1F12A

L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDECVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequestration of the active site by interdomain shifting. Crystallographic and spectroscopic evidence for distinct conformations of L-3-hydroxyacyl-CoA dehydrogenase.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-3-HYDROXYACYL-COA DEHYDROGENASE
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1f12A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1f12A01
1JA9A 2UDPA 1VJTA 2YFQA 5EJ2A 3MZ0A 4J1NA 3WIDA 2AW5A 5CDGA 1Y8QB 4TSKA 3V5NA 1C0IA 2GDZA 1VC2A 4YTEA 4UAGA 3SC6A 4U0KA 3DOOA 2JFFA 1C1DA 4R1NA 4FBGA 1PJQA 3VZSA 1UJMA 1NQTA 4YEDA 3N74A 3CSDA 5JC1A 5LDHA 1OI7A 4Z3KA 1EQ2A 2HKIA 5TC4A 5THKA 5TIIA 3KETA 1X1TA 1IL0A 1Q7GA 3BHJA 1C0KA 4HFJA 2FHSA 3JCZA 5TX7A 4ESOA 3PJDA 5U9CA 4IDEA 3O9ZA 4ZQHA 1PZHA 1QYWA 4JBIA 3COSA 1B26A 1S7CA 3C7CB 4IQGA 4QX6A 5IXYA 4K9DA 1G0OA 3PXXA 1YO6A 4Y9DA 4W7HA 3GH3A 1I3LA 3UCEA 1GYQA 3C3XA 5JAQA 1H6DA 1ZK3A 2AMFA 4LISA 4GI2A 3O26A 5BNIA 3VHRA 1JWBB 2HU2A 1CEQA 3OJEA 5ER9A 1NNUA 3C7AA 4I9HA 4E5NA 3P19A 1PJ3A 1YXMA 4GMFA 5DN9A 4ITUA 2QRJA 2VRCA 4LRSB 4CLXA 3AW9A 1SCUA 2Y0DA 3E18A 1ZIDA 4WNIA 3PZBA 1Y9EA 2DPGA 3AU8A 4PIVA 3IS3A 1C0PA 2C5AA 1G6KA 1ZH8A 3ENKA 3VKVA 3RUFA 4EJ6A 5IFLA 2VWHA 3PGJA 3DBVO 4CM9D 2IEBA 3LT2A 2H6EA 4ND4A 3TJRA 1E7WA 1FMCA 3I83A 4ALNA 3GZNB 5TT0A 1I24A 5A9RA 1MFPA 2DBQA 2R2GA 3V2GA 2YQ4A 4B3IA 3DB2A 3EC7A 3FR8A 4A2CA 3PQEA 4CQMA 5G0VA 1OZAA 3H2SA 1J0XO 1U9JA 1PJ4A 5KKAA 4WEQA 1UXKA 2DT5A 4CUZA 2AEFA 7ADHA 3S2EA 2WD7A 5ICSA 3KO8A 2O4CA 2ZIZA 2JL1A 3NT2A 3GVIA 1N1GA 5GZ6A 5H83A 1N9GA 1V9LA 3WTCA 3LSYA 4ZJUA 1WZIA 3ANMA 1HT0A 3C85A 5KVCA 1G1AA 2VOJA 5KNLA 3L4BA 3NX4A 2QQ5A 2NADA 4HFRA 4RVGA 3R1IA 3RC9A 3RFTA 5I9NA 3U09A 3JQ7A 3LDHA 5I7SA 4RDIA 4JP2A 4MVJE 4BV8A 2V6BA 2YYYA 3ROMA 7MDHA 2WYUA 3HG7A 4WE3A 4U6SA 5EN4A 4BB5A 3MTGA 4PLGA 2HCTA 4BQRA 2OHXA 2NQTA 3Q6IA 1FJHA 3IP3A 5JAIA 3AFNA 2G76A 3AUAA 2Q2WA 2DBVO 2HSDA 2P91A 4YT4A 4GH5A 4FQ8A 5HRUA 4XB2A 2FZEA 2XXBA 2NU8A 4JXKA 1W4ZA 4CMCA 4Q3NA 3GVPA 2ZCUA 4ZVVA 2JD0A 1E1MA 5BR7A 3D4PA 4GGOA 5JNLA 3PJEA 4INAA 4BNZA 1XELA 4YJGA 3OECA 3KZVA 4XDZA 2W98A 2VHVA 3C8MA 4PLTA 1NQAO 3NGLA 1R37A 5BNTA 3LT1A 3OICA 3PEFA 3D3WB 4XQEA 1HE5A 3OBBA 2H9IA 4FFPA 4RPGA 1YB4A 4ID9A 2W2KB 2O3RA 4YPOA 3ZWMA 1LRLA 4F6LA 5J23A 1JLLA 1WXDA 3QP9A 4Q3AA 5TJ9A 1DHRA 4D43A 5IN4A 1D1TA 4LSMA 3MJCA 3AI3A 1N7GA 2DBZA 3G1TA 1IPEA 1HDYA 1I33A 1ZNQO 3FNFA 4ZQFA 2UAGA 5FI5A 3L6EA 4HXYA 2PD6A 1BWSA 3I9MA 4A73A 3UW3A 4KWHA 1BG6A 2IXBA 3JQAB 4J2OA 3ZU5A 3ZHXA 1R0LA 2ILTA 3WFIA 3JQ6A 5BSFA 4R1SA 1T2DA 3LLVA 5KVQA 1N5DA 2GZ2A 2P5UA 4R5HA 1HTBA 3RFVA 3M6IA 4CMGA 4XGIA 1DIGA 4PLFA 1PJ2A 3JSAA 2YHUA 1HSOA 4E33A 3CE6A 2Q4EA 2WJPA 3C7DB 3GRPA 5JDCC 3HDYA 4Y6RA 4DMMA 4EJ0A 1BXZA 1A71A 4H3VA 2J8ZA 5EESA 1GADO 3QA9A 3A28A 2YHIB 4EGFA 3OQBA 1MV8A 4F45A 1QYXA 3JQGA 2OORA 3NAQA 3QVWA 4KDFA 1LDNA 1Y8QA 1ZEMA 1E6EA 1R4MB 4XYEA 2JCXA 4CLRB 2HMWA 1DEHA 3AUSA 2NTJA 1QLJA 5G4KB 1LU9A 3NT5A 4BNKA 2FPIA 2J3KA 3OIGA 3AU9A 4CMKA 1BXGB 1DIBA 3H4VA 3UXYA 4DQXA 4CUKA 1PQWA 5BT9A 3TZ6A 1DO8A 5JPIA 1F0YA 2UVDA 4OSOA 1C14A 1YDEA 4TKMA 4GGPA 1PSDA 1D7OA 2B0JA 4ZRMA 3GUYA 3X2FA 3PIDA 1HETA 3DZFA 4LW8A 3WSVA 1RKXA 1E92A 1T4BA 3Q1LA 3QW2A 5G0SA 4M89A 2QG4A 4NJMB 1CIVA 2E37A 3ZHZA 3LK7A 2Z1NA 4Y67A 1N8KA 5JDIC 1QP8A 3KM0A 4HNGA 3WNQA 1GZ4A 3PK0A 3EZLA 4LMPA 1Y5RA 1H6BA 5B12A 1LLQA 3CMCO 4RPJA 2VRBA 1EBUA 3JV7A 5I8WA 3RC7A 3ICCA 4Y98A 4ND3A 1ZVMA 3JD0A 4Q3EA 2NTVA 3PWZA 2JFHA 4J43A 4CLRA 5I7FA 4YCAA 1YS4A 2AQ8A 3DZJA 1LRKA 1LA2A 4WLEA 2HMVA 1P1KA 4XGKA 1W8DA 1PGPA 1SAYA 1Q1NA 3GA0A 3WGGA 5TT1A 1NASA 3PP8A 4JP3A 4LRTB 3K5PA 4LMRA 4YQZA 5ICMA 4PLPA 4D45A 4A7PA 3L77A 1Y8RB 3E6AA 3EGOA 1U28A 3IUSA 1MLDA 4TRJA 4II3A 1NVMB 1XIVA 4FN4A 3ZNPA 4EUEA 1LNQA 4GX1A 1SEVA 3I6QA 1U2DA 2EKLA 1HYHA 2NLOA 4CQLA 4UVHA 2OUIA 2X1HA 1AXGA 2GCGA 5KOIA 2C2YA 1YONA 3KVOA 2ZYDA 2PY6A 1U8FO 3ZHBA 1VE9A 4X54A 3HDJA 3DMYA 4BKOA 4CV0A 1O8CA 2PZJA 3BZUA 4WKGA 2X0JA 5K6AC 3DBHA 4LK3A 1JKFA 1T2EA 4FC6A 4AJ2A 4IY1A 3WICA 1SZJG 1EQUA 2C59A 3WB9A 1Q7CA 5U4QA 4JCOA 2B4RO 4ONEA 1E3IA 3U4DA 3GFGA 1O94A 1NFFA 1QSGA 2VTDA 1PWXA 4JJIA 5L51A 3NUGA 1HDCA 5FWNA 3JQ8B 2RH4A 3F4LA 3VZPA 4FIZA 1LDMA 2CVQA 3ZWOA 3TFOA 3RI3A 5I9LA 5KVSA 3RU7A 4U8GA 4E0BA 5A9TA 1LSUA 1XEAA 5JCXA 1P1RA 1P45A 3K92A 3ZWWA 4F46A 4PLHA 5AVOA 3IC5A 2J3JA 4B7XA 5EPOA 4PG6A 4MVJP 2E4AA 1DAOA 5FI3A 4M87A 1B8UA 2CDCA 4IINA 4KMSA 5TQVA 4YYZA 3ZNOA 2ZTVA 4PZEA 1LXCA 3RIHA 3ZWPA 2D2IA 3ZWYA 1Q7BA 3ZV4A 2BMAA 3CXRA 5KCZA 1E5LA 1EK5A 4YRBA 3Q9UA 1ZW1A 4NNJA 4D0SA 1TEHA 5JW6A 4IDCA 3CH6A 2VUSA 3ONDA 2BF7A 4BQPA 3ZWVA 4RVFA 5DT9A 2UV8A 5A03A 4J91A 1HZZA 3S1LA 1MG5A 2HO5A 2FPPA 5ENDA 3QSGA 2D8AA 4L73A 1MA0A 3BTVA 4AJ4A 3LYLA 3EY4A 3VZQA 3ADOA 3MWDB 2EGGA 3ROPA 1YJ8A 5DBGA 4AJHA 3Q3CA 3OA2A 1EZ4A 2ZATA 3JQAD 3AOEC 1ZK4A 3MEQA 3E5RA 5JSFA 1RM5A 3K73O 1H0KA 1C3VA 3Q11A 3KTDA 1KVUA 2A9FA 2WYVA 3P2OA 3SC4A 3RU9A 2OP0A 1UDCA 2GSDA 2B37A 2I5PO 4PN3A 3RASA 5G4LA 