA 4B4WA 3KYCA 1M6WA 1X0XA 2E4AA 4BO4A 4YAGA 2B4TO 2EP5A 3EC7A 3SC4A 1Y9EA 1OC4A 2OP1A 4CMIA 4I5FA 4ZQBA 1TI7A 4IUYA 4B3IA 3JQBA 2BLLA 4Y6SA 5CHEA 3EHEA 2RIRA 4QFCA 3RC9A 2C0CA 3WSVA 4J3FA 4OOEA 4LVUA 1F14A 5CG2A 2W2KA 2JCXA 4CLOA 1D8AA 1BVUA 1K2WA 3DXFA 3FI9A 3FPLA 4CLDA 1LC0A 2AMFA 2PV7A 4I9HA 1PQWA 3PQDA 1R0LA 3WDSA 1FDSA 4AJ2A 2UVDA 3KEOA 3AK4A 5GY7A 1XWFA 4GX0A 4MJLA 1PJQA 4CV0A 4U8GA 3AUUA 3S2GA 4IMRA 4BNWA 4RORA 4YT2A 1ZBQA 4IDFA 4WLEA 3B6ZA 1YKFA 4MPDA 1U28A 4B7CA 1AN9A 4CL3A 3WOHA 3IS3A 3I6IA 4RVDA 1GDHA 5C7IO 1UJMA 4M89A 2OOSA 4NZ9A 4QQRA 3ZNNA 4BO1A 2VHWA 5KJFA 3DOOA 3RC1A 3WGIA 1NFFA 2Q1WA 3DAGA 4UEJA 2PLAA 2FY8A 2LDBA 1TT5B 2OL4A 3I6QA 4QTZA 4WEQA 4Z9XA 2NU7A 2VRCD 5A1TA 1O8CA 5TT0A 2IYOA 4R1SA 4J43A 5AVOA 2WWRA 3CINA 3NUGA 3V2GA 5K6AC 1AXGA 3BXXA 2FPGA 2VWPA 4GPD1 5CPBA 4BO9A 3B1JA 4ND3A 4LRSB 5G4KB 3V8BA 3E48A 1UP4A 3OJLA 4K28A 4OYRA 2Y66A 4DQXA 3AI2A 1DEHA 1I2ZA 1R0SA 3AOEA 5TJ9A 2RCYA 3GZNB 3KB6A 2Q50A 4PLCA 4UEOA 2FRDA 5ES3A 1U5AA 4DLLA 1U4SA 1T2DA 3KHUA 4BO3A 1LRLA 1O94A 1T2FA 2X6TA 4RDIA 1E6WA 4IMPA 2DU8A 1ONPA 5GZ3A 4XJTA 2PD4A 3I52A 3HFGA 1KIFA 2CVOA 4HXYA 1GUZA 3ANNA 5COBA 2WD7A 3BA1A 1GCOA 1AGNA 3AM4A 2Y1DA 1ID1A 2NVUB 2UDPA 4GH5A 3BYZA 2I9PA 1VE9A 4WCFA 3HDJA 3PDUA 2ZYGA 1E3EA 3HNPA 4BNNA 2PKQO 1LI4A 1NAHA 1GQQA 1XU9A 5HS4A 1FDWA 1ZXLA 2GN8A 1C0PA 1WNTA 4J4TA 4Z0TA 1AHHA 5K0ZA 1E0DA 2J3IA 2WYUA 3GEDA 4MP8A 1DHRA 1ZIDA 1IPEA 3PHHA 1JVSA 4JJIA 4MVJI 3RJ9A 3ASUA 4Q3NA 3R3SA 2VT2A 4N5MA 4RF5A 2J3KA 3VZSA 1UXKA 4WNCA 4DYDA 1Y8RB 4WJZA 1YDWA 4ITUA 3JQAB 5AXCA 2C59A 1H2HA 4Y6RA 3LDHA 5DOZA 1C0IA 1LA2A 3ZWMA 3WGQA 3DZFA 4BQPA 3R0IA 3D3WA 3AY3A 2VRCA 3MJVA 2BFPA 4MKXA 1U8XX 4J9VA 2EGGA 5T57A 3GG2A 4CM6A 1IULA 4XD2A 2NTNA 3X2EA 1VJTA 1C3VA 1U3VA 3HN7A 1KOLA 3EAGA 2VOEA 1WVGA 3NTQA 4P4LA 3ZWOA 2DVMA 1J0XO 2PZMA 1YJQA 1UAYA 2YV3A 1SEVA 1NHGA 3U4CA 1E3JA 4XQGA 3BMCB 4PG4A 3PI7A 1ZSVA 2D5CA 3QVTA 3OM9A 3I4FA 4O6VA 5T8KC 4XZ3A 5CFZA 4OKNA 2X8LA 4R9RA 3F5SA 4LGVA 4CJXA 3C7AA 1EQUA 4BKOA 5I7VA 4JXKA 3TZCA 3LZ6A 2OMEA 1YRLA 2JFGA 3INGA 3AUAA 4U0KA 4ALIA 1V3UA 2IRWA 1XEAA 2Z5LA 2NU9A 3BZUA 3H2SA 4MKRA 4JNKA 2HLPA 2QRKA 3GG9A 4W6ZA 5BQFA 3ROQA 4YB8A 1XELA 2GSDA 5HRUA 6ADHA 4MVJG 3KSZO 4CUKA 4EYEA 5ADHA 4MDHA 4BV8A 1NXQA 3WBBA 2BKAA 1O89A 3FNGA 5JDIA 1H6DA 4CV2A 4AFNA 1M6HA 4FDAA 3ZCXA 1ZK0A 4PGFA 5TQVA 4MOWA 4CM7A 3DR3A 3MCVA 5KVQA 1NASA 2EJVA 1RWBA 5ILOA 1VM6A 2X1HA 4ZN6A 5I9MA 1ZK2A 2DC1A 1EUDA 5C3MA 3K92A 3BMOA 3TNLA 2PZLA 5JMPA 4NBUA 4DTIA 2GNAA 1PWZA 2WM3A 3OH8A 4WLVA 2EKLA 2AG8A 3D4NA 1QRRA 1ISJA 4DUPA 3NKLA 4NI5A 3LQFA 2PTGA 2VWQA 3FCOA 5CG1A 4NFYA 4YRAA 1YL7A 5L95A 1QXSA 5IXSA 4J7XA 4D41A 4CL8A 4YQZA 2PK3A 2JD2A 3MJSA 3DMTC 3ZHZA 4ND5A 1DDOA 2PZJA 5B4UA 4HKTA 3ABIA 1PSDA 4I8XA 3E03A 1GCUA 3RUFA 2VHVA 2H63A 4KMSA 4MVJD 4NBTA 4LN1A 3C24A 4HNHA 5ITVA 3GRPA 2DM6A 4OH1A 4E5NA 2BGKA 2DTDA 1F06A 1GADO 4XYEA 5CEFA 4CM8B 3VKVA 1WMAA 3PIDA 3EK2A 1NYTA 2DLDA 1ZZEA 3KV3O 1QLHA 4OGWA 4FC6A 1HDGO 3ZU3A 2J5KA 2DTXA 4FFNA 4A73A 5A05A 2AXQA 3DZBA 3QVSA 2O3RA 2X23A 5JMWA 1GZ3A 2ZTUA 4GWGA 2P91A 4XQCA 3PJGA 3K6JA 3GVCA 1E5LA 1HXHA 1ZH8A 3H9GA 2QZZA 5KNLA 3SBOA 4BMSA 2CUKA 4AJ1A 3FNEA 2O23A 2G76A 3RUAA 1CYDA 5IFLA 3EW7A 2IDZA 3ZHXA 1IUKA 1DAPA 2EEZA 4A7PA 1BW9B 1DSSG 3D0OA 5C7LO 2VHYA 4TRMA 4L8VA 2E82A 2P4HX 4BQRA 2FZWA 4GX5A 4D43A 1OBFO 3KLMX 1HL3A 4IJUA 4JP3A 4NU5A 3IKTA 1P1JA 2IEDA 4IXWA 3I4CA 1X0VA 3IJRA 1SBYA 3U62A 5CDUA 2AHRA 1SMKA 1H6AA 4PLWA 2OO5A 1YH3A 1GQ2A 2HK8A 1WZEA 3GA0A 4XRRA 5JFOA 3AOGA 4R16A 1Q2XA 3DBHB 1P0CA 3T7EA 1U2DA 4YCAA 4GX1A 4U5QA 2O7SA 4WLOA 1JN0A 1A7AA 2WE7A 2CSUA 1FDUA 1QV6A 3K31A 3PHJA 4L4XA 1Z7BA 3A14A 5L7YA 5CEJA 3ZV3A 1K89A 3Q6IA 1NP3A 1NNUA 4IXTA 1HSZA 2I3AA 4HFJA 5F21A 3FHLA 2UUOA 5JYDA 2PWZA 2VNSA 2YHIA 1MC4A 1LSJA 4FJ1A 2ET6A 1NX6A 3BMQA 4B8ZA 4H3VA 4LRTB 1S7CA 1QSGA 2NSDA 1DRUA 2QHXA 3OQBA 2ZATA 2WSBA 5IZ4A 3JYPA 4B7XA 3BMNB 1J5PA 1QMGA 4JP2A 1XGKA 3ZWAA 4DL9A 1OC2A 3H9UA 4RF4A 3QWAA 3Q0EA 5TF4A 4CM5A 3TFOA 4RGBA 3O8QB 3DZHA 2WDZA 1ARZA 1MG5A 4RQTA 1M66A 4WE3A 1NWCA 5AXBA 4P22A 1FMCA 1GUYA 2Y05A 3GF4A 3PK0A 4IGFA 5TGDA 3CEAA 3DHEA 4WECA 1SOVA 3L9WA 5I7EA 3I9OA 3P2YA 2NACA 1E6UA 4GI2A 2DKNA 4CLOB 1ENYA 3JQFC 2ZTMA 3L07A 3V1TC 5IG2A 2EF1A 4N5LA 4G81A 3KYDA 5ENDA 4D3SA 4PRKA 5CDTA 2Q4EA 1X1TA 4ZHSA 1ISGA 4GBJA 4M87A 1D1SA 2NM0A 4DMMA 5C5IA 4E3ZA 3I9JA 2ZIZA 1KERA 1EFKA 5DULA 4GSLA 4KUHA 2Y0DA 3JD2A 1C14A 1C0LA 3IUSA 3LK7A 3Q3CA 2YFHA 4W4TA 4NMHA 3WLFA 2GGSA 3F4BA 3PHIA 1PTJA 2X5OA 4Q3EA 3M2PA 4MIYA 1NQOA 5T6BA 3H4VA 1SEPA 3S2EA 4BHTA 2DBRA 3ZV5A 3CMMA 1O0SA 