1F12A

L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
b'KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDECVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-HYDROXYACYL-COA DEHYDROGENASE
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Sequestration of the active site by interdomain shifting. Crystallographic and spectroscopic evidence for distinct conformations of L-3-hydroxyacyl-CoA dehydrogenase.
pubmed rcsb
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1f12A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1f12A01
2HQ1A 4RL6A 4E2YA 3F47A 5FI3A 5G4KA 5F3RA 3WWYA 4FFRA 1KC3A 1SAYA 4DYVA 3D3WA 3HB5X 4OL9A 4NMHA 3FBGA 3BMQA 1GPJA 4MVJP 4UEKA 4XQCA 4J7XA 1EDZA 2NQTA 2NVUA 1QRRA 4XRRA 5TX7A 2I65A 3GGGA 4J1QA 1XELA 3H9QA 4H15A 2YFQA 2AG5A 1Y9AA 1PL6A 1FXSA 5U9CA 4WNCA 3OECA 3WXBA 4UUNA 1LDNA 3CE6A 2HJRA 3CTMA 3IQDB 1X13A 1ISFA 3E5MA 1DLIA 3QLJA 1DHTA 1E1LA 3AFNA 3RJ9A 4I5EA 3D5TA 4JNKA 3TZKA 4Z0HO 4YBZA 1BXZA 2PKRA 4EJ0A 2BF7A 4BQRA 1WXDA 4NZ9A 2Y1FA 1BVUA 3DDNA 3KV3O 5ER6A 1L7DA 4D44A 4BNHA 1NASA 4LK3A 4MJLA 4AJ4A 3TL2A 1WDMA 3OA2A 4RV9A 4N7RA 4R1UA 4YR9A 5L7TA 1OC2A 1P0CA 5COBA 1UXIA 3IUSA 3W1VA 1EBFA 3U4DA 1GFSA 1LSOA 3EVNA 3GEGA 1E5QA 4DREA 2VOJA 1U7HA 4W6ZA 3C85A 1AXGA 1E1KA 4JBIA 4ZGWA 4BNXA 3L6OO 2B5VA 5AQ1A 4MDHA 3D7LA 2B69A 2B4RO 1NX6A 1ZCJA 3LF2A 3ETGA 3S2EA 1VL0A 4GX5A 1S7CA 2DPHA 3C3XA 4FW8A 4J4TA 2E37A 1YH3A 4QT0A 4D0RA 1VRWA 2EGGA 1P3DA 2G17A 1JVBA 4IDBA 4Q39A 3JQFC 2C5EA 3ZW8A 4OHUA 4R01A 1DRWA 3CH6A 4BL5A 1I2CA 3GVCA 1UZMA 5G0VA 4L75A 5KCZA 3ANMA 1P1IA 3PDJA 4J1SA 1C1XB 3H5RA 5KWEA 4YEDA 1BDMA 4G5HA 4TKLA 5JAIA 3WIEA 2VN8A 2PFGA 2ZTLA 2I5PO 3DBRA 4OXKA 4CM1A 1ZK4A 1Y8RA 4TKMA 3D0OA 4BNTA 4RPJA 1LEHA 2J3HA 3JYOA 3KB6A 3CEAA 1ARZA 5IN5A 3SJUA 4OKIA 4AG3A 5C7OO 3A06A 4BS9A 1DRUA 1UR5A 3B6ZA 2OUIA 4OSPA 2DFVA 2I66A 1ZK0A 1WMAA 3SXPA 1HDRA 3PK0A 1AN9A 1TLTA 1FDUA 3OQBA 4GVLA 4O0LA 1EVYA 4YAEA 4O6VA 4QFCA 1BRMA 1U28A 4CL3A 1JKJA 2BELA 3WBBA 3GK3A 1GU7A 4ROSA 4DMLA 4W7IA 5DN9A 1YQGA 4BVAA 3A4VA 1C0KA 4FN4A 4EGFA 1N9GB 2NTVA 1YOVB 2Q50A 2VCYA 5JLAA 2TMGA 3SLGA 3FNGA 4DL9A 5K0ZA 1VC2A 3N7UA 1MLDA 1HDGO 5MDHA 5ICMA 1R37A 1DBVO 3L9WA 3D4PA 1RYDA 1JDJA 1TT7A 2WMDA 2VHVA 3KRTA 4BNYA 4NI5A 1DHRA 2E48A 2Y0CA 1DIGA 1NYTA 4KWIA 1V0JA 4ZU3A 3ZWNA 5J23A 4M1QA 2HK8A 5BSEA 3NYWA 1W4ZA 4WLOA 2UDPA 5JO9A 2C5AA 2VRCD 1A72A 3DR3A 1QORA 3ZI0A 1P1JA 3PWSA 2X6TA 1M67A 3L6DA 2A94A 4NK5A 4D7AA 4NJOA 3IP3A 1CIVA 4CMKA 3OP4A 4ZRNA 1VL6A 1EE9A 4LSMA 1H5QA 2Z95A 4DXHA 4BNNA 2JCVA 1UH5A 3ASUA 3M1AA 1Y9EA 3OHSX 4XYEA 5AOVA 3OEYA 5EL0A 1FDWA 5KVSA 3WYBA 2Q46A 1C0LA 2I67A 4IPTA 4K9DA 1EDOA 3RFXA 1B3BA 2EXXA 3I4FA 2I3GA 3OF2A 2OZPA 2A35A 2GLXA 2WTBA 1E7YA 5I9LA 2W8ZA 2Y1OA 4E2XA 5A5EA 1E7RA 2TMDA 4RVDA 7ADHA 4CLRA 4ZQGA 1BMDA 4C7JA 4PG7A 1PJCA 4QEDA 3O03A 4XQGA 2DU8A 1PGPA 1JA9A 4OH1A 4Q3DA 3ETEA 3ROMA 3BMNA 3I9JA 5DF1A 3I4CA 3DTYA 3U5TA 2HUNA 3ANNA 5THQA 1DEHA 2EF1A 2CD9A 4S3MA 2D5AA 1V9LA 1Z7BA 3RASA 3H4VA 3RC2A 4BQPA 4IMRA 3H65A 1E3WA 4U6QA 2O48X 3DAFA 4IDEA 4NBUA 2HRZA 3UCXA 3LLSA 1NVGA 4B8ZA 4C4OA 4DGSA 4FOSA 5ENDA 5I8WA 9LDTA 4YJFA 3G0OA 1VI2A 3JQGB 4E5NA 1HLDA 1NXQA 5LC1A 3M2PA 2R00A 4JJFA 3GR6A 3H5NA 2VYNA 3B1JA 4UVEA 4NFHA 4GX0A 3K6JA 2C07A 3AW9A 4WGGA 3ROQA 1SOVA 2AG8A 5C3MA 3ZV6A 1UXGA 1TVEA 2VWGA 3TN7A 3ICCA 4I9UA 3RUCA 4BO5A 4BKQA 3HQ4O 4DC0A 1RPNA 5AXCA 5CDTA 2IZZA 3Q6IA 1NFRA 4MP3A 3RSHA 3EK2A 2NVWA 2UVDA 3FNHA 5JCJD 5DBFA 2O7SA 3ZWMA 2OGUA 3GG2A 4FD3A 2VQ3A 5CPBA 1VSUA 2O50A 2RCYA 3VVBA 4R9RA 4HWKA 1PR3A 3ZWOA 4BO8A 3O9ZA 3GPDG 3VZRA 4MVJD 4TRRA 1PU2A 3TZHA 1YE3A 3DZKA 4K28A 3JQEA 4AJKA 4CUZA 3ASVA 3KYCA 4IUYA 1EFKA 4FJ2A 3I6QA 4YRAA 4JQCA 1PGOA 1KYQA 4FGSA 1ULSA 1CF2O 3WFJA 2Y1CA 3DZHA 4IZIA 4RVGA 4E3ZA 4W82A 2J3JA 3Q1LA 4MKRA 1D3AA 3DMTC 3NDRA 2QX7A 2PH5A 4FC6A 3QSGA 3TQHA 3JYQA 1PTJA 2Q1UA 4J4HA 3WSWA 2BGMA 3RJ5A 3KYDA 4MO2A 4FQ8A 3WMWA 3D5QA 1XHLA 5EINA 3UN1A 3GUYA 3UCEA 1X7GA 5A06A 2BD0A 3MTJA 4B3HA 1WW8A 3NDIA 3AFMA 3ST7A 3NUGA 2I76A 4Y98A 4CM9D 2G76A 1R16A 2J5RA 3GZ4A 3OMLA 4EEZA 5EJ2A 1H9BA 3L07A 3HNPA 1ZIDA 1MFZA 5TS3A 3FTPA 1YONA 3DC2A 3ITDA 1P77A 3PI7A 4YJHA 3HDJA 3PGJA 3ZN2A 3OFSA 2X0IA 4JCOA 4II3A 5CEEA 1BG6A 3VPHA 5C5IA 1LSSA 2ZB7A 3KUXA 4IGFA 4CUKA 1CDOA 1JQBA 4E30A 3KSUA 2NSDA 4AJPA 4YQZA 2D2IA 3RUIA 1T2CA 2PD6A 1MXHA 5G0TA 5T5QA 3B70A 3GPIA 1GV0A 3RKRA 1F12A 5L45A 3D4OA 4H7PA 4CMAA 4KZPA 1H94A 3IIEA 1LLQA 3H9GA 3OJ0A 3FF4A 4RLHA 4XJTA 3ADOA 2YV2A 3BHMA 5B1YA 1O89A 2XOXA 1UAYA 4XGIA 4ZRMA 4M89A 3T4EA 4B4OA 4ESOA 5L7YA 4TQGA 4IQ0A 1T2AA 1I24A 4MOWA 1ISIA 5JCJA 3UXYA 3P19A 4CLOA 3UVEA 2AW5A 2VOEA 4HNHA 1NWHA 3K31A 4IJVA 4M87A 1QKIA 4ZN6A 1EQUA 2V6MA 2H9IA 2GN4A 3JQBC 3PJGA 3OA0A 4NU5A 3R3SA 3PHIA 4NHEA 3HG7A 3HFGA 4E21A 3ZCXA 3VVCA 5A9SB 1B0AA 1FJHA 4LVCA 2W90A 1G0NA 1Y8QA 5G4KB 2PZKA 1J6UA 4MKXA 5IDWA 4E31A 3I1JA 2GZ1A 1GY8A 1EMDA 5ES3A 5A04A 1LUAA 5CDUA 1EZ4A 1WZEA 4PLHA 4DRYA 1DIAA 2V6BA 1FDVA 3GLQA 4CR7A 4D46A 1F17A 1CERA 2CDAA 4A27A 3BTOA 4NQZA 2Q49A 3MCVA 1ENZA 3D3EA 1GPDG 3TJRA 