3QIVA 1E7YA 1YQGA 3V8BA 2DUUA 4J49A 4LCJA 2GERA 3KYDA 3GG9A 1VL8A 5KIAA 2J5RA 2IYOA 1ZUD1 2QW8A 5CFZA 3KSUA 1KEWA 1UP6A 3PZRA 1IYZA 2HLPA 1ZXBA 4TVOA 2Q1TA 4IJUA 3SXPA 4C4OA 4R9RA 1CQIA 2O48X 1ENZA 4KQXA 5FEUA 5F1KA 1GEEA 3TQHA 1UXJA 4IIVA 3OSUA 3FTNA 4NBTA 3D64A 2WE8A 4TRMA 2Q99A 1ONNA 4IUYA 2CMDA 3ETEA 3GEMA 1B7GO 4W9NC 1ADFA 1UAGA 1KVRA 1U4SA 1E3EA 2I67A 4EYEA 3ASVA 4AFNA 3U62A 1HF3A 2AQIA 3WGHA 1LSSA 3LF1A 1LRJA 1I2BA 2X22A 2P9CA 2YV2A 5JYDA 2VNSA 2WMDA 3QVOA 4P4LA 4MKZA 3Q9NA 2QZ9A 3LC2O 3EHEA 3QVXA 3RUCA 3WG9A 3H3FA 4B4UA 4ZD6A 3JQ8A 2ZQZA 3KYDB 3MCVA 5A9SA 1R4NB 4FFRA 1GYRA 1ZK1A 4J1TA 1GFSA 3WBBA 1P1JA 3JQ7B 3I3OA 4BNLA 4CMJA 1I3NA 4KWIA 2JHFA 4TZTA 4DA9A 4I9NA 3GUCA 4DRYA 3VH1A 1SB9A 5IJZA 4Z0TA 1X7HA 4FC7A 4I9UA 1ZMTA 5K6AA 4PG8A 2CF6A 2ZQYA 5CDUA 1PZEA 5IDXA 1IZ9A 2X0IA 1V6AA 3ONEA 3T4EA 3AM3A 3GDOA 2Y1OA 1LSOA 1PR3A 2E82A 3K31A 1ULSA 5DDIP 2OXIA 3WBFA 4CMIB 1NHGA 1Q0LA 3A1NA 1HE2A 3FR7A 2GZ3A 1P0CA 5JFOA 3AFMA 3KEQA 3BHIA 4UULA 1JAYA 1I5RA 4KOAA 3TL2A 2PKQO 3O8QB 2X0NA 5A3VA 3TFQA 4N7RA 1VJ0A 3LVFO 1ZEJA 1OOEA 2P4HX 3ZU2A 3KV3O 5JDCA 4XJTA 4BNXA 2NVUA 3L9XA 1DRUA 3L6OO 4WUVA 5GY7A 4R16A 3WGQA 1M2WA 2I3GA 3L07A 1DFIA 2X8LA 4E32A 1VJ1A 5HS6A 1RM4A 1GEGA 4XYGA 3F46A 1CRWG 1N2SA 1F14A 3GQVA 1BSVA 3CTVA 3UOGA 2Q3EA 3HJAA 3TOXA 3FNHA 1FDSA 2YZ7A 5L53A 4ILKA 1L7DA 4MVJH 4PG7A 1HYGA 5C7LO 3OJ0A 1OC2A 3GMDA 4EZBA 3GMSA 1DC6A 3KYCB 4FJ1A 1ISFA 1V8BA 4CQLB 5JO0A 1OMOA 3T7CA 3ZWCA 3FF4A 4L75A 4U5QA 1GPDG 2BELA 2GR9A 4EUFA 1ZSNA 2QRKA 3SLGA 3BTOA 3QWAA 4DTIA 2CFCA 3U3XA 3DFUA 4M86A 4MINA 1GUFA 1BW9A 1NBOA 3L4SO 3FPCA 2A92A 2E6UX 5BQFA 3K30A 4O0LA 1E77A 2RH8A 3PVZA 4J7UA 1UZLA 3WFJA 3H6KA 4GVXA 3WQQA 3GHYA 2J3IA 1ZJZA 2V65A 1FDUA 3GG2A 1YGYA 2EP5A 3TWOA 4DBZA 5CDSA 1EDOA 3DBRB 1E7SA 1EE9A 4BKRA 4CODB 4KQWA 4MPDA 1YWGO 3ZNNA 5HTOA 3KEOA 1LSJA 2WE7A 3U0BA 4OYRA 4TVBA 5C3MA 5JMPA 1BTOA 1VKNA 3WYCA 4CM1A 1QV7A 1F06A 3AM4A 2VZ9A 3TSCA 1GR0A 1UDBA 2ZTUA 5T67A 2B83A 4BKPA 5IN5A 4JN6B 3ANLA 4NQZA 4B8ZA 3QWBA 4NFHA 3VH3A 2NU9A 4AICA 1Y6JA 1M67A 1DJQA 3OETA 1PGNA 3QWHA 3JQDA 4N5NA 2VYNA 4D0RA 4BOYA 1D1SA 1ISGA 4W99A 1FF9A 4DLBA 1I32A 3RUAA 3RC2A 1ZK0A 2EEZA 1K5HA 1DRVA 2HMTA 2O7SA 3DBLB 3IJPA 4YDRA 1WDKA 2JHGA 2RHCA 1WAMA 3DHEA 4JNKA 3BMOA 4RO0A 4OXYA 4CMAA 3FCOA 1NQ5A 3WMXA 3I1JA 3DZIA 2XOXA 4UEJA 3ZDFA 1A5ZA 3INGA 2O2SA 4PLCA 4YJDA 3VH4A 3KB6A 5ADHA 1WP4A 3IDSA 3CPSA 1T25A 1DLJA 3GNTA 2HK7A 4DPMA 4ALMA 1M75A 3KUXA 4DIBA 1R16A 4XDYA 5KJFA 3RBVA 1IE3A 2Y1EA 4XGNA 3JQFA 5AXDA 1YL6A 1H5QA 3OIFA 5FYDA 5TLSA 4OKIA 3TOZA 2OBNA 1XYGA 3VDQA 4BGEA 3DZHA 3NEPX 3GNQA 3I5MA 3OHSX 3PDJA 1EVJA 4H16A 2EWMA 3HFGA 1Y8RA 1RYDA 3GAFA 5CPBA 2I99A 1BGVA 3M1AA 5CDYA 2DC1A 2FWMX 1KVQA 2IRWA 2JD2A 3BMNA 2C29D 3FNEA 3H7AA 1EFKA 2V6FA 2FN7A 1D4FA 3G49A 1PL7A 3TZHA 2ZJ1A 1ZSVA 3F3SA 4FOSA 4A03A 3NJ4A 1WPQA 3Q0EA 5IDQA 1I3KA 3FTPA 4PLVA 3AJRA 5T64A 4BUCA 4ZQBA 2NM0A 3H9UA 1VM6A 2CUKA 3QVSA 5COAA 1E3WA 1UP7A 3NTOA 5A9SB 1R4NA 2X9VA 4TKLA 4WNCA 2YV1A 3DC2A 4RF2A 4BO8A 3JYPA 4EITA 2GO1A 1HDXA 2BD0A 2I6TA 1HEUA 3PHLA 3WWYA 4UVDA 2GNAA 4JQCA 1W73A 4JLWA 5G2OA 3F9IA 2GLXA 2YY7A 4PCVA 2FR1A 2O3QA 4B4OA 4MIYA 3FRJA 1XHLA 4O63O 4AJNA 4WGGA 1CWUA 4XIJA 4PLWA 4BNTA 3GVCA 3I9NA 2G0TA 3GVHA 4DIOA 4PG5A 1NWCA 1WMAA 3GK3A 5F21A 4P4GA 2FSVA 2O7QA 4PZCA 4IS2A 2IE0A 2PTGA 4R4JA 5F3RA 2F00A 1DIRA 1HDOA 1BVUA 3K9QO 2PLAA 3WNVA 4UREA 3GPIA 2GUGA 1LLDA 1KEPA 3MJSA 4XJSA 4B3JA 2Z1MA 4BV9A 3HFSA 3NDIA 4BGVA 3B1JA 2VHXA 3W8FA 1DSSG 4GKBA 1NAIA 5ER6A 2Y1GA 3D5TA 3DZKA 2QYTA 4B4WA 3DWFA 1X1EA 4EEXA 2D5CA 4Q39A 4CM6A 2X5JO 1X7DA 1KY5A 2EXXA 3PDUA 3N7UA 4NJOA 4E2XA 1DAPA 1RJWA 4OOFA 4J6FA 3DEYX 1GU7A 2P5YA 1FDWA 4MOWA 3PWKA 1U7HA 1XR3A 4GKVA 4DXHA 4PRLA 3I4FA 4BGIA 2PGJA 3AUUA 4WOKA 4CM4A 2P9GA 5KJCA 4ND2A 4GQAA 4NU5A 2DFVA 3BMOB 4JROA 1W0CA 1LBEA 4RL6A 3GZNA 3E82A 3VDRA 1DIHA 4ROSA 1VSUA 3H9JA 1DBVO 2ZYAA 3RCBA 1ENOA 4FPXA 1OC4A 2Q1WA 3UCFA 2WD7B 3R3JA 2E48A 4XYMA 2FMUA 1XDWA 1E1KA 1E7RA 1ORRA 1A7AA 1O9BA 4GBJA 3FHLA 1JVBA 2B4TO 1UAYA 3NTRA 5B4VA 5L3ZA 2BHLA 2XXJA 4NH4A 4YBZA 4K28A 1SC6A 5HWSA 3RVDA 4WCFB 5B4UA 1ISIA 3EYWA 3JD3A 4M55A 5HM8A 5TRTA 3ZW9A 3JYOA 1B8VA 2VWGA 3OMLA 1ISJA 3C1OA 2GN9A 1EUDA 1ENYA 3UAGA 4DGSA 1SEPA 5JDIA 1LDYA 4OSPA 3S2GA 1FDTA 4RQUA 3W4KA 4GL4A 3DMTC 3LT4A 3ADPA 2VT2A 2VUUA 1F8FA 4DIFA 4P22A 2AHRA 3WLEA 4UUNA 3CKYA 4NDNE 5L45A 3PRJA 4YAEA 5AQ1A 2JJYA 5AXCA 4D3FA 4J7CA 1A4IA 2EW8A 4J4TA 3F6YA 4UUMA 1X0VA 1P1HA 1PJBA 2EF1A 3O03A 4MVJG 4WLOA 3DHNA 4AJJA 4MKRA 1E3LA 1NHWA 4Q9NA 4Q3BA 2BI8A 1NP3A 3GOHA 3OQ6A 3JD2A 2X86A 5A06A 3V2UA 4GLLA 4IDDA 3ZI0A 4MDHA 4XCVA 3D4OA 2ZJ0A 4E2WA 1NPDA 2CVZA 1EEHA 3D0OA 4MVJM 1NX6A 4UVEA 2PD3A 5B1YA 1C0LA 3OA0A 3VPXA 1GPJA 3GRKA 5A3JA 3PQDA 2OMEA 4OOEA 3KXDA 1Q2XA 4D3SA 1XA0A 2AQKA 2PD4A 2WDZA 2G17A 4IDGA 3TDKA 3WX0A 4BIIA 5L4SA 3IMFA 3RBZA 2GF2A 3OF2A 4BMNA 3UFXA 1NQOA 2G82A 2D1YA 3PYMA 5AXAA 4YJFB 1BXKA 2UUOA 1U4OA 1PS0A 1DC4A 4RF4A 4NBVA 2BGLA 4E5KA 1TT5B 3RSHA 2O3SA 1WW8A 3E8XA 9LDTA 2PH3A 2JD1A 2QRLA 3PFWO 2GN8A 1DPGA 4E13A 