1ZK3A 1G0NA 1ULSA 5L7WA 3CIFA 4HNGA 4GQAA 3DFZA 4IIVA 3FBGA 1HDXA 3U5TA 4YXFA 4P8RA 1PU2A 3VPHA 3ZWCA 4NFHA 3RASA 3ZHBA 2IZ1A 2ILTA 1XU7A 3I3OA 1VSVA 4CPDA 2E48A 1LRJA 3NGXA 1VKOA 2D1YA 4PZEA 4CM4A 4DPLA 3EVNA 3H8VA 1K5HA 1YDEA 3JYLA 4BVAA 2CDBA 1LSUA 3WICA 2V6BA 5L45A 4PG5A 3D3EA 4YEDA 1WW8A 2Z1NA 2BMAA 3OP4A 1GV0A 2FSSA 4CR8A 5IXYA 4OQZA 4G5HA 1BRMA 2NV6A 4NK4A 3VH1A 3UHAA 3RKUA 2WD7B 3W8FA 2IODA 1JAXA 5IZCA 3SVTA 2P9EA 3GVHA 3I1JA 4DQVA 3WQQA 4WCFB 2ZQZA 3OSUA 4BNIA 4DC1A 2AE2A 4HADA 1P1HA 3RUHA 5TT1A 2G0TA 3UAGA 5ICSA 3PLRA 4J4BA 4D79A 2V7PA 4YDRA 4E31A 4B8WA 1LNQA 4MKZA 1PZHA 3AI1A 3NGLA 1I3KA 4AJPA 2WJPA 1LTHR 1DO8A 3PJEA 4FD3A 4Y8VA 3JD1A 2ZJ0A 3JCZA 3CUKA 1A72A 5JPIA 3BAZA 3FRJA 4E2XA 1V6AA 2OBNA 1ZJYA 2OUIA 3LF2A 2J3HA 4UULA 1R6DA 4L0QA 4UUMA 3E9NA 3S8MA 2OORA 3TZKA 1PGQA 2P5UA 3P7MA 3EYWA 1GL3A 3GRKA 4MINA 4Z6KA 3D3WB 2ZK7A 1XYGA 1DHTA 4TVBA 3WGOA 2ZYDA 2CMDA 5I7FA 3K2BA 2AEJA 1O5IA 4NBWA 3TQHA 3C7DB 1KVUA 2B4RO 1IPFA 5FYDA 3R1IA 4LCEA 3WGZA 2PH3A 4R1NA 4N18A 2NU8A 1X1EA 3HWRA 1TVEA 3OJEA 2CFCA 3E18A 5EL0A 4YJGB 4EUFA 4J16A 4ZGWA 1JKFA 4B3HA 3PWSA 4Z0HO 3JD3A 3PFFA 5JAMA 4MVJE 3C7CB 3A06A 3BTSA 1DC3A 4IY1A 1N7HA 3WS7A 4YAEA 2QX7A 4AJNA 1A9ZA 1B8VA 2J5RA 3KEQA 4UUNA 4CUZA 3ZW8A 1YVEI 2PY6A 3H5RA 1LXCA 1P1RA 2Y93A 4FR5A 4OOFA 3GN1A 2HK9A 1H2BA 4NIMA 4UVGA 1HZZA 5L4LA 1DPGA 1E92A 3G79A 3MEQA 2ZB3A 1YQGA 4RZIA 3FNHA 4D0SA 5A04A 3ZNPA 1P0FA 2X86A 5B4TA 4KZPA 4P38A 4YR9A 2BD0A 1HDCA 1I3MA 3DFUA 2R00C 3FWNA 1X15A 4E4YA 1Z75A 3S55A 4J7CA 2VUUA 1T1SA 1E7RA 1V8BA 1B3BA 3M1LA 4N54A 4YRBA 2X0IA 1PZFA 5ER6A 1NVGA 1U1IA 3EMKA 3IAHA 1DOHA 5JNLA 3AUSA 5LDHA 1HRDA 4M49A 5MDHA 1ZCJA 1Y5RA 4F45A 5G2OA 2PH5A 1NVMB 3DBLA 5EQFA 3W1VA 4BB6A 4II3A 4MP6A 5HA5A 4F6LA 1ZK4A 3NAQA 4XEHA 3AOEC 4GGPA 1LX6A 1E7MA 2DBQA 1F8FA 1H9AA 3GUCA 1LLDA 1ZFNA 2AEFA 3NTOA 2POQX 5TS3A 3RC2A 1F12A 4I5EA 4D0RA 1L7EA 3OIGA 3K5PA 3ROMA 1VL8A 3WFIA 5TC4A 2Y0EA 5G0VA 4XDYA 4YT5A 1NVTA 3ENKA 1I36A 2IYPA 2D59A 4GVXA 4XIYA 3RJ5A 1DLIA 1NWHA 2NVBA 4FFRA 4Q3CA 2F00A 3UF0A 1FJHA 4FJ0A 2GASA 2PFGA 4GLOA 4WCFC 3OEWA 3W4JA 1YB5A 1SOWA 4TMFA 4IDAA 1YOVB 1GYPA 3GAFA 1ISFA 3PWKA 3QWIA 2B36A 1Y5MA 3NT4A 3QVXA 5JY1A 1HE4A 3Q9UA 4XJSA 2NTVA 1I33A 4L73A 2G82A 4CMEA 4CR7A 3I9NA 1LDBA 3GH3A 3F5QA 4RZHA 1CQJA 1NHWA 4JJGA 5H81A 4QO8A 4AVYA 4LMPA 1LQTA 5EIOA 3JQGA 4CUJA 5COQA 4AJKA 1BHSA 1GV1A 3PJDA 2DBVO 2EW2A 4YT8A 4PLZA 3ZWYA 3GC6A 4D3FA 1H94A 1EFLA 2SCUA 1PWXA 3DQPA 4IDBA 1SPXA 1X7HA 1PS0A 1DIBA 5CAEA 4D3DA 4I5GA 4BS9A 2D8AA 3HDQA 3RUDA 1R37A 3VTFA 4TVOA 3VVBA 1YB4A 4RO0A 1NPYA 1A4UA 2W8ZA 2B83A 3N58A 4YACA 3LU1A 1G1AA 3WTCA 5KVVA 5CDSA 4WLFA 1WP4A 5ICMA 2Y1CA 4Z0PA 5MGBA 4XYGA 5U1PA 3FD8A 4FSHA 5BSEA 3OHSX 4BGIA 4CLEA 1LUAA 3HDHA 1BDBA 1HWYA 1T2EA 1WZIA 3GDOA 4IDGA 3RIHA 3UH1A 1EE2A 2V6MA 2EWMA 3L77A 1EUZA 1O9BA 1O6ZA 1ADCA 2WYVA 1TB4A 2WEKA 1QR6A 2X9GA 2YHIB 3ITKA 1I30A 1PL7A 4LSMA 5T67A 4R54A 1GYRA 2JJYA 4TKLA 1I01A 4BUCA 3IL2A 4W7IA 3ZH2A 3WYEA 4IDDA 5A4DA 3PWZA 3WSWA 3F1LA 1B8UA 4K9DA 3WWZA 2NVWA 3OJFA 4XGNA 2AEMA 1UDAA 2EERA 2YQ4A 1EE9A 3GUYA 4HP8A 4JK3A 4XA8A 1CQIA 5THQA 2O3UA 3WYBA 4BNXA 4CQMA 4EJ0A 1DJNA 4BO5A 5JC1A 4YJHA 1XDWA 4DXHA 4ZICA 5JDIC 2GZ2A 3ORFA 1X7GA 1I5RA 3EVTA 3WQSB 3DL2A 3GY0A 3B20A 4Q3AA 1ZK1A 3D64A 4M1QA 4DRYA 1WPQA 5A5EA 3LLVA 3UXYA 1EBFA 2GLXA 3DONA 3VH4A 2E37A 4CV3A 5A9SB 2PNFA 4FBGA 3K73O 2FR8A 4ZQFA 2C54A 1PJ3A 1GPDG 2BH9A 2D5AA 3D1LA 4GAEA 4GGOA 3QLJA 1KEWA 1U4OA 4Z9YA 3C1OA 3MTJA 5JBIA 3RU7A 2YFQA 4CV1A 4RPKA 1ZEJA 4GSKA 2CNBA 4M55A 1JAYA 2B0JA 3IKVA 3ZU4A 1M2WA 2VUTA 4XR9A 3VZRA 1OOEA 3BTUA 1D1TA 1T2AA 1OMOA 1Y81A 2UV8A 1H5QA 4ILKA 1EDOA 4BMVA 3PGJA 4E12A 5EINA 1K6XA 3L4BA 2QYSA 4R01A 1LBEA 1YONA 5BSGA 4NJMA 2BF7A 3ZN2A 1W0CA 4ZRMA 3X2FA 1SCUA 3WJAA 1BGVA 1OI7A 3JSAA 2QG4A 5COAA 1Z74A 4Y67A 3NJ8A 4CR6A 3QE3A 4XR4A 4YJFA 3STHA 1E6EA 3QIVA 1N9GA 3JD4A 3DO5A 2X58A 4MVJF 3FTNA 3IP1A 3FN4A 4A5OA 4RDHA 1NQAO 4AL4A 5F5NA 2P4QA 1T1RA 3DZJA 3HN2A 5K9ZA 3NX4A 1Q7BA 2F1KA 4W9NC 1P1FA 4NNJA 4ZQGA 4TZTA 2VWHA 4MP3A 2O3QA 4BGUA 5KJCA 3E9QA 4E5YA 1KEUA 2DT5A 3U0BA 1T26A 1RM4A 4WGGA 2J6IA 2B4QA 3RC7A 3OQ6A 4OJNA 2DFDA 2PR2A 4QT0A 2XF8A 2HMTA 1YL6A 4DMLA 4D45A 1Z7EA 1U3UA 4RPGA 4BNFA 2VYVD 5EPOA 4KOAA 4O1MA 5DF1A 1JKIA 1DBVO 1Q7GA 4LSWA 2BI7A 5U4QA 1SZJG 2CY0A 4OXYA 2PD6A 2JL1A 4PN3A 1UR5A 2AW5A 5T5QA 3U4DA 2BFMA 3DBRA 4WOJA 1JKJA 1B14A 2UUPA 1RYDA 2JAPA 3G1UA 3RCBA 1JA9A 4YPOA 1R4MA 4CLHA 1ZSYA 3JYOA 1RM3A 3QVOA 5F5LA 3NT5A 3VC7A 4DREA 1BG6A 1ZJZA 5BNFA 2V6GA 3Q9NA 3JQ7B 2YV1A 3I5MA 2X0RA 4ALMA 5EERA 2GF2A 2HQ1A 1M76A 