4NR0A 4XJSA 4O1MA 4N5MA 3T7CA 2NLOA 1LA2A 1EK6A 1GUZA 3SX2A 1K6JA 2G5CA 3DZGA 3H9EO 5TLSA 3Q9NA 1ZZEA 2IXBA 1XU9A 5GY7A 1R15A 3FHLA 2GD1O 4W99A 1N5DA 2CVQA 1U1IA 2JJYA 3OETA 4CM4B 3VDQA 4DVJA 3PXXA 1SCUA 4Y6RA 1Z82A 4S1VA 3AU9A 3GVPA 3UAGA 1UXHA 4IXTA 2ZYDA 1PQPA 4FFOA 3U09A 3I9NA 3DOCA 5ICSA 5TSDA 4PLCA 1SO8A 4JK3A 3LU1A 1WVGA 4D3SA 2YHIA 5A5FA 1ENOA 4WE3A 5EN4A 3INRA 3WFIA 2QQ5A 1QG6A 2GPTA 3TOZA 1GUFA 3HN7A 4Z9XA 4BO1A 4MIEA 3AOEA 3TRIA 4KQXA 4ND4A 3AI3A 3G1TA 3MJSA 5A9RA 3I9OA 2E82A 4G2NA 2NACA 1E3WB 3VOSA 2O2YA 2FP4A 2AQ8A 4J90A 4ALMA 4XR9A 1XIVA 1YS4A 3F46A 5A1TA 1OAAA 3FN4A 1HYHA 2Q1SA 2NADA 2NTNA 1NPTO 1XG5A 1Q7BA 3P2OA 1K6XA 4B7UA 2FR1A 4E5MA 1NFFA 4RVHA 1QMGA 1E92A 3R1IA 3WOHA 1ZEMA 5JS6A 4WLVA 3COSA 4ZD6A 2H1SA 3FCOA 4CLRB 4BOYA 3DZFA 4INAA 4J2OA 5F1KA 3PIIA 2P9EA 1HE3A 1NVMB 3H3JA 2AA3A 4ALNA 1W6UA 4IXWA 3EMKA 3IS3A 3RC9A 5T67A 3G49A 3IDSA 1PZFA 4IDFA 4GLOA 4LCJA 2BFAA 3C1AA 4R16A 4E0BA 3RD5A 4IDDA 4OSOA 3KYBA 3IKTA 2VYVD 5JPIA 4CQLB 2NM0A 1YOVA 2Z5LA 1PJSA 1RKXA 2HCTA 1YRLA 3JYPA 4YAJA 4HX5A 3ZU3A 2C2XA 3GGOA 2NTJA 4IDAA 3FWNA 4WASA 5L4SA 3IJPA 1E5LA 2E6UX 1MX3A 4F46A 4ND3A 3KEQA 3WLFA 2AEMA 3WWZA 4IJKA 1P1KA 3HHPA 4BKUA 3WGIA 1IUKA 3EZYA 5DT9A 3ZWCA 4X54A 4J9UE 4GWGA 1PSDA 4Y9DA 5DBIA 4OYRA 3LC2O 4UUOA 1G1AA 5BSHA 4A03A 4FIZA 1RWBA 8ADHA 5JXWA 1O94A 4JN6B 1LRLA 1PWZA 2WYWA 1ZSYA 1N1GA 1CQJA 3NEPX 1Y81A 2IXAA 3DL2A 1B2LA 1A9ZA 1U3TA 1UDCA 1Y8RB 2X7HA 2BFOA 4FFPA 4XX0A 3E18A 5BNIA 3R0IA 3UHAA 4P8RA 1Q0LA 2EGHA 5CP8A 2PGJA 2BLLA 4J9VA 3BAZA 2O4CA 3QVSA 2GZ2A 3BMOA 3FNFA 1PJ4A 2HO5A 4R1NA 5HM8A 3F3SA 2EJWA 4HY3A 1YGYA 3RKUA 2J6IA 3M1LA 1BDBA 4D3DA 3ROKA 3IL2A 2Y68A 1DSSG 1TEHA 2H6EA 4NDNE 4NU6A 1A4UA 3WGOA 4EBFA 5JSFA 2BMAA 1KBZA 5F1PA 3DFUA 3HJAA 3H5AA 3LVFO 4DWVA 1P0FA 1JAXA 4EUHA 1HDXA 2WD7B 1LRKA 1T1SA 2VT3A 3JQ8A 3TL3A 5GZ6A 3I83A 1B7GO 2C0CA 1E6WA 3LSYA 1QLHA 7MDHA 2AEFA 2B37A 4GKVA 4BNWA 1HYGA 1ZXLA 3QVOA 5COQA 1J5PA 2VWQA 4NIMA 1ZH8A 3NKLA 4TWRA 2P4QA 4KMSA 4QX6A 2JFFA 3DXFA 4PIVA 1EFLA 2P5YA 5G0SA 1I33A 2WM3A 1FF9A 1Y6JA 1Z75A 3ULKA 3EYWA 1GEGA 2X5JO 3E9QA 3SC4A 1VM6A 1N7HA 3FD8A 3E6AA 4WOJA 3WNQA 5A9TA 5CPFA 5JY6A 3DHNA 2Y05A 4EUEA 5TGDA 1WPQA 4U8GA 3S1LA 3ZWVA 1NPDA 3AWDA 2PKQP 3H3FA 2QRKA 3D64A 1ZFNA 4NBWA 4CQLA 3FBTA 1PJQA 4MVJE 1KOLA 2X22A 3RBXA 3K96A 3GAZA 3GG9A 2VYVA 3K9QO 2D5CA 1R12A 2ZQZA 3RC1A 4DBZA 2QRLA 2EV9A 3TOXA 3P7MA 2IE0A 1IHYA 3OQ6A 4M55A 5TRTA 4L4RA 3WGHA 4UULA 4FJ0A 3QA9A 2VHWA 3DBHA 4DBVO 3ZH2A 3AK4A 1OI7A 4GL4A 3UUWA 1XCBA 4MVJM 3ETDA 4PVCA 3WICA 1ONNA 1N1EA 1I30A 3KETA 4YYZA 1AXEA 1MV8A 4CV2A 2VZ8A 4O59O 2D59A 4XIJA 1VSVA 4FB5A 1DC6A 4YB8A 1XDWA 5JDIC 1R4MA 1VJ0A 1RM4A 2CZCA 1HYEA 4OXNA 4NBTA 4CM7A 1F06A 2GO1A 1VJ1A 4OKNA 2HJSA 4JXKA 3QWAA 4ZJUA 5EQFA 1X1EA 3ZHXA 4IM7A 4ZHSA 3A28A 3B20A 1RJWA 4PLZA 2GASA 1YB1A 1Z45A 2Q99A 4JLWA 1LSJA 4KTVE 4CLHA 1VLLA 1ZO8A 4RF3A 5L4NA 2UUPA 4R3WA 4RLSA 2HK7A 2I3AA 3K30A 5GZ3A 3QVTA 2Q2WA 3U62A 3WBFA 1DJNA 1U2DA 3ITKA 1DFHA 2W2KB 4PZEA 5B12A 5L40A 3PHLA 2XXJA 4GMGA 4OAQA 1U5CA 2O3TA 4QFDA 2NVUB 3TZ6A 4GBJA 4D3FA 4TRJA 4DLBA 1IYZA 4LCEA 1H0KA 2VUSA 4GGPA 4CM6A 4CM4A 1N7GA 3GMDA 3RUEA 2DTEA 2PZJA 1SPXA 4BGVA 1IL0A 4B4VA 4BO2A 2FR8A 2Q1WA 4WLUA 4Z3KA 5IJZA 2I6TA 3AI2A 3JQFA 3S2IA 3OH8A 3WGGA 2CDBA 1F8GA 4NJMA 1NM5A 2HAEA 2PNFA 1BTOA 1V6AA 3DAPA 4Q3EA 1TI7A 4W9NC 1P45A 1YBVA 5AVOA 3Q9UA 3VPSA 3RI3A 4W4TA 2YHUA 5G4LA 4PG5A 5I9NA 3HDQA 5F1OA 2Y93A 1EEHA 2IDZA 3RROA 4PN3A 3LC1O 2BI8A 2C29D 2FPIA 4IGEA 1DOHA 3RUDA 1B26A 3MJCA 1B8VA 4PG8A 1GCUA 1MFPA 1YJ8A 3X2FA 4OXYA 4UVDA 1IY8A 4BIIA 3NT5A 4WCFA 4XKJA 4R54A 2ZYAA 5JDIA 1HZJA 3NGLA 1HL3A 5T6BA 1PQWA 3RUFA 2GUGA 1O9BA 1QYXA 2OXIA 4J7UA 1PS0A 1Q7CA 2NU6A 4K6FA 4JJIA 3U3XA 4BGIA 2B0JA 3MEQA 3DOOA 3PYMA 1HT0A 4Y67A 1K0UA 1GAEO 1NR1A 4JP3A 4JBHA 1QSGA 1XWFA 3JQ7A 2PKQO 3E82A 1E0DA 1LDBA 3BIOA 3L9XA 3PZRA 2VTDA 5CEFA 4PZDA 1PJ2A 3NJ8A 3LQFA 4GGOA 2NU8A 2BI7A 2JD1A 5L53A 3C7CB 1K6IA 4P4LA 3L4BA 3BHIA 1E77A 1B15A 1XYGA 3FI9A 3I52A 4G81A 2RBEA 2O23A 3GHYA 2YYYA 1LQTA 4WLNA 2ZCVA 3O4RA 4XYBA 2CY0A 2YQ5A 4EITA 4CLDA 1J49A 2GERA 4GKBA 2PWZA 3JQAB 4WLEA 4C7KA 4G65A 3CTVA 5TT0A 5KKAA 2IEDA 2HRBA 3V1TC 1ZBQA 5FF9A 1BWSA 4CJXA 4AJIA 1JKIA 5L95A 1DFGA 2WE7A 3AUSA 3LT2A 1KEUA 2SCUA 1BXKA 1RM0A 2AXQA 4FCCA 3M6IA 1UZNA 1UP7A 3QWBA 1E6UA 4AJHA 1DFIA 1PGNA 4UREA 5I7SA 5HRUA 4LMPA 1LC0A 4NG5A 4II2A 4BB5A 3ZU5A 1P1FA 2Q4EA 3JQCA 4NPCA 3GNTA 4XA8A 1K5HA 1KY5A 1SMKA 4OMUA 1IPEA 2GN8A 2OO5A 4P4GA 3M2TA 2YJZA 4J49A 4LVUA 4RCVA 3U9LA 1P1HA 5I7FA 5KOIA 1Y5MA 3EVTA 2Y0EA 1C14A 4QQRA 3HDHA 1A27A 3H9JA 3LT0A 4AJOA 1NQTA 2AMFA 2HSDA 1JLLA 3MZ0A 3PHHA 5G0WA 4IZHA 3FNEA 5ILOA 4BUCA 4PRLA 2EERA 4ND1A 3V2GA 1U9JA 3H6KA 4KUGA 1GV1A 1T25A 1XLTA 3U4IA 4YTEA 1I0ZA 1JN0A 3GN2A 4UVIA 4F3YA 3DB2A 4U0KA 2D0IA 3LK7A 4XIYA 2A4KA 1KVRA 4LRSB 4ZQHA 1G0OA 1M66A 4K6CA 2P68A 4B7XA 1WAMA 3A14A 3HE3A 2PD3A 3PLNA 4XDYA 5BT9A 5B4VA 4IDGA 3WB9A 2PZMA 3KBOA 3U4CA 3ZWYA 3ZU2A 4EEXA 1JW9B 5A02A 3C7AA 4A0SA 1ENPA 4WEQA 2DFDA 2FOIA 5DP2A 3AU8A 4R1TA 4UVHA 1BHSA 1DAOA 1F14A 