1ENPA 1XU9A 5I8ZA 4W9NA 3GZ4A 1M6WA 4FFNA 5JBIA 4O59O 5L9AA 3DAPA 3FD8A 3EAGA 2BFAA 5ITVA 2EJVA 2C0CA 1V3TA 4OL9A 3DOJA 2DTXA 2C5EA 4GX0A 3IOYA 2Z95A 1MXFA 2PKRA 1Z7EA 1ZZEA 5H81A 2X7HA 1T24A 1QYDA 4PGFA 3ITDA 2Y0CA 4YA6A 3GVXA 2VUTA 1ISMA 3FBGA 4NU6A 1EVYA 3EZYA 3ZN2A 2DTEA 2O4UX 4XRRA 1DXYA 1AHHA 3JQ9C 3UICA 4FGWA 3H5RA 4B3HA 4YAJA 1AHIA 1D3AA 2EKPA 5EMHA 3E1KA 2JAHA 4BO4A 3H9GA 1YBVA 3GPDG 2IODA 1I0ZA 4I5GA 5BNFA 4CQMD 1T2AA 4CM4B 1O89A 1P74A 1RWBA 4FFLA 5DBFA 5DULA 2CY0A 2GRAA 4IXTA 1JKJA 1YQDA 3QQPA 2EKQA 4XYBA 5AOVA 1Z6ZA 4IGEA 4AJIA 4R51A 3VKUA 4GSLA 3KRTA 4MKXA 3TL3A 1MFZA 3MOIA 1WZEA 3TPCA 3FSRA 3Q2KA 4L9RA 3DQPA 4NIMA 5ILGA 4CV3A 3KBOA 1YBAA 2DFDA 1R12A 3HB5X 4IMRA 1Z74A 3GT0A 1EK6A 3E9QA 4IDFA 2VRCD 4ALIA 1HSZA 4YAGA 1X15A 3F4BA 2D59A 2IXAA 4NBWA 1QKIA 4L4XA 5DF1A 1QORA 4BB6A 3DO5A 4YJHB 5IZ4A 3LQFA 1NPYA 1RPNA 2AG8A 5F1PA 2W8ZA 1Z45A 5F5LA 3S55A 3GF4A 3GNSA 2P68A 3P2YA 3I9OA 4HFNA 1TI7A 4RLSA 3DZGA 4IQ0A 3VAZA 1JTVA 2H5LA 4OQYA 5ENVA 4L0QA 3UCXA 2C07A 4KTVE 1KVTA 3RBXA 3U49A 4CM8B 1JDJA 4UEKA 4PZDA 3P5SA 4N54A 3SLKA 3ZWNA 2WEKA 3VZRA 1DB3A 3RKUA 2CD9A 3LC1O 4DREA 1OFGA 3PWSA 2G5CA 4A10A 4BNMA 1R0KA 4RQTA 5IF3A 3B6ZA 3N58A 4D41A 1NFQA 1O6ZA 2VTEA 1YVEI 1H94A 5ES3A 1JVSA 1K89A 1EVZA 5L7WA 4IS3A 2DLDA 5CHEA 5BSHA 1XSEA 4IPTA 4CL3A 4EW6A 2GYYA 4PVDA 4UUPA 2Q2QA 1WDLA 3W1VA 1ZXLA 1XWFA 4R3WA 3DBRA 1PJLA 1QLHA 1W6UA 3PI7A 4P38A 1BHSA 4KUGA 2W2LA 4NK5A 1UP4A 1K6IA 4Y6PA 3PYXA 4BNWA 1YOVB 1NTOA 4HBGA 4E12A 1E3WB 4YVFA 5LC1A 3V1YA 4L8VA 2QIOA 4E4YA 2XAAA 2Q1SA 3H8VA 3U4IA 1V35A 4HFMA 4H7PA 5JS6A 4R1UA 1KOLA 2JKVA 5DOVA 1V3VA 3OJLA 3H5AA 3JYLA 1DC3A 2C7GA 4MVJI 4BNHA 5C7IO 2EHDA 4J7XA 1SMKA 3H3JA 3WR5A 1AUPA 1C1XA 2GPTA 4RCVA 5KWEA 1GCOA 4FOOA 1M66A 3G0OA 1YBMA 3VPHA 4IGFA 4PVCA 3DAFA 5TF4A 2X23A 1LDEA 4W6ZA 1YH3A 2DUWA 1E1NA 3OJOA 4UVIA 3WXBA 3MOGA 4QFDA 5COQA 4FSHA 4L74A 2BFPA 1ZK2A 1GL3A 4RF5A 4GX5A 2O2YA 4K1LA 4YWJA 3S2FA 5JY1A 1TVEA 4ND5A 4J16A 4RORA 1GDHA 3T7EA 1XQ6A 1MC4A 2IZZA 5F5NA 3I9KA 1X14A 2B36A 2J5KA 2LDXA 1IY8A 3ZCXA 2I3AA 1XU7A 3BIOA 1PGJA 2X0RA 4N5LA 1X0XA 4OQZA 3IAHA 1GCUA 2GASA 2ZYGA 5G0UA 2IZ1A 4FDAA 1ARZA 3WSWA 4FJ2A 3RUDA 3IKTA 4R01A 1NYTA 4GSKA 4CLOB 1LI4A 2VYND 3M1LA 2CNBA 4E2ZA 2NSDA 1PL6A 4XR9A 3W4IA 1LLUA 4DLAA 4OKNA 4WECA 2EERA 4OIMA 4OMUA 1K2WA 3PHGA 4YXFA 3ROKA 3NT4A 1DRWA 1CYDA 2P2SA 2PZMA 3UN1A 4CL8A 1X13A 2TMDA 3IP1A 2PWZA 4RZIA 3SX2A 4CR7A 5I7VA 1Z73A 2HDHA 4XWYA 1WMBA 1HXHA 5GZ3A 4IDAA 1A7KA 3R6DA 1NM5A 1MGOA 3WTBA 5KVVA 5KTKA 1M76A 5A05A 1YL5A 3NGXA 5T8KA 4B8WA 2WWRA 3WQRA 3SVTA 1S6YA 4UEOA 4B79A 1KERA 4E3ZA 1C1XB 3UF0A 3TRIA 2GN6A 1KS9A 4XD2A 4XA8A 2O3TA 1YDWA 2OOSA 4R1TA 2Q49A 3HB4X 2VHZA 2WTBA 2P9EA 5A1TA 2GZ1A 1EDZA 5DCWA 3TF5A 2NTNA 2GGSA 2POQX 2Y0EA 4AJPA 3H65A 3OJFA 1NVTA 2I65A 4C7JA 1RM0A 1H6CA 3IKVA 5CG1A 4J3FA 4TZKA 4BKQA 1PQPA 5GMOA 2HQ1A 3ASUA 1UUFA 1Y1PA 1KEVA 2V6GA 1ZJYA 3JD4A 4IQ8A 4NI5A 3OP4A 1P0FA 3AOGA 3FWNA 2VN8A 4D42A 4YR9A 1U1IA 4XQGA 4PFJA 3U9LA 4RGBA 1B14A 1YQXA 1P33A 2ZTLA 2PK3A 3QWFA 4J4HA 4CLHA 3KSZO 2JCYA 1ONPA 2EG9A 3G79A 3DXFA 2RCYA 1LC3A 3OEWA 5T6BA 2W2LD 4GPD1 4O1MA 2V7PA 3WLFA 1F17A 1KETA 5EIOA 4J0FA 3VTZA 4QEDA 3W8EA 4BNFA 4DC0A 4I1IA 4FB5A 3HADA 2F1KA 2WM3A 3FWZA 4YAIA 2BGKA 2HUNA 4GVLA 1M6HA 4MIEA 4IJKA 4WCDA 2HRZA 4CMEA 1E3JA 3K6JA 3MJ4A 1ZBQA 3DHYA 3GN1A 3KSDO 4CMIA 2YQ5A 4L76A 1LC0A 3K96A 3NYWA 4ZA2A 1TT5A 2NNLD 3IUPA 1HE3A 1GQYA 2X6TA 4CLDA 1HYEA 1I01A 1QYCA 1X7GA 2GD1O 4ZHSA 2PH5A 1N9GB 1OBFO 4BMSA 2NU7A 1D8AA 4Y8VA 4YT5A 4B7UA 1T26A 1RM3A 1JAXA 1YE3A 1H93A 4NHEA 2XPCA 4GAEA 3EK2A 3MTJA 3V1UA 2IDZA 3INRA 1L7EA 3NDRA 3WDSA 2ZB8A 1NAHA 3RJ9A 1JWAB 2CDAA 3ZWBA 4EI2A 3M2TA 4IZHA 1F12A 4DYDA 1KC3A 4Z9YA 3F5SA 2ZTMA 1P31A 1JKIA 4EBFA 1K6JA 3RUIA 4I5FA 3I9LA 4WLNA 5JO9A 5C7OO 3SJ7A 3WGOA 2W90A 4MVJD 2CF5A 2NQ8A 2RAFA 1TXGA 3ZU4A 5JC8A 5DCUA 4CQMB 1OAAA 3IQDB 4LVUA 3NV9A 2H63A 1C1DB 2NVWA 4UUOA 4AJKA 3ZNQA 5JMWA 9LDBA 5FFFA 5HBRA 3A06A 2RBEA 4FW8A 3UH1A 3ONFA 4YB8A 2X58A 3CZMA 4BO1A 4XR4A 1QRRA 3FBTA 4OH1A 1DOHA 3E9MA 2BKAA 1T2CA 1DJNA 5L7TA 1WVGA 4J0EA 1WLYA 3VTFA 3GEDA 1IB6A 4PRKA 2C54A 2D4AA 1SOWA 4M49A 2BRUA 1JN0A 5JYEA 3CUKA 2B69A 4CPDA 3DR3A 1O0SA 4CR6A 4RPKA 1KIFA 2O3JA 5A5FA 4BNIA 1EE2A 5JLAA 1E1LA 3QY9A 5GZ1A 3L0DA 4E31A 4U7WA 2FR8A 3G17A 2X5KO 1GV0A 3GY0A 5A02A 4CMBA 2CSUA 3VOSA 3PLNA 2QYSA 1P1IA 2AE2A 4TRNA 4F6CA 4NMHA 2HMUA 2Q1UA 3QLJA 4J9UE 1CQJA 3SJUA 3VPSA 3UUWA 4KTTE 1J4AA 4YRAA 4MVJF 1GUZA 1F8GA 1E3SA 3AI1A 1LEHA 3JTMA 1VSVA 4O5OA 4ZRNA 4JX8A 4R5MA 4II2A 2BLLA 1PX0A 1BDBA 1LDGA 2IZ0A 3L9WA 3MWEB 1TB4A 1ZCJA 1J6UA 1FXSA 3AY6A 1YRLA 2NU6A 4TWRA 4CM9A 1CERA 4BL5A 3AUTA 4J2HA 3ABIA 5A04A 4XQCA 1CETA 2PZLA 4CV1A 3PHHA 2AEJA 2VT3A 4XQ9A 4CMHA 2PZKA 4JIGA 1IULA 4Q3DA 5L4NA 2B4QA 4HNHA 3D5QA 2TMGA 2Y99A 3ZWXA 2Y05A 1KC1A 2HMSA 5CEJA 8ADHA 3WGIA 4M1QA 1B2LA 2G1UA 2OO5A 1DLIA 4Z0HO 1P9LA 3HWRA 2EGHA 1R15A 1PWZA 3ON5A 4OXNA 4QTZA 4NJMA 4AG3A 4CM5A 3IL2A 1T1SA 3AY3A 4CLEA 3IIEA 3R0IA 1HDRA 2C82A 4CM7A 1AGNA 3PQFA 1B16A 4JGBA 2PGLA 4RZHA 2FPGA 