1F14A

L-3-hydroxyacyl-coa dehydrogenase (apo)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDECVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequestration of the active site by interdomain shifting. Crystallographic and spectroscopic evidence for distinct conformations of L-3-hydroxyacyl-CoA dehydrogenase.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-3-HYDROXYACYL-COA DEHYDROGENASE
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1f14A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1f14A01
2Q4BA 3CSDA 3O9ZA 1ISHA 2YQ4A 4CQMA 4H15A 5JC8A 1TA4A 4BB6A 2F1KA 1Z74A 2AW5A 1U8FO 5LDHA 1UXGA 1KEUA 2V7PA 3PZBA 3ZNPA 1PJ4A 2PD3A 4RF3A 4XQGA 3PIIA 2AQHA 5T5QA 3FR8A 2X4GA 3GRPA 1Z75A 3NDRA 2EEZA 4XQ9A 4CV3A 2HJSA 4B3JA 3FNGA 2D8AA 3HB5X 4DPLA 3IP1A 5JFOA 3LC2O 2UV8A 1EUZA 5LDGA 5C5IA 2Y93A 4E4YA 3IJPA 3ETDA 2PV7A 3X2FA 4ALJA 3M2TA 5L51A 1D4FA 3M2PA 4L75A 4ROSA 1WMAA 3JQFA 4XGKA 1GEEA 3PLRA 1N7GA 4OJNA 4F46A 2O50A 3AM4A 5KWEA 4BKQA 1NR1A 3EHEA 2VQ3A 1E1NA 1I36A 4I9UA 3IKTA 1W4ZA 3FSRA 1NPYA 1E3SA 4IM7A 2ZKLA 3HUDA 4R9RA 3UFXA 3IJRA 3RC2A 1LC3A 3WBFA 1PZHA 1R4MB 3C3XA 2Y1DA 3KO8A 1C0IA 3AU8A 4A26A 1DC5A 3S2GA 4ND3A 1Q0LA 1ZJZA 2NNLD 4TRJA 3CXRA 4BO7A 1IL0A 2NQ8A 4GGOA 4R68A 5J23A 3WGTA 3MOGA 3CTVA 4RVHA 3BMOA 1SEVA 3PWKA 5KTKA 1P0CA 2I3AA 2Y0EA 3RUCA 4DIOA 1XDWA 3PHLA 2E82A 2RHCA 1ZK2A 2DFVA 4Z9XA 3TZ6A 2Q2VA 1W8DA 4YRBA 5T64A 1NTOA 5JCXA 2AG5A 3MJ4A 4RV9A 3TL2A 4CLDA 3VZPA 1QP8A 1F8FA 5ER9A 2ZYGA 2Q50A 4ALNA 4NH4A 1R0LA 5G4KB 1LRJA 1I33A 4CMHA 2I9PA 2HMWA 3VAZA 2J5RA 4XWYA 3SLGA 2X0RA 2ZB8A 4DPMA 4E5PA 4ALIA 2HU2A 1YS4A 2IDZA 4B8WA 2FPGA 3C1AA 4DIFA 3UCEA 3LVFO 2J8ZA 4QO7A 4UAGA 4EUFA 1P77A 2GNAA 4RDHA 4FFPA 4MKRA 3PYMA 4KQXA 5JSFA 2GR9A 4XYGA 1NQTA 4CM9A 2DM6A 3PHJA 2D59A 1LSSA 3MCVA 4ZRNA 3ZV3A 4FGWA 1B15A 1YE3A 1DIHA 1Q2XA 1KEWA 1PQWA 1UAYA 4FB5A 2B37A 4UEKA 4WNCA 3INTA 1PGNA 4MJLA 