1B8UA 4IQGA 3SVTA 1BXGB 1W8DA 5HS6A 3CUKA 3QY9A 5THKA 1V8BA 1Q0QA 1HEUA 2UAGA 2PV7A 5JFOA 1PR9A 4OGWA 4PCVA 3Q2KA 5JAZA 1HDOA 2X0RA 4CL8A 2VRBA 5BNTA 1CETA 1DC4A 2ZIZA 5JMWA 2ZQYA 3GFBA 1LDGA 4N5NA 3S55A 3VZPA 4B7CA 2GYYA 1VKNA 3UOGA 4BNKA 2OBNA 2XF8A 3AOEC 4RORA 3TZCA 4LGVA 3RU9A 5CFZA 4WOKA 4E5KA 3JQGA 3GT0A 4YJGA 2AQKA 1DAPA 1C1DB 4HP8A 2WYVA 1V3UA 1VKOA 3MWDB 3ONDA 1PJTA 4CMIA 3C1TA 3GEMA 2YZ7A 3TFQA 2X58A 2HU2A 3ABIA 4OOFA 4B79A 3JSAA 3LT4A 4GWKA 2WWRA 3GQVA 3AY6A 3GC6A 4PLVA 2Z1MA 2D1YA 4PFJA 5B4UA 2DT5A 3O26A 3JQ6A 1P1RA 2D4AA 3ZDFA 5JAMA 3LF1A 1MC4A 4J0FA 5LDGA 1SB9A 3V8BA 5JY1A 1LJ8A 3W4IA 3WQSB 3AOGA 2Q4BA 4GQAA 3CINA 2OHXA 4CQMA 4BNGA 3QP9A 4KQWA 3ZWWA 1X0XA 1AUPA 1U7TA 5K6AC 3Q11A 3UICA 2BFPA 2GN9A 2DVMA 3EC7A 2FMUA 1U8XX 5G0UA 3W8EA 4Q9NA 4RF5A 4FGWA 1HXHA 1I2BA 1QP8A 3EUWA 4J2HA 4O63O 4YT5A 4D43A 1JVSA 1KC1A 5IZ4A 3HDYA 4ZICA 5CG1A 1NR7A 1OMOA 4CMBA 5HBRA 2YV1A 4MP8A 4M8SA 5H83A 2NWQA 2WDZA 2A9FA 3IKVA 1VPDA 4EYEA 3INTA 3VAZA 3OIGA 2WE8A 4XQ9A 3V2UA 4LSWA 4CMIB 4RJTA 4J3FA 3NGXA 4J1TA 3WGZA 2QZ9A 4OJNA 1ADCA 5MGBA 2D8AA 2P91A 3E03A 3UH1A 3K8ZA 4YRBA 1T26A 4EUFA 4UVGA 2CMDA 1YVEI 3ZNNA 2IZ1A 2ZTUA 2JFHA 3WSVA 4D42A 2QYSA 4WPGA 2ZB4A 3BTVA 4PG6A 1CWUA 3AM3A 3NV9A 2GCGA 4A5OA 1I2ZA 4CLEA 3I3OA 4OOEA 1ORRA 3HFSA 1RM5A 3QW2A 4GLLA 1QV7A 3K2BA 3NT2A 2WJPA 4RZHA 3HZZA 5EQDA 3B1FA 3MWEB 3A1NA 1AE1A 1UAGA 2BHLA 4AJEA 1BVRA 1ENYA 1ZXBA 1NAHA 2HLPA 4XYGA 1J0XO 4YJHB 5JW6A 5EMHA 3HUDA 4ZQBA 3STHA 3V1YA 4BO9A 2EKPA 1OFGA 2JFGA 5CDSA 2JD0A 2XXBA 1HF3A 2E49A 1TXGA 2QHXA 2DBRA 3VH1A 3ZW9A 2HMVA 1LLCA 5GMOA 2O7QA 4OIMA 5LCXA 4YAKA 4CLOB 1AGNA 1SC6A 2YQ4A 4JIGA 2LDBA 4YACA 4L8VA 1LBEA 2BFMA 3QHAA 1KVTA 4IINA 3E9NA 4E33A 4ALKA 1ZSNA 3FPCA 4Z0TA 4BKPA 2YW9A 1UXKA 2OFPA 2VYND 1ZSVA 3ZWAA 1YKFA 3PTZA 1P74A 4YT2A 4J43A 1K2WA 4CLXA 4L0QA 1NP3A 1LQUA 5H81A 3SBOA 4CMCA 2CSUA 4AJJA 4GAEA 2CDCA 2C2YA 3TSCA 3DBLB 4IS3A 1EVZA 5TNXA 2C59A 4RVSA 1DPGA 4AVYA 1KIFA 5ITVA 2Y1GA 2NU7A 2AEJA 3PFFA 4R5HA 3GMSA 5EERA 1HDCA 3ZV5A 2UUOA 2NVBA 4HFMA 1H6AA 2W2LA 1LTHR 2PA3A 3NDJA 2DKNA 2EIHA 1U8FO 1A7KA 3VH3A 3VC7A 1L7EA 3I6IA 1PZHA 3F4BA 2FY8A 3TFOA 5HWSA 1DIRA 4XCVA 5L9AA 1LLUA 5TT1A 4B3JA 5BNFA 3LC7O 5JBIA 1KVUA 3PP8A 3CMMA 4XR4A 4AICA 4JP2A 2PZLA 3NJ4A 1SOWA 4OO3A 3PYLA 3WQQA 4DPMA 5JC1A 3KYDB 2VTEA 4BMVA 4J6FA 1B14A 3PHJA 4MIYA 4KTTE 4IIUA 3VDRA 1Z7EA 2DLDA 2NU9A 4KWHA 1TB4A 3F4LA 3FR8A 3G79A 4QO7A 3WR5A 5JO0A 1IOLA 1T2EA 2CF5A 2X9VA 3NX4A 3QJ5A 4QXMA 4BNUA 2VUTA 5KTKA 3VH4A 2QG4A 2RH4A 3W4KA 1KEVA 4YDRA 3PGXA 5U4QA 4CM8A 5JC8A 2QW8A 1XEAA 4WCFB 2NNLD 2PD4A 2YDXA 3TF5A 2Q45A 3L4BC 4GH5A 2HMSA 2FRDA 2JKVA 4I5DA 3S2FA 2YV3A 3ZHYA 4CMGA 4P38A 4DPKA 1E7QA 4J7CA 5EPOA 1KVSA 5I7EA 2R6JA 4R69A 3DQPA 4DUPA 4TVOA 1O5IA 1KVQA 4QTZA 4YRDA 3AUUA 2WEKA 5JDCC 1O95A 2Y67A 6ADHA 4E12A 1NFQA 3WDSA 3IC5A 4A7PA 3F1KA 4WEOA 1I5RA 3OJOA 1N8KA 2R2GA 1LU9A 3CZRA 4KUHA 1RYEA 1HE4A 4JBGA 5IF3A 1BGVA 5GZ1A 1XU7A 3PJEA 2FN7A 2VT2A 2ZB3A 4GPD1 3GNQA 3FTNA 1ZKMA 4MVJF 3WJ7A 3GFGA 4RO0A 5F5LA 1R6DA 5CDGA 1E6EA 1H93A 3ANLA 3MJTA 1WZIA 1GZ3A 2EWMA 4PGFA 1U4OA 3DBVO 3RAJA 1NPYA 5TJ9A 4DA9A 4DQVA 5K6AA 3MJEA 1W73A 3GRPA 3N58A 1MA0A 4PLFA 3CXRA 3V1UA 1ZJZA 1ADGA 4MVJH 1UP4A 4D45A 2O2SA 3ON5A 1WDLA 1HRDA 4FPXA 3F5QA 1VE9A 4GMFA 1EBUA 4RVFA 3RVDA 2V7PA 2GR9A 3GVIA 3VKUA 5KJFA 1YQXA 3L77A 3DZJA 4BNIA 4PZCA 1I32A 3VZSA 2NQ8A 2VHZA 3WS7A 4ALIA 1ML3A 1LX6A 4BV8A 4CM9A 1SNYA 3JQ9A 4FSHA 3JCZA 4R3NA 3E48A 3UFXA 1GUYA 2B5WA 3K73O 4LISA 5DP1A 1D1SA 1GQYA 3QWFA 5H82A 4TRNA 4NNJA 4RF2A 3X2EA 1Q7GA 2X9NA 4R5MA 4UEOA 3DBHB 1HLPA 6LDHA 5C7LO 3QRWA 2F00A 4BMNA 2Q2QA 3KM0A 2FSVA 3WX0A 2CNBA 2H63A 3KVOA 5I7VA 1ZNQO 3IMFA 1EE2A 1GEEA 4XGKA 3VPGA 5T8KA 4IDCA 3UW3A 4IJWA 4R4JA 5ADHA 3KSDO 4PLWA 4YJDA 1B8PA 2FSSA 2RHCA 2DM6A 4BNVA 1T24A 1QXSA 4CM8B 2JAPA 1YXMA 4TZKA 3I9LA 1BSVA 3RC7A 2B4TO 1ULUA 3WTCA 2VZ9A 1DXYA 3P2YA 1U3VA 3GNSA 4L4XA 1FDTA 5ENVA 4WCDA 3ICPA 4D0SA 1YL5A 5EESA 1NHGA 1OZAA 5IDQA 1N92A 1E1MA 1SEVA 2Q3EA 4Q3CA 5BSFA 2A92A 3AJRA 1C1DA 1KEPA 1X14A 1ID1A 4PG4A 1N2SA 3RIHA 3ZNPA 1D1TA 3KSZO 4LRTB 2X0JA 3A9WA 1HETA 3H2SA 4RQTA 4D41A 5KKCA 3JQ8B 2GGSA 4BNFA 4BO4A 4HADA 2ZYGA 1YBMA 3QVXA 2DUWA 1H2HA 3JQ9C 3HADA 3DWFA 4GSLA 1DB3A 1YWGO 1UUFA 2X0NA 2AE2A 2CVOA 1N9GA 3KO8A 4U7WA 1PGQA 1ISJA 3WYCA 1SB8A 2EW2A 1LXCA 2QIOA 1HTBA 3E5RA 1E7MA 1EUCA 1JWBB 3DBLA 3S8MA 4RPHA 4L73A 5AXAA 4FFLA 3I23A 4RZIA 2GSDA 4J1NA 1R0SA 4E6PA 2PGDA 2ZTMA 2DC1A 1AHHA 2Z1NA 3OSUA 3RBVA 5IZCA 3E9MA 4BGUA 1K89A 1ZW1A 2O4UX 5TJHA 4F45A 3G3EA 4QECA 1KS9A 4BO6A 4UUPA 4KP7A 5CDYA 4RDHA 4RVUA 2V65A 5IXSA 1C3VA 4IS2A 2OBYA 2WD7A 3EZLA 2FHSA 4TSKA 5EIOA 5C7IO 4I9NA 3BA1A 2W98A 2IEBA 4QUKA 4LN1A 3DTTA 3O38A 3H9UA 3CKYA 3GEDA 3NT4A 3SC6A 1ZK3A 4D79A 1MGOA 3ZWXA 1C1XA 2DAPA 4B4WA 4XDZA 4ID9A 2EEZA 1P44A 3SJ7A 4HV4A 4E5PA 1R4NB 3G17A 1HE2A 4NFSA 4R41A 4Y6SA 1T2FA 3AM4A 4XWYA 4ZA2A 2J3KA 1WDKA 3PWZA 2D3TA 2O3RA 4IIVA 3BHJA 3F5SA 3DMTA 3JQDA 4J4BA 4J16A 2VNAA 3TZQA 5IN4A 3AM5A 2JHGA 1R0LA 4WJZA 1Q2XA 4DIFA 3KLPX 3OICA 5BQFA 2ZCUA 4BGEA 