3D4NA 3VPFA 3WYBA 3EW7A 3DOCA 1Y7TA 3KHUA 4XX0A 5TS3A 1LQTA 1E6WA 3HUDA 4HKTA 4ND1A 3AOEA 4RV9A 5EINA 3JYNA 1TA4A 3FPLA 1PZGA 4OXKA 1WWKA 1IHYA 3A9WA 3BMNB 5IZCC 3DBLA 1R4MA 4BO6A 3K2BA 3RD5A 2X4GA 2O23A 1H2HA 1DHTA 4G65A 3JQGB 3L6DA 2JAPA 2PFGA 4A0SA 1ADCA 2BI7A 3UVEA 1DC5A 1HLPA 1HWYA 1R66A 1U7TA 3WJ7A 3TZCA 4TRRA 4ZQGA 4BHTA 3RKRA 3QWIA 4QXMA 1O95A 6LDHA 3O4RA 3BTUA 2D3TA 1U5CA 4XB1A 3ANNA 4W82A 3V2HA 2CDBA 3W6ZA 4ZN6A 1GTMA 4Z9FA 2JFGA 2ZB3A 3WYEA 3JQBC 1EVIA 1PL8A 2ZB7A 3ITKA 2NUAA 3GR6A 1U8XX 2NWQA 4IIUA 1E5QA 6ADHA 2C20A 1UR5A 5CDTA 4W7IA 1I8TA 4QO8A 5K0ZA 2VWPA 2Y1CA 4TMFA 4E2YA 4G5HA 1LDBA 2EW2A 2YJZA 1Y9AA 1GYPA 4A27A 3VC7A 2FP4A 5CPFA 4OM8A 2D0IA 3HNPA 1T1RA 2NV6A 1JQBA 2HRBA 5L95A 1GY8A 3A14A 3BMQB 3CINA 4ALJA 1L1FA 2AA3A 3OFSA 1KYQA 4WLUA 2UUPA 4GWGA 4DLLA 3JD1A 4DPKA 2OP1A 4BGUA 4H15A 1G0NA 5JXWA 3ZGYA 4NZ9A 4D7AA 4GLOA 3STHA 2X5OA 1EFLA 3GHHA 3RUEA 4I5EA 5COBA 4QO7A 3RQSA 4NR0A 2YDXA 4R3NA 4BMVA 4EDFA 3WS7A 1A9ZA 1U5AA 2B5WA 3BHMA 4YT2A 3GDGA 1QG6A 2ZCVA 4BNVA 4MO2A 4AJLA 5G4KA 4RVSA 1U2GA 4MJLA 4QUKA 5KJ6A 1ADBA 4R69A 5T5QA 4AJOA 3OH8A 5B4TA 1IUKA 2PNFA 3PYLA 4FFMA 4BO7A 1UZMA 1GV1A 3UGKA 1Q0HA 4BNJA 3L4BC 1UH5A 4LSWA 2HAEA 3ETGA 3T4XA 2A35A 4E30A 1K6XA 4URFA 2PV7A 3WGTA 3OQ1A 2W4QA 5L7YA 1BXGA 1HDGO 1UDAA 3LC7O 1LQUA 3W8DA 1PJCA 5L4LA 1VLLA 3M2PA 3ULKA 1PGOA 2BGMA 1PU2A 3HDQA 1U3UA 1H6AA 5K9ZA 1WDMA 4UVGA 3F47A 3VH2A 3DL2A 1B3RA 4ZGWA 4R68A 1BRMA 3SEFA 3B20A 2CZCA 3JYQA 4IJWA 2VZ8A 5CEEA 5CG2A 2AG5A 5IG2A 1VRWA 3LU1A 1QXSA 2VCYA 4Y6SA 1SBYA 1MP0A 2AE1A 5T8KC 1PIWA 4YT8A 4F3YA 1O5IA 3UHAA 1BW9B 1LJ8A 3AM5A 3D1LA 1ONOA 4XIYA 3DTTA 2DVMA 4MP3A 5DP1A 5LCXA 3H9QA 4WPGA 1DIAA 2AQHA 4LN1A 4OHUA 3QVTA 2HJSA 4OAQA 4B7CA 3JQEA 3GGGA 4DBVO 4E5MA 1ML3A 5IAAA 4BNNA 1A72A 4CV2A 1U3TA 4GMGA 5CAEA 4BO2A 2H1SA 3AWDA 1B8PA 4OO3A 3RAJA 3DFZA 5IXSA 2DKNA 4LVCA 3PJFA 5I9MA 3EVTA 1AN9A 3NKLA 2EV9A 1H2BA 3O8QA 2YFHA 1GD1O 2I66A 3QJ5A 3WIEA 4FD3A 4DMLA 1JU9A 4R41A 4EEZA 3PJGA 3RWBA 2Q46A 1HE4A 2FSSA 4Z0PA 4RPLA 4AJEA 1UXIA 4WLVA 2JCVA 1RYEA 4G2NA 2J3HA 2Y93A 5CP8A 4NFYA 3HZZA 1YL7A 3ZHYA 3DMTA 5CEFA 1E6UA 1GZ6A 4K26A 4Q3CA 2FOIA 4HX5A 4YQYA 2R00C 4CR8A 3WGYA 4JBHA 4K6CA 1MB4A 2RIRA 4YJGB 4EUHA 3HHPA 3ZZNA 1HKUA 1SPXA 4KZPA 3BMCB 3LLSA 4NK4A 3CZRA 1GQQA 4CJXA 3HN2A 1PEDA 2O3UA 2OGUA 1VI2A 1R6DA 3CEAA 4BO5A 4E5YA 3RFXA 2I9PA 2HJRA 1YJQA 2OBYA 3C1TA 1YB5A 4QQRA 4DVJA 8LDHA 4WJZA 5A4DA 3WOHA 2PGDA 3EMKA 3DONA 4M54A 1B3BA 3C1AA 3VVCA 3PTZA 1Y5MA 5JCJD 5JY6A 4DQVA 4S1VA 3V1TC 3UKOA 1HDZA 2EJWA 4IXWA 4BO0A 2A4KA 3HQ4O 2VYVD 3R3SA 2P4QA 1LTHR 1HZJA 3E5MA 5IDWA 1EMDA 2NVUB 4BO3A 4BVAA 5EL0A 3U4HA 5AXBA 5AYVA 2DAPA 4WK6A 1NR1A 2DTDA 3ORFA 3ZH2A 5THQA 1VL0A 4EJMA 4WOJA 4MP6A 1XGKA 1CDOA 2C7VA 3D3EA 3QV1A 1K0UA 2QX7A 4HY3A 2VNAA 4WEOA 1MC5A 4DUPA 1BDMA 2Q45A 3H5NA 3ZV5A 3ZU3A 1SO8A 3HE3A 1Z82A 4QFCA 1Z7BA 3GAZA 1BMDA 5DNAA 2VOEA 3ICPA 2DPHA 1NXQA 5A5EA 5EERA 4WCFC 5JAMA 2R6JA 3A4VA 4J4BA 1FDVA 4G81A 2AEMA 3CIFA 4XEHA 4TROA 3EVNA 3GDFA 3ST7A 4YRDA 5DCYA 4RF3A 1I2ZA 1EBFA 1HRDA 4DPLA 1U3VA 2DM6A 2PA3A 3EUWA 5JCJA 3WQSB 1KY4A 4YACA 5G0TA 4I8XA 3ENNA 3B70A 4E21A 3VVBA 4DQUA 1BVRA 4KUEA 4KDEA 4PLZA 1VPDA 3B1FA 2Y1FA 1E7QA 1I3MA 4J90A 2QZZA 2FY8A 3K8ZA 1YB1A 2Y68A 2SCUA 5TSDA 3G3EA 4RVUA 4I5DA 1KVSA 4C7KA 5BSGA 2DQ4A 1CF2O 1MX3A 2VYVA 1E0DA 1GQ2A 2BFMA 1K3TA 2Z5LA 3MJEA 3NRCA 3WMWA 4NG5A 4J1QA 5EQFA 4KUHA 3QHAA 3D7LA 3NDJA 4HWKA 3KLMX 4HUJA 1KBZA 4BNYA 1T2FA 3DDNA 3K2EA 5MGBA 2FRDA 4NBUA 3LZ6A 3HDHA 1T4DA 4FFOA 1ADGA 3JQBA 3TZKA 4DWVA 2O50A 4D46A 3GEGA 3P7MA 3WGZA 2ET6A 4FS3A 3DAGA 3JQ9A 3BYZA 3TNLA 3BAZA 3H2ZA 1GZ3A 1QYVA 1H9BA 1V3UA 2Q2VA 5EQDA 4AVYA 3PPIA 4J9VA 1B0AA 1J5PA 2J5QA 2OL4A 5C37A 1VKOA 1AE1A 1PTJA 5TNXA 2Y1DA 1SB8A 2J6IA 5DBIA 1ISHA 3PFFA 1FK8A 4YAKA 1CJCA 3OEYA 4Z3DA 4FR5A 3GGOA 2WYWA 4WCFA 5T57A 1NVGA 4HP8A 3JQFC 2DU8A 3W4JA 3PLRA 4WLFA 1I36A 2HK8A 4RDHA 3RJ5A 4L4SA 4XKJA 3X2EA 3E03A 1N7HA 1UXHA 1B15A 2R00A 2C2XA 4CMEC 1EUCA 3FN4A 3WJAA 1E7MA 3PGXA 3AK4A 4IM7A 3H9EO 4NFSA 1AXEA 4P4NA 2B5VA 3O38A 5I7EA 2VHYA 3ZW8A 2Y67A 2PKQP 3I6IA 1TT7A 4HV4A 3DBHB 3PHIA 2V6MA 4A5OA 1GAEO 4TQGA 2AXQA 2HK9A 1JW9B 3I52A 4E5PA 2YV3A 3GN2A 4BKUA 1U3WA 3ETDA 1HL3A 1KEUA 4AL4A 1DDOA 1XQ1A 2CVOA 4O6VA 1NFRA 1XG5A 5KJEA 4QSMA 1LX6A 3S8MA 4S3MA 5HS4A 1ULUA 3KLPX 2Q4BA 3HSKA 3E48A 3LT0A 1DFHA 1IOLA 4U0JA 3CTMA 4NBRA 5HA5A 2IYPA 1I10A 2D5AA 1PJTA 5JAZA 3NTQA 1LLCA 2EP7A 1J49A 1VL6A 3BMCA 3NJ8A 4N18A 2QHXA 4XZ3A 4Z9XA 2YW9A 4JBGA 3PHJA 4K6FA 4A26A 5BSEA 3BA1A 5DZSA 3RUHA 5G0WA 3DTYA 5IDYA 3ZV6A 1PS9A 1DFGA 3FI9A 3PIIA 3TZQA 1NPTO 4I08A 3Q2IA 4IDBA 5U1PA 2OFPA 1IPFA 4R9SA 1QMGA 3FNGA 5IZCA 1PS8A 5LDGA 1Q0QA 3F5QA 4M8SA 4CLOA 4ZQEA 4PLYA 4D79A 3BTSA 3INTA 2YHIA 2LDBA 5DOZA 1ID1A 5KKCA 2IEDA 1HLDA 4ALKA 3SBOA 3I23A 4N5MA 1NWHA 4RLHA 2GN4A 1PGQA 4IBOA 1ZFNA 4PG4A 3AY7A 3BXXA 1P77A 4IMPA 3EDMA 1MXHA 4P8RA 1PZFA 4B4VA 2EIHA 4D44A 2X9NA 1MUUA 4XYLA 1XKQA 3MJVA 4YJHA 4R54A 4OJNA 4CM8A 3OIDA 3GC6A 2BH9A 1ZKMA 3GFBA 3QRWA 4RVDA 2Y66A 1LUAA 1TLTA 2NVBA 3WWZA 2A94A 