1F12A

L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDECVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-HYDROXYACYL-COA DEHYDROGENASE
publication title Sequestration of the active site by interdomain shifting. Crystallographic and spectroscopic evidence for distinct conformations of L-3-hydroxyacyl-CoA dehydrogenase.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1f12A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1f12A01
1Y8RA 1T2AA 1O0SA 4WECA 2IZZA 1I5RA 4DMLA 3ZWCA 3PIDA 1EMDA 4MO2A 2PGJA 3Q2KA 4JBIA 4K1LA 3MTJA 2FP4A 1U3VA 4PCVA 2QZ9A 3ZV6A 1MC4A 1DRVA 2J5KA 4U6SA 1KEPA 1IE3A 3F4BA 3S2EA 1EE9A 3WMWA 1JQBA 3GFBA 1LXCA 2IXBA 3BHJA 2Y66A 3QIVA 3GVHA 1HZZA 3H6KA 4XZ3A 4BNMA 1IL0A 2EV9A 2PZMA 3F3SA 4ALMA 4QUKA 5ES3A 1LEHA 1YRLA 1PJBA 2IE0A 2ZCVA 1BG6A 1K5HA 3ANNA 1DAOA 2BHLA 4W7HA 1XDWA 4CMIA 1ENYA 3F1LA 4XA8A 1Y8QB 2IYOA 2EW8A 5TS3A 4D3SA 1M76A 5T8KC 3D1LA 3ZV3A 5AVOA 2VCYA 4FBGA 1YOVA 1LC0A 2Z5LA 4E21A 3HE3A 5DNAA 1T24A 3V1YA 1ENOA 3KYDA 1CDOA 3VH2A 5ICSA 1PGQA 4PVDA 4BQRA 4CM4B 1UXKA 2G17A 3LQFA 2O4UX 3Q0EA 1LQTA 2VOEA 1BTOA 5ILGA 2P9EA 3WBFA 4YRBA 1WXDA 4ALNA 3HJAA 3D7LA 4IXTA 1UUFA 3GRKA 4E2YA 4J1QA 1HDGO 3K30A 4N5NA 3PEFA 2X0NA 2ZQYA 3Q3CA 4Z9YA 3FF4A 3GEMA 1CYDA 1LDNA 2BFMA 2GN8A 4BS9A 4O5OA 3WWZA 4GKBA 1GCUA 2ZB3A 4J2HA 5B37A 3RJ5A 1GAEO 5CEEA 4M86A 4UVHA 1EFKA 1QXSA 4F6CA 3D5TA 3B70A 4BB6A 2C54A 4RDIA 1GQQA 3IP1A 4WLNA 2C0CA 3TWOA 1CQJA 1BHSA 2DTEA 3WGZA 2PNFA 1NQAO 3ICCA 3A1NA 1VLLA 4RPKA 3UH1A 4ROSA 4BO2A 3MJ4A 1P1IA 2WDZA 4S3MA 4B4VA 1E6UA 3AFMA 3I9NA 2I99A 3ASVA 2WYUA 2YYYA 4BO6A 4OYRA 3FN4A 3AM3A 1VPDA 2OBYA 2X9NA 3TNLA 1GUYA 2QG4A 1GPJA 3JQFA 2BLLA 5EERA 3DAGA 1ZMOA 4FB5A 1B3BA 2WE8A 5COAA 2R00A 2EKPA 3G1TA 3KM0A 2VUUA 4CLEA 4FC7A 2DLDA 1ENPA 2X7HA 4OJNA 3PDJA 3VKUA 3WGYA 2O3TA 2ILTA 3HFGA 1K6IA 1UDCA 1WMAA 3I4FA 4Q9NA 3VTZA 4E5MA 2P4HX 1LX6A 4NU6A 4XCVA 1Y8QA 4Y9DA 1IHYA 5JY1A 3SLKA 1F0YA 2CUKA 5EQDA 1DIRA 3EZYA 3JQAD 1PGJA 2DBVO 4XYEA 3WMXA 1EK6A 2Q1TA 2WJPA 3QW2A 3ZWWA 2CDCA 3IC5A 3V1TC 4CV1A 1QYVA 5IG2A 4CM4A 4EUEA 4R54A 1I3LA 4N5LA 1ZZEA 1E3SA 3DXFA 3UF0A 2Y1FA 4TSKA 1EK5A 2BD0A 2HMSA 1CJCA 3WS7A 5JNLA 3C1AA 1MC5A 5CFZA 4YRAA 1O95A 4L0QA 2PZJA 4M1QA 1XLTA 2Z95A 5GY7A 2NTVA 4B7XA 3GQVA 3WGIA 3RD5A 4I1IA 3PZRA 5IN4A 4KDEA 4R01A 1UXHA 4RVGA 1NVMB 4JP3A 1YBMA 3OHSX 3FI9A 3WQSB 3ZHZA 4MP3A 3H7AA 3Q11A 5A02A 5A5FA 3OF2A 3SVTA 1PZHA 4UUMA 3Q6IA 1H94A 1P0FA 1WAMA 1R0KA 4WLUA 4DGSA 3I5MA 4GMFA 4XGIA 5TNXA 3JYLA 2J3HA 4A0SA 3DTYA 3VZQA 4XRRA 2I5PO 3C7AA 1SNYA 1NR1A 3GY0A 4MVJE 1NWCA 1EBUA 5L53A 1R4MB 2FZWA 4HFRA 4A27A 5FI5A 4R5HA 2JHGA 5JYDA 4Q3EA 4ZRMA 5COQA 1ZFNA 3QWHA 2JCVA 4RPGA 3PFFA 1LSUA 3CKYA 1NHGA 2HCTA 2NV6A 3BMCB 3NUGA 2D59A 5F1PA 1DLIA 3ST7A 3WJAA 3RQSA 2ZK7A 4M54A 4CPDA 4Z6KA 3A14A 4UVGA 1C1XB 4BNFA 2EWMA 5AOVA 1XU7A 1LQUA 1MA0A 1ZMTA 4GX0A 5ENVA 4UEJA 4MVJP 4ESOA 3OIDA 1DBVO 1XHLA 4I5GA 1KEVA 1ADCA 2AE1A 3P7MA 3Q9UA 3KOUA 1S7CA 1XIVA 2D4AA 4ZA2A 3MOGA 1LUAA 1A9ZA 5JFOA 3M6IA 1C1DB 1ZEJA 5GMOA 1DC4A 3E18A 2CDBA 6ADHA 2DVMA 1ML3A 1ZEMA 4LK3A 1Q7CA 4EITA 1DEHA 2FHSA 4DMMA 4UVIA 4BMNA 4BGUA 3FWZA 3T4EA 5A06A 4RCVA 4ZQHA 1X13A 1Z7BA 3ANLA 6LDHA 3JQBA 4YB8A 5L7YA 2D8AA 3BAZA 1VL0A 3ZV5A 3HWRA 4FFNA 5KCZA 3PRJA 1BMDA 1P1HA 3EW7A 4CMCA 2DT5A 3INGA 4S1VA 2FPGA 5JAQA 3U0BA 2X5OA 2B0JA 2O7QA 1J6UA 1RM4A 1VRWA 2J5RA 3DHNA 4Q3NA 3TZHA 4CV3A 4AG3A 2G76A 4YJGB 4CM3A 3DHYA 3AOEC 3DZGA 3BTSA 3IQDB 3W6UA 3H5NA 3SX2A 2VTEA 3WGQA 4A03A 1R4NB 2Z1MA 4CM5A 1EVJA 3AI3A 1YBAA 1X1EA 3DAFA 4YBZA 3KETA 1YL6A 3TQHA 4CV0A 1KEWA 4CM8B 2GD1O 2FY8A 2YFQA 5BT9A 1Z45A 3WSWA 1E3WB 4BNWA 4BO1A 5LDGA 4BGVA 5KJFA 3IS3A 3PYMA 1JAYA 1DC6A 3OJ0A 4ILKA 1R0LA 3S2GA 3O8QB 2B4TO 3V2UA 3I23A 5CEFA 2AG5A 1RJWA 4FC6A 5CEJA 4AICA 3UCEA 2CZCA 3DMYA 2RHRA 1MG5A 1PR9A 3NX4A 4QT0A 4Z9XA 1R16A 2PD6A 3BMCA 4KDFA 4K6CA 1QV7A 3TRIA 3UVEA 1YQGA 2O50A 1TI7A 4M89A 3UW3A 3WGGA 3L4BC 1C1XA 4WCFB 3JTMA 4WLOA 1K3TA 4ALJA 1SOWA 4CLRB 5L7TA 2FSSA 1U2DA 2EJWA 4L8VA 4GGOA 1OZAA 5C7IO 2ZTLA 3WQRA 4JQCA 1DFGA 3H3JA 3GN2A 4B3JA 1O94A 1PTJA 3F46A 3WYCA 1BXZA 2QYSA 1LDBA 5A9TA 1C1DA 4YTEA 3ROMA 2ZQZA 3U49A 1SMKA 3OICA 3S2IA 4E2WA 1NFFA 3H5RA 4IS2A 4BHTA 4ONEA 3OA0A 4IDCA 1GY8A 3ICPA 1OMOA 2X86A 5A3VA 3VDQA 4O1MA 1RYDA 3TFQA 4NK5A 1Y9AA 2HQ1A 3VC7A 2VWGA 3PP8A 3PGXA 3KTDA 1EDZA 3VAZA 3L6EA 3KBOA 2QYTA 1N8KA 4KZPA 3VKVA 1ZIDA 4DBVO 1V9LA 3FNHA 2VWQA 4ZQBA 4WKGA 1LLUA 2AMFA 4BGEA 4XYLA 1QV6A 1TEHA 1HTBA 3DONA 3JYOA 1NASA 4MVJI 4YT5A 2C2XA 4YJGA 2HMVA 2VYNA 1LLDA 3RWBA 4BO4A 3WNVA 2PK3A 3KYBA 1KEUA 4CQLB 4HWKA 1RPNA 4TKLA 3U3XA 1A4IA 3C85A 3JQDA 1ZJYA 3B1JA 1DOHA 2LDBA 3JD2A 4ZU3A 3PJDA 1PJLA 4D3FA 1M6HA 2NACA 5G4LA 5BNFA 4WJZA 3UUWA 3I9LA 5JDIC 1WDLA 4PLGA 4RLHA 1U8XX 3GDFA 4R1TA 3PLRA 4BNJA 5ITVA 4MKZA 3O8QA 2JD2A 3O03A 4AL4A 4Q3BA 4E5YA 3K5PA 1Z74A 3GG9A 4J0EA 4B3IA 1MV8A 3DBRB 5IXYA 1BSVA 1GD1O 4RGBA 3ZHXA 2DUWA 4BKUA 2P5UA 4ND3A 3UFXA 3GRPA 5JAIA 1DDOA 5KOIA 3VPFA 3NGXA 4LMRA 3KRTA 1YJQA 4WCFA 4DIFA 4RORA 1MXHA 1IB6A 4CLRA 2I9PA 1A7KA 