4LN1A 1VM6A 3QWAA 3B70A 2JCXA 3WXBA 1E3JA 2O23A 4IDGA 3H9JA 3WNQA 3FN4A 3RC9A 3QWFA 4DLBA 5CEFA 5AVOA 3WQRA 1AGNA 4Y6PA 4IZHA 4EJMA 1V3TA 2CDAA 2X0NA 2F00A 4RF4A 5ILOA 3ZGYA 3SJ7A 1P1JA 2HMUA 3L6EA 4N7RA 1H5QA 4BNYA 3U62A 3GQVA 1ID1A 5DOZA 3ITDA 1O94A 2QYTA 1NFRA 1WDKA 1X1TA 4YJHB 5T67A 4FD3A 1SAYA 2AMFA 2G0TA 5JE8A 3RIHA 3HSKA 3UHAA 4YQZA 2JHGA 2Q1TA 3PDJA 4A03A 4ZGWA 3SEFA 3CZRA 1Y9EA 1AHHA 2P91A 1E1KA 3RWBA 3FPLA 2VUSA 4IUYA 3JD1A 4DQXA 2VTEA 3OEWA 1AXGA 2P2SA 1I5RA 4J7XA 2OL4A 4AL4A 3JSAA 4EI2A 3PHIA 4P4LA 3FPCA 2FN7A 1C0KA 1I32A 3JYQA 4GVLA 4CMIB 1JKIA 1PJ2A 1J49A 3NUGA 4JJGA 1ISIA 4A27A 4CUZA 5BSGA 4XX0A 4JBIA 4EUHA 3VZQA 5F5LA 2NSDA 4QTZA 3DO5A 3DFZA 4NQZA 4WLUA 3JQAD 5JAIA 1PWXA 3F6YA 1N1EA 1X13A 4RO0A 1N2SA 5JY6A 4Q9NA 1X14A 1P1FA 2YQ5A 3UKOA 2ZB4A 1VC2A 4DTIA 1KIFA 2IZZA 4D46A 1JN0A 4PRKA 1KVTA 3U5TA 4Q3CA 1GCOA 2ZCVA 1YL7A 3DAPA 4BV8A 5JY1A 2Y1GA 1PJTA 1B8UA 2NU8A 1Z7EA 2V65A 1MFZA 1C1DB 3E9MA 3FBGA 2JFFA 5DBIA 3L9XA 3QP9A 3RFVA 3ZWWA 5GZ1A 1HLPA 1T2EA 1ZSYA 4A10A 1B7GO 2PWZA 1BGVA 1QXSA 5L4SA 5TJHA 1L7EA 1ZK0A 4IQ0A 4KDEA 2I67A 1LQUA 3T4EA 1KVRA 1NVMB 3PWSA 4BO1A 2X6TA 1LNQA 3JQ9C 2D4AA 2JAPA 3KYCA 4M87A 2YY7A 2EG9A 3E5RA 4KDFA 3C1TA 4U5QA 1A5ZA 4Y6SA 3IKVA 3W4JA 2GCGA 1Y8RA 3KUXA 1I10A 2JCYA 3V1TC 4ZA2A 3RUDA 3DQPA 4GVXA 4X54A 3K8ZA 5TT0A 2A94A 2PZMA 1HWYA 4Q39A 1EK6A 4YJDA 3T7EA 3AI2A 3EYWA 3NV9A 2XAAA 4YTEA 5AYVA 5HS4A 3DR3A 1SMKA 5ENDA 4IJVA 1QMGA 2CZCA 2J3HA 3KSDO 4N54A 4QSMA 3ZU5A 4XRGA 4Y6RA 2VNAA 4U7WA 4H3VA 3OQ6A 1JA9A 5DCWA 3GDGA 2CVOA 2Y1FA 4J90A 2EKQA 3N7UA 4NZ9A 1M2WA 4IS3A 4C7JA 1Q7GA 3IMFA 4D0RA 1GQQA 3DBVO 2NWQA 3WGGA 4RJTA 2GASA 4WCDA 4PLYA 3L07A 1HSOA 3K73O 4JGBA 1DIAA 2RHRA 1TB4A 3ZWMA 1U3WA 1BW9B 4QFDA 2IZ1A 4RDIA 3ONEA 3W8EA 1GZ4A 3RKUA 5CPFA 4JROA 1BXGA 1XHLA 3E18A 5H81A 1EUDA 3QWBA 3GY0A 2VWPA 2AXQA 4J1SA 1I2ZA 3OICA 1JWBB 1R6DA 3ICPA 1HDYA 5IAAA 3KVOA 3H9EO 1XA0A 4PZCA 