2PR2A 4QT0A 3TN7A 5TGDA 4CM3A 5C5IA 2VQ3A 5TJHA 3OM9A 2I76A 5FF9A 1GUYA 2VWQA 4OGWA 5ILOA 2ZB4A 3S2IA 2OZPA 3AI2A 4QECA 4RVHA 4WASA 4CUJA 1PQUA 1SOVA 1R0SA 1ZMOA 4GX2A 1Z75A 4FJ0A 4DC1A 1P44A 4MVJA 2Q50A 4W4TA 3VPGA 3LF2A 4RJTA 3W6UA 1UZNA 1UXGA 2E49A 1YOVA 5B37A 2VHWA 3HN7A 4MP8A 3E9NA 3F1LA 4ZICA 4ZU3A 4FGSA 3C24A 1YKFA 3DZBA 3KYBA 4ALLA 2XF8A 1XLTA 4DL9A 2BFOA 1PJSA 4KP7A 2WSBA 1WNTA 5DP2A 3GLQA 4D3DA 2ZKLA 2NACA 4RPHA 3RROA 5JE8A 2YDYA 1N92A 4DYVA 3GGPA 2UYYA 1IZ0A 3I4CA 4XRGA 5MDHA 1IHXA 3F1KA 5ITWA 1PR9A 3JQAA 1XCBA 3QE3A 4J1SA 4HADA 4JJFA 4JJGA 4LGVA 1I2CA 4MIOA 4BNUA 1H9AA 1NR7A 4AJ1A 1EUZA 1V0JA 2B35A 5F1OA 1QV6A 1QR6A 2FR0A 2YUTA 3BMQA 2W2KA 4BO9A 1SNYA 3KYCA 3ZWAA 3ROQA 3U4CA 1N1EA 2DBRA 1A4UA 4E6PA 1A9YA 5L40A 2X9GA 3B1KA 3G1UA 4JK3A 3KOUA 3MJTA 4Z6KA 4U6QA 3I9JA 2WD8A 3D3WA 3RC1A 4BS9A 4IZIA 5H82A 1ZSYA 3IJRA 4NPCA 1MG0A 1P1FA 2RHRA 2FZWA 4IJVA 4LCEA 1ZO8A 3U5TA 3ZV3A 1I30A 2VZ0A 4GWKA 5KJ1A 4L4RA 1A27A 1P3DA 2ZK7A 3CMMA 4FCCA 4BNGA 4YJFA 3JQCA 1Y81A
chains in the Genus database with same CATH superfamily
1E64A 2O1EA 4TV9A 3WP0A 2YFQA 2PXXA 3MJDA 3UTDA 3WGKA 2OD2A 3MZ0A 4J1NA 5EJ2A 2AW5A 2A57A 1XEFA 3WIDA 1LCIA 3H18A 5FR1A 1J1ZA 5CDGA 1ZPDA 4K9MA 4URZR 1YMQA 3D4BA 3OT1A 2Q5LA 4YTEA 3ILYA 4QNMA 1C1DA 4P36A 4GU5A 3H87A 4HEA1 4FBGA 3A1WA 3NWPA 1PJQA 3VZSA 1NQTA 1XZCA 1DADA 1OBOA 1DJMA 3CSDA 2YZKA 1GGFA 2DT8A 4W6QA 3W5SA 4Z3KA 1EQ2A 1QYRA 2HX1A 5TC4A 5THKA 2E5WA 1RYNA 4HDMA 1IL0A 4QYSA 5LLDA 2ZROA 1V8PA 1VBFA 2FX2A 4RJLA 1W4BA 2ZREA 3VKWA 3PJRA 2OVBA 1FUKA 1Z36A 2B2CA 2HTEA 4IDEA 1AOXA 3VR1A 3UA4A 4H7JA 1E0SA 3COSA 1S7CA 3R0XA 1WUJS 4FILA 1S02A 4QX6A 2XLCA 5TEWA 1KTIA 5IXYA 3NFRA 1G0OA 1RJGA 4Y9DA 4W7HA 1B6TA 3IE0A 1ZVJA 2JEOA 1AK9A 4TKUA 3H1EA 4BDSA 1XRQA 4DDMA 2JKZA 1YACA 1POWA 2AMFA 4ODIA 4ZHQF 3KQQA 4B45A 3VHRA 4MR9B 3EGCA 1CEQA 3Q2OA 5ER9A 2IELA 2VPWA 3HCAA 4J0DA 4E5NA 3P19A 1PJ3A 1XRRA 1BE8A 4GMFA 1KXZA 1A5BB 3DDOA 4QYWA 4Q7JB 1G3UA 3STYA 1UKZA 1QAQA 2R6GA 2VPZA 3O4VA 3O8OB 1PKEA 1SCUA 3E18A 2ZYUX 4WNIA 3T1NA 2O7VA 4I3FA 4PIVA 3IS3A 2IHKA 5HIAA 3WYAA 4LDQA 1CQZA 2I34A 3TLEA 1E1YA 4RFSA 3OKFA 4FZRA 4DGQA 8ATCA 5C53B 3PGJA 1EX9A 4CKCA 2NO6A 3NYIA 3KTAB 1ZOOA 4QRHA 4ND4A 5F3WB 2QRHA 3I83A 3ET4A 3KWJA 2RGYA 4MS3A 1I24A 1C3EA 2R2GA 2D0OB 3BGVA 4QREA 4YJ2F 1OX4B 4FHZA 4A2CA 5LB4A 1C4XA 4C2BA 1V9SA 5CLIA 3D6VA 4KLZA 3WL3A 4N8EA 4D1YA 2QZSA 4NBLA 4FD2A 4ZEXA 1A9QA 1PJ4A 4QM7A 1H2XA 4HGPA 1E94E 1UXKA 4WEQA 4CUZA 1TYEB 4Q7EA 4B6OA 2IYTA 4IHJF 3FOBA 3Q15C 3S2EA 5ICSA 2ZZMA 3A27A 2ZIZA 4GOJA 2AMVA 5FA5A 4JLNA 1SOMA 2I2XB 3FHJA 2XV1A 1N9GA 5ESWA 3WTCA 2MIIA 5CTJA 3WMRA 1D2RA 1WZIA 3GMTA 3M6MD 5KVCA 1G1AA 5LQRA 3L5KA 1K8YB 2NADA 3RC9A 1P5JA 3LBYA 1RI5A 1B8OA 3UAXA 3RW9A 2E18A 2W2QA 4RDIA 5B2EA 4CTMA 3ISVA 4QVIA 2UZ1B 4HNVA 4WACA 3QYPA 1UJ6A 4OQLA 2M6RA 3ROMA 5EN4A 3HG7A 4U6SA 2HLHA 2HZ7A 4ID3A 1FTSA 1WQ1R 5KNDD 4LRWA 4IJ5A 3QBTA 3MTGA 3H1BA 1SUBA 4WHMA 2DZDA 1MC8A 4KQKA 1K7XB 4BE9A 4BQRA 4FI3C 3Q6IA 1FJHA 5JAIA 3CSUA 1C30B 2JFPA 1X42A 5IVDA 2P91A 1EFDN 4DV4B 5HRUA 1E1CA 1J2RA 5D1NA 5E95A 1D2MA 4JXKA 3GVPA 1M34B 2FA9A 3C6MA 1GHTA 2JD0A 2VR1A 5H3CA 4BASA 1FQKA 4DBLE 1MOQA 1FNSA 5EHIA 3N86A 5E2BA 3E9RA 1SRRA 3KZVA 5KHLB 3R6GA 5IK2A 2Q7DA 3BSYA 3C8MA 1USGA 5DLEA 5IH7A 4OHXA 3FVTA 3PTLA 2GN2A 1EINA 1J0BA 3D7SA 3IDOA 1QPZA 4KNWA 1JJVA 2JFQA 4QJIA 4KI0A 4MWOA 4Z7NB 1YB4A 4RGYA 5KPJA 1N3IA 4ERNA 2OD7A 4Q1EA 4F6LA 4CTNA 1AKQA 1XZFA 4LRUA 4DNOA 3QP9A 2B34A 1PJ8A 1D1TA 2H11A 4KMRA 1NVXQ 1ZA1A 2RJOA 4MMZB 1IPEA 1L7QA 2WJ6A 1E79D 2EFDB 4ZQFA 5K6AC 3LS2A 3WGVA 2OK8A 4Q66C 5J1TB 1FS4A 2IGBA 2PSEA 2ZSFA 1IY1A 4Y2PA 5K2MA 4IWNA 1ODCA 1BG6A 2IXBA 2JFZA 4RNDB 1I94B 2JIDA 4J2OA 3ZU5A 4D92A 1AUOA 2QMUA 2I4OA 3N9IA 2NUAB 1AGXA 2BEWB 4IFTA 3M4ZA 1DBIA 4PZAA 5BVGB 3QKSA 3FMIA 4P54A 2XGOA 3LLVA 5KVQA 4CI9A 2BHRA 1U0HC 4EK9A 4MQLA 1Z2DA 2P5UA 2B1IA 1HTBA 1M2OA 3L6CA 1HYBA 4XGIA 3U5ZB 1JEYA 3BAFA 2UYGA 3HCFA 1YBFA 1P8AA 1FRNA 3SBDA 2QIPA 2XQJA 1U8EA 3CB4A 4D0LB 4UE6A 3KK0A 4OI0A 1U8YA 4CF4A 3QOWA 4QVGA 1XN1A 4HAXA 2Q4EA 1ZCFA 3GRPA 3LQ2A 4W7SA 4QGSA 1FA9A 2QN8A 5GV8A 4DMMA 4EJ0A 4JD5A 3VC2A 4H6WA 3SOZA 2B4AA 1JA0A 4KXNA 5CCDA 1QYXA 2LXNA 2OORA 2RHHA 4I6EA 5K4GA 3R23A 3LBHA 4BP1A 1Y8QA 3EFOB 3B1WA 2E89A 5EKUA 1I1OA 1ZEMA 2CYBA 4IZ6A 5IKEA 3I6MA 1E6EA 1DKUA 2DWCA 4XYEA 1Y9ZA 4DILA 4LWPA 1X8JA 4YP7A 2VJLA 4LOIA 2HMWA 1M2OB 2CJXA 2AI3A 221PA 2NTJA 3AUSA 4NOMA 4Y18A 4CHTA 5G4KB 1LU9A 3NT5A 5M29A 2FPIA 2J3KA 5DYGA 3AU9A 3JSXA 1NC3A 3UUEA 1BXGB 1YB7A 3AINA 4K03A 2I3BA 3MTBA 4O5AA 5BT9A 1D2GA 3K1YA 5JPIA 4BYMA 3EMVA 3LUPA 5CB8A 4PHTA 1RZRD 2X1VA 2OQ2A 4IQFA 1RC8A 3DLBA 1D7OA 2B0JA 3G2KA 3L5OA 5HBGA 3PIDA 4LW8A 2O8FB 3VDXA 1CC1S 1T4BA 2BMJA 2IXGA 4HD8A 4TLEA 5G0SA 4FYIA 3WNZA 3W8NA 1LBSA 4NJMB 4QPZA 4UM9B 3ZHZA 4CIWA 3UKDA 2Z1NA 5JDIC 5K0FA 4LGCA 1XD9A 1J24A 3KM0A 3NWJA 4RXMA 4XWOA 1CF9A 3PK0A 1Y5RA 1BXRB 3C8ZA 1H6BA 2YNMD 2CD7A 2EL7A 3CMCO 2ZUSA 4UUAA 4TV8B 1CY6A 1CKEA 3VHXA 5I8WA 2VPXA 3MWKA 3ICCA 4U2DA 3TTWA 4ETWA 5AW5A 4LQ4A 3TTXA 4Y98A 2WNHA 