1Z6ZA 2B36A 2ZTVA 5HTOA 4NNJA 3RUDA 4YVFA 4LCJA 3FRJA 1DXYA 4DUPA 2QZZA 2UDPA 2BGMA 3QJ5A 2E49A 4TVBA 1ULSA 3IUSA 1N1EA 3TZCA 5GZ6A 3H8VA 3WBBA 3NT5A 3F5SA 3SEFA 2FWMX 2PA3A 4P38A 2NNLD 3UCFA 3NDRA 4DQXA 3L77A 5EMHA 1HDYA 2HRZA 3PHHA 2NVUB 4YJHB 2QHXA 1ZKMA 4XDYA 4CLXA 3LC2O 4MINA 2CNBA 5G4KA 1I33A 1U5CA 1ADFA 4TZKA 1VKNA 1JWBB 3AWDA 3EY4A 2V6GA 3OETA 4NQZA 4CLOB 5JAMA 3SXPA 3L6OO 3W4IA 3AUTA 4QQRA 3U9LA 5EPOA 4OXYA 3TL3A 3OIGA 5FI3A 1W73A 1E3EA 3OJEA 2O7SA 4RZHA 4W4TA 3DMTA 4IIVA 1SO8A 3BHMA 3EAGA 3H9UA 3KZVA 4L76A 1N92A 1W6UA 2DBZA 3ZW9A 3KSDO 1GU7A 2IZ0A 3Q1LA 4OMUA 4IZIA 4PG7A 1H9AA 1NAHA 1V8BA 5TLSA 2AEMA 4NH4A 4EYEA 4GI2A 3EK2A 2FR8A 4R1NA 4E3ZA 2ZB8A 3OJFA 5L45A 3EVNA 2VUTA 4PIVA 2J6IA 3VDRA 4BIIA 4FIZA 1L1FA 4K26A 5DF1A 3UAGA 1B3RA 1MUUA 3HNPA 3JQGB 4MP8A 5CHEA 2JKVA 1VE9A 4YA6A 2J5QA 3QRWA 2JAHA 3SC4A 4EEZA 2HU2A 3E1KA 1NXQA 1B8PA 3OEWA 1I24A 4G65A 3ZWMA 1JKJA 1WDMA 1DC5A 1DPGA 4Y67A 3A4VA 5BR7A 3RFTA 1NPYA 3JQ9C 3N7UA 4IUYA 1YKFA 4FW8A 3WG9A 3LK7A 1U2GA 2EP5A 2Y99A 5ENDA 2OL4A 3ZU4A 1F14A 2FRDA 2GERA 1XR3A 1HWYA 5IJZA 4CMEA 4CQMB 1ZJZA 5BSHA 5F5NA 1YVEI 2YQ4A 4PZEA 1CEQA 2WD8A 1GL3A 2IODA 4URFA 3DFZA 1F17A 3NEPX 3ZNPA 4EUHA 2EG9A 3RUCA 4I5EA 2F1KA 2HUNA 3WXBA 4JXKA 1MGOA 4DC0A 4BNIA 1UH5A 3AOGA 5C7LO 3RBZA 5JO0A 2NVUA 4YJHA 4YEDA 2ET6A 4OL9A 2CY0A 3ENNA 4E30A 4BVAA 1PJQA 1QMGA 3QSGA 3PFWO 1QYXA 4CR8A 4B3HA 3W8DA 2X0IA 4RQUA 5A3JA 3TFOA 3N74A 4WLEA 5JDCA 3OQ1A 1PZGA 5C3MA 1ENZA 4KTVE 1UAGA 4RO0A 5FWNA 3VH3A 2V7PA 4QFCA 1OI7A 2AEJA 2QRKA 3F4LA 2X58A 3CZRA 4Y6SA 2HRBA 2FSVA 2OBNA 3G3EA 3Q9NA 1FDUA 5KVSA 4DTIA 1JU9A 4JBGA 5JC8A 1JKFA 3G1UA 3HN2A 4IM7A 1YOVB 1LSOA 3PJGA 4YJDA 4GAEA 5C7OO 1A4UA 1GEEA 1ZUD1 3PI7A 1U3WA 3RKUA 3RU7A 1T4DA 1C0KA 2B83A 3C1OA 2VRCD 5F1OA 1I2BA 4YACA 1ZO8A 2DQ4A 1VM6A 2YHIB 3RUHA 2B5WA 1IPEA 4L74A 4AJIA 2I6TA 1HDRA 3CTMA 3GEGA 1X7HA 2I65A 3WX0A 4PLCA 1P1KA 4HFJA 1MG0A 2I76A 5DBIA 2FMUA 2OHXA 5BSEA 2ZB7A 1U3TA 1VJTA 3GUYA 5G0VA 4UEKA 9LDTA 1EQUA 3AU9A 1F06A 3VPGA 4A26A 2VZ0A 1H6BA 2VRBA 5K6AC 5G0UA 1B2LA 2NVBA 4BO8A 5BSGA 3A28A 3IJRA 4XRGA 1RM3A 3GF4A 2VHWA 4UUNA 3K6JA 3CH6A 4IJUA 4CQMA 1KIFA 2C5EA 1F8FA 3PZBA 3JQ7A 1A9YA 2VRCA 3D5QA 2YV1A 1PL7A 5F1KA 1R37A 1SZJG 3VVCA 3PTZA 3M1LA 3DOJA 3RUIA 3KV3O 4AFNA 4OO3A 2ZTMA 4W7IA 2JJYA 4E31A 4BO7A 1FXSA 4FQ8A 2UAGA 4EI2A 5CDGA 3MEQA 1XA0A 4YPOA 2YV3A 2DC1A 3CSDA 3HHPA 3JD4A 4JNKA 3X2FA 3H9QA 1YGYA 3MJSA 4BL5A 5IXSA 1DB3A 4HX5A 3QVWA 1UDAA 4JK3A 2CD9A 2PFGA 3VPSA 3W4JA 2DPHA 2PV7A 4PVCA 1LBEA 2W2LD 2XXJA 2O3JA 2WEKA 1I36A 4K9DA 4EUFA 1Y5RA 1DJQA 4EEXA 1LLCA 1QKIA 4KWIA 1IHXA 1R66A 5AXBA 4E5KA 4DYVA 1E1MA 3I4CA 4JGBA 3IAHA 2VHVA 5I8WA 4BNNA 3R0IA 3OBBA 1NNUA 3FSRA 3TPCA 1YB4A 1SPXA 5G0WA 3ROPA 3KYCA 5JAZA 1EUCA 4ND2A 4MJLA 1KVQA 3DZBA 3HDYA 4LSMA 3SJ7A 4C7KA 4MVJD 1KETA 4WOJA 2WYVA 4TMFA 2DM6A 1G0OA 2QW8A 2BGKA 2AXQA 1M75A 1JWAB 1NFRA 3E03A 4NFYA 1GYRA 4HV4A 2J8ZA 1PJ4A 3LU1A 3D3EA 2DBRA 3EC7A 4XX0A 3KO8A 1WLYA 2YHIA 1DAPA 4L9RA 3KXDA 3ZZNA 3FNFA 3JYNA 2Q1SA 3JQ8A 1GUFA 4B4UA 3GC6A 1N7HA 2POQX 3DWFA 3UXYA 4XQ9A 4KWHA 1GV1A 3GUCA 4ZHSA 3BTVA 3T7CA 1D1TA 1YB5A 5C5IA 1ZK0A 4UUOA 2Y1GA 1PGOA 4DBZA 1R12A 3ZWNA 5DCYA 5EIOA 3IOYA 2X8LA 3JQAB 5LDHA 1FDVA 2NM0A 4BMVA 4BNXA 5B12A 3WICA 3FTPA 3B20A 4FPXA 5I7FA 1PU2A 5JW6A 1YB1A 5I7SA 1MP0A 1I10A 1L7EA 3IDSA 4XKJA 1UJMA 1RKXA 3RC2A 1HSOA 3AUUA 1RYEA 3ONEA 3BMOB 1B8UA 1KBZA 1EQ2A 2OO5A 4IDDA 3B1KA 3R3SA 5AYVA 2Q46A 3KLPX 5B1YA 1HE5A 1VSUA 3E9QA 1IY8A 4IINA 3AI2A 1HL3A 5JBIA 2AQHA 5A04A 2E37A 2W2KB 4IJWA 4BB5A 2G5CA 4N18A 1EBFA 5I7EA 4XB2A 2VHXA 1B15A 4GVLA 2BELA 4IDBA 1PJTA 4IDEA 4KOAA 4AJEA 2BRUA 4R68A 3U4DA 3JD0A 3G49A 4R9SA 4ZVVA 4E32A 4HBGA 4J1NA 1BW9B 5CAEA 4GBJA 3H2SA 4DQVA 1NP3A 4TVOA 2AA3A 2Q2WA 4HKTA 2QIOA 3LVFO 4YQZA 4CUKA 1KVRA 1SOVA 4MKRA 1CQIA 5BNTA 1B7GO 3MZ0A 1XWFA 4B4WA 3QWIA 5ER6A 4AJ2A 3OP4A 3OMLA 1ZK1A 1UZMA 3ZWXA 4DQUA 5FFFA 2FZEA 1SCUA 1T1RA 2Y93A 1RM5A 5L9AA 4AJHA 3RIHA 4BNKA 4JJFA 2CDAA 4Z3KA 1P1JA 5KVQA 1U5AA 1CWUA 2HK8A 4NBRA 1IZ0A 1SB9A 4D3DA 3SC6A 2C5AA 3AK4A 4UUPA 1FK8A 2YUTA 3LZ6A 4GKVA 1VL6A 3E9MA 4Z0TA 2QX7A 4F45A 4XGKA 1ID1A 4MDHA 4UVEA 4DL9A 4INAA 1J4AA 3P2OA 2GASA 5KKCA 2IZ1A 1PR3A 4GWKA 1PX0A 3RUEA 4LISA 3JQAA 5HS4A 4II2A 4A7PA 3IKTA 1KYQA 2H6EA 1SAYA 1GYPA 4OHUA 4BV9A 3E5MA 4PLHA 4XYGA 2EHDA 4YT2A 5KWEA 3NRCA 4AJNA 3ABIA 3LT0A 4TKMA 4DA9A 4I9UA 7ADHA 1ISHA 4YAGA 1GZ4A 4W9NA 4RPLA 2HJRA 3ZH2A 5TIIA 4GLOA 1FDTA 1JW9B 1VJ0A 3MJTA 4NR0A 3ZWOA 3BMOA 5L4SA 1XU9A 4CM9D 1JN0A 3R6DA 5TJ9A 2IXAA 4WK6A 5TQVA 1AGNA 4HUJA 3RCBA 2AQ8A 4FFRA 2TMGA 3K73O 5LC1A 3X2EA 4CMKA 3RJ9A 3GVCA 2PZLA 1P9LA 1SC6A 4H7PA 2W2KA 1U9JA 3H2ZA 4MVJH 5TC4A 4XIYA 4UEOA 4QEDA 4HFMA 1R0SA 1H6CA 3ROQA 3GNSA 5B4TA 1E1LA 2BH9A 2NUAA 2P9GA 4Q3DA 1N2SA 4YQYA 2AG8A 1BXGB 1GQYA 3G17A 1BW9A 4IIUA 4IMPA 3MTGA 3FPCA 2EP7A 4R16A 4CMJA 4NJMB 4I5DA 1DJNA 4E33A 2HMUA 1LDYA 4JIGA 5FF9A 3FHLA 4DPLA 2AQIA 4B7CA 2IYPA 5L7WA 3I9MA 4Y98A 1HYEA 3PQDA 3GHYA 5DT9A 4XWYA 5LCXA 4TZTA 4BUCA 2ZCUA 4D44A 2NSDA 2C59A 4G81A 2E82A 2WMDA 