5DP2A 2YZ7A 2PGDA 3I23A 3AWDA 3WG9A 1VJ1A 5JXWA 2C7GA 2YJZA 1BVRA 2QQ5A 3WGYA 1O95A 3WX0A 1F17A 1NBOA 1XQ6A 3OF2A 2C29D 2EJWA 3H3JA 1I3NA 4IJKA 1KETA 3CSDA 1LDYA 4RLSA 2ZYAA 4FFOA 4YVFA 3JQ8A 4BGVA 2JAHA 3L0DA 4PLFA 1PL6A 2YYYA 3PZBA 3Q1LA 2IE0A 4ID9A 2P9GA 2OHXA 1PJ4A 1Y8QA 1K0UA 1F8GA 4WK6A 3ZU5A 2O4UX 4PG7A 1MG0A 4XWYA 3N7UA 4OO3A 2EW8A 3JQ9C 1PGJA 4IS3A 4CMGA 2BI8A 3F47A 4HY3A 1P31A 3PLNA 2Y67A 2Y1GA 5JY6A 3DTTA 4E0BA 3NTRA 1YBMA 3MTGA 4DIFA 3RUCA 4N5NA 3WGGA 4OQYA 1ZSNA 4URFA 1XSEA 4DPKA 5H82A 4AJIA 3HB5X 3E6AA 2DFVA 1V3VA 1Y7TA 1PQUA 3I9LA 4DQUA 5CDGA 2GN6A 2YY7A 3C8MA 4CLRA 4YJDA 2VYVA 1UDBA 4L74A 1WWKA 1LDGA 5EESA 2I6TA 5GZ6A 4JX8A 2HK7A 4CQLA 3ETGA 3OICA 1U9JA 4NQZA 3E5MA 4I1IA 3PHGA 3Q2IA 1CWUA 1HETA 4JROA 1QYVA 2AA3A 3DBLB 5L51A 2VQ3A 1R15A 2I3GA 3FR7A 2JD0A 4Y98A 1MXHA 4HUJA 3SJ7A 4D46A 3GFBA 4DIBA 1ISHA 4CODB 3IQDB 4E5KA 2G5CA 2GUGA 4A2CA 4J7UA 2C5AA 3GMSA 2WD8A 2C07A 4MIOA 4WOKA 5AYVA 1B2LA 3VH3A 1BXGB 1HYHA 2XXBA 1ENOA 2YUTA 1JQBA 3UICA 5DT9A 3ONEA 1PX0A 1LLCA 3KUXA 1E1MA 1ML3A 4TWRA 1PZGA 1N5DA 4MVJH 3BHIA 1LDNA 3H9QA 3LLSA 2VHZA 4TSKA 3WFJA 4DYVA 5L40A 5A3JA 5CP8A 2JFFA 4YA6A 1ADBA 4K6FA 2GR9A 3RFXA 1DRVA 1RJWA 4K1LA 4XIJA 4FS3A 3ZWBA 1DLJA 1PJBA 2HMUA 1VRWA 4I9UA 2CZCA 3SJUA 2NNLD 1SAYA 4CLXA 3WIDA 2PD3A 3IIEA 2VT3A 3WJ7A 4QECA 1YXMA 4MVJA 1H9BA 4H7PA 3P5SA 1P3DA 1V0JA 2DPGA 1MFPA 4E2WA 2O3SA 4ZVVA 1N2SA 3KYCB 1KEPA 3JQAD 1SB9A 4U7WA 3ULKA 4C7JA 1NFQA 4CMIB 3HADA 1EVZA 1K6IA 1J6UA 4IDCA 3L6DA 5DBFA 1TT5A 3NT2A 1DC4A 3MJCA 3PRJA 4XQEA 3RROA 1FK8A 4HV4A 3DZIA 2W2KB 2JCVA 5FI5A 1MV8A 3I9KA 3ZNOA 4IQ8A 5G4KA 1QORA 4NK5A 4R1UA 2ZB4A 3PP8A 4R51A 4J1TA 2FN7A 3RBXA 5A9RA 4J91A 1EUCA 1VL6A 4BNHA 3GZNA 5L4NA 4WPGA 3CKYA 1YJ8A 1HDRA 3DOCA 3UVEA 3QWBA 2R6JA 1SO8A 2QRJA 3GFGA 2V65A 1E77A 1M75A 4R69A 1LRKA 4E2ZA 2VWGA 3PQFA 4EEXA 1E7QA 5A3VA 1I24A 1IHYA 3DMTA 4EJ6A 3JD0A 2Y1EA 1QYCA 1NM5A 5F1KA 2NVUA 3DBVO 1ADGA 3R3JA 2XAAA 1C1DA 5HS6A 3CXRA 4B4UA 3WGHA 5EJ2A 2O4CA 3PDJA 1PL8A 3BIOA 3OIFA 4X54A 3DAFA 5B1YA 2A4KA 2VUSA 1P33A 2A94A 4BMNA 4E32A 1XR3A 3MJEA 4NBRA 4CQMB 3H9EO 4IDEA 1W8DA 1WDLA 5CDYA 4OHUA 1ISMA 4I5DA 1B16A 5IF3A 3A1NA 3EZLA 5LDGA 2ZTVA 5TLSA 3VVCA 3S1LA 4J2HA 1NPTO 4EEZA 1V3TA 1Y8RA 2XPCA 3DC2A 3JQAA 9LDBA 3QA9A 2JFHA 2IZ0A 5BT9A 4HFMA 3CH6A 5ILGA 1N8KA 3ZZNA 1BXKA 1N1EA 1NR1A 3L4SO 4FFPA 1LEHA 1IZ9A 5T64A 4P4GA 5JO0A 4IS2A 3RVDA 2CVQA 1HDOA 3LT0A 1P1IA 1F0YA 1E1LA 1EK6A 1DB3A 1EDZA 1X13A 1GYQA 2H9IA 4ND2A 2E49A 2AQHA 3FR8A 5TNXA 2AQIA 4OSOA 3NJ4A 3W6ZA 4JBHA 2X9NA 1HLPA 4TQGA 1C1XA 1XA0A 4QXMA 2VOJA 1DFHA 3PXXA 3TRIA 3QV1A 4EGFA 1MLDA 3BMCA 4GWKA 1T4BA 4GKVA 3V1YA 5C37A 1E5QA 4P4NA 3AFNA 3MJ4A 1H6CA 3KO8A 1CJCA 4KP7A 1GY8A 4OSPA 1EQ2A 5IAAA 1D7OA 4UUOA 2PKQP 3WWYA 5GMOA 1NQTA 4J0FA 3OECA 4IQGA 4CM9D 3PYXA 1ORRA 4ZQEA 4GMGA 1DIGA 1XQ1A 4YJFB 1GR0A 3S2IA 3T4XA 5JAQA 4EI2A 1TEHA 1PS9A 4DVJA 2YV2A 1PZEA 2ZB7A 4TRJA 1WAMA 5A9TA 3OJOA 4QSMA 1V9LA 4TZKA 4XB1A 3JQDA 1KBZA 2P68A 1UAGA 1GFSA 3MWEB 1U5CA 2C5EA 4UREA 2ZKLA 3K8ZA 5JAZA 1J4AA 1GZ6A 1I8TA 3GPDG 1B15A 1A5ZA 2GDZA 5G0UA 3ZU2A 2NWQA 4A0SA 4YAKA 4FOOA 3G1TA 3JQEA 2W98A 3JQBC 5DNAA 2R2GA 1JLLA 3LVFO 4Z9FA 4J1QA 5DBGA 3HSKA 3GEMA 2RHCA 5TJHA 1SNYA 2C82A 4GX2A 2X5JO 3IDSA 3UCFA 3RFTA 1R12A 5B37A 5A02A 5KOIA 2TMGA 3PTZA 4U0JA 4UVIA 1YS4A 2BFAA 1ADFA 3B1KA 3DB2A 3NYWA 4DPMA 2EV9A 5EN4A 4J49A 1VKNA 3BTOA 1ENZA 3HB4X 4Y6PA 1HE5A 4JGBA 3KSDO 4F46A 4TRNA 5IDXA 4TROA 3TPCA 4RPJA 3NV9A 3LT4A 1SC6A 1W6UA 1QYDA 3LC2O 1Z45A 4UAGA 4S3MA 1LDEA 3L6OO 1V35A 1R4MB 2HJSA 2CF5A 3PPIA 5JO9A 3VZPA 4FC7A 3H5NA 2BGLA 4BL5A 3ICCA 5KJ1A 4E6PA 1A27A 4ONEA 1NFRA 1FXSA 2Q2WA 3F1KA 3FSRA 4B3JA 4CMBA 4PFJA 4A10A 1ULUA 2RBEA 4WLUA 3BHJA 2ZCVA 4FN4A 4CM8A 4CM9A 4Z3KA 4RCVA 1MXFA 5DCWA 3ZWWA 2O3TA 3UKOA 4XB2A 2W90A 2O48X 3BMOB 3A9WA 3JYQA 1TLTA 2GO1A 1U2GA 2EKQA 4BNJA 1H93A 4IJWA 1HKUA 3OBBA 1T24A 3D4OA 4DGSA 3DZGA 1HYEA 3A28A 1ZNQO 1ISIA 1R4NA 2X22A 3DTYA 1VL0A 3Q11A 4WNIA 2Q45A 3GGGA 3NEPX 4J1SA 4QO7A 3VPSA 2EG9A 3TZHA 2GN4A 3W4KA 5TIIA 3WNVA 4B7UA 4WEOA 4E5PA 3W8DA 3LF1A 1N1GA 4HX5A 4L4RA 2Q2VA 5JDCA 4QUKA 4RVFA 2DPHA 4AJHA 1GQYA 4TKMA 3WR5A 3ZWVA 2YHUA 3TZ6A 4YT4A 4Q39A 3QJ5A 2B37A 2Y1OA 5FI3A 2JD1A 1VJ0A 3TOZA 3G0OA 3ZWPA 3FWZA 3DBHA 2QW8A 2VYND 4HWKA 4ZA2A 1IB6A 1ZMOA 3GAZA 3GMDA 4NDNE 4A27A 3GHYA 1DJQA 4CMCA 1RPNA 4BNZA 2GERA 3L4BC 3HZZA 3ADOA 3FPCA 3UFXA 4LVCA 4BNVA 5KVCA 1T2CA 2HCTA 3QWFA 3RSHA 2RH4A 4C7KA 4A26A 4HBGA 4XCVA 5JC8A 2GZ3A 5L53A 3MOIA 4UUPA 3KZVA 3DZKA 3L6EA 2FPIA 4R5HA 2OZPA 4UEKA 4J9UE 1SB8A 1UZNA 4IZHA 1DC6A 2YDYA 4XX0A 1DXYA 1LJ8A 