4GFDA 4MW7A 1ZVMA 3CLTD 1GNVA 2JBWA 5HTKA 1ZD3A 1J06A 2Z6VA 1AKVA 4GECA 4CLRA 3SEQA 1XLTC 4JI2B 4YCAA 2DETA 1PFVA 1P2GA 2G04A 3DZJA 2OENG 4HWSA 4WLEA 1F6WA 5D1HA 1HFKA 1NATA 1U0FA 4UE3S 4HHEA 4DRXB 2FJ0A 5FNVF 4TXLA 1GAWA 3P9YA 1PWEA 3I3SR 3GA0A 4Y2UA 6REQB 3B6MA 3I0ZA 5BYAA 1N2EA 2MSLA 5CB4A 1RPTA 1PNQA 2PUFA 1RMTA 1W5SA 1G5QA 3LHFA 4OXIA 1TPZA 3AEYA 2ROQA 3L77A 5LU8A 4LPSA 4RTMA 3IUSA 1MLDA 2F1HA 1NVMB 5H4GA 2WWWA 3ZNPA 3H5OA 1LNQA 2VBIA 4JVLA 2JH9A 3MINB 1NI4A 4CFSA 2BYTA 4MO9A 3GEBA 2GPBA 3VU1A 3P4UA 3HLYA 3SFVA 1YONA 3QUSA 1YZFA 3L8ZA 4FGKA 1E2NA 5JRJA 4QDJA 2QAIA 2PY6A 1U8FO 1U02A 1UBMS 1UFVA 1PVDA 3QF4B 5BV1A 1VE9A 4X54A 4TKVA 4BKOA 5CBKA 1BEEA 1J22A 4WKGA 1HPLA 2OD9A 3F5DA 1L5WA 3H86A 1MT0A 4MWBA 3DBHA 4S0ZA 1T2EA 4FC6A 1QR2A 4NCKA 2BPOA 4HMOA 2BFBB 4CIVA 1Y6ZA 3AH8A 5DGCA 1SZJG 1II8A 1U81A 2NOAA 4WNYA 2PRKA 3QBDA 5U4QA 1D1PA 4MW9A 3W9BA 4CF6A 3ZGOA 3HKDB 1L7RA 4ZO9A 2QTHA 4E1VA 1O94A 2YWRA 4C30A 2EX0A 5LN1A 1QSGA 1R4AA 1G8PA 4XLTA 4JOCA 4LY3A 4P5PA 3L0BA 1Y3IA 1TF5A 3A0RB 4LJSA 3VMMA 3J81k 5KYWA 5EKXA 4CCYA 1R8YA 4B4DA 1DKNA 1TCCA 3CGWA 4WBXC 3WGJA 1PW7A 4U8GA 4E0BA 4L8GA 5AI5A 1XEWY 2GAFA 2YR0A 1H65A 3Q40A 1LSUA 2JFOA 4COOA 1LS1A 3RNOA 2DWPA 5I7WA 4ZVNA 2HJHA 1Y7LA 1P1RA 4REQA 3PGMA 1Z15A 2JIOA 4TZ0A 4MJXA 1CRQA 3E27A 2QD5A 1T6NA 1CJBA 4L78A 2B8JA 3QQ5A 1B8UA 4YYZA 2BFDA 1RHKA 2M6SA 3A1UA 3RIHA 4D2IA 2W6IA 2FUG1 4YCJA 1N9ZA 3FJYA 4MYUA 1UK9A 3BJIC 3T0FA 2BMAA 3CXRA 1X1BA 2I2AA 3V97A 3Q9UA 4M1ZA 4DM3A 4D0SA 2JA1A 5ALFA 1L4LA 4P35A 4IDPA 4RHTA 3H2KA 3NATA 1I3CA 1QIKA 4X5OA 1YJCA 1RCTE 5I9BA 1J99A 3SZLA 1Y1SA 2JFUA 4RVFA 2XX3A 4F2PA 1EXDA 3WHIA 1J7KA 1SCBA 2WHQA 1K3FA 4BVBA 1UIMA 3SFTA 4M0DA 4OLFA 4YMIA 1TK3A 1JSLA 3A6GA 3I2FA 4AJ4A 2APJA 3EY4A 3PNKA 3ADOA 1V16A 1HKHA 3VR5A 3PFGA 3ROPA 1YJ8A 2BZ1A 2RH5A 3Q3CA 3OA2A 2ZATA 4RYLA 4AULA 3AOEC 1ZK4A 3VSDA 3ZQKA 1MT3A 3KSBC 1RM5A 1U9YA 2VJOA 2C1EA 2HF8A 2H52A 1KVUA 2A9FA 5DHSA 1QQTA 3NHKA 4RJJA 2LVBA 3SC4A 4GOXA 4ZVPA 3RU9A 2OP0A 1GT6A 1UDCA 4KLRA 2B37A 3KALA 3JS5A 3ZTTA 5JQGA 1M5TA 2RI1A 3QIVA 5HE8A 1RKBA 2BKXA 3GNLA 4J49A 1JT2A 5IRCD 4WDRA 5FTLA 4O4IB 5IAGA 1AT1A 1PDOA 5JI3E 1QQ5A 1YS2X 2HWWA 3DYBA 3O9VA 4JZYA 4RD0A 3L7OA 1ECBA 2XY4A 3I12A 1SXJE 2ZVPX 2BKUA 3IAS1 3PXEA 1JX6A 1ZGAA 4R8MA 2I6UA 5JH7A 3S99A 2G08A 3II6X 1OX4A 3WBKA 4OXQA 1W5FA 3DLCA 4TVOA 3QFTA 3PQ7A 4X1YB 5FHRA 4R9RA 3NETA 1CQIA 3EY9A 3CVJA 2ZS7A 1ENZA 3L84A 3PVSA 1W581 3TAUA 1G5IA 3CLRD 4UD6A 1YRBA 3P2EA 1MD9A 4D96A 1LTQA 4YK7A 2IOFA 1SBHA 4BVHA 6YASA 4CHGA 1GEEA 2W43A 1UXJA 3GOQA 4IIVA 1R8XA 3A70A 2QJRA 4NBTA 4Y2TA 3D64A 2WE8A 2K4MA 1EXMA 3LYAA 4M98A 4NEHB 4IUYA 4TRMA 3ETEA 3K5IA 1US8B 2QX4A 1KVRA 1U4SA 4IWYA 4EYEA 1QMPA 4DA7A 2W8BA 3OURA 1SCAA 3DEZA 3OUTA 3FHTA 1C9YA 1LSSA 3FDFA 4I4CA 3Q98A 1AU9A 3HZOA 3QKRB 2VP3A 2VNSA 2WMDA 2Y1WA 5LL6P 4MKZA 1AV6A 1G21A 2JRLA 3BPSA 3L6BA 2J4CA 4UU1A 3FCAA 4B4UA 2PUTA 4FE7A 3I5UA 3AHGA 6Q21A 2B21A 2ZIXA 2GZDA 3CSSA 3MRSA 3PFHA 1SG6A 5IYZA 4X85A 5C1BA 1AF4A 1G41A 1UBTS 1ZH4A 4WI1A 2ZS8A 3I3OA 2DF8A 2AN9A 1OHHD 4MYTA 4R9NA 4BNLA 1L5VA 1KU6A 3TTVA 2V7TA 3GUCA 2H4XA 3P2JA 1FU8A 1V16B 1RCFA 2OLEA 3NDBB 3F2IA 1SD5A 3CYFA 3G5AA 4JLBA 1P17A 5K0CA 1GT91 3S5UA 4IX9A 3DQZA 1X7HA 1WP9A 3FM9A 4RULA 4MEBA 3AKZA 4PG8A 2G9ZA 3DEKA 3HKBB 4OYYA 1U2GC 5EYPA 2BGRA 4BXOB 2HADA 3I58A 2Z6QA 5JG7A 3ONEA 4MWCA 3TOVA 4DTCA 1IG0A 1CJMA 3W79A 4NXNB 1QHYA 1RAEA 4HDMB 4DWOA 1UT8A 2E82A 3K31A 2XB2A 1AQNA 4M21A 4C0AC 2VG8A 3WKBA 1S7GA 4NH0A 1XTQA 3KE9A 4UHEA 2AC2A 3JWEA 3CRVA 2NO4A 1TM2A 1N8NA 3ZIAD 2UYHA 1QQ6A 1JSCA 1UCFA 4GKAA 3T5MA 1OLUB 4CU2A 2FN8A 2PLRA 3BHIA 3CKMA 3B12A 3KEQA 4UULA 4Y0NA 4B3MB 1OAOA 1JAYA 1TCAA 2FCAA 2WJVA 2E7ZA 2PKQO 1WA5A 3OJCA 4TMYA 3GLHB 4AF8A 4AFNA 4CG3A 4ER5A 1JI0A 2X4DA 3O8QB 1J39A 1R6AA 1USUA 1YS7A 3COWA 4N7RA 5A3VA 4AROA 1AZTA 3N8GA 1F7UA 2YJGA 2P4HX 2XW6A 3KV3O 4R1OA 4QG3A 4Q05A 4BNXA 1DP4A 3GEHA 3HCCA 3QFHA 1JHYA 2BW0A 4WUVA 1Q1EA 1F1BA 4R16A 3P71T 1BJTA 1EK1A 5D3MA 5JIBA 1M2WA 3S1AB 3DEIA 3JASA 1Y1KE 3DCIA 1T9ZA 3P4YA 1XP5A 1ANKA 2QVZX 3C5WP 3LPLA 4H77A 3AETB 4XYGA 5CNKA 5JSZB 5LQSA 4DA6A 1KR5A 5AUNB 5AIBA 1L1QA 2JGMA 2P2NA 4Y9UA 1BJKA 4S35A 1Z7WA 1D0VA 1BSVA 2Q3LA 1K7SN 2QTRA 3UOGA 5AO9A 3FNHA 1X1DA 5CW2A 1FFXB 1V6CA 2XJ9A 1MF7A 3FSJX 3L0YA 4YRGA 4EGAA 721PA 1TUEA 3F6PA 5FOUA 3FOAA 5C7LO 3IMCA 2XYRA 1OC2A 3REGA 3KYCB 4FJ1A 3DQQA 1ISFA 2ADFA 1MEJA 4LJYA 4X3CA 4I50F 5ARCA 5JO0A 3ZWCA 3WL6A 3A4NA 2VC2B 1ND6A 4H18A 4U5QA 2BELA 2GR9A 4GPBA 1KKLA 3QLEA 2P2ZA 4Q4AA 3A6ZA 3U61B 1OGJA 4KQMA 3F8TA 4HMQA 4WVLA 4K7JA 4X65B 2CFCA 3DO6A 3GGCA 1P1CA 3MUOA 3K9HA 2OY0A 2XMPA 3C6KA 5BSMA 5C5EA 1XNHA 3DFUA 3K0EA 3TFWA 5H9VA 3T9AA 2OAEA 2HU8A 4MINA 1NSFA 4M1SA 5KNBA 3FPCA 1XL1A 2E6UX 1MNQA 3LBNA 5B58C 1RQNA 2QW1A 5BQFA 4ND8B 2CLMB 3PT5A 2NYRA 3CG0A 2GK6A 4GPIB 1P2DA 1S3SA 1XMSA 3ETJA 4QL3A 1QBGA 4N76A 2V65A 4RHUA 3SX0A 3DE4X 4KR2A 5CFOA 3KKQA 4EL0A 1UZUA 3X44A 4DBZA 5HRAA 4WZAE 1U0SY 3R5JA 5E8RA 1OLSA 4NONA 4BKRA 1TOAA 1Z26A 3F3MA 4ETIA 5CB4B 1JJAA 2CLKB 4FLFA 2QRPA 3KDPA 1LSJA 