2WTBA 3KHUA 3OH8A 3O9ZA 3WFJA 4TRJA 1PL6A 2GDZA 3F5QA 3GA0A 2GR9A 3FNGA 3TN7A 1X1TA 4Z9FA 1PJ3A 5HM8A 1HT0A 2Y1EA 2EJVA 4RZIA 4CM6A 4WGGA 3OSUA 5DCWA 3HDJA 1J49A 2O3RA 3FD8A 5DP1A 3M2PA 4PZDA 4I8XA 1M67A 1TT5B 1A71A 4RVUA 1E3LA 3WLFA 2CFCA 2B37A 1E7RA 4PG8A 5IZCC 1FJHA 2J3IA 5KJCA 2GSDA 3DBHB 5G0TA 1BDBA 3RC9A 3I9KA 1A5ZA 1H2BA 1Z73A 4QXMA 1QSGA 2OUIA 3QY9A 4KMSA 4MKXA 3BIOA 1AHHA 1LSJA 2Q99A 5CP8A 4DC1A 3QVOA 5B4VA 3WTBA 2XXBA 3DAPA 1UXJA 4BV8A 3L0DA 3BZUA 4ZN6A 5JCJD 4KUEA 1E7QA 3A9WA 4I5FA 2ZYDA 4ZD6A 5KVVA 1QRRA 2J3JA 3INTA 4BO3A 1QG6A 2X0RA 1GQ2A 1ADGA 1E5LA 2VYVD 2X0JA 2D5CA 3TSCA 1DHTA 1PS9A 4BKRA 1E7YA 4WNIA 2C20A 3LC7O 1ONOA 4I9NA 3MJVA 3NJ8A 2AE2A 4D79A 4A73A 4M8SA 3ZHBA 5DULA 4GVXA 2YDYA 1T2DA 4JX8A 5L95A 2IEDA 3WIDA 1HXHA 4L4SA 2PH3A 3UGKA 1V3UA 1JTVA 3KUXA 4L4RA 1Z75A 4RF2A 4OKIA 5IN5A 2YY7A 1BXGA 4RL6A 1LRJA 1EUZA 5T8KA 1BVRA 4D0SA 1J5PA 1KERA 4NJMA 5JCJA 5DOZA 4CODB 4RF4A 4NIMA 3KSZO 5G4KB 5CDYA 2YHUA 4RJTA 1D7OA 2P91A 4NZ9A 3CTVA 5HS6A 2GRAA 3W6ZA 1K0UA 2OORA 4FN4A 5TX7A 3HZZA 2C07A 2RHCA 4LRSB 2OFPA 3ZWPA 3WIEA 5I9NA 1EVZA 4D42A 1SBYA 4PLZA 4C4OA 2X4GA 2X22A 1XELA 4M87A 4WASA 4XQGA 1KC3A 4NFSA 3PJFA 1O8CA 8LDHA 5FYDA 4OOEA 1Y5MA 3DO5A 2VQ3A 3ZV4A 1XG5A 3DB2A 1D3AA 1HE3A 4IS3A 3UICA 4TROA 3HDQA 1MFZA 4YT8A 2ZYAA 1GADO 4LSWA 4ZGWA 4R41A 5JE8A 3RBVA 4KP7A 2IDZA 1E6WA 1TT5A 2VNAA 3CZMA 5JCXA 4NPCA 3L07A 4XR9A 2R2GA 3DBHA 3WOHA 3ZDFA 2EEZA 2NWQA 4CM7A 3GAFA 3JQ6A 4E2ZA 1ZCJA 1AN9A 1UP6A 3KB6A 1G6KA 4YJFA 3GT0A 1XQ1A 4UREA 4ALLA 4MOWA 1CERA 4RPHA 4FDAA 2VT2A 2DFDA 1NVTA 4J6FA 1TB4A 3NYWA 3H65A 4WPGA 1V3TA 3TOXA 4JBHA 3OEYA 2QRJA 5I9MA 4XIJA 3TZ6A 1I2CA 1YDEA 5DP2A 1LDGA 4NI5A 4CUZA 2VT3A 1KVUA 1B16A 2O2SA 1WZEA 2B4QA 3D64A 1HZJA 1UDBA 3NT2A 1UXIA 2CSUA 4HNHA 5A05A 4GWGA 3RVDA 5L4NA 4KQWA 3B6ZA 2CVQA 4OH1A 4TRRA 2W4QA 2ZIZA 3I3OA 3I9OA 4R3WA 1U3UA 2VNSA 4L75A 5DBGA 2FN7A 1EEHA 1BXKA 2WYWA 3LYLA 3LT1A 4RV9A 2VUSA 4NBVA 4BNZA 3ADOA 4IJKA 1KVSA 1M66A 4J7XA 1LRLA 3GVIA 2DUUA 3S55A 3ZNOA 4EJ0A 1N7GA 1PSDA 2XF8A 2G0TA 4ZQFA 3G79A 5GZ1A 1EFLA 5KTKA 1VKOA 4GQAA 5EJ2A 3WTCA 8ADHA 1NPTO 3P2YA 1NPDA 2YQ5A 2OXIA 2YJZA 3QWAA 3B1FA 4OOFA 1MB4A 1Z82A 2GYYA 1NQ5A 2YZ7A 5ITWA 3LDHA 2BGLA 1C3VA 1E1KA 1WWKA 4R3NA 3U09A 3CEAA 3E82A 5THKA 1LSSA 3RC1A 1P0CA 4IDFA 2BI8A 1B26A 1ISMA 2ZATA 4YXFA 1T2CA 1H6DA 3EUWA 3PVZA 4FFOA 3F47A 4J7UA 4ND4A 4R4JA 4RPJA 4ZICA 5JYEA 7MDHA 4K28A 3EMKA 4PLVA 2Q49A 4XQCA 3GZNB 4PLWA 3OQBA 5CPFA 5DN9A 1Y1PA 2Q2VA 3L4SO 2XOXA 3HSKA 4II3A 2VHZA 5AXCA 1JLLA 3U4HA 2E6UX 4CR7A 3RUFA 2DTDA 1E0DA 3DBLB 3HQ4O 2HK7A 3PLNA 3GAZA 2R00C 1ZVMA 2CMDA 4IGFA 3ON5A 4XD2A 1KY4A 1DFIA 3GG2A 1SEPA 1H0KA 1DIGA 1BWSA 1DRWA 2A94A 3CUKA 3VH1A 3MWDB 5HA5A 3I83A 3MOIA 3ZGYA 3AY6A 3LT2A 4MP6A 4UAGA 1PS0A 4D46A 3E9NA 4P4LA 5A9RA 5L4LA 3OIFA 4BQPA 2BMAA 2Z1NA 2NU8A 2OGUA 1UR5A 4LGVA 3HG7A 3VZPA 3I9JA 4H3VA 5H82A 1EE2A 4G2NA 3K2EA 4IZHA 4TWRA 2V6FA 4JCOA 1P74A 4QO8A 1MFPA 3AW9A 2OOSA 4U0KA 5EN4A 1UP7A 2Y67A 3FNEA 2HDHA 3JQ7B 1QYDA 3I1JA 5TT1A 4YYZA 3GN1A 4FFPA 1B14A 5H81A 3WJ7A 4QECA 2E48A 4PZCA 1Q0QA 3DHEA 3GNTA 4P4NA 1ISGA 3W4KA 3JD3A 3ZU3A 4IPTA 1DIHA 1DLJA 2EKQA 1WDKA 5G0SA 3GR6A 4XGNA 4BNTA 1V6AA 2Y0EA 3JSAA 3ENKA 4Q39A 4W6ZA 1UZNA 2DBQA 5JO9A 3ASUA 4WCDA 1ZXBA 3DZIA 4M49A 3PQFA 3ZWBA 2AHRA 1H9BA 2YDXA 4BKPA 1YH3A 3DZJA 4XYMA 1HE2A 3WGOA 2CVOA 3BTOA 3U4CA 1K2WA 3MJEA 2NQTA 4WUVA 3GMSA 4MIOA 5BNIA 1E6EA 1E7MA 3PGJA 4NDNE 1O9BA 3KYCB 4YT4A 1HKUA 3AOEA 4E13A 1ISJA 5DDIP 2J3KA 5ADHA 1TLTA 4PRLA 1G0NA 1ZSVA 4CMGA 2PKQP 3GZNA 5TSDA 1GTMA 1PS8A 4XEHA 3W8EA 4D41A 3NV9A 1LDMA 3VPHA 1AE1A 3GVPA 3SJUA 5TF4A 2NU6A 4BNVA 1PGPA 3NTRA 1JVSA 1ZH8A 2C29D 3VPXA 3IUPA 4GX2A 2SCUA 1K6JA 3DBLA 2CF5A 2O48X 2UUPA 3OQ6A 4R9RA 5T64A 3ROKA 1HYHA 1M2WA 3JQ8B 1HDCA 4OAQA 4F46A 1M6WA 1V3VA 3DQPA 5A03A 1BRMA 3GK3A 4JLWA 4WEOA 3ZW8A 3E8XA 5GZ3A 4R5MA 1UAYA 2CF6A 2HK9A 2FOIA 3C24A 3HB5X 4EJ6A 5F5LA 1BGVA 4QX6A 1ZK2A 3L4BA 3SLGA 4CMHA 4ZJUA 3HADA 1PWXA 4E4YA 3ZU2A 5A4DA 3ZN2A 1NWHA 2NLOA 3HDHA 4IGEA 3JQBC 3RBXA 4J0FA 4PGFA 2A4KA 1FDWA 4U7WA 3SBOA 3NGLA 4U5QA 1X14A 4NHEA 4Y8VA 5KJEA 4J3FA 5IDQA 4DPKA 3L9WA 4B79A 1LRKA 3GFGA 3NAQA 2D2IA 3DC2A 3IL2A 5L51A 3W8FA 3QWFA 2IRWA 2I66A 1I0ZA 3K96A 2ZKLA 3WLEA 3OECA 2A92A 4QO7A 1KY5A 3QE3A 4BMSA 5DOVA 1NAIA 3AY3A 1O5IA 1HLDA 2A35A 4D0RA 2P9CA 1PJCA 4LVCA 4Q3CA 4H15A 2X5KO 3PIIA 2NTNA 1O89A 4R1UA 2LDXA 1F12A 4MIEA 3ITKA 3PK0A 5G2OA 1PL8A 1H93A 1YO6A 4DREA 2DTXA 4RVHA 4YR9A 2PGDA 3D3WB 3KLMX 5ICMA 3ETGA 1EDOA 5F3RA 1CIVA 1HSZA 2FPPA 4LCEA 1P1FA 2G1UA 2O3QA 3PWSA 3MWEB 1ZSNA 3QA9A 1I3KA 2BFAA 3GNQA 4CV2A 1E77A 3GHHA 1LDEA 2V6BA 2NU9A 3T7EA 4KQXA 3O4RA 5L40A 4BNYA 2PY6A 3E6AA 1I30A 5HBRA 1XSEA 1E5QA 1HLPA 2NVWA 3GMDA 1WVGA 4QFDA 3IIEA 2W2LA 1HE4A 5JDIA 1NTOA 4OM8A 1O6ZA 3EZLA 4DLLA 2Q45A 4NU5A 5CDUA 4U8GA 2GF2A 2HJSA 3D4PA 3OM9A 1LJ8A 1R15A 2JL1A 3H9EO 3RROA 3ZNQA 2Y1CA 3S1LA 4CLHA 1IYZA 1JVBA 4R69A 4A2CA 4KUGA 1IOLA 4ND1A 3PYXA 4O0LA 4JJIA 1PGNA 2UYYA 5DCUA 4YRDA 3K9QO 1WMBA 1IULA 3FCOA 1JDJA 1T2FA 3L9XA 4MVJA 2PTGA 