2VN8A 1G0OA 3O8QA 2DBZA 4R5MA 5LC1A 4PLTA 1YGYA 3O03A 4R68A 3KTDA 3HUDA 4RL6A 1BMDA 1ENPA 2P5YA 4FPXA 2DTEA 2NLOA 4MVJP 3P2OA 1KY5A 1MX3A 2QYTA 3TN7A 1P9LA 4PVDA 4BNYA 3QWHA 4BOYA 1W73A 3I83A 3GNQA 2GCGA 3MZ0A 4EITA 1NTOA 5A06A 4NJOA 2HAEA 2FR0A 2OXIA 4AJOA 5THKA 4A03A 3BMQB 1VI2A 4ZJUA 3GK3A 2D0IA 3HE3A 5A5FA 1H0KA 3K30A 2DQ4A 1Y1PA 1ZUD1 1TXGA 1WDMA 2TMDA 1L1FA 3WTBA 4BNLA 4G65A 1NAIA 3KVOA 4CMHA 1P1KA 2D2IA 1KVSA 1MUUA 2C7VA 4PLGA 3G17A 2UAGA 4ZU3A 1KYQA 3QW2A 4RLHA 3RUIA 4AJEA 5A03A 2R00A 4NBVA 2BELA 2EP7A 4ESOA 3T4EA 3U4IA 3WBFA 2Z1MA 1HYGA 2G17A 3F9IA 1U7HA 4L75A 1YE3A 2VYNA 1UP6A 1OAAA 2AQ8A 3AY6A 1KVRA 1WMBA 5JAIA 1X14A 3UOGA 4E30A 2FOIA 4J1NA 1HE2A 1HT0A 3C1TA 3LC7O 3WQRA 3KYDB 4BO0A 3UN1A 2HSDA 3OMLA 1NQ5A 3PVZA 2PGLA 4JCOA 4E21A 4LCJA 3RAJA 3D5QA 4QX6A 1LC3A 2Y1FA 3S2FA 3E1KA 3ZV4A 4RPLA 1CDOA 4MIEA 1QKIA 4ZRNA 2FHSA 3KBOA 4I08A 3VHRA 1H6BA 3ZNQA 3HG7A 1LSOA 5FF9A 4ZQHA 1G6KA 1Q0LA 1Q7CA 1RM0A 1QLJA 4H16A 4LISA 1RM5A 2PA3A 1WXDA 2EHDA 3EDMA 4D7AA 2V6FA 4WUVA 5TSDA 4BGEA 4XQ9A 4FFLA 3K9QO 4G2NA 1MB4A 1TA4A 4O59O 1N7GA 4ND4A 3E82A 1C1DB 4RVGA 2DUWA 3F46A 1M67A 3TSCA 4KQXA 2PGJA 2EGHA 4N7RA 1OZAA 3DWFA 3PZRA 4L4SA 5JSFA 1Q1NA 5LCXA 1B8PA 1YO6A 4ALLA 4IQ0A 1CF2O 1PS8A 2QRLA 2B5VA 2O2SA 4EZBA 3U4HA 4J6FA 2FPPA 1EVIA 2YW9A 4CM4B 2QZ9A 4GKBA 4J90A 1AE1A 1PQPA 2HUNA 5HBRA 1UH5A 4KTVE 5KJ6A 3QSGA 3AU8A 3NRCA 4EW6A 4YWJA 1UZMA 5HTOA 3UGKA 2HO5A 1DFGA 4Y9DA 4EJMA 3HJAA 2XXJA 2GRAA 3VAZA 9LDTA 4AG3A 5ITWA 3E8XA 5J23A 3KM0A 3GN2A 5KVSA 3K96A 2VHXA 2EXXA 3GVPA 3ZWNA 1GAEO 1PGNA 1NR7A 4KQWA 1E7WA 3D7LA 1A9YA 4YAJA 2OP0A 3M2TA 2VZ0A 3TZQA 3KLPX 4WCDA 1I10A 2GN9A 5B4VA 4BIIA 2H1SA 1KC1A 4EBFA 4PLVA 5L7TA 1GEEA 2OBYA 2NUAA 2NU6A 3IC5A 4GVLA 4E13A 3AJRA 1C1XB 1PR9A 3U09A 3WGTA 1WDKA 1KY4A 4YJGA 5KKAA 3KXDA 1GEGA 3GDGA 3OEYA 1CRWG 5CPFA 3SX2A 2FSVA 3JQCA 4QFDA 2G1UA 3TJRA 3UUWA 1B3RA 4RJTA 4DA9A 3QHAA 3K2EA 4UVHA 3ETEA 3FF4A 1YQXA 1OFGA 7ADHA 1KVTA 4JLWA 4BO8A 3OQ1A 1BTOA 3VH2A 5BSHA 2NTJA 1YBVA 3M1AA 3PYLA 3OJ0A 3KOUA 4BNGA 3C85A 4UVDA 5K6AA 2P2SA 3WMXA 1E3WA 1N92A 4ALNA 3EY4A 2X0JA 3AM5A 1HDZA 2JCYA 1YB1A 2X5KO 4PG6A 1DAOA 3NDIA 3RI3A 1MC5A 3UCEA 3GQVA 2C2XA 4BNUA 2GPTA 2PZKA 3V1UA 3TL3A 4E2YA 3RD5A 5BSFA 1IE3A 4C4OA 3H3FA 1B26A 3TL2A 3AW9A 1QYWA 2JHGA 1I32A 1KC3A 5FEUA 1YBAA 1Z6ZA 4PZCA 2WTBA 2O50A 4IIUA 4CMKA 1T4DA 2AE1A 3MOGA 2AQKA 2H6EA 2Q46A 3OETA 2J5QA 4MVJM 3HHPA 3Q2KA 2HKIA 4M86A 5HM8A 3N74A 2FP4A 4EUEA 4ND1A 2WYWA 1E1NA 2IZZA 3E5RA 3UCXA 3GVXA 3DHYA 4EUHA 3VOSA 1ZVMA 3QRWA 3O38A 3CTMA 3PYMA 5I7SA 4B4OA 3ADPA 3GVIA 1DIAA 4BKUA 1DC5A 2Z95A 4JIGA 5G0WA 1EMDA 4Z3DA 3U3XA 3W4IA 1PGPA 1E3SA 1PJSA 3IMFA 1IYZA 3GT0A 4NR0A 3VPFA 1Q0QA 4YRDA 1MGOA 1LLQA 3O26A 3H65A 4R41A 1E7SA 3VDRA 4BNMA 2HU2A 3RFVA 2Q1UA 1QP8A 4KUEA 3RWBA 1KS9A 2RHRA 1VSUA 4IINA 3RBZA 1EVJA 2CVZA 4FCCA 1XKQA 1B0AA 1PJCA 4U6QA 3GR6A 5DDIP 2ZQYA 2CF6A 2DAPA 5I9LA 1YOVA 1ZKMA 4DBZA 4WASA 1EBUA 2Q1TA 1JDJA 5JE8A 1BWSA 3KSUA 4FGSA 4PRLA 4BO6A 5TRTA 4F3YA 3B1FA 4B79A 3WMWA 3GGPA 4JQCA 1HE3A 1XG5A 3TF5A 4FJ2A 4YQYA 5L4SA 2IXAA 3ST7A 5IJZA 4CMAA 4D44A 4JBGA 1R4NB 4OKIA 1A71A 1LU9A 3LYLA 5IDQA 2FZEA 2X0NA 2GZ1A 1P45A 5JS6A 3CE6A 3GNTA 5L3ZA 1EVYA 4W9NA 3FBTA 1IY8A 4K6CA 3R6DA 3HFSA 3SEFA 2JKVA 1UP7A 2FMUA 2P9CA 4F6CA 5U9CA 5DP1A 4R3WA 4YYZA 4J0EA 1Y9AA 1FDTA 5T8KA 4YAIA 4DIOA 3GZ4A 4E5MA 3H5AA 5F3RA 1U3WA 1PIWA 4OAQA 4XGKA 5IZCC 1ZW1A 1JU9A 3PHLA 3NDRA 3E9MA 5DBIA 5IN5A 4XYMA 3RU9A 2B69A 5KKCA 1DRWA 2Y0CA 4KDEA 3BHMA 3JQ6A 4BNKA 1P74A 4DLAA 1AHIA 3ZGYA 1I2BA 2I66A 4D42A 4RV9A 4OL9A 2C2YA 3ITDA 4IBOA 2Q1SA 4RVUA 3I9MA 1ZMTA 1RYEA 3O9ZA 2NQTA 4UVEA 3IJPA 1DIHA 4OMUA 3SLKA 3ON5A 1IOLA 1JWBB 5I8WA 3QP9A 1UXHA 2VZ9A 1QG6A 4GMFA 4DC0A 3GOHA 4U6SA 5B12A 3PJFA 2RH8A
chains in the Genus database with same CATH superfamily
3BX1A 5I8ZA 3G85A 1CIPA 1HTBA 2HA0A 3QE0A 1L9KA 1XCBA 4NG5A 4YBZA 1U81A 2AKEA 1J23A 1EZ4A 1ZUHA 2CE7A 2NXWA 1D3AA 1CIVA 1JJBA 2XQJA 3HY3A 4OJTA 1F3LA 3EGEA 3DWIA 4M1KA 2E5LB 4MJ7A 5JJKA 2O54A 2P1ZA 4HMOA 4ZJYA 2WU8A 3HZRA 2ETXA 2RGEA 2RI0A 5CAEB 4BIMA 5FNVA 1YI1A 1XZDA 1JIQA 1O4VA 1W49A 1C0KA 3D3KA 4PZDA 2BEKA 3PFNA 3TH5A 4M22A 3SMQA 2C88A 4H77A 4L9AA 4P83A 1PEDA 4QUJA 2Q4BA 5FWAA 3C41J 1LBQA 2I87A 2IQ5A 5DOVA 3BKXA 3WZLA 5BOSA 1LDMA 3P4YA 2XCRB 2BJHA 3FKSA 2VAVA 3O5AA 5JJIA 2XTZA 3EH2A 3NTLA 4MAAA 3T41A 3DMFA 3I9V6 2OO7A 16PKA 1YASA 4DR1B 1OHHA 2IPMA 4KGDA 3PTAA 4QAQA 3PXDA 4E5VA 3IOYA 4JEIA 4JLBA 1JBEA 3K4QA 2IP4A 2QI9C 4OXKA 3DDNA 5JQGB 1RIIA 2EWVA 2ZPTX 2C95A 5C7OO 3INRA 4P4UA 4ROSA 2NADA 5C18A 3H2ZA 2G25A 1UPCA 3ZLVA 