2J5QA 3Q2IA 4DLLA 1ZMTA 2W4QA 1QLJA 2Y99A 5U1PA 1OOEA 1E3LA 1Z6ZA 1F8FA 2AQIA 3DEYX 1HWYA 3KZVA 3ORFA 3RUAA 5HTOA 4JGBA 5A05A 1QR6A 3ENNA 2VNSA 2IZ0A 3BTUA 2EG9A 1JTVA 4A10A 4A73A 2I9PA 4XGNA 4Z9FA 4DLAA 4DQUA 3VPFA 4BO7A 2ILTA 4MVJA 3BMCB 1YBAA 4DTIA 1PJ3A 1PWXA 1GTMA 3PVZA 3EW7A 3WGTA 2H5LA 3P5SA 5KJ1A 2XPCA 1IZ0A 1E7WA 3ZHZA 1I01A 1E3JA 2DBVO 4YT8A 5CEJA 1NTOA 4WK6A 2ZK7A 2P9CA 2YDYA 3U0BA 1UZLA 5DOVA 3RUHA 3UKOA 1YDEA 2FZEA 4H16A 2ZB8A 3QWHA 1PQUA 4HUJA 4Q3BA 4CQMB 1DC5A 3TDKA 4PLPA 2OMEA 3RFTA 3JV7A 4CMJA 3T7EA 4CMHA 3OJFA 2E4AA 1T4BA 2R00C 1IPFA 4ZVVA 5TIIA 5HA5A 2J5KA 4FJ1A 1DO8A 3RQSA 3FR7A 3NRCA 1ZK2A 2EP7A 2G82A 1EUDA 2GDZA 4RF4A 4RQUA 3RCBA 5FEUA 3D3WB 4FFMA 3ROPA 4CV1A 3CMCO 2IODA 3W4JA 2ZKLA 1W0CA 2EKLA 1LRJA 1QYWA 2VHXA 1GYPA 4P4NA 4CUJA 4ALLA 4B8WA 4XB1A 1I36A 1LDYA 1QYVA 2WD8A 2X23A 4K1LA 1DRVA 4FOOA 2V6GA 4PLTA 4YJGB 4HFNA 4MVJI 8LDHA 1U5AA 2F1KA 1WMBA 3JD4A 4GSKA 1GD1O 2B83A 4FBGA 3OM9A 4N5LA 2C82A 1I3LA 3JYLA 3RWBA 2YHIB 4N54A 3DO5A 3AUAA 1NNUA 4B3IA 3ZNQA 2EHDA 2BRUA 3KLMX 4GX1A 2X5KO 4WKGA 4Z6KA 3EAGA 4JROA 4P22A 4ZQEA 5L51A 3WMXA 3ONFA 4DIOA 4BO3A 5IDXA 1GDHA 3DHYA 4MVJG 2JCYA 1I10A 2IRWA 4R51A 4QO8A 4BKOA 1DC3A 3GDOA 4IMPA 1MG5A 1T4DA 2DBQA 2P2SA 2B35A 3QVWA 2Y1EA 1WWKA 5F21A 1M6HA 3PHGA 3PFWO 1IE3A 4HNGA 3C8MA 2HMTA 1ISMA 4MPDA 4R1SA 1UDBA 1XSEA 2FWMX 2DUUA 5AYVA 4DMMA 1H2BA 4AJ1A 2X9GA 4CODB 4M54A 1H6DA 2RH8A 3PJDA 1XR3A 4MINA 4Y8VA 1ADBA 1H6CA 2HMWA 3CSDA 1ZVMA 4YWJA 5JCXA 3VTFA 1M75A 3PYXA 4HXYA 3GZNA 3JD2A 1VJTA 2JAHA 3OQ1A 3R3JA 4HFJA 4N18A 3WNVA 1PJLA 3RBZA 1MB4A 1AHIA 3FPLA 1EVIA 1T2DA 4RGBA 1WNTA 5BR7A 5KJCA 4U0JA 1SZJG 2FPGA 1NBOA 2V6FA 3WG9A 3F6YA 3HB4X 3Q0EA 3F9IA 4ALJA 3PIDA 5A9SA 3ZZNA 1V35A 3G1UA 3PPIA 3JTMA 1YQDA 2ZJ1A 4IY1A 3B1KA 4BKRA 1G6KA 3GN1A 1C0IA 1GQQA 4CQMD 3O8QA 5BSGA 4BNLA 2ET6A 3H2ZA 5A03A 4FFNA 4KOAA 3IJRA 4ND5A 1QYCA 1ZUD1 2BGLA 1QYDA 2VUUA 1GYRA 2AQHA 2JD2A 2Q2VA 3EHEA 3RU7A 3GGPA 5IG2A 1P33A 2I99A 1Q0HA 3GHHA 1YB5A 3OIDA 3ZV4A 2C7VA 3MOGA 1GR0A 4WNIA 3GA0A 4RPGA 3L4SO 1H9AA 1PL8A 4W9NA 3BYZA 5KVCA 4XEHA 2BKAA 4H3VA 3DAGA 2YY7A 1NQ5A 4L9RA 3L6EA 4LW8A 3GOHA 4E5YA 3VPXA 4WLFA 4I1IA 1DJQA 4XB2A 2ZTVA 1PGJA 4ILKA 4ND2A 5AXBA 2RIRA 1KEWA 3OJEA 1ADFA 2YUTA 1DDOA 1UP6A 5A3JA 3FSRA 1HSZA 1PZGA 3HN2A 3KHUA 4MIOA 4PLYA 4Y6PA 4TROA 5DOZA 1SEPA 1HSOA 2IYOA 1A4IA 1RM3A 3GF4A 3IUPA 1SBYA 1I3MA 1X1TA 3OEWA 2X1HA 1GADO 3ENKA 3D4NA 4IJUA 5JAQA 1E7SA 4CMEA 3KYCB 5COAA 2JCXA 2JHFA 5JE8A 2WYUA 1ONOA 1HDZA 3OIFA 1O8CA 4QSMA 5KVQA 3VKVA 2UV8A 4CV3A 3S2GA 2Y1DA 5DULA 3PWKA 1NQOA 4E4YA 4RPLA 3WIDA 3LZ6A 1UDAA 3PDUA 4CM3A 4A2CA 1YO6A 1C0PA 3V5NA 1Y7TA 5ER9A 5FYDA 5DCUA 4TVBA 1LDEA 2CUKA 3GRKA 3GDFA 2J8ZA 3WTBA 1JU9A 3WJAA 5HS4A 5JDCA 4FS3A 4E2ZA 2RAFA 4KDFA 1IZ9A 3KXDA 4AJLA 5KNLA 3I9MA 1YL7A 2OL4A 3GZNB 1P9LA 3BZUA 1ONPA 3C1OA 3DZIA 1CJCA 1VL8A 1MG0A 9LDBA 3JD1A 1NVTA 4YXFA 4Z9YA 3NTRA 4AJNA 5AXDA 3V2HA 4A26A 4DQXA 1GCOA 1GYQA 2ZJ0A 4JX8A 4Z0PA 4F6CA 1EQ2A 1OBFO 4TRMA 1PS9A 4M49A 5G2OA 1V3TA 5DBGA 4DYDA 2PH3A 1ZEJA 3IP1A 4L74A 1A5ZA 4BHTA 4GVXA 1ZJYA 3LT1A 3MOIA 2GRAA 2CFCA 5DDIP 5A3VA 4XD2A 1MP0A 3PLRA 1QV6A 2EW8A 3KEOA 3BMNB 5LDHA 2W2LD 4HBGA 1YDWA 2W2KA 3IOYA 5CG2A 4XYLA 2X8LA 1M6WA 3PZBA 1BW9A 5C37A 5IXYA 2HKIA 3TPCA 4BMSA 4NBVA 3LDHA 4CPDA 3ONEA 4Q3NA 3NTOA 5K9ZA 1U3UA 5IFLA 3W8FA 1WLYA 1PJBA 2GN6A 1I3NA 2DBZA 1LI4A 4BNJA 4YJFB 4ONEA 5JNLA 3ZWPA 4NFYA 3PRJA 4EI2A 3ZV3A 1Y1PA 2PK3A 4YA6A 4CM5A 4DC1A 2QYTA 4GX2A 2OORA 5B4TA 3ZHBA 1M76A 3I9KA 3ZWBA 1XQ1A 2O3JA 1LLDA 5I8ZA 3BXXA 1F0YA 2G1UA 1R4MB 2OP0A 5TF4A 1B3RA 2FPPA 4I5GA 2DQ4A 1YB4A 1LDMA 3Q3CA 1LNQA 2GZ3A 4TZTA 2GNAA 4URFA 3EGOA 5DNAA 4YCAA 3FWZA 4RDIA 4LMRA 4I9HA 3GY0A 3UGKA 1L1FA 4YAGA 4YAIA 4I5FA 3C24A 4Z3DA 1H6BA 2X4GA 1A71A 3BTSA 3WLEA 3H8VA 1YJQA 3K2EA 3LYLA 1PEDA 5L3ZA 2JL1A 3NTQA 5F5NA 1WP4A 5KJ6A 2X86A 3AI1A 2ZATA 3E8XA 4F6LA 4YPOA 3SLKA 3I5MA 3INGA 3DZBA 4WUVA 1NWCA 3PQEA 2QZZA 4EJ6A 1BW9B 2O3UA 2XAAA 3GUCA 4BNMA 3AY3A 4PLGA 3WGYA 1A7AA 1B16A 4NBRA 4W7HA 3UF0A 2C7GA 2EJVA 4BB6A 4L4SA 4FC7A 1Q1NA 3HWRA 1GL3A 3BMCA 4WCFC 4M86A 3AY7A 1U4SA 1LC3A 4U5QA 3JQAD 4J0EA 3MTGA 3HSKA 4FR5A 5T8KC 3TWOA 1JAYA 2O3SA 2AE1A 1EK5A 1ZK1A 1MUUA 3DHEA 2LDXA 2UYYA 3C7DB 4O5OA 3ZU4A 1HE5A 3W8DA 4JJGA 4E13A 1Z74A 1TA4A 4YVFA 5T64A 4TMFA 4IQ8A 3DFZA 3T4XA 2VHYA 3QE3A 4DIBA 3KTDA 4EZBA 3N74A 2YFHA 3NAQA 4BO0A 4Q3AA 4CMEC 2PGLA 4ZQFA 4PRKA 1PS8A 5JYEA 1D8AA 3DONA 3W6UA 3CZMA 4L76A 4XQEA 2AHRA 5JMPA 3KOUA 1R66A 4KUEA 2P9GA 1Y8QB 2DPGA 4WECA 3JQBA 1R4NA 3EDMA 4HKTA 1FMCA 2WSBA 3GVXA 2VWPA 1Z73A 4DPLA 1JKFA 1A9YA 5ITWA 3BMOB 1FK8A 1O6ZA 2QRJA 2C54A 1BXGA 1YL6A 3D1LA 3WYEA 1E3SA 3QIVA 5TC4A 1I8TA 3UCFA 2GF2A 4PVDA 4XZ3A 3U4HA 5IAAA 1U2GA 4R9SA 1CQIA 1EVJA 1D4FA 1X15A 3QV1A 1OC4A 5B37A 1PZEA 1U3WA 3EY4A 3K5PA 3WQRA 1D7OA 2HK9A 3DBRB 1XA0A 1X7HA 2Y66A 3PJFA 1EUZA 2POQX 4OM8A 1GZ4A 1PX0A 1M2WA 2J3IA 5IZCC 1X0VA 4U6SA 4NH4A 3CIFA 4BNZA 1S6YA 2C20A 2BH9A 3W6ZA 3PQDA 3PEFA 4UAGA 3DOJA 2PLAA 1K3TA 1Y5RA 4GI2A 1E3EA 1O0SA 1NAIA 3PQFA 4OQYA 4EDFA 1R0KA 5A4DA 5JYDA 