4IDGA 1Q0LA 1PJ2A 3GOHA 4HFNA 5T5QA 5I9LA 3HB4X 1YBVA 3GPIA 3ZWAA 3PYLA 1YL7A 4GMGA 4IBOA 3IKVA 2W90A 3C1TA 1TA4A 2EERA 4J49A 4AJ1A 2FR0A 3JV7A 3WGHA 5AXDA 4CL3A 5EESA 1GEGA 1PEDA 1ZNQO 2WSBA 3ZU5A 4CM1A 1QR6A 1I3NA 2NTJA 2NQ8A 2JFGA 1QP8A 1WW8A 3O38A 3PHLA 2Y0CA 3CIFA 3PWKA 4D7AA 1YQXA 3P19A 3VH4A 1U4SA 3H4VA 5C37A 3WYBA 3ONFA 2FR1A 4FOSA 1MX3A 3K31A 2B35A 1W4ZA 2O3SA 4NBUA 3RSHA 3AU8A 2TMDA 1P44A 3FBGA 3D3WA 1HETA 3LT4A 1N1GA 4Z0PA 3JCZA 2GN6A 3BA1A 2GZ2A 1ZSYA 2YFHA 2RH4A 1ZBQA 4GL4A 5U1PA 1Q7BA 3U62A 1VC2A 1C0LA 4P8RA 4UULA 5MDHA 2Y1DA 1HDOA 2VWPA 4OXNA 5DBFA 3PPIA 1VL8A 1S6YA 3DTTA 5TRTA 2ZYGA 1JAXA 3NTOA 4LN1A 4FOOA 1ZW1A 5EL0A 3EGOA 4M55A 5IF3A 5K9ZA 3H9JA 1ULUA 4WCFC 2GZ3A 4BKQA 1GPDG 4DIBA 1CRWG 2DAPA 3DOOA 2JFHA 2PGLA 4TRMA 3QVXA 2X6TA 2I67A 4BNLA 3DR3A 1HEUA 4MVJF 3OJOA 3IMFA 2GGSA 3JQ9A 2PKRA 1EVIA 4ID9A 3EYWA 1I8TA 3K2BA 3RU9A 3WQQA 1E7WA 1X0XA 3GDGA 1P33A 2VN8A 1PQUA 2HO5A 5A9SB 3MJCA 2VZ8A 2E4AA 1HYGA 3WWYA 3PQEA 1NX6A 3RC7A 3VVBA 4F6LA 2X5JO 4E2XA 4FGSA 5EINA 3PXXA 1YXMA 2GN4A 2ZJ1A 3LLSA 3FTNA 2EGGA 3HN7A 4J16A 2VOJA 2XPCA 2YV2A 3DZFA 4DRYA 3DMTC 1QLHA 1XGKA 2RCYA 3CPSA 3Q2IA 3TOZA 3G0OA 4BO9A 1MLDA 4WLVA 4MVJM 3WYEA 4FR5A 4N54A 1UZLA 1AXEA 3D0OA 2C7GA 3GDOA 2GZ1A 4HNGA 4ALKA 3CXRA 4FFLA 4JP2A 5T6BA 5JMPA 1H2HA 4H16A 4CLDA 3CE6A 3NT4A 4B4OA 5IZ4A 4EGFA 1XEAA 2NU7A 1T2EA 2HSDA 3AJRA 5AXAA 4N7RA 3OJLA 3WB9A 3HFSA 4BOYA 2B4RO 3TZQA 1DSSG 1CF2O 4PFJA 1OFGA 4JROA 1VSVA 4AJ4A 4GSLA 3PHIA 1DIBA 2C2YA 4J1SA 1C14A 1GFSA 3VTFA 1Z7EA 4RF5A 2AW5A 4IMRA 4RF3A 4CM9A 4D43A 2XAAA 4OQZA 4D45A 4A5OA 1XYGA 3RASA 3C8MA 1WPQA 5JSFA 4CMEC 3QVSA 4NBWA 4ZQGA 4EJMA 4L4XA 1ONNA 1YQDA 4FS3A 5CDTA 4Q3AA 3KSUA 2O3UA 3UN1A 4JN6B 4NJOA 5KJ6A 2RH8A 1IPFA 4P4GA 4P22A 1YONA 4CMAA 1EZ4A 1N9GB 3DDNA 4XJSA 4ZQEA 1FMCA 9LDBA 3ZCXA 5CG1A 5L3ZA 4XB1A 5K6AA 3GGPA 2P68A 3DL2A 3L6DA 2CVZA 1TT7A 1P31A 4YDRA 4LMPA 3STHA 5A9SA 4PG6A 4AJLA 1LLQA 5JLAA 4DYDA 3KVOA 1L7DA 2GPTA 3QP9A 4FJ2A 5JDCC 4RDHA 4CJXA 3I52A 1V35A 3WGTA 1Y9EA 3DOCA 2ZJ0A 4OSPA 2R6JA 3GGOA 3GGGA 2UVDA 1LNQA 4HXYA 1KC1A 1P3DA 1PQWA 5CPBA 5U9CA 4IQ8A 3LF1A 4XYBA 3GLQA 5HWSA 2O4CA 3I6QA 1HF3A 3IP3A 5T67A 1DO8A 4J91A 4PG5A 1H6AA 3VZSA 1TVEA 2GUGA 1E7SA 2C7VA 2PWZA 4BO5A 2NADA 2WWRA 3BMQB 3K8ZA 3DZHA 1OAAA 3CINA 1YDWA 4I08A 4NFHA 1I3MA 4O63O 1R4MA 2O2YA 5MGBA 2ZB4A 1U28A 4J4HA 1DFHA 2PZKA 2W98A 1R6DA 2JD0A 3IJPA 2Q4EA 1E3JA 4B7UA 3F1KA 1GZ6A 2HLPA 3FBTA 2ZTUA 2QRLA 4FFMA 4GX1A 3RKRA 1JA9A 3U5TA 1ISFA 2I3GA 4G5HA 1U8FO 3JYPA 3GH3A 3ZHYA 4DIOA 3E5RA 1PZEA 3OA2A 4CUJA 2VYVA 3KEOA 4WEQA 3NTQA 1KVTA 1U1IA 5JPIA 1GYQA 1YJ8A 4DVJA 4WNCA 3AY7A 5IDYA 2D1YA 3D4OA 1V0JA 4GX5A 1U4OA 4J43A 1NBOA 2VYND 1E1NA 2Q1UA 2OP0A 4K6FA 3ETDA 1N9GA 3GZ4A 4PLYA 3S8MA 4DLBA 1AHIA 4JJGA 1Y6JA 2V6MA 4J1TA 5TT0A 2DFVA 4MVJG 3RAJA 2JFFA 2JCYA 2Y05A 1D4FA 1GCOA 4BNGA 1OC4A 5BSFA 5COBA 4BO0A 1QYWA 1XCBA 3GVXA 2RBEA 4ALIA 1LC3A 3R3JA 4KTTE 2BFOA 4RVSA 5KVCA 4DPMA 1J0XO 3ETEA 1K6XA 3OFSA 3M2TA 1GR0A 3JQEA 4TRNA 1HDXA 3H9GA 4FJ1A 3PHJA 2O23A 2Q3EA 4I9HA 1OBFO 3VOSA 4IDAA 1PIWA 3RUAA 3GPDG 5K0ZA 4N5MA 4RVFA 1LTHR 3QLJA 4RLSA 3FR7A 1W8DA 2OZPA 3BTUA 3D4NA 3DBVO 2UV8A 3LLVA 4MPDA 4AJPA 2YW9A 2JHFA 4J7CA 1P77A 1R4NA 1LI4A 1UP4A 4TQGA 1I2ZA 1P45A 4PLFA 3V5NA 4OGWA 3S2FA 4B8WA 1KS9A 1B0AA 3NDJA 3O26A 1NM5A 2Q2QA 4HP8A 4QSMA 3BMNB 4FGWA 4CM8A 1HDZA 1D1SA 2DPGA 2GN9A 4Z0HO 2EIHA 3ADPA 1E3WA 5KJ1A 2P5YA 1VJ1A 3BMQA 4PLTA 1CETA 1B8VA 1T4BA 3JD1A 5JS6A 4R1SA 3QV1A 5CG2A 4E0BA 3PJEA 4C7JA 3UOGA 3DEYX 5IDWA 2WE7A 3DFUA 3H3FA 4UVDA 4RVDA 4LW8A 4DLAA 2RIRA 1X0VA 1NR7A 5CDSA 1P1RA 2GLXA 2Y68A 3NDIA 3WSVA 1K89A 2DU8A 2V65A 1A72A 4E5NA 5H83A 1NQTA 1C0IA 4NBTA 1U7HA 4O59O 1ZXLA 4L73A 2UUOA 3C7CB 5A5EA 3TZKA 2BKAA 3WNQA 1SEVA 5BQFA 4Z3DA 3A06A 4J90A 1ADBA 4DWVA 4J4TA 1F8GA 1LA2A 2F00A 2D5AA 1GV0A 3ZWYA 3KEQA 3QWBA 3UHAA 1X7GA 3N58A 1OOEA 5ER9A 3E48A 3F9IA 4AJOA 4W99A 2HMWA 2IEBA 5THQA 1WNTA 4XQEA 3FR8A 5KKAA 1EUDA 3R1IA 1ARZA 3UCXA 4XJTA 4GH5A 5DZSA 3PWZA 4YCAA 3QQPA 3COSA 5JMWA 2PD3A 3F6YA 2DKNA 3AUSA 2PD4A 5JXWA 2HAEA 4Y6RA 3JQFC 4QTZA 3TDKA 4IJVA 1FF9A 1FDSA 4FD3A 1XQ6A 4OQYA 2X1HA 5T57A 4Y6PA 4EZBA 4CL8A 1ZK4A 5KIAA 4IQGA 1DC3A 1WZIA 4FCCA 5A1TA 3K92A 1RWBA 3EHEA 2P4QA 1HRDA 4ND5A 2B69A 2EKLA 2QQ5A 2HKIA 3AM5A 5U4QA 2WM3A 3I6IA 4IXWA 4EDFA 1IUKA 4DXHA 3P5SA 1BDMA 1PZFA 2G82A 4GGPA 1T26A 1YWGO 2A9FA 1IZ9A 1UXGA 1D8AA 4O6VA 2VHYA 1T25A 3JQCA 4AVYA 2HMTA 4J4BA 4GPD1 4WLFA 1Q2XA 3LSYA 4E6PA 3BHIA 4CQLA 4PLPA 2VTDA 1TXGA 2P2SA 4CMBA 4NMHA 2WD7B 5I8ZA 4IQ0A 2AEFA 1RM0A 3BMNA 4AJKA 4W82A 4J9UE 1SB8A 1Y81A 4WOKA 3ZI0A 1YL5A 4OKNA 3PDUA 4HY3A 3H5AA 4XDZA 1H5QA 2EW2A 1G1AA 3ANMA 4R51A 1PQPA 3LC1O 4EBFA 4E5PA 3C3XA 4GSKA 3EVTA 1Q1NA 3M1AA 3DBRA 2D3TA 1YS4A 4LVUA 4AJJA 4NG5A 1WP4A 3RFXA 1PJSA 3BYZA 3U4IA 1X15A 4ZRNA 2X9VA 4U0JA 3QHAA 1Y7TA 1QYCA 2JAPA 1E92A 3QVTA 4BNHA 3V2HA 5F21A 1X7DA 1MXFA 1GUZA 1GDHA 2X9GA 4WE3A 1I01A 4YJFB 5TGDA 1Y8RB 1AXGA 4FJ0A 1ZK3A 2OP1A 3C7DB 4W9NC 3WR5A 1GZ3A 2C82A 5HRUA 3RI3A 1NQOA 1NYTA 1ISIA 2Y0DA 1DRUA 1EVYA 