1Y5NA 2WE7A 2ZRKA 4NS4A 3T3HA 4BV3A 4Z4CA 4XUDA 5H70A 2FE1A 3E7FA 1OIWA 3E3OA 3WL8A 4AZVA 2K6GA 3AQ4A 3N8KA 2XQFA 4GUDA 1HR0B 1O0CA 3IJ5A 2W2OA 3P9KA 3PNVA 5HP4A 3K16A 1UDBA 2VP0A 2ZTUA 4UM7A 4CDNA 3OTGA 2V4ZA 1W19A 1BS2A 3ANLA 4NQZA 4B8ZA 2OO3A 3UM9A 1EJ6A 2NU9A 3UJCA 3KL2A 3ONNA 4G1EB 4KQGA 4EABA 2FZKA 1BD4A 1VFNA 2VSOA 4TMZA 4C2TA 2D7JA 3QWHA 4N5NA 3JQDA 1ZGBA 2AB0A 2QEQA 4D0RA 4BOYA 5LLTA 1AJEA 2CLHB 3OZAA 4X20B 3OC6A 3ABSB 4UU0A 3RC2A 2EKDA 1HNWB 1SVLA 4X66B 3GO4A 2O7SA 1U9IC 2HMTA 3AF0A 2ODNA 1BGXT 1DARA 1XTJA 4BVKA 4KQIA 1XNJA 4CMAA 5LZ8A 4RO0A 1YZUA 4MRPA 2J9ZB 3MMZA 5IUNC 4KE6A 5JAHA 2I4LA 2HGSA 3ND7A 3FHCB 1RWQA 2EC5A 4H7KA 4RSGA 4UEJA 5E6SB 5FQNA 2O2SA 3ZDFA 1Y5LA 4XCQA 4YJDA 5JASA 2EFHB 2H7VA 3MQ2A 4TUYF 4B6FA 5BPFA 3FIUA 4RA6A 4JJEA 5ADHA 2JCBA 5KU1A 4US0R 4PHHA 3S4YA 2DX7A 4LOJA 5C8ZA 3VKFA 1DV2A 5F2OA 5HIMA 1BGWA 2JIZD 5JMTA 2W6QA 4ALMA 2ZB2A 3TZLA 4BMXA 1M75A 4G37A 1APBA 1R16A 5KJFA 3L05A 3PXAA 2P9TA 3QK7A 1Z0ZA 2Z6UA 4OUDB 2O8CB 3JQFA 4EHNA 1R8SA 1YL6A 3LCVB 2FPLA 2WAOA 4KR9A 4C3UA 3OIFA 4G5SA 2CCKA 4XFKA 4JUDX 5CXSA 1XTKA 3VV2A 3R6TA 1B74A 4X7BA 4L5BA 2AN1A 1OGYA 4FCVA 2H18A 4P58A 1GN8A 4DEXA 1A9PA 3D6UA 2ZR7A 2KWIA 1BQEA 4ZV9A 2EWMA 1JB1A 5CPBA 2VYFA 3DOIA 3GEPA 1ZL2A 3OE5A 4MEJA 4RD2A 1LVHA 1A1SA 3C8HA 4TX1A 2YNMC 2WHPA 3PF9A 1Q3HA 2ZJAA 1KVQA 2XGSA 4JUBA 1WHTB 2P2GA 2C29D 2C9OA 3TZHA 2WA1A 1LI7A 5EAIA 2QJWA 5D3ZA 4DVGA 5LYJA 3Q0EA 5JZVA 1UJ2A 3EVZA 2R65A 5ALXA 3ZE9A 5IJ0A 1DTEA 3GROA 1VM6A 2GOYA 3I5AA 2CUKA 5H7XA 2A5YB 4LCBA 3TJMA 5JS1A 4AP5A 4MCAA 4TKLA 5K0SA 2V98A 3SEZA 2Z9DA 1U9ZA 1X19A 5REQB 4AY2A 3WAJA 2C7PA 1TTHA 2A7QA 1KJ9A 3JWJA 1DX9A 2A1TR 5TMEA 3ZBPA 1L4BA 1PV2A 2HEIA 3WWYA 1P7YA 1TLFA 1UPUA 2A5LA 3LPNA 1W73A 3MRVA 3R5SA 4H7EA 4NZMA 4QJBA 4QPDA 3SX4A 1WXEA 1YA8A 5CH3A 4MULA 3QW4B 5CBPA 3UB2A 2G5GX 1U1GA 1CUVA 3G85A 1JQ3A 5DBOA 4DCUA 1U2QA 2J3DA 4HXGA 4XIJA 1KI3A 3IAXA 2QX9A 4Z4HA 1ZGJA 3ELWA 4JLMA 2GI4A 2O06A 5LLSA 1KAHA 1WMAA 3PGA1 2C5HA 5F21A 5TR9A 3W5IA 4U2KA 5B1EA 4ZT2A 4HNTA 5FWXA 2FSIA 3CW2A 3THWB 2AXEA 1IK6A 3RIMA 1TZKA 4L3OA 4O1HA 1OXVA 3EZ6A 4CZ2A 4GI3A 2F00A 2YXEA 5EJGA 4G5YA 3UA3A 1BVUA 3HCDA 2P4EA 3K9QO 2PLAA 4MX8A 3HA2A 3ITNA 4MICA 3WNVA 5HMLA 1L4MA 3F71A 2GUGA 1LLDA 1NDUA 3GPIA 4XJSA 5FLYA 3AR3A 1UOPA 3WV5A 4CN8A 2DE0X 4D80A 1BN6A 3G8AA 5ERGB 3B1ZA 3B1JA 3V46A 2IS6A 3K1ZA 4KLCA 3W8FA 1DSSG 4GKBA 5K3SA 3HKCB 4IXNA 1PZMA 4KVGA 1KR2A 4KR0A 2ZDGA 3EXFB 1Z5NA 3D5TA 4WKCA 2FZ4A 5ER6A 1TVKB 2VDUE 5A7FA 2C3MA 4L27A 3DWFA 1UPBA 3QF7A 2QAGA 5D3QA 2P69A 4EEXA 3HB1A 5KYYA 3TG2A 2X5JO 2QLFA 4LY0A 1ZN8A 2EXXA 1ZITA 1E58A 2JC3A 1DAPA 3CW9A 5GAJA 1XNRB 1G5TA 3DEYX 4ARBA 4MOWA 3E7DA 3PWKA 4BTVA 3DDWA 1EP3B 4J6EA 4LQLA 4QUJA 3O3OB 1C3JA 5ICCA 3AUUA 4J0JA 3AUXA 3T12A 1G20A 4WOKA 4LJ9A 1WF6A 5KJCA 2ZI6A 3K9CA 3GJZA 1XHEA 4P32A 2KE5A 3BCUA 2EGUA 2PKWA 5CJ2A 4EHKA 5KDDA 4JWTA 4ROSA 4X95A 3U1VA 3I9FA 1CB0A 5IYZF 3JXEA 2ZYAA 3RCBA 4C5CA 1VZ2A 3WK9A 3QU2A 3BGSA 4WOBA 1Q15A 2Q1WA 1GL7A 3KR2A 4BCBA 1GP2A 1GTZA 1VPEA 2E48A 2Q9BA 1OXMA 1RI3A 1KNXA 4PAOA 4JJ6A 5AJXA 1KDYA 2PUDA 1DUSA 1XZHA 3DUFB 4IRMA 4MDEA 2FEPA 3FHLA 1U1CA 2E4XA 1UAYA 1MZPA 1U0GA 2WTNA 4Z1MD 5L3ZA 2B1GA 4NH4A 1L5KA 5B7PA 2WWIA 4V3CA 1SVUA 2C2ZA 1M2HA 4B6RA 1Q21A 4L2IB 1ETUA 3JD3A 2OO7A 3AF6A 3DMPA 3RV3A 2CMGA 2J0UB 3U80A 4ANFA 4JC0A 3PNMA 3G8BA 1EWVA 5BN3A 1WCWA 2GN9A 2ZWPA 2PRSA 1S2NA 1ENYA 2CL7X 2FI1A 2W11A 1NONA 3KHKA 5HMMA 3QX3A 4YMHA 1W0KD 1SEPA 3B3FA 4OSPA 3VXKA 3S2GA 4RQUA 3SYLA 1Y80A 4JSTA 2AW3A 1A7JA 2VH2A 4H35A 3IUNA 3DMTC 1LWOA 4C0LA 1F48A 1OX5A 1MTOA 4UFNA 5GVSA 2R7NA 4RABA 4Q18A 4DIFA 1RMQA 2PYZA 4P22A 4A8TA 4OCZA 3CKYA 4NDNE 4LS3A 3PRJA 1ETHA 5L45A 3R7BA 1GZ7A 3E4CA 5AXCA 4GQBA 1JDZA 4J7CA 2F64A 3MJRA 5JQGB 1UWCA 2EW8A 1IXKA 5JNVA 3HJNA 4ROTA 4EFLA 2P6NA 1DG9A 5EEHA 3F6YA 4QELA 2I1QA 4G63A 3S2YA 2VAVA 1PJBA 4XQ0A 3T1HB 1V5FA 4WLOA 3ZCQA 1KMNA 3DHNA 1KBQA 4EKGA 2J59A 2QM8A 1NYQA 5CCEA 2IHVA 4FWBA 4HNAA 3ZCUA 1NHWA 4Q9NA 3GOHA 2IUYA 2X86A 4CCWA 1OAOC 2M32A 4KWCA 2P2YA 4OL0A 3ZI0A 4F96A 4Z5XA 2MCFA 5BR8B 2QT1A 3PGLA 2XYVA 2YTZA 1U3FA 4E2WA 1WHSA 2ZOSA 1Z5WA 3D1JA 3OG9A 4QPCA 1FCJA 5KMGB 3C6XA 4EARA 4ACBA 4GSYA 2QD2A 4K2HA 1JHQA 3B36A 1TAUA 4F2HA 1VCNA 1KPIA 1K8QA 3EDYA 1VHJA 2ZIXB 1C9KA 2B0CA 3KXDA 3NHMA 2PD4A 4WW0A 1EX6A 1V1JA 3Q41A 5GJCA 3MTAA 3WX0A 4KN9S 2H0QA 3IMFA 4JLPA 4BKMA 1TYCA 4M1TA 3RIXA 4KRXA 4FYXA 5AXAA 4YJFB 1DC4A 3R9XA 3D6MA 4E5KA 1TT5B 3RSHA 3N8HA 1QB8A 3ZH9B 1WW8A 3V8EA 2PVPA 1JYSA 3DFMA 3KVRA 4ZREA 1H2ZA 1ZNWA 4KQEA 2F43A 3UWDA 4DG8A 4QM6A 3R44A 3SBEA 2GN8A 1DPGA 1ENPA 5CYOA 3SR4A 1J9GA 2AL7A 2JGDB 2IUSA 5AJYA 2F1IA 5L9AA 3WYNA 1VP3A 3V1KA 2I29A 1Z6AA 4KPYA 3FD8A 5FTNA 1KSJA 2BSQA 3CZQA 1X1RA 5ITVA 1CQWA 3LH5A 1V3TA 1UPXA 1OASA 4B2PA 2DTXA 5EZYB 4GX0A 1DI0A 4NABA 3IOYA 2Z95A 3CR7A 1Y3HA 2H59A 3MAJA 4AG5A 5JPCA 5H81A 1ZZEA 4TWZA 1OFUX 2ZWAA 1SCUB 1NF2A 4PGFA 1JIKA 4AD8A 4BB0A 2Y0CA 3PU6A 4YA6A 4IG4A 2VUTA 2Q7XA 5IJ0B 4HT3B 3HU5A 3C0KA 1SGWA 4NU6A 1A4XA 2RAVA 4IL5A 4C21A 3ZN2A 2DTEA 1YR7A 2HO4A 3L1KA 3MCUA 