1CYDA 4E32A 4OQZA 4EW6A 5KVVA 1MXFA 5L4LA 4KDEA 2CVZA 5DCYA 2O3QA 4YQYA 2OOSA 1NHWA 1PIWA 1X7DA 4BV9A 1GZ6A 1PL7A 3IAHA 5CAEA 2DTDA 1MC5A 1GQ2A 4RPKA 5DZSA 5KJEA 5TQVA 4AJ2A 4XYMA 4J91A 3QWIA 1JWAB 3R6DA 4MKZA 1I3KA 3GAFA 1HDYA 1P31A 3RFVA 1ISGA 5T57A 1ZMOA 3O8QB 1KY4A 2PR2A 3U49A 4I8XA 3WGQA 3GVHA 4ITUA 5I9MA 2Q1TA 1UXJA 1V3VA 2X5OA 1DIBA 4R68A 2NUAA 4XRGA 4UEJA 1HKUA 3VHRA 4I08A 4UUMA 1UJMA 3JQAA 3VZQA 4IBOA 2FZWA 1XGKA 1E1NA 5IDYA 4B4UA 2PY6A 5L7WA 1T1RA 3VH2A 1TT5A 3LLVA 3K92A 4NK4A 1ISHA 3ADPA 5KIAA 2PTGA 2P4HX 3TNLA 3AUTA 3VTZA 3ZGYA 4YT4A 1IHXA 3JD3A 4CR6A 1E3IA 1HZZA 2VWHA 1IULA 2G0TA 3GH3A 5FI5A 3JD0A 3GDGA 1DIHA 2HMUA 2NV6A 3FRJA 4E2WA 5FFFA 2DTXA 3JQ7B 3QQPA 4AL4A 3DMYA 3ZNOA 2Y0DA 3CPSA 1FDSA 1XQ6A 5ILGA 4FDAA 1IB6A 4EJMA 1XKQA 3BMQB 3MJ4A 2CF6A 2P5UA 4K26A 2RHRA 3L0DA 4HFRA 3SEFA 2IYPA 1J4AA 1CRWG 1NQAO 3F1LA 3E1KA 2FR0A 2EKQA 4CV0A 2VZ0A 1LSUA 5FWNA 2OP1A 3OBBA 4CR8A 1KETA 1DLJA 4AFNA 3MJVA 2EP5A 3OJLA 5DCWA 5CHEA 4MP6A 2BGKA 2VRCA 3JYNA 3H7AA 2HDHA 1TT5B 2B4QA 4NJMB 1KERA 1CEQA 2B36A
chains in the Genus database with same CATH superfamily
4RL6A 4C01A 3A32A 2OFXA 3REQB 4MJ3A 2F3QA 3U26A 5HQ3B 5K20A 2FWNA 3X1ZA 3WWYA 1SAYA 1KEKA 3VPBA 4OL9A 1LD3A 3A6GA 3BN3A 4XQCA 2NVUA 2O6HA 4XRRA 1SBQA 1L5FA 5TX7A 4F11A 3H9QA 1WU7A 4LDAA 3PQ8A 2YFQA 2IIVA 5IAGA 5BV8A 3EEQA 5FBVB 1PL6A 4FZVA 4TUYB 4GM4A 3KWLA 4Y7CA 3BILA 4UE3S 3RANA 4DTCA 5JS1A 1LDNA 4O02B 2Q2OA 3A26A 4AECA 3IQDB 1ORWA 4NS1A 5DN6A 5ERXA 3EG9B 1DLIA 1ZD4A 2WF9A 1Y3IA 2MT9A 4P31A 1U8AA 3AFNA 1J00A 4N3AA 3O8OB 1F1BA 1FUEA 4LF6B 2C8VA 3KKPA 4KR6A 4DQKA 1C7EA 2A86A 1PFWA 3BH0A 4FZ3A 4WIAA 1V26A 1UBOS 4BQRA 4W8GA 1CJKC 2DF8A 3RVSA 1A2OA 2BM9A 2JFYA 4JP5A 2Y1FA 5LUAA 1B0UA 3ZZUA 1ITZA 1P18A 2XB2A 3AEKB 4UAUA 5EMMA 3WIBA 2QAGC 2WILA 3C2QA 4MJLA 4BNHA 2O8DB 3TL2A 3IYLW 5K3CA 3OA2A 4DXDA 4X90A 4R1UA 4YR9A 3EDCA 4K6KA 3F6CA 3GRZA 4H18A 3PEWA 3EW9A 3OZ7A 4DLUA 1C3OA 5JARA 5GOZA 2YJGA 7ABPA 1L7PA 2RGAA 3CZAA 2H1VA 4W6ZA 5KSOA 5KTYA 5U4XA 1CJUC 1AUOA 3IEKA 4D98A 5IMBA 1S2NA 2GBPA 4BX3A 4LXHA 5AQ1A 3BQ9A 1F0PA 5CA1A 5KHLB 1DAHA 3D7LA 4RX1A 2NUTA 3AZPA 4U2BA 4B84A 1EA7A 2DPHA 3FFBA 3ZS8A 3DL0A 4Q00A 4B2IA 4G36A 5JANA 2PL9A 2ZRLA 3ABSB 5LB4A 1FY2A 1V41E 2XMBA 2NUPA 2BCGY 4MICA 4QT0A 3UM9A 4KQHA 1BQEA 2K4MA 2H0QA 1K75A 1KP9A 3C4QA 1L4FA 2R6ZA 4D0RA 4J76A 4D25A 1DKRA 2GXQA 3FNBA 2EGGA 4F5WA 4A15A 1TTQB 5KMGB 1JVBA 3B7WA 3PL5A 1D6MA 3W06A 4RTPA 2NZUG 4DV3B 1MBZA 1YK0A 1Y4UA 2R4TA 5ECDA 2PXXA 5GVSA 1XMPA 2OCYC 1L4HA 3EXG1 1I2CA 4P08A 3TTVA 4BCCA 3JTEA 5I7UA 3DDUA 2ZIXB 3FKSD 1FFHA 4KE7A 4PS0A 1G5PA 2CFTA 3PDJA 1PHRA 4J1SA 4QOGA 2ROQA 4HI0E 4F3CA 2IOFA 4Q9HA 3SCZA 3WIEA 1JZQA 4E07A 2GRJA 2PFGA 3R09A 4OXKA 4F72A 1PFVA 2FFQA 2IPAB 1HZZC 2IIPA 2Z8XA 1Y8RA 1WW3A 5NLLA 2XD9A 4BNTA 4EW2A 1VFNA 4RPJA 2IYUA 4PV7A 5DBOA 1QVRA 4I3HA 1Z36A 2BGGA 2HZBA 2WJAA 3ZTTA 1WZNA 3UFBA 2E21A 5B64A 4P83A 1P6UA 1MC8A 2WICA 3JWEA 3ESDA 4OKIA 3SJUA 4AG3A 3U7FB 5KNBH 1JSLA 2FDXA 1NA5A 3A06A 3VFDA 2IUEA 3B6ZA 4FUTA 4OSPA 3ZQUA 3SS9X 4MGZR 3BCRA 3GJ3A 1YA6A 1SU4A 2O7NA 3B6JA 4FSXA 2PS9A 1EUQA 1WMAA 2O1XA 3M1YA 4D4GA 3B51X 1FDUA 4O1HA 1QIJA 1MRNA 4JLVA 4O6VA 2HYIC 1U28A 5IBPA 3WL6A 5F23A 3GK3A 1BCSA 3B2NA 3PV0A 4FIDA 1F4PA 1YQGA 3A4VA 4OK6A 2YZGA 3P26A 1LWOA 1VI6A 1N9GB 1YOVB 4OP3A 4QDUA 5JLAA 2JDID 2PX0A 2JHCA 2W6IA 4RFSA 3SLGA 3WWDA 3RIGA 2X8BA 2HEGA 1T9DA 3ESZA 4RH1A 3CVVA 1C4XA 3K09A 3TIIA 1MLDA 4LFBB 3T7SA 5K8CA 1HDGO 3CX7A 4YRZA 1DBVO 1XKTA 3N5CA 1H2XA 1E2EA 2QBYB 5EJ4A 1UEXC 3VRHA 4D9KA 1W25A 1DINA 4OB7A 4B7AA 4KLRA 5C1OA 1TT7A 4R0NA 2R1UA 3HL0A 2BEVA 3CNEA 1PZMA 3ILYA 1DEAA 2ZJAA 4NI5A 3SYNA 2GSWA 1BVHA 4KWIA 3H8WA 1V0JA 1YZQA 5J23A 2AV6A 5C8ZA 4M1QA 4OG2A 3KBBA 5JO9A 2UDPA 5TVGA 4UNQA 1KZYC 3UJ6A 3DR3A 4AMYA 2GBGA 2GBFA 3KSMA 4HXFB 3B9RA 1KQNA 1C3OB 1OKKA 3CF0A 1A5BB 3L6DA 3UHOA 4NK5A 2XVXA 3P2EA 4NJOA 1VA4A 5KI6A 1ANKA 2HHAA 4ZRNA 1Z6PA 4KH1A 3RS2A 1RU3A 1Y1RA 2IHBA 1VL2A 1FNDA 4M37A 5LDDC 1QGYA 3H17A 3T1NA 4LQDA 3WK5A 4WBNF 5AVSA 4QGGA 3SIRA 2V7XA 4QXPA 3UY4A 4CEHB 4XYEA 3TRDA 4HNVA 4GOLD 4EY7A 2QL9A 3N6RA 4UXHA 5ED0A 4AF6A 3R5XA 3KQPA 3QGMA 1KYVA 4FDMA 5H1YA 4WFIA 3RYCB 1GSOA 5KU7A 2HY7A 1QG2A 1D2HA 3RFXA 4L02A 5AI0A 4QPZA 4RLFA 4B2LA 2I3GA 3R7LA 5IHPA 2I4TA 2V5VA 1KAGA 3G6WA 1G7SA 3G5LA 2WTBA 1HT3A 3I9FA 2Y1OA 3NHKA 4E2XA 2IF0A 3REOA 3PKZA 4S35A 3FCYA 3MRSA 4OI1A 1CUXA 3FUVA 1YACA 7ADHA 1IZZA 1FC0A 3N87A 1BMDA 2P2DA 2JAUA 3BD7A 3OPMA 4QEDA 4BB0A 4C7JA 3M6XA 2VQFB 1QPZA 1PGPA 3M1IA 2WYOA 4YCLA 5DF1A 4BLRA 2EWVA 2FX3A 3NAMA 1VOTA 3ANNA 4P3NA 1EWQA 4C6RA 4RCYA 4G8DA 4TS4A 1JHDA 1MPTA 3AHEA 4HH4A 5FLKA 3CX4A 1J0DA 1V9LA 1Z7BA 3CC8A 3H4VA 4BMYA 2A84A 3IUBA 1GNQA 3JAWB 5F33A 1USIA 1X7XB 4FLMA 1N75A 2I71A 3F8WA 4TTVA 4FFVA 3TVYA 3VU1A 4NBUA 3HB1A 521PA 2HRZA 3FSGA 2G36A 3EXHB 4EPTA 4TXNA 4F85A 1IU9A 2YMMA 2XYVA 2IY7A 1JH9A 2PMFA 5C8YA 1O94C 1XTUA 2IYZA 1NXQA 5M2QA 3T1YB 3FIJA 2R00A 4JJFA 4COOA 2WJ4A 2A0YA 1JFLA 1XVTA 4DQ0A 4UVEA 1MAHA 2UYGA 4COKA 1N6IA 2ZXEA 3AW9A 3EAFA 4JLJA 3BF8A 4D9FA 4PRYA 3A4IA 5F35A 