4YAJA 3VHRA 4B8ZA 5JC1A 3WFIA 1ORRA 2PR2A 2AQKA 1NHWA 4U6QA 5J23A 1E3IA 2OMEA 3AI1A 4X54A 4OXKA 3V2GA 3ZNNA 5IZCA 1YE3A 3AM4A 3VZRA 1I32A 1LU9A 3BXXA 5IAAA 2BF7A 2FPIA 4CLOA 2H9IA 5ILOA 4YAKA 4YWJA 1JKIA 2H1SA 4J9VA 2Q1WA 4F3YA 2Q50A 5KNLA 2EXXA 4PRKA 1T1SA 4OIMA 3T4XA 3MCVA 1DIAA 1QLJA 3JYQA 1OC2A 5JY6A 3ULKA 3V8BA 2GO1A 2I3AA 4CMIB 1ONPA 3INRA 3ONDA 3W1VA 1W0CA 4MIYA 3WDSA 5I7VA 3EDMA 4EW6A 4E12A 3KYDB 4CQMD 2JD1A 3ITDA 1NFQA 2H63A 1N5DA 1A27A 3RFVA 3TL2A 1QORA 4GLLA 2Q4BA 1C0PA 2GNAA 5TJHA 2H5LA 3TJRA 4YAEA 3JQGA 2WD7A 5IFLA 2BFPA 2W8ZA 2PH5A 4J2OA 1DHRA 4LRTB 3FPLA 4HADA 1BVUA 4CR6A 3NKLA 4FSHA 4IY1A 3NJ4A 5AQ1A 1A7AA 3AFNA 3UKOA 1XKQA 4BKOA 2EF1A 4KUHA 3ZWVA 2JCXA 3HUDA 5EQFA 2PLAA 5FEUA 5IDXA 2BI7A 2PKQO 2D0IA 2RAFA 1NVGA 4RQTA 1Q7GA 3LF2A 4BGIA 3GEDA 3TF5A 4YAIA 1PWZA 2VZ9A 4NK4A 1KOLA 3AUAA 3PHGA 3CMCO 5B4UA 2B5VA 2GCGA 4XR4A 2EGHA 1AUPA 4PG4A 4PN3A 1U7TA 1Q0HA 2VWHA 2X23A 3DZKA 4ITUA 3ORFA 4OSOA 3CMMA 3V1UA 4A10A 4BNUA 1VI2A 2Y1OA 3FWNA
chains in the Genus database with same CATH superfamily
1L7OA 3JWIA 5FQOA 4WECA 3BF7A 1TFUA 3DMDA 3PIDA 2GEKA 2LKDA 3OIVA 3CUUA 4K1LA 4L5IA 3MTJA 4MO2A 3T7TA 3BZWA 2QZ9A 3TL6A 1MC4A 4UOEA 4R9UC 1E20A 3AKCA 1BGWA 2EKZA 2LTAA 3ZGXA 3S2EA 8MHTA 1OBOA 4P54A 3DG9A 2OQ2A 1YCFA 4QYIB 1JQBA 4CZ2A 4QFMA 3TUZC 2Y66A 4KQ2A 1PJAA 4XZ3A 3FGOA 4XIFA 1IL0A 1EDBA 1QZUA 2PZMA 3I04A 4MUHA 1J0BA 5KMGA 1WW3A 1OIVA 2GXSA 4G9BA 4KE7A 1LEHA 1X77A 2O5VA 1MV5A 2GRJA 2PRSA 3BGVA 3OOWA 4HSGA 4IVPA 1ZVVA 1QAQA 3FMIA 1A3CA 3UJ8A 1BG6A 3ANNA 1O4VA 4KQEA 5KTNA 1FU8A 4CMIA 1XDWA 2NN3C 1ENYA 5JIBA 1KI3A 5K0SA 2CMHA 1PTJC 4D3SA 1TZMA 4N40A 2O59A 1T9CA 2QD4A 2SHKA 1R18A 1UPXA 2QVYX 3INYA 4FBGA 3UMRA 4C0AC 3PFIA 3QITA 4AKTA 6AT1A 1YS2X 1T24A 1UWKA 3V1YA 3ORYA 4CCWA 4DMKA 4PVDA 4JV5B 3K4QA 4QJ3A 1USWA 5C5CA 2DCMA 1UXKA 2E87A 2A0FA 4K9LA 1LQTA 2VOEA 2NXNA 3S40A 2P9EA 3GWZA 4PX2A 2YJ3A 1TUBA 2FWAA 3AR2A 1WXDA 5JS2A 3WBFA 4A82A 4UTPA 1R6BX 5JJ5A 4FNAA 4KR3A 3L01A 1UUFA 4L0DA 4MV9A 3EGWA 1MOSA 1GTVA 3K30A 1E79D 1L7BA 4N5NA 1GAXA 3Q3CA 5L3VA 3GEMA 1LDNA 3KXLA 4BS9A 5IS2A 3GCZA 3H1AA 3LQYA 2YHSA 1E6KA 3Q7SA 1GAEO 3IVMA 1N1DA 3DP9A 2M98A 4UVHA 1MB9A 2W4IA 3P0HA 1YV9A 2ECOA 1Q1AA 1ZCAA 1Z22A 3EXG2 4I5IA 3B70A 4XWOA 3A6ZA 1U99A 3N6RA 4PBTA 3ENQA 3VR5A 3PXEA 1D1QA 1EM8A 4BLRA 5DYIA 3VR3A 2DTEA 3G0BA 5J1TB 1KU0A 5AESA 5FTLA 3Q41A 1QIMA 1JI3A 2J4FA 5KQSA 4Q4HB 3WMEA 1DELA 1T5BA 3RARA 2VA8A 4ROSA 3VYWA 4MTLA 3N86A 1QAOA 4JI8B 2YCBA 2O52A 1ES9A 2P2GA 4WSOA 1YHNA 2IDKA 4B46A 3BVPA 3T5PA 5EA2A 2P30A 3P9ZA 4D98A 3V1LA 5JQWA 1E6UA 4DADA 4HZGA 1T5OA 2VHTA 2YC2C 1RXCA 4R9VA 2I99A 2WIGA 4ZO7A 2FF7A 721PA 2X7JA 5E4JA 4LDPA 3CVUA 4BO6A 1Q12A 5IKEA 3GEHA 1AO0A 5K4AA 2RBGA 1KAQA 3QH4A 2PGNA 4FB5A 3ELWA 1JFFA 2F64A 1WV1A 2R7NA 5DVZA 1Z56C 4LQLA 1JMVA 3FLEA 3KJHA 2JLVA 1GNPA 5ARDA 3MOSA 5LWHA 2VUUA 2XECA 3FDFA 1U65A 3OPQA 3Q7QA 1BXRB 1N5JA 3KU1A 4FC7A 4MWGA 4ZAXA 5IKPA 4MW4A 1NW9B 3QI7A 1E2BA 3PXAA 1GZVA 2X7HA 4OJNA 3WGYA 2CVPA 5JEDA 2IY8A 4JT9A 2O3TA 2ACEA 4BASA 3HFGA 2RKOA 4NZOA 1MB2A 2GO7A 4EMUA 1WMAA 3I4FA 3RC3A 4E5MA 4MUYA 1Y8QA 1G5RA 3V46A 4U7PB 4WINA 5EQDA 4W8GA 2C2BA 1F6BA 2H1WA 2JVIA 1GGHA 4LPKA 3BJMA 2PKWA 4UKDA 3WMXA 5BWOA 2P6PA 3ZWWA 2X5NA 3QW2A 4V0ME 5K6TA 2CDCA 1EVEA 1VGQA 4ENVA 1FE8A 3HGQA 4CDGA 1LVUA 3L7KA 3M82A 5JNSA 4IIHA 4EUEA 1MRNA 4R54A 2C1ZA 1I3LA 2QENA 4RJLA 4N5LA 1UAAA 4P4SB 1A9PA 3FA2A 4OYYA 2X4IA 4TSKA 3U5ZB 3NHJA 3VTAA 5DM2A 1CJCA 1N2HA 5K0NA 4OUDA 3B82A 1KI6A 4H9GA 4MV5A 1Z47A 3AVTA 3O9MA 3EE6A 3SXJA 1AH2A 1T4CA 3HGMA 1E9RA 2OZEA 4L0QA 4Z9BA 3WGUA 4NJEB 3KOMA 5GY7A 2O7RA 2ZUTA 5JAUA 1BMFA 4P53A 2H54A 1PVOA 4I1IA 1NJ2A 1MH9A 4KDEA 5IN4A 3GL9A 5KX5A 3DEIA 4DMGA 2COUA 3OHSX 3FI9A 3JASB 2AFHB 2EZTA 1SUWA 3SIRA 4LV6A 1L4EA 4Y7CA 1PZHA 1IQ0A 1H94A 1P0FA 1X80B 1BDJA 1R0KA 2R5FA 2A58A 4WLUA 3Q87B 1FUUA 1OLSA 1OQAA 3LLCA 4RESA 5T3YA 2O8BB 3JYLA 3U1VA 1AQJA 4YGYA 3NVDA 3SHOA 2PJUA 2OHVA 2CNWD 4XRRA 4ZARA 5CFPA 2HBRA 1Z5NA 1JBKA 3KQVA 3KZNA 2NGRA 4R8RA 5DMXA 3Q6MA 2QRNA 4Q3EA 4MIKA 4CEJA 1K5PA 3B2NA 4GI1A 5J5CA 3ZCPA 1QGUA 3QWHA 3FM9A 5T7BA 4JI0B 2A67A 2XUQA 1KDTA 1LSUA 2Y27A 3L06A 3CKYA 4AS2A 1NF9A 3NUGA 2Q8QA 1VL1A 5EKUA 3NIGB 4ZRDA 3ST7A 3WJAA 2GETA 3LXRA 4DR2B 3A14A 5H0IA 2A5DA 2N75A 3GT7A 4BNDA 3WRWA 3GDWA 2ORWA 2DE0X 1MA0A 3E23A 3F2VA 1KBOA 4MS4A 4GX0A 4YUWA 5B2FA 3LBNA 2FQ1A 3HP1A 1IY0A 1X1RA 4ZOEA 4MUXA 4H6VA 5EP1A 5EXXA 2AE1A 2E5WA 3JALB 3P7MA 4ON9A 3Q9UA 4RSRA 1CPYA 3PCRB 1QM5A 4KREA 4JB8A 1GGFA 2XMCA 4MROA 2WG2A 3M6IA 2J9GA 4S1PA 1C1DB 2CNWA 3W5IA 4Y9RA 9MHTA 4LFAB 1L5HA 1XXHE 1DC4A 3ZGLA 1FA9A 3E18A 3I32A 6ADHA 4DT1A 2CMKA 3HVHA 1ND6A 3VSAA 1Q7CA 3A6EA 1CZNA 4DKJA 5LUAA 4FILA 2OQVA 4BMNA 4IIBA 3ZJ5A 3KFLA 4BGUA 2DUMA 1UMCB 1H85A 3IDOA 1J2UA 4H4CA 4LUCA 4UPDA 1Y82A 5AOBA 5A06A 4RCVA 2N47A 2PSFA 4P5PA 4BQIA 3AHIA 5KYTA 1KJJA 3Q3IA 4GBMA 1KHHA 2C78A 5P8WA 4YB8A 3IQHX 2P0YA 2RGAA 3EFOB 5L7YA 4RZXA 4HDSB 1VL0A 3FOAA 4FFNA 4BAZA 4BDSA 1BMDA 4MAMA 5K09A 4CMCA 4IZ6A 5D3MB 5I48A 1D2CA 2FPGA 2V97A 5SY9A 3M8KA 2J08A 