1U7TA 5KJ6A 3MOIA 4S3MA 1E7WA 4GLLA 3OM9A 1B8PA 1T25A 4FFRA 1VL8A 4RL6A 1NVGA 4XQEA 4DLLA 3HDHA 4BO3A 4P4GA 1MGOA 4E30A 3MJCA 1J5PA 4OKNA 1H6BA 3K5PA 4PGFA 4FR5A 4NBTA 3JYNA 1MXHA 1NBOA 4G2NA 1UUFA 3VPSA 4HFMA 1J0XO 4IQGA 3A28A 3TSCA 4GX5A 4AJ1A 1JLLA 4Y9DA 4MIEA 2JD0A 1C0LA 3DBLA 3W4IA 3RBZA 2OBNA 4J9UE 3IS3A 4F45A 4BGVA 1UR5A 1N8KA 3E82A 3BMQB 1R4NB 1ADFA 3GUCA 2Z1NA 3PRJA 3KB6A 3LSYA 5DBGA 4IQ8A 1VI2A 3MWDB 1LSOA 4NU6A 4Z0HO 2C7VA 5ITWA 4UUMA 3KYDA 3PGXA 2X22A 3TOZA 4YCAA 3PJEA 3JV7A 2VRCD 4II3A 4BO4A 2HMTA 3GC6A 4XIYA 3LT4A 1E6WA 4UEJA 3RCBA 4FOOA 1GR0A 5U4QA 3W8FA 4OOEA 4E31A 4R3NA 1E7RA 1R66A 4A73A 2PLAA 2O3TA 3RFTA 1VE9A 4BIIA 1O89A 3LLSA 4WECA 1NHWA 3QV1A 2WMDA 2YDYA 3GVIA 3ANLA 2B0JA 4CPDA 3JQEA 3TNLA 3JQDA 3RSHA 3ZWXA 3RU7A 1P1KA 5GZ6A 1DBVO 2G17A 1N7HA 1PR3A 3KZVA 2WYVA 5FYDA 2IXAA 4ONEA 4CM1A 1W6UA 1HTBA 1EBFA 5KJCA 3TRIA 4OSPA 3QVSA 2B5WA 1BVRA 3AI1A 3V2GA 1Z7BA 3NGXA 1ZKMA 1MFPA 2GSDA 3DONA 2H1SA 4BNTA 2YUTA 3PFFA 3KLMX 4HBGA 4PZDA 2H5LA 4BMVA 4IDDA 4JJIA 2DTXA 4HNHA 2O3RA 4R51A 1TT5B 3FBTA 5JO0A 4CMJA 3GHYA 1I30A 1BWSA 4OOFA 1MXFA 2D3TA 2CY0A 4BGUA 2BFPA 1FDSA 2Y99A 4J1QA 3ZWCA 2R00C 5G0UA 5G0TA 3HE3A 2PGJA 4JNKA 2VUUA 3DZFA 5A3JA 2CMDA 5AXDA 4QFCA 1DFGA 3TDKA 1VRWA 5G4LA 5ICSA 4HNGA 3DBLB 1U4SA 4LGVA 1NWCA 1JU9A 4KUHA 4NBRA 2BFOA 5EN4A 5L3ZA 4CQMD 5CFZA 1BTOA 4BNXA 4MIYA 1M66A 1NAIA 3GNSA 2J3JA 3AM5A 3JQ7B 2IYOA 1GYPA 1U2DA 1EVIA 4RF5A 5EL0A 2YW9A 1ML3A 1P1RA 2Y1OA 3WFIA 3I3OA 1NQ5A 4AJLA 1TT7A 2IEBA 1P0FA 2VRBA 4XRRA 4BNMA 2HK9A 4DRYA 5G0WA 1ADGA 3QVWA 1BDMA 4NMHA 4OGWA 4TWRA 4YAKA 4BOYA 3E5MA 4MOWA 3BHIA 5TRTA 3L77A 1VKOA 3AUAA 3VPHA 4PG7A 1H6DA 4WUVA 1OC2A 4F3YA 3OIFA 1QKIA 2I66A 4O63O 2QRKA 6LDHA 3F1LA 4XCVA 3I9NA 1NQOA 3GEDA 4A5OA 4I5GA 1Y5RA 2VZ0A 3DTTA 2X5OA 3PGJA 3GMSA 4OAQA 2AEMA 4E5KA 1DRVA 4WNIA 3KM0A 4I9HA 4ZVVA 5DF1A 1UDAA 1CIVA 4M55A 3INGA 4GBJA 2C07A 5JYDA 5L45A 1GU7A 2O3UA 