2QQFA 2VQDA 4DXAA 1NUPA 4MRVA 5LQMA 3A1EA 3NB0A 4K3UA 4YP9A 4D57A 3AETA 5EWJB 1U3DA 2DKFA 1UKCA 3BSFA 1EFPA 4MX8A 1XCMA 1YF3A 1NURA 3DNPA 5HEKA 5JD5A 1S2IA 1ZGHA 4IV5A 3Q6IA 2VKQA 1MEOA 1VLHA 5IKEA 3VXKA 3H2HA 3EK2A 1OY1A 1OWNA 1J9EA 3UTDA 1LY1A 3FNHA 5DSTA 1GPBA 1SBCA 5DBFA 2X0EA 1KJIA 2Q62A 3ZWMA 1VKJA 1HQCA 1KF0A 1N6KA 2VQ3A 5CLLA 1FB5A 2WYIA 2O50A 4LXTA 1FFXB 5CPBA 3VVBA 4KR0A 4R9RA 1YQUA 1Z83A 4HWKA 3E5NA 2WKPA 4M9XA 1SCIA 4PGMA 4DR5B 1PR3A 2I4OA 3FLAA 3HM2A 1SFRA 2P40A 3MINB 1NVDA 4JYBA 3GPDG 4UDXX 4V0SA 4TRRA 3VZRA 1KJQA 4FWTA 5EIWA 4AJKA 1VHJA 1XRSB 4Q1AA 1VJDA 5DGXA 1P0PA 2C1ZA 1EFKA 1NXPA 5E2IA 4FJ2A 4MGEA 3VNRA 3O73A 2ZQ5A 4YRAA 4C4OA 2GETA 3PUXA 1RRKA 2E7ZA 5JXGA 2VJYA 4JQCA 4GZLA 1PGOA 1KYQA 1YQQA 3QLEA 1BMQA 4NHOA 4S12A 5DWQA 1MVNA 1QQ6A 4FGSA 1CF2O 4JP1A 5CBPB 3A1CA 5CB8A 3GWZA 1QVWA 5ALLA 4ZYTA 2GPSA 4E3ZA 3MGAA 4KR2A 1JSCA 2XEXA 3WB2A 2J3JA 1V16A 4JJAA 4FGKA 1JS1X 2W2QA 5KYYB 3FYCA 2R6AA 3DMTC 3O4VA 2ACWA 3PXUA 2QX7A 2PH5A 3TRHA 3O4HA 3AGPA 2IA5A 4B75A 1V7QA 5AUQA 1NE7A 4FC6A 3RHSA 2QN6A 4BBAA 4YLYA 2G4VA 3HZOA 3TQHA 3FI0A 1PJAA 1KDZA 4J4HA 2QW1A 1USUA 2RH9B 2WUFA 4PPFA 4PAMA 4EHKA 2H29A 1Z13A 4GZMA 1CLUA 2B1RA 1Q19A 4BJ6A 1JLMA 1NBMA 2QRMA 2PU7A 4FQ8A 2HQOA 5IARA 1XHLA 2H07A 1GG8A 3GRCA 1ZM4A 3AUFA 4M9SA 2AOUA 3I8OA 4D9EA 9MHTA 1FVOA 5AVZA 3GZ4A 3BERA 2J5RA 2OO5C 4EEZA 1LVGA 2Z8YA 3HNPA 3LA8A 4GPBA 1MFZA 1F48A 5FNVB 1YONA 3IQWA 3DC2A 3DUWA 4IP0A 1P77A 1P4JA 3TPFA 4DSNA 1POWA 2AK3A 2IHVA 2HDWA 2MJLA 4YJHA 4II3A 3DPUA 1L5QA 1NJFA 1LSSA 4D8YA 4PNZA 2AMYA 4X8OA 2HLDA 6NULA 1CDOA 3NANA 5BO5A 4B71A 2H57A 3FSEA 4E30A 3K4QA 4EG6A 3KSUA 1OX6A 4RSGA 3ZX4A 2H1HA 4AJPA 1JNYA 2D2IA 2XWQA 1V95A 4RVCA 2QMEA 1K7CA 1TK9A 3GI1A 4UHBA 4WGFA 4TXHA 3B70A 4M36A 2AMJA 1PP4A 2I2FA 2W00A 1D0SA 3LW8A 4QOSA 3LDUA 4QVKA 4X1OA 3N76A 2NGRA 2ADFA 1AUQA 3SBDA 3UAWA 2J31A 1CJMA 1LLQA 3FMPB 5JG7A 1VYUA 4PQEA 1Q1QA 1O89A 2XOXA 3WLPA 5JRDS 1UAYA 4KB5A 4ZRMA 4M89A 1GTRA 3MLAA 1L7BA 5G1OA 4DUGD 4ESOA 5L7YA 4I1VA 3H3XA 1ZCBA 4UDNA 5T4EA 1T2AA 4HAIA 1B93A 2FMKA 3HJUA 4C2TA 3COYA 3TBFA 3OQNA 3MQ4A 4V0RA 4AG6A 4E1BA 4LGCA 1TZKA 2DY0A 2PO5A 4MGKR 4EI9A 4IFTA 1C1YA 2QA5A 2ZJ3A 1NWHA 2YHAA 3DT8A 4PEVA 3TB4A 1U2TA 2P1RA 5BPFA 4AS3A 1R6VA 3DFKA 3P97A 4ZANA 1M83A 1L4LA 3PE3A 4BECA 2V6MA 2H9IA 2JIRA 3QLTA 4HMPA 4W5QA 3OOSA 3QKRA 4CT0A 2GN4A 3B6EA 1XZBA 3JQBC 3LZCA 5E9JA 2OYRA 3EEYA 1ZGBA 2WF7A 3WIUA 2XHEA 4YHBA 3GT3A 4YRRA 1Z0FA 1JYFA 3X1YA 4CF5A 5ITZA 5A9SB 1X7WB 4JGGA 5E1MA 1G0NA 5JIBA 4PYNA 2AI2A 2AOTB 2DP4E 4MKXA 2XQKA 5C7YA 2WJIA 1GY8A 4ZTUB 5A04A 5L6MB 4YP6A 1MV5A 4XI9A 2V55B 4M88A 4LYFA 1JG2A 2V6BA 3C6ZA 5IVDA 3ZLUA 4D46A 4LXIA 3S8YA 1CB7A 4F96A 2PQMA 4NQZA 2FG7C 2LXNA 1T2UA 1ODSA 2VJNA 1GPDG 1LBTA 4M0DA 4O1MA 3CEHA 3F9RA 1VE3A 1W6RA 2ZRGA 1E9FA 2CCGA 4DWJA 5FQNA 4LWOA 4Z2YA 5TLSA 3H9EO 4J16C 3Q9NA 4QDTA 1KS2A 4ZARA 4AZ0A 2IXBA 4BQIA 1DGQA 2ENWA 4MQEB 3CZ5A 1VLJA 2FKNA 3RU2A 2JJYA 4EO9A 1ZH6A 4XTCS 3ZGOA 4IDQA 4DVJA 2WF5A 4KQ9A 1RBMA 4OBBA 1RYNA 4BFZA 3CRMA 1ORHA 3CNHA 3PT9A 3IJ5A 2R79A 3HNOA 1UXHA 4BFUA 2LKCA 2QZJA 1OA0A 4JLBA 5J4LA 2R8ZA 3GBSA 3GLIB 1K7EB 3FYHA 1SO8A 2OT3B 3PFBA 1BS1A 3FDZB 1GL9B 3LHFA 1LI5A 1WVGA 3OG9A 4DFDA 3MB5A 1HT1E 3DTVA 3ROTA 5EN4A 4BVHA 3INRA 3TECE 3J81A 3WFIA 3BVPA 2QQ5A 3K1ZA 2YXEA 5M7EA 3L40A 3NV7A 5CUQA 1GUFA 1HFJA 4X61A 1ZM7A 3MXOA 2V4UA 1ZI6A 3PUHA 3SZUA 3PC7A 3TW0A 2PX8A 3U48A 4BO1A 2EF0A 5E9AA 5F64A 5JVDF 1RC8A 1VSQA 4J03A 4F8YA 2XRZA 1LQ2A 4C20A 5A9RA 1J2JA 1SUEA 3K2IA 4CL0A 2AJCA 4G2NA 2X40A 3AJ9A 2AIRA 2NSYA 1AKRA 4RGQA 4R9UC 3BDIA 2WVJA 5CYGA 1F60A 3NTVA 4N8DA 2AQ8A 2WG1A 4J90A 4TS3A 3ACBA 4TMKA 4ERXA 1YS4A 2ZS7A 1A9PA 5CLQA 5T6MA 3CCBA 2XVMA 3FN4A 4PHFA 2C1XA 1FVHA 3VISA 3ZD9A 1ZA2A 2NADA 2NTNA 4BJ3A 4X3CA 4DMGA 4B7UA 1XZDA 3BG5A 4RVHA 1QMGA 3A2NA 3FKSA 1EHYA 3R1IA 1ZEMA 2XMGA 4NQRA 4GOND 3AEQA 4EPXA 4ZD6A 3RS8A 3X2SA 4CLRB 2ZTHA 2SECE 4OKSA 3DEZA 3B12A 3E3LA 4J2OA 3BZWA 1GZHB 3PIIA 2P9EA 2BMWA 1KQOA 2OOKA 1NVMB 2J0SA 4FEYA 1W6UA 4D96A 1FPQA 2H5JA 3LHIA 4XUGB 4CIBA 3RC9A 5T67A 3IDSA 2BKUA 1E2PA 1L6IA 2QMHA 4IDFA 4LCJA 4QG3A 5LOVA 3SI7A 2VP5A 3A6EA 2FFRA 1P4SA 3BXZA 4IUCS 3WWOA 2OTCA 4K7JA 4MJ7A 2MSCB 4OGGA 3RD5A 3TD9A 3PX3A 5ISMA 3IKTA 4MUGA 2FWRA 4PR0A 2GCOB 4RIGA 1ZP6A 5I6DA 4KR3A 2G1AA 2ZBQA 1A97A 1GCAA 3QKTA 4C4TA 4FKZA 5BVHB 1RC0A 5HFJA 5B7QA 1K08A 3NP9A 4KQFA 5GGXA 3JYPA 3P52A 3ZU3A 4LNHA 1O6BA 1JKJB 3GGOA 4IDAA 3H1FA 3OO0A 4F1KA 5L4SA 3IVGA 2ASVA 2ODTX 3IJPA 4WV3A 1HR0B 2Q5CA 4H3SA 3U3JA 5KDOA 5THXA 2WP0A 5LQNA 2PRZA 3EGCA 4TWZA 4DOMA 3L6UA 1IUKA 3ZWCA 1IJEA 1I9GA 1KP2A 2C94A 1SA0B 1RJFA 2J3LA 2VVTA 3EDOA 3N0VA 4J9UE 5NULA 1PSDA 1SUAA 3LC2O 4N0MA 1G1AA 5C5CA 3LSTA 4FIZA 1RWBA 5T3YA 8ADHA 2G7MC 3K6RA 2I3DA 1O94A 4ITRC 2BWJA 2GRUA 4OHPA 4GP9A 3HACA 4QHSA 1PVVA 1CQJA 1XDBA 4OJKA 2VJCA 2ZIWB 1Y81A 4DG9A 1N4DA 3T9BA 1CTQA 1A9ZA 2X7HA 4YUXA 2BFOA 2P4SA 4A1FA 4AP9A 1Y6QA 1VGVA 1RSZA 4V0KA 4Y1RB 4DA6A 1CPYA 3F73A 4J9VA 3BAZA 1MX5A 2GZ2A 3FNFA 1PJ4A 1HUQA 4R1NA 3GLIE 1OH7A 2D7DA 2W6ID 4WERA 2FAXA 4HY3A 1N3YA 