3GJTA 1UPFA 4LDQA 3B1VA 2Z2IA 3C3DA 4Q3NA 1XAHA 3FB4A 3DHNA 5KYWB 1C8VB 2GYUA 4CV3A 2ODEA 5IK2D 2LD4A 2QR2A 2DUJA 3PDCA 3RVLA 3I64A 3I73A 1A88A 1CUBA 4W6QA 2OZLB 3VOAA 3KEMA 3QKTA 3DHYA 3H2JA 3AOEC 4L5JA 3O91A 4UASA 4G0MA 3ZTWA 1XMPA 2BUBA 3OU2A 4HB3A 1U5BB 3H5NA 3WGQA 2FYTA 4U00A 5M5BA 1E0KA 1TAGA 1U2PA 2R8OA 3DMPA 2C00A 1V5WA 1U0HC 2QUZA 3D0KA 4BMYA 2XMRA 1EVJA 4FS8A 1G5HA 1YZNA 4PYNA 2VH2A 1P62B 2ATVA 1X1EA 1NVKA 1Q91A 2KI5A 3IUMA 4H4EA 4R6XA 4YBZA 3TQHA 3HABA 4BFCA 5KNDD 3RADC 3AB8A 5SY4A 3N5KA 1O94D 4RE5A 2JBHA 2VFAA 4P34A 4QODA 2JJMA 3CJRA 3QOYA 4X65B 4BO1A 5IC6A 1EXDA 2J0UB 3LOPA 3MELA 1KRWA 4EGAA 4KRXA 4LNAA 2DFLA 3VAYA 4YUZA 1OY1A 1RXYA 3CZPA 4HDKB 4PAWA 2V9ZA 3C7TA 3ROEA 4J3NA 1AKWA 1R0LA 3S2GA 1BC5A 3CVOA 3O8QB 3P9NA 4O2BF 5EG5A 3TKLA 3V2UA 1XZKA 1HMPA 1SKUA 2AG5A 2CL6X 4JLSA 2O8CA 4U5XA 2ZRLA 4YRQA 5CEJA 1UPBA 3BDVA 1ZUHA 2PM8A 1H0SA 1AKQA 2J4CA 3DP7A 3NX4A 3WWDA 5IJ0A 4RHTA 4GPBA 1SQGA 1ADYA 5DK4A 3R5FA 5JSKA 1T3TA 3ZK7A 1MDBA 1F5SA 1M6EX 3UW3A 5DBOA 5KYKA 4G8CA 4O3MA 5K8UA 1ZHHA 3L4BC 4WCFB 3JTMA 1D5CA 4CQNA 3TKYA 1E2JA 1P72A 2QN6A 1U2DA 2RK6A 4DRZA 4F9FA 2QJTA 1OZAA 5C7IO 4GXNA 2ZAOA 2ZBUA 2GKSA 4DV4B 1Q3HA 4YCNA 1J8YF 5KNDA 5A5VA 1M6YA 1OASA 2G5TA 3C6KA 5FOVA 3W7AA 1FVFA 1O94A 3MFQA 1XNHA 3VSBA 2A9QA 4BE4A 3ECCA 3FFBA 3VFDA 4YTEA 5CA1A 3NCHA 2RGUA 3QLUA 2GCIA 1SMKA 1QB8A 3GMTA 3LUKA 3C43A 4FLMA 4JUDX 3S2IA 1Z5WA 4BHTA 1G8YA 4ONEA 2ZE8A 1CY0A 1GY8A 4HH0A 5IC5A 4FDLA 4AY6A 1JZQA 2I87A 3FYDA 4FGLA 3S2ZA 1IZYA 4NZMA 2DWUA 1DE0A 2VHUA 3SZUA 3VDQA 2I2WA 2ZRQA 1RYDA 4F6RB 4NK5A 2ESRA 1WHTB 2NUTA 3HO6A 3KXKA 2EJUA 1L3IA 2G07A 1I6LA 3WDKA 5JEEA 2VLIA 3QMMA 3N2GA 4JBWA 3VAZA 5GINE 3L6EA 4CU2A 4OXRA 1OB5A 3AM1A 3V7NA 1KZ1A 1P2VA 2CLOB 3H9BA 4A15A 3OOJA 5HK9A 3SQXA 4LXTA 5EY5B 4BBPA 4KZPA 1ZIDA 3OD1A 1IC6A 2EAUA 2AMFA 4BGEA 4V0LA 4B75A 1WZNA 1HORA 3BXPA 2BCGY 2ZVDA 1HTBA 4QPCA 4RBNA 4D92A 4EQ6A 2GTPA 5DBHX 5AVRA 1XN4A 2WTAA 1ECPA 4JA2A 5FHRA 4A91A 2DETA 1LLDA 1XVAA 6PFKA 4LK2A 2B8WA 5EIBD 4FSDA 3RWBA 2E5FA 4LHYA 2PK3A 3OY2A 3RTCA 3WNVA 5A2QA 5JALA 4KHPB 3DOUA 1ESEA 4Q9IA 1MD9A 1SCIA 4GPTA 5HF6A 4J0DA 3KT6A 3U3XA 2HA4A 1A4IA 1E5XA 2MOKA 2QUBA 2V7UA 3IDFA 4LYHA 3REGA 5KNBD 1DOHA 1YRQA 3JD2A 4AY2A 1X42A 5DI3A 3PJDA 1KI2A 1PJLA 1ZCZA 1GVNB 2NACA 3INNA 4MI3A 3BB3A 3RABA 4WJZA 5KPJA 4F1KA 1JKJB 1TW3A 2ORIA 4I3GA 4RA9A 1W0KA 2ACKA 3IJEB 3UJPA 3GLHE 4RLHA 1BDHA 2CFOA 2EW1A 4RKQA 1FTSA 5EIFA 4Z51A 3DAOA 4QUBA 1VI5A 2R66A 5IVKA 4KQKA 2ILVA 2OY0A 5JAPA 5CVCA 3V7YA 3AQIA 4IICA 3ZHXA 3ESRA 2OCAA 1BWPA 5EQJB 1V71A 3N6VA 4HGQA 3AF3A 3QF7A 4FZRA 2IXFA 3P71T 5CA1F 5FBQB 2X6QA 3A6FA 4C7OB 4CLRA 2QAGC 4JVSB 1A7KA 1Z6ZA 1E99A 3A0UA 3BFXA 5HTOA 4UAVA 3AO0B 4LBVA 4YVFA 1DXYA 2PGOA 1H3EA 1BJKA 4FBLA 4OK6A 2O1XA 1Z16A 2XMDA 1W0JA 3TZCA 4BFWA 3BSYA 5BYJA 3NT5A 3F5SA 2RJ3A 3RJMA 4RTMA 2ZI3A 4ER6A 1YA6A 4DQXA 1KF0A 1K7YA 4NAVA 2ABWA 1A9QA 1EP9A 1X1AA 1H1LA 2NVUB 1GN8A 3I6ZA 4YJHB 3TD6A 2QHXA 4JI4B 4K9RA 1UF9A 2ZT8A 4XDYA 4CLXA 4COKA 3GLGA 2CNBA 2WJYA 3ENZA 4TZKA 3AR7A 1WCIB 2LIVA 1G5PA 2IS6A 1JWBB 4BEJA 3Q3VA 5F1YA 3OETA 1ZRHA 3OCYA 3LPLA 4CLOB 4BC1A 1KIMA 5LBUA 3SXPA 1WPRA 1Z5PA 1K5DA 3OSZA 1K98A 3W4IA 2WQZA 4QQRA 1D4AA 2B5OA 1L2TA 2B8EA 2K4MA 2OCGA 3RS2A 1NYRA 1P73A 2YWRA 1J9GA 4HCJA 4FNGA 5FI3A 5CA0B 5I9TA 5HPYB 1FY2A 2O7SA 5AVUA 4RZHA 4MW9A 1FUIA 3DMTA 1TYBE 2JEOA 2IX3A 4QRDA 3HU3A 4LZPA 1YK0A 3RAPR 3RRNA 1IH8A 1A5BB 3FIUA 5H7XA 3WDMA 3KUDA 3KSDO 4OF4A 2WT9A 1SCQA 2IDMA 3NHKA 5HVNA 4TZ0A 1H9AA 4G0OA 3M6LA 3UKDA 1NAHA 1V8BA 2FW8A 3DO8A 2AEMA 4EYEA 3KKLA 1E2FA 1FW8A 4GI2A 2AR7A 3EK2A 1FBTA 1YR9A 2FUEA 1QQTA 5TY0A 3RSGA 1EP1B 1XROA 4FWTA 4OGLA 4JUFA 3ZH9B 5L45A 4JBYA 2FX3A 3I58A 3VDRA 1TQ8A 4NBKA 4PPYA 1UBHS 4EHNA 5DYYA 4X66B 4N48A 3QE4A 2GJAA 4MP8A 3T61A 2AOUB 2JKVA 3QZUA 1LVGA 3P26A 3DEFA 4BN5A 2O0JA 3JTEA 3SC4A 4I50F 1CJMA 3E1KA 1E2GA 1XRNA 1U0TA 1DC5A 2A1IA 3VU1A 4EF6A 5A3QA 4QE3A 3DV0A 3EPLA 1N6HA 3I9FA 3O1HB 4RIHA 3D3NA 4AAYA 4EW3A 3JQ9C 1ZM3A 3VQTA 3WG9A 4KV9A 5AJYA 3LK7A 4D97A 4QNMA 1U2GA 1X7YB 3G5TA 3IBCA 4R1LA 1QHNA 1TGYA 3BFPA 2Y99A 5ENDA 1R64A 2FUNB 2ZI5A 2OL4A 3PHCA 1F14A 2IU6A 2PIDA 3QI2A 4IDPA 4XLZA 3T6KA 2DX7A 2PZFA 4O4IA 3W9SA 5IJZA 2IYXA 1R6VA 2N42A 3HBMA 3KXIA 4WXMA 5C9ZA 1VCHA 2IHTA 1G8FA 3OX4A 3M4NA 3WHKA 5HRCA 5F5NA 3S1AA 4HDNB 1Q77A 3QUBA 2WD8A 1ORHA 3FMVA 3I6BA 2IODA 3PD0A 1KZ6A 4R84A 4CKYA 2OWDA 5SZHB 5JADA 3NEPX 2BGNA 1XCJA 3EVCA 4GPIB 4QXPA 1NJ6A 1LFAA 3OM0A 3IRUA 4POOA 4Z5XA 2MCFA 5C1OA 1MGOA 3EXFA 3P9SA 4GOJA 5JI2E 1MIHA 5FQNA 2PS9A 4PTYA 2AS0A 1JG6A 5JO0A 1D8TA 2ET6A 3ZYCA 1TECE 4OL9A 3LHFA 4MYDA 5AVZA 5E95A 1G9XA 1K6MA 4TTIA 2X4LA 3IERA 3CRMA 4GIBA 4B3HA 1MJGA 3P9QA 2X0IA 3S6JA 3WYDA 5A3JA 3TFOA 1OXKB 3TJMA 4BLQA 2BR4A 3P2KA 3NWBA 5KMGB 4LSZA 5FWNA 2NZ8A 3ESAA 3HP4A 4NU8X 4PZPA 3OJXA 1QDLB 1U0RA 4I1VA 1OI7A 2XAUA 5FOSA 1SHTX 1WU7A 2X58A 1J20A 2P8SA 1Z9BA 3PNQA 4Y6SA 2HRBA 4B48A 5KSYA 1FDUA 2P9TA 5KVSA 5CK5A 1JU9A 5EJAA 5TMEA 3KOOA 1IHOA 3QEOA 3LQKA 1A8UA 1QCYA 4EENA 2J32A 2WM2A 3ELUA 4IM7A 1FQOA 5AKLA 