2O59A 2P6UA 4C7OA 3BXFA 4PQYA 5DI3B 3UBTA 4RXTA 1FSPA 2HJVA 2X40A 2QUIA 1QFSA 4LVNA 1NMZA 4B3HA 1TQ4A 3TNDA 1F60A 4DS3A 5EMHA 1H0RA 2EKPA 1FJXA 1E4EB 2JAHA 2J0QA 1KI6A 4EATA 1USIA 1JSRA 2FSVC 5EE0A 2H2HA 3TIIA 2NP6A 1N5OX 1I0ZA 4I5GA 3D2AA 4OB7A 4PAGA 4P0QB 1T2AA 4LJ8A 1O89A 1P74A 2Z30A 5DBFA 3TR6A 3UQZA 1BDHA 1XLWA 2CY0A 2YHSA 4IXTA 1JAHA 1JKJA 1VL2A 2GPNA 4OEHA 3SIRA 3NNNA 3IDZA 2QUJA 4LNUA 1YR1A 4IGEA 4FFDA 3KKOA 3VKUA 2YV4A 3E23A 2XWQA 4FGJA 1FBTA 3SGLA 5LQNA 3OD1A 1UC9A 5H1YA 1WZEA 4CKXA 3D02A 4L9RA 3DQPA 5ILGA 3JARB 1UBOS 1YBAA 4LFBB 1DX4A 2PMCA 3GYBA 2ZRAA 2DUJA 3ENZA 2FXVA 3I0MA 2H92A 4YAGA 3GLIB 3RAPR 1X15A 3NVKI 2QUAA 4PYMA 1QGED 2CXQA 3NHJA 1KY2A 2Z3WA 2PGXA 3DTNA 4C87A 3DO5A 2XB4A 5IZ4A 2W4IA 1YZHA 3ACBA 3KL4A 3KJGA 3OPQA 5CLJA 5EHGA 1P81A 1NPYA 2AG8A 4EG4A 4B6EA 4Y0VA 3FGPA 3LI2A 1Z45A 2HBZA 4KXXA 3NHSA 3BXGA 3L7IA 3S55A 3GF4A 3GNSA 1FFHA 4CNBA 1ZUNB 3BWXA 3ELBA 1TI7A 2AF4C 4H1UA 4RLSA 3THWA 3C87A 3OLQA 1KMCA 2YYSA 4L0QA 2MSDB 3UCXA 2C07A 1D6NA 1QIIA 1YAJA 3WHPA 2BHTA 5BRAA 2YWJA 3U49A 1HA3A 5FWDA 3RG8A 3FX2A 3H5TA 1JAZA 4KYVA 4PYRA 2G0NA 1GUAA 1W76A 4P7BA 2SBTA 4JI3B 3FOEC 1R6VA 3LC1O 1CBUA 4A10A 5EIFA 4OQ4A 1NDHA 1R0KA 4KN5A 4JFRA 4KR6A 4MYCA 1E18A 4DSZA 3B6ZA 2IKQA 4QBGB 4MV1A 2ZR8A 2VTEA 4L8FA 4ZAXA 3RS8A 4J7AA 1II8B 4I99A 1E4OA 2F7SA 1VYTA 4IS3A 5CHEA 5L7WA 1MNAA 1VLQA 1YR8A 4CL3A 3QEBZ 4C7BA 4PVDA 3FHOA 3RRZA 1WDLA 1C8KA 1WV1A 1C7FA 2H1RA 3IDFA 1XWFA 4OFBA 1OLSB 1PJLA 1W6UA 4FHCA 4E4TA 3LUCA 4RTQA 1XCLA 1K6IA 2WVHA 4RU1A 3BFVA 3UAWA 3F9CA 3TLMA 1N57A 2ZE6A 3K5WA 4YVFA 1T5HX 2XAAA 2D0DA 1D04A 2BZ0A 2G7ZA 3IIKA 1V35A 1J8YF 3DKPA 4FZVA 2P65A 1TA0A 1J0EA 2YVKA 4H7PA 4R1UA 5DOVA 5JS6A 1V3VA 2P41A 3H5AA 3JYLA 4XVHA 1O08A 1Y9JA 2C7GA 4OJYA 3IAM1 4KIFA 3FZYA 1BCSA 1NU8A 2O5RA 3FYUA 2EHDA 4WRRA 4HDKB 4C22A 3H3JA 4DHWA 1C1XA 1AB5A 1VI6A 5KWEA 3O4HA 3U7JA 1M66A 3G0OA 1YBMA 4NU8X 2O14A 1PK7A 2BHSA 1C2TA 1SZDA 1T5OA 4LNHA 4W6ZA 1XDZA 1LW6E 2VNHA 2DWQA 2WUGA 2HLDD 2G80A 4KXMA 4UVIA 5HQTA 4JP5A 3MOGA 5LBIA 2I2WA 1GCIA 3CPHA 5COQA 1R1DA 2YWFA 3AJDA 3LUAA 4KAXA 4LI3X 3BE4A 3NBQA 2DY1A 1AO0A 2D5IA 2CZQA 5CT5A 3EOAI 3KP1A 2V7VA 1V47A 4YWJA 2O2YA 4K1LA 4FBLA 3S2FA 5JY1A 3L7AA 1UC8A 2Q0HA 4ND5A 5JH7B 4M9QA 5F77A 3CN9A 3FGOA 5EIHA 3Q5DA 1N2GA 1GDHA 4G5GA 3QVLA 1ZD2P 5LMUB 1MC4A 2XTZA 2V5VA 1Z56C 4OQPA 3TUIC 3VUEA 3FB1A 3HGQA 3B6KA 1X14A 3I9KA 4FHDA 1L4YA 1LNZA 4LZJA 1N3BA 1IM2A 3L7MA 3AIKA 1CNMA 5ALGA 1ZR4A 4F2DA 1L6RA 3LRTA 1M8GA 4LF6B 2HJGA 4L0MA 4N0MA 4BX9A 4DT1B 3HH8A 4YDHB 2FPGB 2BP7B 3SJCA 2JGAA 3E9EA 1X9GA 3FKJA 5BMOA 3IKTA 1EHCA 1UK6A 1MO3A 2CBXA 3MJFA 4Q4JA 4R01A 5FWYA 1Q11A 1IBCA 1QGZA 1T43A 1XLVA 2GBCA 2I1LA 2JJQA 2J85A 2QSJA 2VYND 1PL6A 4DB2A 2ZRLA 4PHGA 3SC2B 1L5QA 4A91A 3WIBA 1LLUA 2MTBA 4NE2A 4R2WA 4WECA 3ZHOA 2PYDA 3C5HA 1FRQA 3PHGA 3NT4A 2P2SA 3RS4A 3FPSA 4JI0B 1FFAA 4QGHA 3EH2A 5CB6A 2B3DA 3OPYA 3RAGA 4TYMA 4RZIA 2QENA 3B78A 3OJXA 3RWOA 1Q6YA 4UMVA 1LPMA 3I1YA 2H0RA 2HCRA 1HV8A 2A2ZA 1A7KA 3Q9SA 1PNVA 3R6DA 3VO8A 4D9EA 5IASA 1NM5A 1RABA 4PZPA 4KYIB 4RY0A 1KS2A 1Y6QA 3IHKA 3WTBA 1N8TA 1U8UA 4LBYA 4CIBA 3L01A 1TE2A 1OVMA 4B8WA 2GEFA 3R7WB 3EVFA 4MS1B 3LD9A 4EG7A 3S70A 1C1XB 3IV7A 4G1BA 3WK7A 2ZIFA 3CO5A 3LCUA 2GN6A 1GO2A 1KS9A 3ZVNA 3Q7PA 2CUTA 4IMJB 1ZIXA 4YRQA 2OOSA 2YVQA 3QUAA 1HK7A 4D9GA 3GLSA 1EFCA 1XF1A 4R8VA 4QGFA 2VDLB 2VUHB 4N3AA 5KS2A 1P29A 2BUBA 2ZIAA 4MQMA 1N77A 1KSHA 2EX1A 4EO4A 5DCWA 1IN7A 2NTNA 3FUWA 3SM9A 3IR5A 3OJFA 1OKKD 5HEKA 1XVTA 1AUVA 1H6CA 2W2PA 3O8BA 4PO8A 1DXOA 5FOXA 2JLAA 1REQB 2YOFA 4KG7A 5JT1A 2J33A 2G67A 3A9SA 1T4CA 3OD5A 3DLTA 1CDEA 5GMOA 3V55A 4BU0A 3ZD6A 2V6GA 2C9YA 2OHIA 1P0FA 3KZKA 1HRKA 3OWXA 1OFHA 1XVLA 2E2WA 2QVGA 2X6QA 3AI7A 4ZANA 3CEMA 2H3HA 3GJSA 3U9LA 2C7QA 1JMVA 1X2EA 3I53A 1Z0DA 1P61B 2PZ8A 5AKKA 3WRVA 2IX3A 5JEEA 1BMQA 1P33A 2HXGA 1WB5A 4M0MA 4J4HA 4WBSA 1IM5A 3EUAA 3ILHA 3KSZO 1QDEA 2JCYA 1H4VB 3P9IA 4ZGBA 5BV2P 3N53A 3RRMA 2O5EA 1XZGA 3IB3A 1LC3A 4QJ4A 4GM4A 1ZM7A 2BZGA 3OIUA 3RARA 4N41A 4O1MA 4S05A 4BLSA 5EIOA 4J0FA 5CYFA 2F48A 4JR2A 4Y2RA 3S8YA 1UFOA 1FZTA 1CZLA 4H1HA 1FX0B 2RGBA 4I81A 2ZTHA 1RYHA 3BXPA 1KFJB 4ML3A 4URHA 2JIZA 2ZYIA 5B3LA 1M6HA 3O7WA 4MIEA 4EOGA 2R68A 4PSCA 5B2FA 2R79A 2VS1A 4DANA 4E6EA 3MJ4A 1BA2A 2GNOA 1KAQA 2NUTB 4XVQA 1UBEA 1NR5A 3AHJA 4IGAA 4D9BA 2WLTA 2IXDA 4IXMA 5CA1A 1EI9A 3G59A 3ROXA 3GJYA 4GPTA 3VR6D 5ALNA 1IXSB 1CP3A 3I04A 1HE3A 2ZRNA 2EIXA 1CD5A 2COEA 2WT4A 1I01A 4FWIB 4RVOA 5DRTA 4ESVA 1PT5A 4ZHSA 1SN7A 2X7XA 3C3WA 4R05A 1SULA 3SNKA 1OBFO 3IQGX 3VTKA 4BMSA 3C98A 3GLFB 3ND6A 3QEAZ 1CTQA 1J2UA 1FNCA 1A5AB 2YBDA 2BEUA 3CNHA 4B7UA 5KQRA 2F17A 2V96A 1VE7A 1UKEA 4LRXA 5IDVA 4Q6BA 4BX2A 3ZDDA 1IWBB 1JAXA 4NP6A 1YE3A 1FJGB 3RC8A 3Q3GE 3KAKA 4PS0A 3EVCA 3EK2A 5KTSA 1CVRA 3GYGA 2XDYA 1ES9A 3V1UA 1L2TA 2IDZA 5JMOA 2IK8A 4OBEA 3VI4B 2O8EB 3TQTA 1J2YA 2NZVG 2WZQA 3HVJA 4IJQA 3ZWBA 2CDAA 1VXOA 2ZE7A 4WX2B 5I4CA 2PBFA 2B8WA 1H4TA 5F2KA 3F5SA 4DQ0A 2A3NA 4KXFB 3P94A 1VHLA 3HP4A 3FPGA 4X92A 1K6JA 1LQ2A 2ZZKA 4R84A 3VR4H 3I9LA 4WLNA 5JO9A 5K3EA