1E1CB 3F6SA 4J0CA 3TRJA 4B83A 2J6IA 1EWVA 1BDBA 4Y9SA 3W5AA 3BXOA 3T3OA 5B3LA 3FETA 4D3DA 3AEUB 3IL2A 2ORWA 5DI9A 1DSSG 2H6EA 4NDNE 3G2MA 4NU6A 3V7WA 5EJ7A 2PEYA 3M5PA 4KLAA 1NNSA 2QI9F 2PSHA 3OZXA 1NW5A 1J8QA 4JENA 3E70C 3HJAA 4JWTA 4EKGA 2OORC 3H5AA 3BBPA 3UMMA 4IHJB 4OQEA 4QE3A 4DWVA 1EWTA 1HEIA 3VUEA 1LRKA 1TMYA 3JQ8A 3E81A 1XZJA 1E2NA 3HGTA 5DCLA 3TL3A 1B7GO 1FDOA 2C0CA 1J0AA 3DAOA 4NCXA 5JQGA 2LGJA 4OXRA 2AEFA 2GM9A 5KAMA 4M6WB 3VPDA 2ZPTX 1GA1A 3VV3A 4WJLA 1HYGA 4PZ9A 4OUDA 5COQA 4OQPA 3EA4A 3NKLA 1Q2UA 1KDTA 4KMSA 3RHZA 16PKA 3QNMA 2JFFA 2NZ2A 3DXFA 2QOEA 1Y0BA 4WN3A 1Y6JA 3RDPA 1LZLA 1Z75A 2PFKA 5SY9A 1Q57A 2K7ZA 3IA7A 3SC4A 4NV3A 5EHQA 1HQDA 2E9SA 3FGOA 1N5LA 3IJEB 3WB0A 4D99A 1XP5A 2A6PA 5BMVB 3SZGA 4N41A 4C2AA 1JFSA 4UOEA 1S2LA 3R7WA 3T35A 2PKQP 1Z7GA 1Y6RA 3H3FA 4QAQA 2AG1A 5ALVA 1OXSC 2NUBA 2H2IA 3UKDA 5B6IA 1IBRA 1KWGA 3SBXA 1XJQA 2AC2A 3FBTA 5K3AA 4JITA 3F7OA 4DSUA 4MVJE 1KOLA 5ARBA 1G42A 5C51B 4DADA 4JQSA 1KBQA 1D2MA 4HC4A 1BRTA 1R12A 1BFUA 4H0FA 3DLBA 4G97A 4JQZA 4DGQA 2OG1A 2XWSA 3P7MA 5AK0A 1A95A 1NW8A 1YQEA 3FPGA 1KR2A 5E3HA 4KZKA 3C7TA 4YJ2A 1EUYA 5BXQC 1RE0A 5EJGA 1P2VA 4H6WA 2XR1A 3QA9A 4ENVA 1OWMA 1P2SA 2GZMA 4J94A 4DBVO 1EGVB 1YB6A 3AK4A 1OI7A 4GL4A 1NBMD 3IQGX 4A6EA 1FYWA 1I3CA 2I7VA 2PRYA 5DI3B 4RA6B 4FBLA 4Z3KA 2C97A 2YYSA 3QNWA 4K40A 4WFKA 1JT9A 1YJBA 3C16C 4NCHA 1FS6A 1AOXA 3SICE 3UUEA 2VZ8A 4UZFA 1F8XA 2D59A 2XUQA 3MYRA 1MU0A 3KB2A 4PPQA 1DC6A 2WA1A 4R2HA 3EGDB 3LPNA 1R4MA 1RM4A 3KFXA 2E6KA 1TO6A 2GO1A 2PUVA 4CKEB 4OKNA 2KHZA 4IJ6A 4LXQA 3TM5A 2JFNA 4KBYA 3WFZA 1PD0A 4C29A 2G5TA 4MXDA 1XQWA 3FPKA 3T9FA 3V1LA 3STWA 3ZHXA 3LH5A 3VJKA 5EWMB 4ZHSA 2FPRA 2NX2A 1ONBA 1RJWA 4JLWA 1OBCA 4UQPA 1RLMA 2C5FA 1UC9A 4U7PB 1MH9A 4D8TA 3D81A 5L4NA 4R3WA 1LW6E 4JYPA 4JBLA 2PZ8A 4HLCA 3OWXA 3SP1A 4TVKA 3THSA 4Z7NB 4YP1A 2HK7A 3ZY3A 3PDIB 4LGMA 2UYOA 4HSEA 4EB6B 5GZ3A 4JYAB 1G20E 2Y0BA 3JALB 3R6LA 3FJ1A 4FCVA 1S02A 3BRWA 3PGMA 2DLCX 3HVHA 5CFRA 2W2KB 3HBMA 5IUNC 1EB8A 3SR3A 3KAPA 3Q12A 3T5AA 1F7UA 1PX2A 1RXCA 1U5CA 1WHTB 3BQMB 2AH5A 4DCGA 2G08A 5IVPA 1W1IA 4L9AA 4TRJA 4Z8YA 3W3ZB 3HWWA 3KT6A 3L8GA 3W5JA 3JR7A 4NH0A 4U5XA 5KYUA 4BJHB 4Z8XA 1B43A 2WAMA 3LVBA 4CM4A 3E84A 1V71A 4R98A 2DTEA 4R8VA 4HAUA 2P79A 5FR1A 4ZHQB 2QTNA 4GEGA 4GMKA 1F8GA 4NJMA 3FVVA 5DMHA 5JEEA 1BTOA 1O94D 1PDOA 3P2MA 1QQ7A 2QR3A 3Q9UA 3CO0S 221PA 2YBDA 1XCJA 2ZUWA 3QHQA 4HNSA 4PG5A 1KOFA 4Q1DA 2IS2A 5F1OA 1EEHA 2IDZA 8ABPA 4PN3A 3ZJ5A 1NDQA 2BI8A 2C29D 3ZE2B 1VG8A 4M9UA 5KPDA 1CT9A 3PHCA 5BSUA 1M34E 3RUDA 1B26A 1DDGA 3V4PB 2HHHB 1C2YA 1B8VA 3MBIA 3THWB 1XZGA 4EI8A 1E9CA 5HQTA 1RYZA 2GFQA 1IY8A 4I50F 4TXMA 2F9LA 4TYPA 5KTSA 1MVLA 1WHSB 2DCMA 2RGXA 4R54A 4WCFA 3Q7SA 4OQ4A 2ILVA 4OLBA 2BUAA 2KQUA 1FFYA 3MILA 1HL3A 3SXJA 3WWPA 2GUGA 5IFKA 1DELA 1WZUA 3RKSA 5HRAA 4PS1A 1Q7CA 2QUJA 2VYQA 1ECLA 3U3XA 4ER5A 2Q8NA 1MQ8B 1UKZA 1V45E 3MEQA 5IS2A 5BQXA 2ZRQA 4Y67A 3E61A 2D1QA 3SC2A 2AX3A 3ZZ1A 1RWKA 1TEVA 2BAGA 3LO5A 4JP3A 1QSGA 1XWFA 3L9XA 3E82A 3OBIA 1E0DA 1YE8A 1U02A 1JQDA 3HYRA 4GOMD 2BJVA 5DLEA 3OMXA 3UMYA 2QTTA 1U4NA 2NU8A 1Z15A 4G0PA 5ALOA 1K6IA 4P4LA 3L6CA 4EBBA 4MHTA 1B15A 3DMNA 2FUG6 4NYMR 3M6MD 4DRXB 2D0OB 4YV0A 2NNWB 3MERA 1XNQB 3AVVA 4S24A 2WUVA 2ZANA 3L05A 1ZJ6A 4ND7A 3E22A 3PRYA 2O20A 4Q4HB 1M6YA 4HZGA 4GLFA 2B1JA 3DB1A 3CVJA 2NG1A 4RADA 1T4CA 1J49A 2HA7A 1OAOA 4Q5IA 3RLFA 1KPHA 2EKBA 2PWZA 3LFTA 2NZ8A 3C3EA 4C7KA 2F3PA 3GPLA 1QVAA 1N25A 4FYYA 4LZNA 1JJVA 3SM3A 2R84A 3HCDA 1VIAA 2NO9A 4EHJA 4XVUA 1AHNA 4H1WA 1Z18A 1ZBQA 4WBSA 5FF9A 4CJXA 1KRWA 2QI9C 4AJIA 1JKIA 5A7FA 1PO7A 4X97A 1JG6A 2H9AA 2UU9B 5EYPA 4DR6B 1KEUA 2SCUA 5E3JA 4HLUC 4OY3A 1RM0A 3ORRA 4OA8A 5BSMA 1UZNA 1UP7A 3VYSB 1MB9A 1BNCA 3IVMA 2WHXA 5AK4A 1PGNA 1L4KA 2XCQA 2Y92A 1CRQA 2XRMA 3IMCA 1DXHA 4PGAA 1ZMXA 4OUDB 3SE7A 5BN4A 4NG5A 1LV8A 4RHUA 4BB5A 5KWJA 1P1FA 1K3FA 3B38A 4ZO6A 1NVVR 3R9KA 5JQGB 3R23A 4N4AA 4ENPA 2VYCA 3DNFA 3N2GA 5ALEA 1H05A 1KY5A 1P9WA 3ONWA 1C9EA 2YVAA 4H7EA 2ZRHA 3AJAA 5GJCA 5AIBA 1G21B 4RCVA 1XHEA 3Q88A 4OLHA 2VSNA 5D3MA 3UANA 1PQYA 1LBHA 4A16A 4DCSA 2QX4A 4BCBA 2FW1A 2ZLBA 3H9JA 2RKWA 3LT0A 3NBZC 1JV2B 1XP8A 2RB4A 4HJXA 1Y1QA 3BWEA 4IF4A 3WHPA 5ALRA 1NVEA 5IM4A 2QTFA 1E2FA 1G8HA 1DKQA 4IZHA 4OAPA 5H3LA 5ILOA 1SVKA 1M7HA 1C7RA 1QUEA 2NZYA 2RC6A 4PRLA 4B6EA 1U9IC 1KYYA 3QVUA 2IU3A 4ZVLA 3H6KA 4Y0VA 4M60A 4CT4B 3TG2A 4GDFA 3GN2A 5DYTA 5FKJA 4EGJA 1THTA 3AVOA 2YVUA 3OAAA 4XIYA 5JWOA 4D80A 3WMEA 1KVRA 2P2GA 1C7ZA 1B6SA 2E89A 2GT1A 2I33A 4XDYA 5D84A 2QRNA 3SEZA 1QRTA 2BHSA 3JU3A 4J0HA 4TTJA 3VR3A 4EQZA 4MEAA 2YXDA 1FU8A 1ZRNA 1B76A 3U4CA 2Q3DA 3OEED 3RTCA 1O1YA 1QDLB 3EIEA 3KTAA 4PHCA 4RQAA 3SZLA 5A02A 5JWHA 1ST2A 2HU5A 2Q4TA 3ER8A 4WEQA 5B58C 5DM60 1V4BA 1ZJ5A 4PQYA 1L5MA 2NXJA 4LV6A 3ZXIA 2V97A 1BHSA 2GBLA 5A6VA 4OB8A 1E6KA 1NC1A 4QXRA 3SVTA 1BXGB 5DX0A 1SC9A 3EG5A 2UAGA 5JFOA 1ZLXA 2XCLA 5CIQA 3Q2KA 4Q82A 2ZWOA 4X44A 2AKYA 2QUHA 4CL8A 5E6RB 3RK4A 2BR4A 5BNTA 1CETA 1ST3A 2EJUA 4QZVA 2ZIZA 4M38A 1DTEA 1OBVA 1H0RA 2V1XA 4HGQA 1UM9B 3VR0A 1IZ8A 4JLDA 3U3MA 3FVRA 2DY1A 