1LSOA 1JL3A 4ZCQA 3VYTB 1A4UA 2FQYA 5LA6A 1GEEA 1VB3A 3L6BA 3QK7A 4DNOA 3MC1A 3RKUA 3OQPA 4OQQA 4Z1MD 1A2KC 1C0KA 2B83A 4UAUA 3W9BA 4L57A 4JCCA 1K6EA 2HU8A 3G23A 3SE0A 2KSQA 1H5NA 2DQ4A 4XX0B 2IZ5A 3E61A 4LCBA 3DMNA 3KKOA 2I6TA 1HDRA 3VYUB 3U7RA 3GFPA 2CK3D 1P1KA 2JEYA 1FXWA 2WQ7A 2I76A 3E9DA 4O4IF 5BSEA 3GFTA 1NG9A 5K7SA 4HS4A 1AUXA 2R751 3QYAA 2RARA 2WWHA 2CLKB 3F7MA 2DG2A 2ZKIA 3NIWA 4DIMA 4M6WA 4EG1A 2QJOA 3PQ7A 4XVCA 3G2QA 4YWHA 3PVSA 2VRBA 3VU8A 3O94A 1B2LA 1VTKA 3G8AA 3GW8A 3V97A 5CYFA 3IJRA 1I7PA 3GF4A 5EIAA 2VHWA 5JU6A 1W85B 4WADA 2P11A 3GUVA 1KIFA 2C5EA 2ZRAA 2FSUA 3HFJA 2Q4OA 3JQ7A 2ID4A 5F1KA 1YMQA 5FO0A 4U02A 1WOMA 2IV7A 3FTFA 1LTKA 1KJZA 2J59A 5DWQA 2FJ0A 4ZU6X 3ZD6A 2VAWA 3A6DA 2OCIA 3AC0A 1FXSA 3MTIA 2CK3A 3ZK9A 4YPOA 4WXHA 4TQAA 3CSDA 3MCAA 4BL5A 3H9QA 2O5CA 1SBQA 3IHLA 4ND7A 1RIFA 4HX5A 3GJ4A 2OBBA 2GPWA 2PV7A 3DOFA 1VDZA 1OTYA 3O0TA 4RH0A 2IY9A 2W2LD 1JVNA 4DM7A 2I2FA 1FMTA 3M5DA 1ZR2A 2C9MA 4BEWA 3FDIA 3TVYA 4J29A 4D9MA 2CCJA 2Z2ZA 2XNHA 5LA6F 1AGYA 1W7AA 3I4CA 2VATA 3MBKA 2OEPA 4JGBA 5GJWC 1IBCA 3T99A 4LECA 2F3QA 4DR7B 2VHVA 5I8WA 3R0IA 2O8FB 3MRTA 1X1QA 2JS7A 4M4SA 2B1IA 3K0HA 2GKOA 5G0WA 3ROPA 5K8TA 5JAZA 1EUCA 1O97C 2B6HA 2ICAA 4ND2A 2CLEB 4CFYA 3SJ7A 4KH1A 1QNLA 4X60A 1KPGA 4ZV7A 2F1OA 4WOJA 3QF4B 2A3RA 3VNVA 1Y3FE 3I3SR 2DM6A 4JLBA 1FXWF 2H06A 2YVLA 4ZK6A 3PTAA 2FE4A 4HDAA 4LRQA 1TW2A 5HKOA 2NXWA 2X42A 4RTKA 1PJ4A 2J3MA 3W8RA 4BVFA 3FPAA 4EG4A 1R00A 5DT2A 4YY3B 1P4GA 3RVRA 4W5RA 3ZZNA 1G4UR 2WB4A 3A11A 3OQHA 4OUDB 3JYNA 3WL3A 3QXGA 2GZHA 1MHTA 3GJ5A 3KQTA 4LMBA 4EMTA 2JAWA 3DWFA 4NQRA 2BGWA 1G7TA 4AJ9A 2H5IA 5IW8A 3WGNA 3DDOA 1CJKC 2AUMA 2O2IA 1X1CA 3BTVA 4ZHSA 1WULS 1D1TA 3ER6A 5C5IA 1I2MA 2G7MC 4WFQA 2HCJB 1EK2A 5T4HA 4HDRB 1JJ7A 2QRUA 5C37A 1RZUA 1R12A 5KOJA 3ZLVA 7AT1A 2P79A 4PCUA 4GI3A 2EQ5A 5HF5A 1OPRA 3RR2A 1BFKA 2BEUA 3L79A 1FDVA 5KHLB 4BXOB 1DCKA 3B20A 4RANA 4YRJA 4BVKA 3ET5A 3EVZA 4QXRA 1YB1A 1CJUC 3FFXA 5I7SA 5JNWA 1OWLA 1C8BA 2GB4A 4RABA 3N8KA 4DSNA 3DFFA 1H4TA 3DKPA 1QOZA 1XZHA 4N47A 3RC2A 3VV2A 4Z86A 2F4VB 5KWIA 1B8UA 1ZGHA 3VXKA 3WK4A 3CPJB 3OCJA 3B9BA 3MIIA 4JWKA 4IDDA 3DVSX 1QGUB 1TQHA 5I7AA 4OBXA 4Q47A 3R3SA 5AYVA 3P2IA 4G0UA 2AWOA 5KVAA 4YMVA 3OE7D 5DHFA 4RIEA 4BN0A 2VBCA 3EA5A 4QGGA 3AI2A 4D6YA 1HL3A 5NLLA 3UXMA 5JBIA 2PH1A 4Q1AA 5C2JB 2AQHA 2HPVA 3AL2A 1R88A 2P2CA 3LHDA 1VSBA 4DIUA 5DSTA 4BNDB 4X95A 3UUGA 3DHVA 4M8LA 4OFBA 3A9UA 4N18A 1XZNA 3BDIA 3D3QA 3D6VA 2J7PD 3REQA 1U0LA 2EL7A 5I7EA 5FXMA 4ZVRA 4GVLA 3TGLA 2AJCA 3RUPA 1F7UA 1CUIA 3RK4A 4JI5B 1CZHA 4UCXA 1CC1S 1NF2A 4R68A 2H9YA 4R9SA 2G9VA 4HBGA 4D6XA 4EEKA 4C2TA 3WK9A 4YCCA 1ST3A 1JQJC 4ZOAA 1NLFA 4O5AA 2Q2WA 2IHUA 1T8TA 1U1CA 1YA4A 4CUKA 5CB6A 3AR5A 4MKRA 4KIUA 1CQIA 4DT1B 1FDOA 3PGVA 5BNTA 1JWLA 1RQRA 2VYCA 4YP5A 5B36A 3ZHVA 1FNBA 4ZJPA 1ATIA 4A0QA 2ATIA 4DQUA 2XWSA 2OZVA 2FZEA 4K8RB 3CRRA 3UV6A 5CXXA 1SHKA 2HA6A 4R0VA 3E15A 1L5KA 1LK0A 1PFUA 4KBYA 4CIAA 2W2PA 3CCBA 3S44A 4MVWA 3EG9A 2ZS9A 1J7JA 2EJCA 2V5UA 3G7UA 1DKMA 4YUAA 1INLA 2FPGB 1V11B 3DTVA 1ZD8A 2WKWA 4OH7A 4B3RB 1MJHA 3QXXA 1OUMA 1R8QA 1IZ0A 1XK6A 1A7JA 1ABBA 3SYKA 2ZUFA 3LY5A 1QRAA 4IQ4A 1FK8A 4JI7B 3H5TA 2RC6A 2YUTA 1L4NA 1KNQA 1RE1A 1U8EA 4G9EA 4KH0A 2QX7A 4QUJA 4Q9HA 3PDIA 2EX4A 4LKOA 3VR1A 1I5EA 1ID1A 4N49A 5ESDA 4XW2A 4MDHA 2FWJA 4HLUC 3L7BA 3I5YA 1OB2A 3P1JA 4OQMA 1LCIA 1LK5A 3P2OA 2GASA 4DG8A 2IZ1A 4MICA 5F4ZA 3KQSA 3DDUA 4LISA 5EXPA 3MJDA 4H0CA 3A2LA 1KYQA 1SAYA 1GYPA 3BSSA 4C21A 4DZTA 5KDLA 3OTOB 4XYGA 3TOSA 5KWEA 4TMVA 3N28A 1ZNXA 5FUXA 4YCLA 4YP0A 4I9UA 1PG2A 3KG2A 4W9NA 5CW2A 3MD9A 1PVVA 5L3RA 1LK7A 1V5EA 2HJRA 2QW1A 3G2NA 3ZWOA 1U8AA 3BMOA 2O8CB 1NOIA 1ST2A 1XU9A 2W2OA 3DBIA 5KYNA 1OGJA 3AXTA 2X77A 4FI3F 2IXAA 4WK6A 5IJ0B 1WPXA 6GPBA 4L3WA 2C5HA 5JZSA 2BGJA 1R6UA 3R3VA 4MGKR 1P17A 3RCBA 4AXBA 4ARBA 3RJ9A 3F5MA 3GVCA 5MN4A 3VO8A 4Q93A 3AEKA 1H2XA 1Q0UA 2KMLA 1ZA2A 3W5BA 1NTRA 2W2KA 1PFWA 3KFVA 4MLZA 2KLBA 3TBKA 4IV5A 3PU6A 2HJHA 4XIYA 2INGX 4PXSA 3HZOA 2FSHA 3PQCA 2ANCA 1GDDA 3NWJA 1R0SA 2FFAA 1AKYA 3SM3A 4Y2SA 3T9FA 2J9FA 2XY4A 4MCAA 4V3BA 2NUAA 2W2XA 1GNVA 3IAAA 4Q3DA 4QVGA 4XI9A 3E9YA 4B74A 1GQYA 1BW9A 1CRZA 4IMPA 4R16A 4C05A 4CMJA 4CGYA 5CA1B 2CV2A 3EQ9A 3AVXA 1DJNA 2D0PB 4EAQA 2Z5VA 2JBAA 1LDYA 2Z4TA 3IVXA 4PYRA 4F2HA 4P9NA 3CLRD 3ESCA 4WXYB 5D7NA 4B7CA 1ICIA 1YTUA 1QQ6A 1JIKA 1QPBA 4F1JA 5L7WA 4IQFA 1BQ4A 1MNAA 1R0YA 3PQDA 3GHYA 4RNDB 3VR6H 4AULA 3PEYA 1SCJA 3I2KA 3H1EA 2ZCUA 1TM3E 2C59A 5HZHA 3EA0A 2G63A 2AFIE 3HYLA 3MAAC 3KHSA 2OGWA 1G2PA 1T3GA 2D1TA 3F5QA 1RWWA 1TL7C 2B7CA 1M74A 4FEAA 1JYSA 1E8MA 2M32A 2WKQA 3FNGA 5BWBA 1EGHA 1KDRA 1OXTA 3MD0A 1PJ3A 3AV0B 2Y1EA 2EJVA 2YIMA 3OUUA 4HMQA 3JRXA 4RZIA 3T1TA 5IKXA 5ITVA 2X8WA 5JCZA 4WGGA 4B44A 1TF5A 1J49A 3CJQA 5ED4A 1XOIA 2XWPA 4F93B 2EFJA 4I8XA 4N39A 4TN1A 5SYNA 1YUBA 1QHSA 1U0EA 1NVEA 4NARA 1OYWA 1YRYE 1E7RA 5DK6A 1C7RA 5DLYA 1FJHA 2J3IA 2BMDA 4OHWA 3ROXA 1PF7E 5JYBA 1IBKB 3RC9A 4LF4B 2GAOA 5HIJA 2YTZA 2IP4A 1H2BA 2GEUA 2ZXUA 3P9PA 1EWRA 2XLCA 1QSGA 1QG2A 2OUIA 2VXBA 2XA1A 4QXMA 