1OC4A 1P31A 4E0BA 3G1UA 5L7TA 3JQ8A 1VPDA 1H2BA 4CM5A 3P19A 3D1LA 3VC7A 2E37A 3H5AA 3I4FA 5TQVA 1UJMA 2CF5A 1ZMOA 3QSGA 3HN2A 2C82A 2EWMA 4ZD6A 4YYZA 3GOHA 4JBHA 1EFKA 3WLEA 4BO6A 2WYUA 2B83A 1SBYA 5KJ1A 1LUAA 4BO0A 4BO8A 4DGSA 2HO5A 3ADOA 1U3UA 3IUSA 1T1SA 3VKVA 1XU7A 4F6CA 4R16A 1RWBA 1IB6A 2BF7A 5G4KA 5EQFA 1Z82A 2DBVO 2PZLA 4PG4A 1YBMA 4ZICA 1UP4A 4GKBA 1I2BA 3CUKA 3GF4A 4CLRB 4Z0TA 4ZU3A 1Y8RB 4WLEA 5F5NA 4XD2A 4MVJM 1AXEA 4PLFA 5ILGA 4WLNA 2FSVA 3AOEA 3H5RA 2B35A 3GPIA 3FWNA 3HJAA 4J7UA 3UCXA 4YJFB 4NBUA 3RD5A 4HX5A 1HEUA 1F14A 3K31A 1D3AA 4CM9D 5C37A 1B3BA 1U2GA 1HKUA 4GL4A 4EITA 1UXIA 2QG4A 3G17A 3CIFA 5AQ1A 3WB9A 4OL9A 2VT3A 2GF2A 4LW8A 4WOKA 2X9VA 4CM7A 2Y1EA 3BHJA 3PQEA 1P44A 5T57A 2YV1A 1EFLA 3HADA 4LRTB 2AQKA 1K6JA 1WMBA 2JD1A 3KEOA 4XJTA 2EF1A 5I8ZA 3V1YA 1NHGA 2DTDA 2OO5A 1VLLA 1O5IA 1J4AA 2BGKA 1X1EA 2GZ2A 3OETA 5EESA 2NQTA 2WD7A 1U7HA 3FTPA 3JD4A 1MX3A 2ZQZA 4FFNA 3D7LA 4L0QA 4WJZA 5IXSA 1QLJA 3MTGA 4KOAA 2YZ7A 5THQA 5EINA 1HE4A 1DFHA 4ZQBA 5IFLA 2BRUA 1KOLA 4LMPA 3OP4A 2R6JA 4O59O 3GVPA 3L4BC 1MUUA 5K0ZA 4GKVA 1UZMA 4IXTA 2VOJA 1CETA 4JP2A 3H2ZA 1JVSA 3PIDA 1CJCA 4I5EA 1TLTA 1V6AA 1OBFO 4RVUA 2FOIA 1XR3A 5C3MA 3DBHA 4AICA 3WGIA 3H4VA 3DC2A 3GVXA 1PL8A 1A9YA 2VZ9A 4R5HA 3RVDA 4KUGA 1BG6A 1IUKA 3CMCO 4YXFA 7ADHA 5THKA 2YHIB 3KSZO 4E32A 4GX0A 4YRDA 4BNHA 1Z73A 2QIOA 3GA0A 1SEPA 3DZGA 4YJFA 3RUHA 3S2FA 4YJHA 3B1FA 2FMUA 3BMCA 1LBEA 3U9LA 1A72A 3KLPX 1PS9A 2HRZA 4E2XA 5A03A 1A7KA 2PR2A 2OOSA 3UUWA 1VKNA 1YB1A 3ASVA 1YDWA 5TF4A 1LX6A 3K2BA 3PP8A 4E21A 3ZNQA 4BL5A 1NQAO 3SLKA 1PGOA 4BNUA 3JYLA 1C1XB 1HYHA 4EW6A 1NFQA 5K6AC 4BO5A 3OA2A 2NU6A 4IMRA 2W2KB 4QEDA 1QYVA 4XDZA 3LF2A 2HUNA 2GN9A 1D1SA 3AUTA 3FTNA 3ULKA 1FK8A 1HDZA 1SCUA 3IQDB 1EZ4A 1A71A 5F21A 2UVDA 3GK3A 5L40A 2I99A 2PH5A 2Q3EA 1SO8A 4YWJA 1WAMA 3ONFA 4EYEA 1NYTA 4IXWA 1XCBA 1FDVA 2XOXA 3GLQA 1LDEA 4B4OA 1JAXA 1WPQA 3VH2A 1K5HA 3D5QA 