4B7CA 3W77A 1ZQ1A 3QV2A 4B46A 7GPBA 5FLXA 2IEIA 4KHPB 1BAPA 1VKNA 4GZ3A 3ITNA 3TLAA 1TQ4A 4AMBA 1NKVA 2XF8A 1AK9A 2B98A 1AKWA 1BEEA 4E5KA 2CV0A 2O8BA 1P7YA 1GLGA 2AHOA 4ZVKA 2CL0X 2FMFA 1VCHA 3U1VA 1DAPA 2D5LA 1C1DB 5ELXA 1N2JA 2WPDA 4OAOA 4HP8A 2QE7D 4E2FA 4R0MA 1VKOA 2DPXA 1FL9A 1GJRA 3ONDA 1MNQA 4DZTA 4CMIA 4F2HA 1ETHA 3QU2A 1EFTA 3AKEA 2X58A 3ABIA 5FI0B 5ARCA 4B79A 3CZPA 2FF7A 2BZSA 1BE0A 2HA0A 1U0BB 3SKYA 3P9ZA 3VR5A 3FOFC 4M0FA 5BOVA 2VXYA 3AY6A 3LY5A 3PVSA 1ZOIA 4PFJA 4R0VA 1TUBB 1G3MA 2I4LA 1A2KC 5B4UA 1ODKA 2DT5A 4GGMX 1SXJB 4Z54A 1P1RA 2X2PA 1NE2A 2OYSA 3C43A 1H4TA 1NW9B 3ENZA 3LF1A 1TMKA 4M53A 3R4VA 4DEYA 1ZI8A 3AF6A 3U4QB 4NOJA 1LJ8A 3FPFA 3HCBA 2DYKA 4MS1B 3W4IA 6GPBA 4BBPA 1Y9DA 2WTEA 2CC2A 1FOEB 1U1CA 3BFKA 3KQYA 1NG1A 3LBYA 4FMDF 4GQAA 1TK3A 2I2DA 4R2MA 5LB2A 2XCSB 4C3OB 3EEBA 2OHXA 4BNGA 3QP9A 2B8EA 2PUJA 2O7RA 3L8ZA 1W7AA 1YZHA 3AP1A 3TG8A 4CI0B 3EF1A 4CZ2A 2VRNA 2XW6A 2BE7A 3LTEA 1WCV1 2BFPA 4QGSA 3LYUA 3A6JA 1RI5A 2DVMA 1VFPA 5DXFA 3VR4D 1XE3A 1Z34A 2V8OA 2OGWA 4Q9NA 2I87A 1ZQ9A 4J2HA 5TQ2B 1I2BA 4XJVA 5FDFA 2WHRA 4O63O 3LWZA 1MZPA 5E4YA 1XRQA 3HJTA 2Q1XA 4RKQA 5IZ4A 5CG1A 1OMOA 5JLJA 4IXNA 1OX4A 2BSAA 3IBFA 4MPPA 4M8SA 1O6FA 1KY2A 2WDZA 4MKFA 5FPTA 3IKVA 3USZA 4LHXA 4P82A 4WL0A 4RACA 1KO4A 3UXEA 4TYQA 3TTTA 3ESCA 3VAZA 4UCFA 5CJPA 1P0MA 3RREA 1W46A 4J3FA 4RJTA 2H2AA 3MWDA 3NGXA 5DYIA 4DEXA 3EIUA 4OJNA 4IW3B 4B4KA 3PE4A 2O57A 4FU0A 1HFKA 5HF6A 3UH1A 3SEAA 2J7KA 3T1OA 4IEFB 2FK8A 3N5KA 3RSOA 1E0KA 2XQJA 4RD4A 1YD7A 1GILA 1BOOA 2FQYA 2GK4A 2Q5EA 4G37A 4WPGA 4IQFA 3TRFA 2D7JA 4PG6A 5DIFA 2OCGA 3CEJA 4D4LA 4AMZA 5IM4F 4FFWA 2I6GA 4P36A 3P9QA 3EIXA 2YIMA 1NOJA 1R3UA 1RM5A 1T6ZA 3DSRA 3HYCA 3QU7A 4HB4A 1QV7A 1QGDA 3K2BA 3AFGA 3LMKA 4RZHA 2W71A 5EQDA 4BRUA 5LNK1 1V11A 4U7DA 4V03A 3ZJUA 2V4ZA 4M1KA 4AWAA 1PW7A 1QOZA 3RBAA 5AM2A 5CFLA 1Z4PX 5EGSA 3BGSA 3RTEA 5FAKA 1ENYA 2RHJA 2HCFA 4MWDA 4ZXPA 3F90A 2YVLA 3HUDA 3EOZA 3WK9A 5ALJA 2FZKA 1PSZA 5CDSA 3V4LA 3FJYA 3WL4A 1U7UA 1A0OA 3T41A 1OZFA 3C14C 1BE8A 3UA3A 3U6KA 1JIJA 4HYEA 4LV5B 1TXGA 1MO6A 4US1R 3ZW9A 3CA8A 3VO9A 1QS0B 1QCZA 3PEYA 4B43A 1O6CA 2O7QA 1RIIA 3OPYA 4YAKA 1RR6A 2P9TA 2UZ0A 1UOQA 2UZ3A 2ZR8A 4AMVA 4JIGA 3IAM1 3IPXA 4YACA 3W7BA 4YGYA 4IINA 2DJIA 3M9XA 3E9NA 4E33A 3MWJA 1ZSNA 3GDWA 3LDAA 4LYDA 5ADWA 1HH4A 2YW9A 5FRDA 1UXKA 2AD5A 2VYND 1J7KA 1H2YA 1ZSVA 3M5DA 3ZWAA 1PLLA 1KAHA 1L5WA 2AOXA 2GZDA 3AZQA 3P2KA 4CKCB 3PTLA 1GNTA 3DOIA 3K0CC 1NM5C 2B7LA 2X4DA 3KE9A 4UEWA 1MIOB 5DHUA 4EUKA 2P3SA 3ZCVA 4GAEA 2CDCA 2VR1A 3BDVA 3VA7A 3L7KA 1EVZA 3G9UA 3KHKA 2C59A 2KWIA 3QVLA 4RVSA 3ETHA 2BEUB 4OU5A 4AVYA 1KIFA 2VPQA 2QRQA 2ZBEA 3NVDA 3PFFA 3A27A 1UEIA 2YZ2A 1HDCA 4JWKA 4Y6GB 1FUUA 3SK0A 2FW0A 4TTRA 5CH8A 3U80A 3EVFA 4YJKA 4A8JB 1QH8A 2W2LA 1OYWA 2UZ1B 1W75A 3NDJA 3VH3A 1U8FO 1A7KA 3VC7A 1UC4B 1SC1A 1ZVJA 2XNDD 1KYTA 3K35A 5HZHA 5HWSA 1K88A 3FCSB 5L9AA 2AN4A 2YWEA 3K20A 2P0AA 3UZUA 2IU6A 3EAQA 4DYHA 4V1CI 4GXQA 3PP8A 2FSHA 4M21A 3TAUA 4XR4A 4AICA 1I3OA 2AOUB 1J42A 1OLXB 1IK4A 1HI9A 2PLFA 5JJCA 2QSJA 4QGBA 5C81A 4Q18A 3VVMA 3AJEA 2D1FA 3PHJA 1N3BA 4KTTE 2EFEB 1SBTA 4F86A 2DLDA 3LECA 4WY2A 5BWNA 4EX7A 4CU5A 2NSHA 2ZS9A 4UTVA 1IQUA 4CIYA 2AN1A 4L9SA 5HDQA 1EFUA 3CPJB 4KFUA 3U61B 1XMVA 1J0CA 4BNUA 3D8HA 3QJ5A 3VH4A 2RGCA 1GIAA 5AJZA 4MNTA 4RENA 1J21A 1ZMRA 4IIFA 5JC8A 2A9PA 2C9BA 3EBPA 4RE5A 1MW9X 3UH0A 4A1OA 2BC9A 1QP7A 5CBPA 2PD4A 1JZSA 5EE5B 4F6RB 4DJAA 3AESB 2ZFUA 2XKKA 3AGQA 4UNPA 3UPTA 2Q6VA 4GH5A 3G2PA 4XCXA 4Z51A 3N2KB 1ACMA 2QR2A 5H02A 3S2FA 3CX8A 3Q5DA 3ZHYA 4DPKA 2QRVB 5FH9A 1T8TA 4J7CA 5EPOA 3W9BA 1EXMA 1GU1A 2JJMA 2R6JA 4MQFB 4R69A 4DUPA 3BFJA 2NO7A 4TVOA 4MV3A 1S4MA 2A2ZA 4UHHA 5JH7B 2BEJA 3GLFE 2WDPA 3AUUA 2BCJQ 2IYRA 2PXAA 3KQTA 3OCJA 4U00A 3L8YA 4A7PA 3LXXA 4IXMA 4TLBA 4Y0NA 3U1TA 3UFXB 4EHFA 1I5RA 3OJOA 4PIPA 1N8KA 3WB1A 5ADUS 2JJ8A 3P2IA 1Q12A 5IT0A 1LU9A 1IVSA 4EW3A 4DV6B 3CZRA 4MDYA 1VIMA 1RYEA 4JBGA 5BWOA 4NXMB 2HN9A 1BGVA 2VJAA 1XU7A 2XH8A 3OPNA 3A8TA 4YK7A 3B7PA 4MWEA 4XFDA 5E6SB 4ZVNA 3FTNA 1ZKMA 2IDKA 2XECA 1U28C 4UM8B 5JJBA 3MIZA 5E0KB 1VB5A 3WMFA 3V1MA 3AETB 1C4KA 1R6DA 4QRHA 5ELLA 3F2IA 1E6EA 1UK9A 3ZJYA 1H93A 3AONB 5AHXA 2OB2A 1ZG3A 3U4AA 3VYUB 5KWSA 3H2IA 3DBVO 4A0FA 3L7MA 1XNRB 1NPYA 1R6BX 1UDXA 3KJFA 1RD4A 2XNCA 4LF9B 2AXNA 5ENZA 3V1UA 3G2NA 3WLIA 1ZJZA 3EQZA 3IO3A 3NATA 5AVVA 4GPZA 2BMJA 1PKXA 3ICWA 4MMZB 1E6CA 3EXHA 2I4RA 1L1EA 2O2SA 3GUHA 4MI9A 1X1QA 3NU1A 5BSKA 3W5SA 2BSQA 2OZKA 4X6LA 2CEKA 5CLHA 2GR9A 3CKLA 3RUPA 2WT4A 4HLQB 2HQBA 2OC4A 2QRPA 1VHQA 2ZRFA 2PZFA 3DZJA 4P5DA 5E6SA 5TVKA 3KFVA 1ZHHA 4X95A 3RV4A 3K72B 3ZC3A 5FA8A 3TQCA 5JR3A 5K01A 4L6AA 1UQTA 3D2BA 4NCNA 1NF9A 4R3NA 4UTPA 1UWCA 2VBIA 4LISA 2B5WA 2IELA 3OCYA 3NC0C 4F0JA 4O4IF 3LY9A 5G41A 4Y2JA 3ZVKA 1XAJA 1RQLA 1FE8A 4RF2A 4IKPA 3WGVA 4BQFA 4DBLE 4M0LA 1UF9A 3DBHB 4OHKA 2R751 4LMBA 2F00A 4BMNA 1S96A 3KM0A 3HHEA 2FSVA 5EZ6B 4X1IB 3KVOA 5I7VA 1QGED 1JWLA 1GEEA 1S3SA 2FG5A 4QUBA 1RADA 4JKIA 4KXQA 2YZKA 4MGIR 3F6EX 3SNKA 3IBSA 1U8TA 1YFKA 1BKYA 2IY9A 4I7EA 5ADHA 1NTRA 2J3QA