2H4HA 3ESYA 3N2IA 4LJSA 2QVZX 4LYGA 4NU6A 2VDOB 4KH0A 5C1DA 1R6VA 1XZLA 4NMWA 1R16A 4O5OA 1IY1A 4GL4A 4TWBA 4E3WA 1N6RA 3MOSA 4ALLA 5JNSA 3G02A 2IYSA 1IB0A 3BTVA 4U6NA 2ZRBA 3IBSA 4C29A 1K3UB 4CKEB 1WMDA 3USES 2F3SA 1QIEA 3AUTA 4PE5B 1ORIA 3HVRA 4M54A 1UXIA 3G3EA 4QPDA 4R3NA 1OX4B 4RVSA 2LDXA 2YDXA 2R1VA 1W2GA 1Y6JA 4R9NA 3ZWXA 2J5BA 8ADHA 1I0ZA 2GBPA 1DARA 1SIBE 3I04A 3MCAA 1PG5A 3ONDA 3QFCA 2F4NA 4PGGA 3UT5B 1Q16A 2X9LA 2ZTLA 3HZOA 4MQ6A 3TSOA 1XT6A 4Z3OA 2GYVA 4ND6A 3TRDA 2IV3A 1AJEA 2R6DA 4D9MA 1Z18A 1TVKB 3FJ1A 2OQ2A 3CF2A 3MJFA 4AZSA 4JN6B 1R0BA 5C1IA 2KYRA 4JLUA 1P44A 3KR0A 3EZYA 3Q7SA 2HT6A 4R40A 5AWFC 3UWKA 1OAOA 4ENQA 3H9CA 2QRHA 1A4IA 4DA7A 5IDWA 1AKYA 2H2HA 1X2BA 2QNIA 3B3FA 4R2XA 4YXWD 3RYCB 3NHZA 4QXQA 4WGFA 2XMCA 4GYWA 3NHPA 4IIHA 1U2GC 4H4DA 3ANXA 4BQEA 1S2GA 1WW2A 2WHQA 2XYPA 1YDGA 3GLQA 5JLJA 1ONOA 4JBXA 1PR1A 1XZAA 3BFPA 4R9VA 1VE3A 3HYCA 2VTDA 3FHOA 5CVDA 1PLJA 2Z2KA 3KQWA 2FWMX 3OD5A 1XJ0A 2HUPA 2A9PA 1E6LA 3EIUA 3EEQA 4MS1A 4ZHQB 2C4MA 4R7GA 4PN7A 3MJHA 4HX9A 5CFOA 5CCEA 3DB1A 3RUPA 2A0KA 1JHZA 2ZAYA 4FHGA 1F0NA 3INTA 4W99A 4JLAA 5D85A 3ZDXB 1BEZA 4TYWA 4BVHA 1MH1A 4NZMA 2QRQA 1L8OA 3FMPB 3RODA 4KQ2A 4EVSA 1ZA1A 4X95A 4FDMA 3TZLA 1M6NA 1OX6A 3EPJA 3RQSA 3COPA 4ARBA 1T9DA 3KQVA 4MQFA 4KU4A 4PLYA 3N2GB 2P78A 2D3TA 1MIOB 3NH6A 1E3LA 2HA4A 2V5AA 4B4DA 3QE2A 2C3MA 4HAOA 3FPBA 1MAAA 1T3HA 1Q50A 4X85A 4DCSA 1YVPA 2QR5A 4CMEC 1ZD8A 1SBIA 1ZN7A 1C8VB 4OXQA 1SKBA 1OLXB 1VHLA 3SSMA 1YULA 4A36A 1TUBB 1OVGA 3FNFA 2CD9A 1PTKA 5H9WA 2EEPA 4Q9NA 2W8BA 1L1QA 3PNMA 4RV5A 2X1LA 4MMXB 4F6RA 1G20B 2NQ8A 2Q7OE 2YIVX 4M0CA 5AW6A 3F6EX 2ZZNA 4M7PA 5FFNA 2VAMA 3H83A 2ERCA 2YMPA 3KYIB 4H7KA 3KCQA 2II6A 3B70A 2FX2A 1A98A 3KXKA 5EP1A 2QX4A 2WIBA 4N9WA 1GL7A 1MPXA 4R1OA 3K32A 3OC6A 3JQ7A 3GJRA 3HDTA 5LA6B 1J5XA 2NP7A 3DKPA 4ILEA 3AYZB 2HCBA 5G4LA 2ZUEA 4XRGA 4V1CA 2Z83A 1HZJA 2VF7A 1Z06A 5G0TA 2Y68A 4ZD6A 5IEBA 4AJJA 4NV3A 4LMRA 3RUEA 2AZXA 1GZ7A 3CW8X 2FR1A 1UJ4A 2J9GA 3R09A 3KJIA 2VDWA 4IZIA 5JSZB 5KYUB 1AF4A 4YPFA 1CZHA 4WZAE 4FM9A 3DUWA 4HPWA 1G4AE 2H1CA 3R2JA 4RW0A 4FN5A 1QP7A 1CYEA 1T3TA 1ZOSA 2EC5A 2LXNA 4HGQA 3T7CA 4P54A 4UCFA 1Q12A 1F51E 4O25A 4OM8A 1Y7PA 4RL4A 1A8IA 3G9ZA 5KI6A 4ERXA 1U9IC 4MEBA 4HYQA 1BDMA 3ENVA 4FIZA 1JUDA 2IUEA 5EKDA 1R5BA 5D51S 2XOXA 4OQEA 4RESA 4UM7A 1TC1A 1R0KA 2E1PA 1M2HA 4HR7A 4RFSA 5CX1B 5KHOC 3ZTTA 2KM1A 4ZO4A 4DDTA 1RKXA 3L06A 1L4FA 1KJ9A 3D9QX 2HWKA 4TN1A 4MGHA 5BYBA 4HZGA 1JFFB 2ZCUA 4XOIA 2R5WA 3HCAA 5EUBA 4BB0A 4RF3A 3RIGA 2GCNA 3DLHA 1VZ2A 4HNVA 2R6GA 1C50A 2RFLA 4BFLA 4ARCA 2I99A 2ZXEA 4CIAA 2FEWB 3F6BX 1IM2A 3GLGB 2HBYA 3S1AB 1Z7YA 3DHNA 4PZ9A 2LE0A 2WMOB 3PICA 4GR5A 1I5EA 3COSA 3WNQA 1WBDA 5EE0A 2C8LA 4C7BA 1T8SA 2WKPA 5C9ZA 4KH1A 5F5XA 2ATVA 1IWPB 3ETDA 2Y27A 5EG5A 2O2JA 2XNJA 3JQ8B 3SC6A 4JQSA 3FUXA 2WAMA 1FSFA 4QUAA 1DG9A 1JTVA 1OSNA 5D8DA 1DUVG 3QPCA 2PJZA 2B35A 4H1UA 5EI5A 4EB6B 5K3OA 2XZPA 1M2EA 3GMIA 4GICA 2RHMA 1FDVA 3BIXA 4IEEA 2QL9A 3FVRA 3IAS1 4NOLA 5DU2A 4G8JA 1W4LA 3LUDA 1DEKA 3NM5A 2C92A 1JW9B 3N0XA 1WHSA 3OIDA 2Q0QA 4BO0A 1BDIA 1IM5A 2H65A 2X6RA 3AEKA 1ULAA 2V6JA 1NJ6A 2ZYSA 4PCAA 4YNBA 1M7BA 4AN4A 3FCCA 4NXNB 3TOXA 5KJEA 4ZYUA 2A35A 2YS7A 4JC5A 4AJ4A 2I5PO 4HDOB 1I80A 3DC7A 4OHPA 5CNMA 5TARA 3UOAB 3ZHYA 1JDPA 4ITRC 4Y2HA 5GONF 1QPGA 3D7KA 4I9NA 5HIIA 1A50B 4HFNA 3KT0A 1GUFA 5BSUA 3THWB 2Q3EA 1DKRA 3MCTA 5LQSA 3VFDA 3MW8A 2I4OA 3LMKA 3M4JA 4RC9A 2QTVB 2UXBB 2XYHA 2CXUA 1FSGA 1ZM7A 3DOEA 4HQ0A 4IFBA 3PKZA 3QZUA 5FWNA 4RD6A 2WR8A 3M49A 5KNCD 2Z9BA 2BOVA 4ZYVA 3DKIA 2GJ8A 5SY9A 3RYHB 5IS2A 3KYBA 3UWOA 2AG5A 3GJZA 1QU2A 3ZJUA 2JIQA 3G0BA 2ZB8A 4ZVUA 3L1UA 4OXIA 3OIWA 2XA2A 2RGDA 2OZEA 1D2MA 3VHXB 1K3TA 1AKEA 2YZMA 3KPVA 4JDUA 5I7WA 3R5XA 4FFWA 1JDBB 4O0LA 3W6UA 4A6XA 5I7AA 4JASB 4BMCA 3KEGA 1IEVA 1I4EB 4UPEA 4HB0A 2X9VA 3SXUA 1E66A 1HF3A 1UBEA 1IUNA 3C5VA 5BNWA 3DMHA 4I14A 4I55B 3TEFA 3LY5A 5DM0A 2QJWA 3WLEA 2HX1A 1M0SA 2I67A 4A5SA 3HEAA 2IU4A 4I1RA 4B76A 4YCLA 3ZGZA 3BFXA 3FMFA 3IR5A 1T4CA 2Z6AA 4IM7A 1HSOA 3R9XB 1YK1A 3G8YA 3KYCA 4B47A 4BO4A 1L0BA 2NTYC 2ZE7A 2EP5A 3R3HA 4YAGA 1B6SA 1JA1A 3R3ZA 3BJEA 3E7WA 1IN6A 3L3BA 4I5FA 4WBXC 4ZQBA 2POCA 3ZOKA 5GADl 1TI7A 1L8AA 4KIUA 1KY3A 3BT7A 3KCNA 3QBDA 1I7PA 3RC9A 3EHEA 2RIRA 1P7CA 3WSVA 4J3FA 5FBQB 3X43A 3WFZA 1F14A 4MUNA 5CG2A 1KXJA 3W5BA 2ZWAA 2JCXA 4RAOA 4LJLA 4IEFB 3P9XA 1Z62A 2AYXA 3UM9A 1OIVA 2WU4A 3FI9A 1L7OA 1GSOA 3H6HA 1KEKA 1N25A 1UKZA 2VNIA 4ZAWA 2PV0A 4HMPA 1UMDA 3PQDA 3KJHA 5ABPA 4AJ2A 3HP1A 3UGJA 1QHEA 3O1HB 1AO3A 1Z2EA 1FJ2A 5FWYB 4DT1A 3OZFA 4GX0A 4IMRA 4YBRA 3OY7A 2P30A 