5EIOA 2G76A 3I6IA 4M1QA 3Q9NA 4HFJA 5CDSA 3BMOB 3AI3A 4DYDA 3N58A 1N9GA 1UH5A 2GD1O 4CUJA 1JWAB 5IF3A 1O8CA 2OP0A 3ORFA 3I1JA 4MVJH 4G5HA 3WYCA 3W1VA 3I6QA 2FRDA 4RPJA 2I65A 4YVFA 1UAGA 3GT0A 1K0UA 1JKFA 1P74A 1MG5A 5A9SA 1E3WB 2AQ8A 4FJ2A 3ROMA 3C85A 1H94A 3WFJA 3GAFA 4HFRA 5TJ9A 5I9NA 1I01A 2DBRA 2WJPA 1NWHA 3D3EA 1ONPA 4WOJA 3ZWVA 3CPSA 1HF3A 2UDPA 1XKQA 4HP8A 2O48X 1M6HA 1UDCA 2QW8A 1L7DA 3IOYA 5EQDA 1UXHA 2C20A 2QYSA 3RROA 2HK8A 3QA9A 5F1OA 4WEQA 1HSZA 4PN3A 4CLHA 3BAZA 3JQ9A 3COSA 2YHIA 3WGOA 3ZWOA 2J3IA 1A4UA 3PYLA 3OJFA 4J2OA 1EVYA 1SZJG 5A9TA 4NPCA 5AXAA 4CLOB 4XEHA 2PTGA 3PEFA 2Q1SA 3TZQA 1DPGA 5KCZA 1LU9A 2BMAA 3H9GA 4YJGB 3CKYA 1ZJYA 4UUOA 5FWNA 5JMWA 2VOEA 5DCUA 2A4KA 2P9GA 1HE3A 2RBEA 4WGGA 1E6UA 1HDOA 1GD1O 1VSUA 2GLXA 4IDFA 1SNYA 2QRLA 3H9QA 2X0IA 1WDMA 1LLCA 4L73A 5GY7A 3WMWA 3FI9A 4BNJA 2B5VA 1E5LA 1A4IA 1RPNA 2V6MA 4HKTA 2DTEA 2H63A 4CM3A 3NTRA 5JPIA 2VTDA 4WASA 1MC4A 1OI7A 4BNLA 1VL0A 4GWGA 3DMTC 1I8TA 4E2ZA 3GZNA 1HL3A 1WXDA 2EV9A 3S55A 2Z95A 5EMHA 1OZAA 4U6QA 5B4VA 5A9SB 3ANNA 3BTOA 4IJWA 4ALMA 3PJGA 1E3LA 4FN4A 4FS3A 1ULUA 2O2SA 1DIGA 1DO8A 1JTVA 3ZWBA 4TZKA 5T8KA 1HE5A 5HBRA 1E3WA 4P4NA 2YV3A 4FC7A 4EBFA 4JN6B 4J0FA 1O0SA 1GZ6A 4L76A 2AHRA 3GVCA 4Q3NA 1BXKA 4JQCA 1H6AA 2WE7A 3EMKA 1E7QA 4FDAA 4MVJI 4NNJA 5BNIA 2Y66A 3TFQA 1H6CA 2GZ1A 1DIBA 4BVAA 1X7GA 5I8WA 1I0ZA 2VWHA 4DA9A 4IDAA 3PVZA 3ZU3A 1ZSVA 4FOSA 4J49A 1T2CA 3GVHA 1I3NA 4I08A 3OSUA 4CMKA 3VH4A 3DAFA 2WDZA 2Q4EA 1ENPA 5TS3A 3ZH2A 5CDGA 4BQPA 4EDFA 1X15A 2EW8A 3ZWNA 2CDCA 4AJHA 3B20A 2PA3A 1ONNA 1U8XX 5A5EA 1EVZA 1NPDA 4Z3DA 2FHSA 4WKGA 4IZIA 1Z45A 3JQAA 4BNWA 4XB1A 3F4LA 5IZ4A 3LU1A 4D3FA 1U9JA 1XEAA 3ASUA 4YBZA 4O1MA 1Q0QA 2EGGA 4R1UA 1X0VA 3PTZA 3HHPA 3JD3A 1PGJA 1C14A 1DFIA 1XYGA 1ZFNA 3ICCA 4OO3A 4BNIA 3AK4A 4BHTA 3V1UA 1I2CA 1HDGO 3C1OA 3ZDFA 2A92A 3RAJA 1TEHA 4U0JA 3V5NA 5I7SA 4Y98A 3GRKA 5DDIP 1LDMA 2GN4A 4GLOA 2EW2A 