4YGXB 1YVPA 1AHHA 4RX1A 5DI3B 1OU4A 4D5EA 4JH0A 5B4VA 2PT6A 2ZBVA 4TMYA 1O6CA 3DAPA 3Q72A 2IBMA 2R6HA 3WTBA 3ZBUA 2HW8A 4RA9B 4BV8A 3L0DA 3BZUA 1SUPA 1QG0A 4YFVA 3KLOA 3T1HB 1L5FA 2AB0A 2JCBA 1UQTA 2ZAYA 1D07A 3LQ1A 2FFRA 3RLIA 5KC9A 2ZYDA 1V1RA 3NEAA 1M1YE 2C84A 3I09A 4UD2A 3A05A 1RKVA 1QG6A 2DY0A 2FOLA 2X0RA 5TDHA 2UXBB 1RBQA 5JOQA 1E61A 4G5QA 1CF9A 2C7PA 3PENA 1KU6A 2WA1A 2F4NA 1UZUA 1V39A 4C76A 1IY2A 2WMOB 3NJ8A 2QTTA 1J8FA 4DCNA 2YJGA 4FOTA 5A0FA 4M8SA 5E4FA 1RBMA 4EOGA 5DULA 2J30A 4OAOA 4WBXC 5C31A 4DEYA 3DE1X 1I6KA 1VFNA 3EBLA 1T2DA 4X84A 5L95A 2ZE7A 1HXHA 1JIVA 1KAGA 1PI3A 2W4MA 3R4VA 2QT1A 3HO1A 1NP6A 3SJCA 4RYLA 5FL3A 5PNTA 2K5UA 3A1TA 4RIGA 3RVQA 5EWJA 1LRJA 1EUZA 1RTTA 1BVRA 2PYIA 3EGDA 1QIKA 3SWWA 1Q83A 1P9RA 5DOZA 1PLLA 3KVRA 1LPNA 5EZYA 1NVVQ 2OV3A 4LPSA 4RJTA 2P91A 3BWEA 2QBYA 2H1VA 5J2UA 2GRAA 5LQJA 1H9CA 3J81A 2C07A 3L41A 5I9NA 4FWBA 4GOND 3VSEA 1UEXC 4D42A 3OLCX 1C9KA 4PLZA 4AWBA 5HZMA 4GRAA 2X4GA 4IGIA 4N5IX 1XELA 1C2YA 2ZQ5A 4M87A 1DQZA 1XZAA 4O2AA 4WASA 5MGNA 1NXXA 4G0WA 1SU8A 4UBLA 3SQOA 1T1EA 3DO5A 5DGTA 3BS4A 3RSQA 4Y9TA 3ND7A 3O47A 1QDEA 2G72A 1R8YA 4IS3A 1U0SY 4WKCA 1KJYA 4KN9S 5BXQC 1TZJA 2WHQA 5AUPB 2ZYAA 4X3PA 5EWMA 4OQDA 4GMKA 3RBVA 1X92A 3TLKA 3HKDA 2DFKB 2OG1A 1L8LA 4YPFA 4WFJA 3FOWA 3OQVA 3G8YA 4U2FA 5JCXA 5LQMA 2KYRA 4X41A 4DLTA 4ZEMA 4K6HA 1FFCA 4D4HA 3L07A 5EAIA 3VJMA 4NOLA 3RLFA 3WOHA 3FZYA 3T7SA 4B3FX 4U3JA 3JQ6A 4PPFA 3KUCA 3NTUA 4BQOA 5HIKA 4QUAA 1UODA 3LA6A 4NZZA 5AKKA 1G6KA 3FNRA 1YK1A 2XUOA 3ODPA 4ALLA 4UREA 1UM9A 4YS6A 3N76A 3FHJA 2WSIA 1CERA 2VHEA 3TX6A 2J0QA 4J6FA 2DFDA 1NVTA 2JC3A 4ABTA 3NYWA 3DV0B 3H65A 2ZBFA 3V7WA 4YYEA 4WPGA 1OFHA 2R48A 2G36A 3ME5A 4JBHA 4RZ2A 1XTSA 3A7EA 3LCJA 3TZ6A 5DP2A 2R1UA 5C4IA 5JSQA 2CLCX 4M9SA 3PNBA 1TRKA 4XPIA 4AMVA 2EYQA 4MWTA 1IFXA 1WZEA 4IDNA 1SA0A 5HDBB 2E6KA 1S9DA 2GBCA 3DWGA 3EMVA 4NECA 2L19A 5L4NA 3AL3A 4F7WA 5KTRA 2OC4A 1ISSA 1S2OA 3UWDA 2QUJA 4ZV9A 3EZGA 1GA4A 1KYZA 2CVQA 2O2EA 3X1MA 4MO9A 5EZYF 1VJCA 4YJ3B 3FCEA 4ADSG 3CR3C 5LL6P 4L75A 5DBGA 5J2UF 1EEHA 2NXCA 3BCRA 5KC8A 1OBHA 1ZI8A 4B84A 4KC0A 5JZ9A 4PINA 5B2ZA 5GGXA 1FLDA 2PVCA 1ZD9A 1QZZA 3GVIA 2DUUA 3EXFB 3AQ4A 4U4AA 4EJ0A 2D54A 3W79A 3KQKA 1N7GA 1W4RA 2XF8A 2YYZA 1Z62A 2G0TA 3VHXA 4O2AF 4S04A 3M3DA 5KTKA 1EWVA 1XDGA 1I14A 2G04A 2YIJA 1L5NA 1YMVA 1B43A 1X38A 3WTCA 5JS8A 3Q8LA 3UJ9A 5JMTA 1GKYA 2HWUA 2GXUA 4AUMA 4LHXA 1MB4A 4L9AA 3EDOA 3ENVA 1TLFA 1NQ5A 1YRHA 2YZ7A 5B1HA 3WLQA 1ZD3A 4ZT3A 3IT1A 2CHUA 4BJ3A 3I0ZA 4PFQA 3SPXA 3OZRA 4QARA 4J0HA 3AERA 2OXTA 4MSUA 3BJZA 3CEAA 2R7KA 3E82A 3H5WA 1LSSA 3RC1A 1ZW6A 1P0CA 1AA6A 1DC7A 3BERA 2BI8A 3B13B 2H0RA 2ZATA 4UNPA 4YXFA 4R4JA 3EUWA 3IBGA 1A2QA 3BRSA 3GGCA 3PVZA 3K94A 4J7UA 4YMSA 4ZICA 2AJBA 2Z3ZA 3WB1A 1K1EA 2TS1A 4HGZA 1ECLA 4LJ7A 5B5SA 2YJNA 2ZSHA 3MJHA 4PLWA 4E5UA 1Z0AA 1NSFA 2YUIA 4D8WA 2Q2VA 2ZYVX 2FXVA 4M9RA 4YYZA 4X1YB 4TYWA 4II3A 1TJYA 3SG0A 4CF5A 1JQKA 1LZLA 2V7QD 4B3MB 3U4HA 1PWYE 2E6UX 2VK8A 2AUNA 2WMNB 1E1CB 1HKHA 3MUOA 1FQJA 1K4KA 1E0DA 3IV7A 3I05A 1IBSA 3HQ4O 4IKEA 4U2EA 5ALEA 7GPBA 1U7DA 1KE2A 2XQKA 4QQNA 3EODA 2WFLA 3W5SA 3RYCB 3D1VA 1DFIA 3GG2A 1MZPA 1SEPA 2IYUA 8OHMA 1H0KA 3UMVA 1SZCA 1QFZA 1JMYA 3CUKA 5HG0A 5HA5A 3VH1A 1UJCA 4DHEA 4D26A 4CU5A 2FUCA 4QLAA 3ZGYA 3OT4A 3CRNA 5GGYA 2JDID 4MP6A 1PS0A 3KQYA 3MRXA 2W6CX 3HDTA 4IFIA 3OIFA 2Z1NA 3QUSA 5A3RA 2HRQA 2OGUA 3LS2A 4LTNA 3LAWA 2PFSA 4LGVA 3I9JA 3VKFA 5H82A 5CM9C 4TV9A 1XZFA 2XYQA 3B8HA 4G2NA 3K2EA 1J0CA 2C77A 5BOVA 5FA8A 4B7AA 2G9ZA 4JCOA 2PU5A 1C1HA 3AW9A 4L6CA 5EN4A 2Y67A 2HH9A 1KMIY 4ZO6A 5FFNA 3JQ7B 4WT7A 1P6QA 4I3HA 2LW7A 3MMNA 4Y2RA 1TYDE 3ZY6A 2OYSA 4A16A 2ATEA 1TAQA 1P60A 2BFNA 4H3KB 3J80A 1ZHOA 1Q0QA 3D2CA 4W9RA 5IVDA 3GBSA 1Y3AA 1TYCA 2ETVA 1XA4A 4QPPA 1YQUA 3ZHTA 2BTEA 5CCEA 1DIHA 1XWIA 5G0SA 2ZWIA 5KX5F 1EWTA 3ISTA 1OX4B 2XA9A 3UB3A 2HX1A 1YI1A 2JDIA 3JSAA 4Q39A 4ZZ1A 3H75A 2J9XB 1P6XA 2ALJA 1C1YA 4JOSA 3OESA 2WTMA 2DBQA 4F86A 4IILA 3AG5A 2H7YA 5IARA 4YR7A 1KQFA 1GU0A 5AKIA 1ZXBA 4AF7A 2EKDA 4M49A 2R6R1 3ZWBA 4C0HA 1CUFA 1URPA 1FP4A 4BKPA 1JAHA 3WRYA 1YH3A 2H2HA 2ZSJA 3UMGA 2NNWB 2CVOA 3U4CA 1K2WA 5K0BA 4LC9A 3QU2A 4LJ9A 1ND5A 5DLPA 5AK0A 1M6VA 1YR2A 2NTYC 4X00A 5IH7A 1CE8A 4NDNE 3ZIDA 4D02A 3CVJA 3GELA 4ZVTA 5GOTA 1EUCB 5KNBH 4YT4A 3R6TA 3T4PA 3JWHA 2J3KA 3ABQB 3FETA 4JJKA 4KLNA 5ADHA 1G0NA 2HA5A 1ZSVA 2NU9B 3GLFB 1JUDA 3GZNA 1EAYA 4YMUA 1E66A 1GTMA 2WAOA 4XEHA 1F1BA 2PO5A 2ZRIA 1W581 4JT2A 4OQPA 1RKBA 3SU8A 4D41A 1ZKDA 1AE1A 2IH2A 1CVLA 1U6JA 5AM5A 1H2WA 1QRDA 3HM2A 4H77A 4QTYA 2CE2X 4BNVA 1W88A 3I2IA 1ZH8A 2C29D 2ZR9A 4RFSA 1E4OA 3T3OA 3M1IA 4ZCMA 3DBLA 1XKTA 1OI2A 3SYTA 5IXJA 3OQ6A 1EFCA 1JGTA 1HYHA 4QYMA 4BWGA 3GIWA 1F9EA 3P0RA 1HDCA 1SVIA 3BN3A 3L1HA 1Z4NA 1K8XB 5LBTA 3LQQA 4WVLA 1RI3A 4DR5B 3TRFA 5GZ3A 2HIAA 1PFGA 4R5MA 1DBPA 2KBEA 3M1YA 1C0EA 3B3GA 4ME6A 2FOIA 2ZWPA 3L4EA 5EEGA 3WLTA 4Q24A 4EJ6A 4OGFA 2H2WA 4UHKA 2E0IA 4FE7A 3ZE9A 1A82A 5DMHA 4KR9A 5BURA 1BGVA 4EYKA 3KTAA 1LB1B 1SU4A 3LVQE 1QFSA 2ZIEA 1LPMA 4L4ZA 3SLGA 5KOJB 1PWXA 1XZLA