5AVTA 3UXEA 3HXOA 2PWAA 4L5CA 1J90A 4NU8X 1T6YA 4G4GA 2PKCA 3P2MA 4KQFA 1L4LA 3PDCA 3KTFA 2FSVC 4TT3D 4WLEA 4MPDA 4Z9AA 1OFHA 3PQ8A 5HRCA 1SIUA 2Q4RA 2UYHA 4N41A 5ALHA 4IDOA 5EIBD 2IEGA 4X41A 4EOGA 1UJMA 1VBMA 4QQRA 4NZ9A 3ZNNA 4BO1A 3DOOA 3A9SA 1NFFA 3Q1KA 3TLBA 2VBCA 2C9DA 1KOGA 4HQRA 5FOVA 2QAJA 3TQCA 1TT5B 4C87A 4QTZA 3BXZA 4JLPA 4KAXA 2NU7A 1M8GA 2VJDA 2G04A 4D4JA 2R1TA 4R1SA 4V0SA 3COJA 3NUGA 3CISA 3HRKA 1AXGA 3BXXA 3RVLA 3VNRA 4K9SA 1T9BA 4GPD1 4M0DA 2VF8A 4ND3A 5G4KB 3RSQA 3OESA 3V8BA 4WJLA 1XQ9A 1PJZA 1QVWA 3DZCA 3AI2A 4LNAA 4W8HA 1I2ZA 2ZRNA 4PAQA 5JD5A 2Y1WA 1EUCB 1G9TA 1NVAA 3E0QA 3IV7A 4RYDA 1O95C 3O92A 5JSKA 2RGNC 3H75A 4X92A 5J1SB 5ES3A 1FS5A 3NVDA 1SVOA 3KHUA 4MR9B 1AMUA 1H3FA 1O94A 1T2FA 2VIIA 2X6TA 4RDIA 4TSFA 5LBTA 3PPYA 1KJJA 1E6WA 2QB5A 1ZH2A 1ONPA 5GZ3A 2VPWA 1WKBA 1QHYA 2VJMA 3N5KA 1NVXQ 2HHCA 5FUMA 4X9XA 1NMYA 1SUFA 3HFGA 3EDYA 4OHBA 2CVOA 1H4VB 2Z2IA 1W9HA 2FUNB 1IRIA 1GUZA 3ANNA 3BCHA 5COBA 2HQRA 5JXJA 2HNKA 1GCOA 1L4MA 2WOOA 3MINB 3N2KB 4RY9A 4QVKA 3S2UA 1MABB 2ORED 2NVUB 5DGIA 3BYZA 3FDZA 1Z26A 4JB0A 5HM6A 3LTEA 3PC4A 1OXTA 2XOEA 3T9BA 3EG9A 1QCYA 2G40A 3HCDA 3REGA 1EFVA 2I6XA 1UBRS 2Q3MA 4YV1A 2ZYGA 3G2HA 3HNPA 1MB9A 3DF9A 1JFVA 1C3JA 1IHDA 2PKQO 1UL1X 1ZXLA 4CDMA 3TBKA 2WYUA 3GEDA 1WXIA 1DHRA 3AFOA 4GZ3A 1KTVA 3UAWA 4ZK6A 2QE6A 5FYQA 1JVSA 3KB1A 3ASUA 3SICE 4HBZA 2XMDA 1E5DA 4MPRA 2BEUA 1GLGA 1CUDA 2AJBA 4N5MA 1P7PA 4H6VA 4E1AA 3TG8A 2O2DA 1UXKA 4WNCA 3AFGA 1QCZA 3GARA 1Y8RB 5KOHA 1ZXXA 2G08A 1YDWA 1N2JA 1E3DA 4ITUA 2VPXA 4LOJA 4M1OA 5AXCA 2VPQA 3R5FA 4TMZA 5DOZA 3ZWMA 3HLYA 2BI4A 1HOXA 1I1QB 3DZFA 3KOMA 2QTCA 1J1IA 2VRCA 3TNDA 1TM5E 3VR5A 2BFPA 5HZHA 4X0EA 1M74A 4J9VA 5T57A 1RMTA 3IP9A 2D0OB 4KXMA 2E1RA 2A5JA 4XUCA 5GONA 1Z8DA 1RZRA 3EAGA 1BH2A 3R5KA 1YJAA 1F20A 3TGPA 4LJAA 5DM60 1EH5A 3ZWOA 1QE3A 1QFMA 3L40A 2GFHA 3M33A 5FTJA 2DVMA 2Q1YA 3RTCA 3CXUA 1K98A 4Z4GA 2QQFA 1SVNA 3AETA 1UPXA 4UM9D 2I80A 2GEVA 1CDDA 3S4YA 4JY7A 4YHBA 1JAHA 1E3JA 3GJ0A 3U4CA 1ZLXA 4PG4A 2IPLA 3GLUA 3KXLA 2IVZA 5AM3A 3NOXA 3M6VA 4Z7NB 5T8KC 3OM9A 1KP2A 4O6VA 3FVVA 3IQWA 1P81A 2AKYA 3ET5A 2R6CA 4XZ3A 5CFZA 4I2VA 5B6PA 3E9EA 5M7EA 1Z5ZA 4US0R 5AVZA 2O5EA 5GPBA 4FNMA 4MMYB 3D81A 3VU3A 3ABSB 4RKFA 5LB4A 3I3SR 1XMPA 1CJMA 2M6RA 3L0PA 2ATCA 3MWJA 2F59A 1YRLA 2JFGA 2R7MA 1AX9A 2GLUA 1M0TA 5CIYA 4MW7A 4OUDA 3OZSA 1K92A 2GZAA 5AM4A 4ALIA 1K4YA 4MKRA 3BZUA 1A9TA 2QT0A 3CPEA 3QFTA 2GK6A 2H00A 4NF2A 4PIPA 2HLPA 2PCJA 2QRKA 4W6ZA 1FRVA 1Y4ZA 5DLEA 2ZBVA 1Z7WA 4YB8A 3RVNA 3SM9A 3WA7A 1XELA 1SR8A 2B9EA 2CNDA 3KLBA 4NCHA 5HRUA 2FAXA 3L2OB 3TOSA 3AP2A 3FJOA 3BBLA 4CUKA 1AD2A 4NQRA 2CLLB 4ZO6A 2R11A 2X5NA 3WAGA 4RAQA 4BV8A 2Q62A 2YBEA 1A2QA 1JS1X 1SUAA 1H6DA 1MEEA 2VDRB 1GFIA 3IA2A 4AK9A 3KQTA 3OCZA 4QWWA 1JR3D 4F8JA 1M6HA 3KWLA 4FDAA 1J8DA 4U7PB 1LNSA 4UOZA 1YFKA 4RTKA 1PZXA 2VT6A 1ISSA 3WRVA 3CKMA 4NC9A 5KVQA 2LCIA 2JLZA 4F4HA 1B74A 1XTKA 1VYTA 5LIRA 1VM6A 2DZDA 3B1WA 3T7SA 4KZKA 4N5DA 2P9JA 2VZEA 3CO5A 5C3MA 5K2OA 3WGUA 3K92A 3BMOA 1Q3TA 2BM0A 3TNLA 3EMVA 3BE5A 4DKXA 4WN3A 1XZBA 5DKFA 1O5TA 3ZW7A 2ZE5A 5M3BA 3EEYA 4LPKA 4J0GA 4NFLA 3SIRA 2EKLA 2IDMA 2IL1A 3D4NA 4TQ9A 1QHGA 1C2YA 2Q5HA 3NHMA 3NKLA 2QRPA 2J5XA 2IYUA 3RAFC 1FCJA 2VWQA 4Q7KA 1U3GA 4IIJF 2XTMA 3SI7A 3QXHA 3RRYA 4MUAA 3UW1A 5BXQC 1XU4A 2BZ1A 4FNOA 4NECA 4Q5IA 4TLEA 4E09A 4R31A 5JASA 2JD2A 3E84A 3HDGA 1XBTA 4RJIA 5J4LA 3EXEB 2KBFA 1DDOA 4UBIA 3ZEAA 3TECE 2IVFA 1JEQA 4H1VA 1UMCA 3P9KA 3NO4A 4NBTA 2DQZA 2R8EA 3C24A 4HNHA 5CCXA 3L43A 3LO8A 5I48A 2GI4A 4M8KA 2DTDA 1Q3HA 1OA1A 3CNQS 3W78A 3PIDA 1S3FA 3ICVA 3AL3A 2VJLA 3RG8A 2DLDA 2FVXA 4OGWA 2HF9A 4DDKA 1W85B 2D54A 3JWGA 2CBXA 4FFNA 4A73A 1NXPA 4PCLA 3Q8MA 3P9ZA 1PX2A 1VHWA 2BEWB 3QVSA 4RADA 1TK2A 3TIVA 2JAQA 1GN8A 5JZ9A 3SOZA 2ZWOA 4TL6A 3UTCA 2Z2JA 3O8OB 1W1UA 2A0UA 3HPQA 4PNZA 2M1XA 3K1YA 3W5UA 5KNLA 2I54A 3PCTA 5KTYA 5KNDD 2J09A 3KX2A 2QVCA 2YIMA 3ZHXA 4CCYA 1IVSA 1IUKA 1DAPA 3PUIA 2WU0A 1A7UA 1P7WA 3V9AA 1MTZA 4DWWA 3A7EA 2DQKA 3QPAA 4DANA 5SZJA 2E82A 2OM6A 1N8SA 3P5BA 1U5BA 1KFCB 3KLMX 1RYYA 2NYAA 4WACA 5EA2A 4QOIA 1WG8A 4LXIA 4KACA 4R3UC 1KDPA 4YFYA 3QITA 3SM3A 1QHXA 3FWKA 1UM9B 4POAA 1K8XB 5CK4A 1BS9A 1Z63A 1KQOA 1MDFA 1YVUA 2F3QA 4C2TA 5GQSA 2J1LA 5EIWA 3SU8A 4DDMA 4MYUA 3DE0X 4MSUA 3SFTA 1U6IA 3NPMA 4XRRA 5JFOA 1M2GA 1JI3A 3SF0A 1STOA 2ZZKA 4Y1EA 1UT5A 4BAZA 4EKIA 3ME5A 4EJFA 4PONA 4WLOA 2VXBA 1RHMA 1I94B 4ES6A 2C9OA 4L4XA 2D2EA 3A14A 3IAS6 3ZV3A 3E4CA 1GNRA 4FE4A 2Z08A 3L7AA 1RJ9B 4G5FA 2OAEA 3I61A 2I3AA 2FK7A 1CUGA 2CE2X 5LQAA 3PUHA 2VNSA 4RZXA 1MC4A 1G20E 1NX6A 4UW9A 5T4FA 