5DT9A 4AJ4A 5L4NA 4HXYA 3FWZA 5FI5A 3ROKA 4O5OA 4RCVA 4BGIA 4JK3A 1DOHA 4J4HA 4G65A 5L7WA 4YAEA 5BT9A 1IZ9A 1LLQA 4GWKA 1XSEA 4YR9A 3U09A 3MTJA 1U3VA 3QLJA 4ITUA 3GZNB 4L8VA 1YOVA 3DXFA 2C7GA 2E48A 1PJSA 3B6ZA 4DMMA 2XXBA 2EP7A 2Y67A 5TX7A 4EJ0A 3LC7O 2JD2A 1BVUA 4W9NC 1H9AA 1TVEA 1Z6ZA 4LVUA 4WLOA 2HCTA 4WK6A 2A35A 3WJ7A 4B3HA 3OJOA 3WYEA 4D41A 4Q3BA 4H16A 1PZFA 5I7EA 4KTVE 3PJFA 3UVEA 2EIHA 3HDYA 2PKRA 4PG5A 3LZ6A 4ZRMA 3JYPA 1B14A 1WP4A 2H9IA 2W2LA 5DBFA 1ZUD1 3OH8A 5TNXA 5IDWA 3E48A 3GAZA 3K6JA 3JYOA 3ON5A 3GMDA 1E1LA 4KP7A 5A9RA 1N92A 3VH3A 1ZO8A 3H65A 4RQTA 2NUAA 4JBGA 1ENZA 1M75A 5U9CA 3DBRB 1PJCA 3FNHA 5BQFA 4BNFA 3WTCA 3ZWAA 4B8ZA 1CDOA 1F06A 4FCCA 4N5LA 4CR6A 4TROA 4FJ0A 4UVEA 3RJ5A 1HRDA 2TMDA 3I83A 2O4UX 3ZU4A 4AJKA 4CR7A 5TIIA 2IYPA 3DL2A 4IJKA 3PDUA 2YFHA 1B16A 1C3VA 1ZW1A 2OGUA 1F17A 4N5MA 3SC4A 2DT5A 4LRSB 1XQ1A 1W0CA 2Q46A 3PPIA 5DCYA 4BUCA 3T4XA 4AG3A 3TQHA 3F46A 2ZCUA 3WWYA 2ZJ0A 1EK5A 1NVTA 4TRRA 1NXQA 3STHA 3PI7A 1RM5A 1WLYA 3E03A 5IDYA 1YKFA 3GZ4A 2NM0A 2YV2A 3GFGA 1OMOA 2EXXA 4R01A 3NTOA 1NNUA 4J1TA 1P45A 1YL6A 4YAGA 2FR0A 2P4QA 2WYWA 2NADA 2YHUA 4W99A 2CVQA 4ZQEA 5C7LO 2EERA 4OMUA 2JL1A 3EUWA 3LT0A 4P8RA 4DIBA 1YO6A 1DRUA 3TF5A 1RM0A 1E7SA 1KEPA 4L9RA 3KV3O 1EUCA 2R00A 4B3IA 3NEPX 1E77A 1XLTA 1IHYA 4E6PA 1YJQA 4WCFC 4FFLA 1P3DA 3UH1A 3FF4A 3IUPA 4FBGA 1PL6A 2BLLA 3BMNA 2X23A 5G0VA 2VHVA 1QORA 4AJ2A 1B8VA 5B4UA 3TWOA 1EE9A 3AFMA 2FP4A 4B4WA 4EEXA 2GN6A 1KY5A 1BXZA 3U49A 2P9EA 4RPKA 5BNFA 1J6UA 4MVJD 2DLDA 2VHXA 1LRLA 1V3UA 2E4AA 5B12A 4JP3A 1ZCJA 4BO9A 1DB3A 1U5CA 4KWHA 2OBYA 4I5DA 3WMXA 3QW2A 3RBVA 4FSHA 2CVZA 1CEQA 1DIRA 1E7MA 4BS9A 1XU9A 2GGSA 3QVOA 4DL9A 1Y7TA 1DDOA 2EKLA 1ISGA 3I23A 4WEOA 5A3VA 1OOEA 4AJJA 2JFGA 5ITVA 5IZCA 4BO2A 1HDRA 5JW6A 3VKUA 1R0SA 3O4RA 1R4MA 2VYVD 2GO1A 3PFWO 5ES3A 4KUEA 2AE1A 4PLVA 3S2IA 5TGDA 1PWZA 4TQGA 1XQ6A 2ZB3A 4DREA 1N5DA 1DXYA 3UOGA 1PSDA 1ZEJA 