1UWCA 1QE0A 2QV7A 4GPTA 4H3VA 3PT5A 1RAGA 3LCCA 2AG6A 3FSJX 4LDJA 1MOQA 1BD4A 1IPHA 2QHXA 3FA2A 4MDFA 3WK5A 2FPIB 2WSBA 4KI0A 2XMQA 4C4YA 1XWWA 3IP6A 1M83A 3ED5A 1QMGA 4JP2A 1XGKA 1U04A 4X1IA 1WIWA 1P8JA 2QORA 3H9UA 4ER3A 4RF4A 4RUKA 4RVOA 4XX0B 3Q0EA 4DR6B 1X9IA 3TFOA 4MKIA 3I1FA 3DZHA 2WDZA 1ARZA 3LHDA 4RGBA 4HLUC 3JZMA 1NWCA 3FTQA 3IVGA 2AUNA 1I14A 2UZ0A 3AF5A 4WV3A 3ZI7A 1I6WA 2Y05A 4IGFA 4L9WA 4RY2A 1TO1E 5TGDA 3ZYZA 2CGEA 2C5BA 5CDHA 3DHEA 3K8YA 1X3SA 2QUBA 3CKLA 1KI6B 3OZCA 4RCYA 5L3SA 1TKBA 2BTEA 3MTAA 5J4YA 3QBTA 4N7MA 2XW6A 1MJ5A 5E7QA 5A7FA 2J85A 3T7TA 2JGLA 2OXCA 3EULA 4M1WA 5EWMB 1FP1D 3OU7A 1W36B 4H7FA 3V1TC 5IG2A 4DR4B 4F2HA 2EF1A 2V8OA 4I0WB 1L7XA 4LIPD 5D5QA 5F4ZA 3F7NA 4ZVRA 5CDTA 1E4VA 4M87A 2NM0A 4DMMA 1P73A 4PSKA 3I9JA 2ZIZA 3KL2A 1PK7A 4WK0B 4HO1X 3V8PA 1FYDA 1KERA 3QKSA 1C30B 4GSLA 5DULA 5J63A 4WBNF 2XEXA 2WT8A 1YUMA 1X1RA 1C0LA 3IUSA 3UG6A 2I3ZA 4JL5A 1TF2A 4W4TA 4ZOCA 3BQ9A 4F8YA 3OO1A 3DCJA 4ZMSA 1K7XB 4FWIB 4L8LA 2JC3A 2PSSA 3PE6A 3SR4A 4BGDA 3SKVA 3F4BA 5K05A 4P3KA 5JQWA 1FYEA 4JYCA 3WSTA 1PYOA 2NZWA 5TPZD 3M2PA 3GLGE 1NQOA 5HKBA 4LNHA 4LF5B 4BEJA 3S2EA 3A3NA 4JUFA 3T38A 4RMGA 2DBRA 4QDKA 3TUJC 3ZV5A 2B92A 1O0SA 4YRJA 2RGGA 1ZK3A 3M82A 5L7WA 1GZDA 3Q10A 1EFRA 4HNGA 2OCLA 2F43A 2FPGB 4WOCA 3RS9A 2I91A 1KPHA 3IVXA 5AVXA 1YA8A 3NORA 4YXFA 2JK1A 1KAEA 1XVLA 3O4FA 1QAOA 1TM7E 3T5MA 4LGYA 3TK1A 4RIFA 1R74A 1CUAA 2IZ1A 2QQ0A 4QBKA 1JA0A 5C35A 1JF8A 3CR3C 4MWDA 4IJMA 2XBUA 3SD7A 5K3AA 2CL6X 2JIZD 4A0QA 3H1EA 1MW8X 3WLIA 2JFNA 1XEXA 1N0VC 2XUOA 5CVEA 4DPLA 3EVNA 1M7HA 2K2QB 2REOA 1YDEA 3JYLA 3V9PA 4BVAA 8MHTA 1DZ3A 5LKRA 1XZIA 2V6BA 2WTNA 4PV7A 2ZRHA 4IIJA 3QUAA 2WWGA 2V4ZA 4QLOA 2Z1NA 4ZXPA 2XZLA 5AVVA 1BDHA 1T1JA 3MWLA 4AO7A 2BEVB 5IXYA 4G5HA 1OPRA 2MU1A 3B85A 3P1JA 2NV6A 1KAGA 4LYHA 4S0ZA 1AZTA 2AGVA 4TS1A 5ADUS 3H8SA 1H85A 3SYLA 2JK0A 2ZIWB 1NZDA 2PT7A 2Q0HA 2QMQA 3B7GA 4MWOA 4O4JB 3JAKB 4F92B 1OAKA 1RJGA 2P9EA 3GVHA 5DHTA 4CEIA 3WQQA 3CRRA 4BNIA 4DC1A 2QVLA 2AE2A 5DK6A 3PLRA 4J4BA 2QK4A 2V7PA 2XRFA 3SQXA 1Q0SA 2BHSA 2X6QA 2JAWA 4HRAA 5ESWA 5C0OE 1B0ZA 4F93B 4JBWA 1WBBA 4PPFA 3LPDA 1JZQA 4YRCA 1XRPA 1KFBB 1GPMA 4FD3A 4LCBA 2HA5A 2NO5A 2PZGA 2E18A 2XUHA 2D4HA 1JR3E 3C4JA 3O1IC 3QLUC 4E5UA 4OB6A 2OFFA 1CEXA 1XAHA 1ZJYA 2OBNA 2WUVA 4JKYA 2J3HA 3LUCA 1VIMA 4UULA 4UUMA 3CBGA 3E9NA 1Z0UA 5IUKC 2RJ3A 2OORA 5J4KA 1FJXA 2EBWA 2ODNA 1Q14A 3TZKA 1PGQA 2EKBA 3II6X 4ZDJA 1TM2A 2P5UA 4KAAA 4X7PA 4FGUA 1TCBA 5HIJA 2EL7A 4ZQCB 3URMA 1GL3A 1QOPB 4REQA 2OAGA 1M72A 3D3WB 3SJAA 2WFLA 3D7SA 3RH0A 4BUJA 1KL7A 1DHTA 2NQ2C 2XV1A 3KFVA 2KB0A 2ZYDA 3DBOB 2CMDA 1U1EA 3K2BA 2AEJA 3P20A 4LOKA 2WD9A 4PU0A 4K6MA 4EHBA 3AQ4A 1RXVA 3TQHA 4RH0A 2WQZA 2FFRA 3WKAA 2IDJA 4GI5A 4QLAA 4MV7A 3LNTA 3TINA 4LCEA 2OEPA 3WGZA 3UMGA 3PEWA 3IB6A 3CB2A 3V1MA 5TVKA 5CXQA 1X1EA 5HYVA 3H1AA 3ITEA 3GLIE 3TCKA 1WO8A 3AMVA 3FLAA 4O4HF 4ZGWA 3S29A 2CMKA 3FVQA 4R6WA 5D1NA 2V1UA 4FYJA 5IJ0A 3CF6R 1ZP6A 1ULBA 1SVKA 2PMCA 2PWPA 2PL9A 2Y1LA 3C7CB 4PYNA 2GA8A 3JVIA 3BTSA 1W36C 1DC3A 4X61A 1DTSA 1QAMA 2QTNA 1AGYA 4IXMA 5ALUA 2XXAB 2YOFA 4TXHA 3HV2A 4AJNA 1B8VA 4O4LB 4CUZA 1EHIA 1U0OC 1YVEI 2GX6A 5FPTA 3NBAA 3H5RA 1LXCA 3R20A 3AUXA 4OOFA 4PHFA 1WEHA 5EHGA 1LBTA 2JDID 2HK9A 3GEEA 4M9XA 1GGMA 1Y1SA 4NIMA 3F98A 5IVIA 1VHQA 3UJ8A 3G79A 4DN6A 4YDQA 3ZGNA 5L4LA 2OSVA 4ABTA 5KTTA 2FEOA 1SG9A 2HHHB 2Y77A 4A23A 1X7ZB 1L4NA 2ES4A 2GZRA 2QJTA 2WB4A 1NG1A 4RZIA 5CYOA 2QS9A 5AMXA 3ZNPA 2CLEB 1EA5A 3BB3A 2NXJA 4LRXA 2BD0A 2EL9A 2VUHB 3I05A 4WKPA 4YRFA 5IUNC 4HN2A 4D9IA 3FYUB 2CCJA 4HQOA 4E4YA 3IMGA 2P4EA 1V8BA 1J7KA 1W52X 3ESAA 5DN6A 4Q02A 3ZKWA 2X0IA 1FEZA 1A77A 4IJ5A 2HCRA 4EMSA 4XOUA 3AF4A 5LQNA 2EFGA 4K05A 4ZJZA 5EQFA 3W1VA 2WY2D 3LBFA 4MUYA 4L16A 5IKEA 2ZUDA 4Q3LA 3A6GA 1P62B 4ZEWA 4HYYA 4P7FA 2PT9A 1P17A 3IRVA 1P2FA 1P80A 4QSHA 1F0KA 3WYAA 5BORA 5AW4A 3PSHA 2VNJA 4YCJA 4WBNA 2YXEA 4Z1MA 1H9AA 4Z7QB 4UUQA 3SPXA 5D87A 3ZLBA 2VR1A 1NI4A 2POQX 4RJLA 4I5EA 3PRHA 4CYMA 2RE8A 1KMHB 2HPHA 3AB7A 3DZDA 5F98A 4GQBA 4C21A 3TW6A 1GUBA 1GR1A 3KB2A 4KYIB 4ND7A 3W77A 5F9HA 4H1TA 4B3FX 3K5HA 5ES4B 1H1LB 2PIDA 1IUPA 1FVHA 1QFZA 5AM5A 2UU9B 3RJ5A 4I3GA 1R0CA 4WA7A 2WWTA 4AAYA 4DILA 3A6FA 4GM4A 3LXUX 3H5LA 4RTLA 4XLTA 2CZGA 3EUEA 1EVQA 2MYNA 3KELA 5CNJA 3W1WA 2WKQA 1UJ5A 2BMVA 1ILEA 1YOVB 3QH4A 1CY6A 3DG9A 4TKVA 2RK3A 5LD2C 2NVOA 1VGQA 5B3AA 3MHTA 5JVDB 2G6TA 2QXYA 1Y5MA 3SEZA 2R65A 4KLAA 4Z5XA 1QHIA 2G9VA 4RACA 2YWEA 3MMNA 2WUFA 5JYBA 2NUTB 5DXAA 1P91A 3RT9A 4XJSA 3ANTA 4FILA 4L73A 4TOIA 2CJWB 2HU7A 5CB4B 3I9NA 3ZE8A 2O2ZA 4OYLA 3GLFB 3LRTA 3AUJB 3MXOA 