2LDXA 5HRUA 1XIVA 3U4DA 1B26A 1WW8A 2C29D 1SB9A 2HQ1A 4GAEA 4LSWA 2PD4A 2E49A 3WDSA 3MWEB 1PS8A 1ARZA 3PHGA 1PJBA 4IPTA 3IP3A 5CDYA 4QECA 4J7CA 3AJRA 3NJ8A 1MC5A 4QUKA 4Y8VA 3U4CA 4P38A 3O03A 4HWKA 1IULA 3WSVA 3HWRA 2C5AA 5A1TA 1LQTA 4P22A 4AJIA 1HETA 1ORRA 2AA3A 3Q6IA 1EQUA 2NACA 4K6CA 2VNSA 3SC6A 1PGPA 1KERA 4WCFB 4C4OA 1M67A 2WEKA 5L95A 2VYND 3QY9A 5TLSA 4NFSA 3WIDA 1DSSG 3LC1O 1Y8QA 3WSWA 4M86A 3KYCB 4E5NA 2OUIA 5K9ZA 4AVYA 2P9CA 3ZV6A 4J16A 1RKXA 3OHSX 1LA2A 3U3XA 3RASA 4XGNA 3JQAB 3GPDG 3GHHA 2W2KA 4CV2A 1YONA 1V3VA 2H6EA 2R2GA 4F6LA 4IDCA 4DLAA 1LLUA 1X7DA 1QV6A 2D2IA 3Q9UA 1IZ0A 1PIWA 3A06A 3L6DA 1E6EA 2DBZA 4R1TA 3GR6A 4OM8A 2I5PO 1LTHR 4PLPA 1DRWA 3CZMA 1ISMA 2P5UA 4J91A 4UUNA 1QYDA 2HK7A 3VTZA 1T2AA 2CUKA 3FD8A 3CE6A 3LDHA 4IIVA 3SJUA 3KOUA 1U3TA 2QRJA 3AY7A 1F12A 1K6IA 2J5QA 1U5AA 5ENVA 1VL6A 1PJQA 3F9IA 2CDBA 4BV9A 4OKIA 2WD8A 4RVGA 3ZWPA 4W9NA 1S7CA 2CD9A 3NT4A 5BSHA 3DMTA 1T2FA 5BSEA 1V8BA 5AOVA 4IGFA 4D0SA 3OJEA 2GYYA 1YBVA 3E9NA 3DEYX 1FDUA 3F1KA 1KVQA 4E13A 3K30A 2BFAA 3UCFA 1MB4A 4NR0A 3JQ6A 1UZLA 3NX4A 3VPFA 4K9DA 2RH8A 1SC6A 2W90A 3DHNA 3DMYA 3GN2A 1ZEMA 1G6KA 1V35A 3C24A 2NTVA 3D64A 4YT2A 2AEFA 4FFMA 4RLHA 4ZQGA 1O6ZA 2NVBA 1HDXA 5K6AA 4JLWA 3UXYA 5COQA 1GUYA 5I9MA 3NT2A 2BGLA 3HN7A 3NDIA 3WNVA 1AN9A 3DBRA 2ET6A 4R1NA 4KMSA 5DP2A 2J3KA 4UVHA 1PJLA 1YOVB 1DLJA 1G0NA 2PKQP 4JIGA 4DBVO 1NX6A 3GGPA 3MEQA 1KETA 3A9WA 1XG5A 1Y81A 3BZUA 1IY8A 2BI7A 1UXKA 2NU7A 4IMPA 4RORA 4J43A 3ZI0A 3CEAA 1LLDA 1LDYA 2BD0A 4RVFA 2X0JA 4J6FA 5JLAA 1KVUA 1Y1PA 2HLPA 1P1IA 2ILTA 2DAPA 3AUSA 1HDCA 3OQBA 2BH9A 3O38A 3U0BA 3IDSA 3Q2KA 4HADA 4PLHA 2OORA 5F1KA 4XR9A 1U28A 1DEHA 3ST7A 1DLIA 3TJRA 4DC0A 2OHXA 5COBA 3WBBA 2NV6A 1JW9B 2RIRA 2I3GA 4YT5A 4PCVA 1CQJA 2BI8A 3BTUA 1EBUA 2D0IA 2IE0A 4TVOA 3Q2IA 1YB4A 4YJGA 2X58A 1VSVA 3VDQA 1BDBA 3A4VA 4LK3A 3X2EA 1YWGO 5BNTA 1E3IA 1AUPA 3RUEA 3VVBA 2D1YA 4EEZA 5L7YA 1SOVA 