4O2AB 4HGRA 1PT6A 4KRFA 1HTWA 4RJKA 1OLUA 1X87A 3LBAA 3TLGB 2EQBA 2GEBA 1D0IA 3SSNA 1FFCA 4ESEA 4MHTA 1S89A 2P5SA 3TXYA 4QOGA 4RGYA 5IKXA 1XZ8A 2IOQA 3OM0A 1GV1A 1QMPA 1PW7A 2V74B 5FL7D 3ZWYA 3C97A 3H2JA 3KOOA 4EPRA 4YAFA 2Z6QA 3QEKA 4N8SA 5NLLA 1P5RA 3IERA 5IKMA 6ABPA 1CLEA 3ZDQA 2XMGA 4EG4A 4V0NA 3TGLA 1A9RA 2PRSA 3TLJA 5BW4A 4D3DA 4I5GA 4BS9A 5B7PA 5KTOA 1R37A 2JBWA 4IUDS 4IZ6A 5KEIA 4TVOA 4HEHA 3IPLA 4FDTA 5H16A 4KXNA 4MYCA 2B83A 3BXOA 4YACA 4AG5A 3LU1A 4KK3A 1G1AA 2I34A 4G89A 3SEQA 4KFUA 5KVVA 4N0PA 5J2UF 3K9HA 2ZUBA 3NUZA 2Y1CA 4BVKA 4RNDB 4H7HA 3MTIA 4PFKA 5U1PA 1G98A 3OHSX 4BGIA 4CLEA 2H5IA 3THXA 1BS2A 3L0YA 1H1DA 3PUWA 5IBQA 4TTAA 5JEEA 1BDBA 1T2EA 1TF7A 1WZIA 3GDOA 4X97A 3FNRA 3HUFA 5AM0A 3V7UA 2WTUA 4G0WA 2BAGA 1QIKA 4WX2B 3UH1A 1EAYA 2MSKA 3L77A 2EWMA 2JVIA 2JJ1A 3D8BA 3ITKA 1ADCA 4H17A 4I1OA 4M7RA 3VC1A 3SWWA 3Q98A 1CRPA 4OBXA 3TO5A 2WZBA 3GBVA 5H59A 5T67A 4R54A 3ZGXA 3IO3A 1ECJA 3HEBA 4IWXA 1NTRA 3VU9A 1LPMA 1I01A 1HURA 4Y2VA 2A57A 3ELUA 2JIPA 3QEJA 1C3OA 1FRZA 4ZAYA 5D7NA 3HBAA 2EQ5A 2AOWA 3UUFA 3FOZA 1WB5A 5TEVA 5FNVB 4OHZA 2CLFB 4L2IA 2A6PA 1BCRB 3WSWA 3F1LA 3WWZA 1DJMA 4YUZA 4XGNA 3GUYA 4JK3A 1EE9A 4EG8A 3WYBA 1R00A 1CQIA 1YS2X 2NO9A 2O3UA 2ZYWX 4CQMA 3FYUC 1CUYA 3QX9A 3T1NA 4D97A 2QE7D 4DXHA 5BOSB 4O4HA 5JC1A 5JT1A 1ADJA 1AHNA 1V5GA 4FCWA 2IP1A 2V4UA 3LUGA 4GI1A 4B3GA 4AQ7A 3K16A 3PQ4A 1UKAA 3DL2A 4D4LA 5LJLA 3F73A 2WAOA 4DV4B 1UKYA 4B6OA 1IY2A 1ZZGA 3D64A 1WCYA 4DRYA 1EGMB 3ACDA 4IYRA 4QKQA 1XNHA 3LDFA 5A4FS 1TNDA 4HTFA 3VH4A 1A8UA 1ZKDA 2NX2A 5GM1A 1PWYE 4FBGA 2HIAA 2H92A 1FDOA 2R86A 3K73O 2WHXA 1CVRA 2FR8A 1E2QA 3AUKA 2C54A 4ZAVA 5B2ZA 3TD2A 4BFVA 3OZTA 3INYA 1WXFA 3NAGA 4GAEA 3BDAA 2GK4A 3WBKA 1TQ2A 3V7NA 5DYNA 2XMPA 5JBIA 1C9YA 2BCEA 3H2BA 4N49A 4D2IA 2CD7A 2PQ6A 4CV1A 4RPKA 4C4RA 2CNBA 2YY5A 4NAUA 2R1VB 4LV6A 5F9MA 3VR5H 3KKOA 3ZU4A 5LSAA 1M2WA 2GD0A 3K70B 1VXRA 4QICA 1FU7A 1GDTA 1EDOA 4YDHB 3IJ5A 4AU1A 3U4QA 5I8PA 1J1UA 3G88A 1KI9A 2ZBGA 1LBEA 1CY0A 3VJKA 5LZ4A 1AKWA 2WG1A 2BV3A 3GEIA 1IQRA 4HGYA 1YFJA 4MW2A 5I5GA 4JELA 1SCUA 3IT3A 1FMJA 3EMBA 2QG4A 3JSAA 4H9GA 5AIBA 1P2GA 4ZZ3A 3OWHA 3CA8A 2XUDA 4RY0A 3NJ8A 4CR6A 3SLRA 2A59A 3QE3A 3OEED 3EBPA 4U2CA 4LF4B 1BJTA 3MMXA 3QXXA 3R7NA 4UHJA 4ZYLA 1Z83A 1N9GA 5SZHB 3JD4A 1SKMA 4LE1A 1NU6A 4L85A 2I33A 1Q44A 3EWIA 3IP1A 2CDRA 2P75A 3JQRA 2Q8PA 2GMWA 4NAVA 3OUTA 3SVLA 4RX1A 2W42A 3KUUA 5LQRA 1SFRA 3C3PA 4RDHA 3WL4A 3T5GA 2TYSB 2XITA 5DK4A 3W2EA 4XIFA 3U7QA 4CQNA 4E4TA 4LHXA 1CK4A 1Q7BA 4GW3A 1ZWKA 5CX4A 4TVSA 1EYZA 4MS1B 1LF0A 3CQ9A 5F3WB 2BMWA 4BGUA 1HE1C 3E9QA 2W2VA 2FSPA 4E5YA 3U7GA 4JL6A 3QKRB 4UFOA 1A9OA 3QF7A 2AYZA 4GOLD 4PO1A 2J6IA 4UHBA 3ENZA 3X1JA 1T1EA 3FF1A 2D6FA 1W2HA 4QQ8A 5B3JC 2PR2A 4MQFB 5I5EA 5LQUA 4EUSA 1FX0A 4N0DA 4C6SA 4HRVA 3UHPA 2G80A 2VYVD 1JKIA 1XZHA 1Z38A 1JEAA 1FNMA 2VDUE 2ZULA 4LSWA 2XUZA 1SZJG 1FTNA 4TMKA 5A4KA 5HJ2A 4PN3A 1ZRSA 1AK2A 2VJKA 4XQ0A 2BFMA 5EXEA 4RK7A 3DBRA 1PSZA 3R40A 4MW9A 4ZCPA 4KFTA 1JKJA 1B14A 2W8BB 4GSYA 3C8UA 3THSA 5AJUA 4F6RB 4DAOA 3MG9A 1Z2DA 1T8TA 3OE7D 1H0RA 2FQQA 4YPOA 5LYJF 3OLXA 5K6RA 1TJYA 3EQ8A 3PQ3A 1QGYA 1Z22A 1ZSYA 4DREA 2OV6A 3IHKA 3AZOA 3D0RA 1L4HA 3JQ7B 2GM5A 2IEZA 1I3OA 4Y2YA 3KKQA 2I6QA 4FYWA 2XDAA 2FGKA 2R6HA 4EO9A 4V1CB 3KTAB 5DP2A 4AECA 1T6ZA 2YZ7A 3D8SA 3I23A 4LQLA 2A0FA 3R5HA 3WG9A 3GH1A 5BV1A 5BQPA 2G5PA 2JRLA 2QQ5A 3PSAA 2VDWB 3ANYB 5EVCA 4C0KA 4MS3A 5IAKA 5I9BA 4RLFA 4ECEA 5TQ0A 1XQ6A 5J2UA 1RS0A 2C29D 1OYWA 3H3JA 4RKQA 1I3NA 4W1QA 2QRMA 4FZ5A 4P93A 4X5OA 1SBZA 3UOWA 2ZYAA 3A10A 4A2PA 1QTRA 4F11A 1GGVA 1TW2A 2I6UA 4BGVA 5HK8A 1TGVA 2CWDA 2WUGA 5C4MA 2QTMA 1E2KA 4EKGA 1YZKA 1PF7E 2Y1KA 2R4TA 3WAKA 1XK7A 4DIKA 4PG7A 2QZPA 1MG0A 3PQ6A 3P26A 4XWYA 4DQLA 3EEIA 3F2IA 1OASA 4RFSB 5EXTA 5CH8A 2AG0A 3R5SA 1PGJA 4IS3A 3N07A 4CMGA 4B2IA 2IHJA 2ZPAA 4P31A 3N0TA 4GNRA 1FNSA 2WHPA 4CFYA 5EMMA 1J07A 4D81A 2BTOA 3U37A 1N3LA 3AL2A 4HNRA 5JY6A 3CX7A 2DSTA 4E0BA 3SSOA 1JYFA 1JG1A 3FYTA 2WJIA 3I6ZA 3JVUA 5CFNA 4TXMA 1W34A 2QLNA 4HXFB 4AZTA 1EIZA 2CLCX 4R2KA 1BWRA 1XSEA 3AIOA 4FHCA 1L8LA 5H82A 4DPKA 3FYCA 4TTTS 4DKJA 3RVBA 1EU1A 4CLRA 3O84A 2TS1A 2XUFA 3BSYA 4L74A 5HJEA 4HZIA 1OGJA 3G2LA 5EESA 2I6TA 1JG3A 2VXOA 2HK7A 3OIVA 4JX8A 4JWKA 4PAGA 3K70C 4GI3A 3F6RA 4CCWA 3OICA 4D4GA 2BE7A 1SQGA 3I1YA 1QIGA 1QQAA 3GX1A 1CWUA 4G5OA 4JROA 2NPOA 3TGWA 3MQ4A 1RI4A 3KDAA 4JQYA 1EX7A 3TS1A 1GUDA 2VQ3A 1R15A 3UBTA 5IVPA 3HA7A 1F48A 4XPZA 1RQGA 4PRZA 1MXHA 1T2NA 3JRXA 3SJ7A 1OAOC 1WHSB 4M9SA 4ODIA 4Q03A 2R0QC 1OFUX 3ONVA 1Z6TA 3AEKB 3ZTYA 2QL5A 4ENUA 4CODB 3ZCSA 1WXQA 1YS9A 4DG8A