4CV0A 4PVDA 3WGHA 3NDJA 1I24A 1X0XA 1KC1A 4M8SA 5A05A 1WVGA 3FR7A 1B0AA 4BNKA 3D3WB 3IIEA 2XPCA 2X7HA 2OZPA 1IYZA 4DPKA 1SPXA 3O8QA 2C59A 1ADCA 2VN8A 5CHEA 3E1KA 3LT1A 3KHUA 3D0OA 1ZXLA 3ENNA 3K9QO 4CJXA 2Y05A 4KZPA 4L4RA 4DUPA 3EC7A 4OIMA 1CQIA 4NJMA 1JDJA 1YJ8A 4D7AA 1NFFA 1WNTA 4XA8A 4EUEA 4YDRA 2CSUA 4B4VA 3GEGA 5CAEA 4HFNA 1GAEO 3PHHA 4OHUA 4MVJF 2G82A 2ZK7A 1DHRA 4Z6KA 5KNLA 4M54A 1EVJA 3D5TA 1QV7A 1QSGA 4NBWA 2VT2A 3V2UA 5ICMA 1GV1A 1NASA 4WLFA 2QQ5A 2J6IA 4DQUA 4HUJA 5TSDA 1LRKA 5CDTA 1DC4A 1E7YA 3EDMA 5F1PA 3C7DB 1Y5MA 4K28A 1RJWA 4GSLA 3DZJA 1D8AA 2FPPA 3PZRA 2DVMA 5HS6A 1XGKA 4KWIA 4NI5A 2W98A 1GL3A 1ZMTA 2ZQYA 3M1LA 3MJTA 3TOXA 3ROPA 4MO2A 3ZV5A 2IRWA 1YRLA 3A1NA 4RPHA 1VJTA 5I7VA 4RVDA 2HMSA 3F4BA 1LI4A 4IJUA 2ZIZA 2NU9A 2QZZA 2DUUA 5KIAA 1R37A 4CMCA 2V6FA 1R15A 3F3SA 3KYDB 4W6ZA 1C1DA 4YA6A 4CL8A 4NBVA 3O8QB 2SCUA 1IOLA 1OAAA 4AJEA 4YAJA 3W6UA 4R41A 4BNVA 1LSUA 4YB8A 1LEHA 1SB8A 3B1JA 2D5AA 3KETA 2Q45A 3WGYA 3ZW8A 3JD0A 4DQVA 1EDOA 1F0YA 3Q0EA 4O0LA 4NDNE 4ESOA 2Q2QA 4CR8A 2PGDA 5ER6A 1PR9A 1ZK4A 2B4TO 2EP5A 2NTNA 3DAGA 5DULA 3IL2A 2VZ8A 3AUUA 1SOWA 1IPFA 2BELA 2D5CA 3U4IA 5AXCA 4XYBA 4PRLA 1L1FA 3DHYA 3A14A 3L0DA 4L4SA 4XR4A 3PJDA 1PJ3A 1Y9AA 4J1NA 4UVDA 4YACA 3GGOA 2C0CA 4XJSA 4R1SA 2X5KO 5TT1A 1K89A 4MPDA 4IDBA 4A0SA 1TI7A 3RU9A 1F8GA 1GCUA 2DFDA 3KSUA 3HFGA 1QG6A 1GYQA 4OYRA 1RM3A 4XYMA 4GI2A 3ETEA 2IXBA 2CFCA 2BFMA 2V6BA 4FW8A 4NJMB 4WCFA 4Y67A 1Y6JA 1VJ1A 1LDGA 3T7CA 4DVJA 4BKPA 1DC3A 2YYYA 3DOCA 3EY4A 4MVJG 2PKQO 1VJ0A 4MIOA 1T4DA 5GZ3A 1P33A 2Q2WA 4JCOA 3P2YA 4CLXA 3I9KA 2JKVA 4BNGA 4BKUA 3NKLA 2NVWA 3M6IA 3ZWYA 4DXHA 4Z3KA 4BKRA 3JCZA 3K96A 1P9LA 4YEDA 3WG9A 1BXGB 4B79A 4QX6A 4I5FA 3W6ZA 3H2SA 3C7AA 2VRCA 3OA0A 4GPD1 4HV4A 3HG7A 3DOOA 4DBZA 1NR7A 3S2EA 4CMGA 2GERA 3NYWA 4LSMA 5A4DA 4Z0PA 4U6SA 5HTOA 5IN4A 2POQX 3TPCA 5IDQA 1PQUA 2Y68A 2JJYA 4XYLA 5CPBA 5KJFA 3UAGA 2X9NA 1FDWA 1BHSA 3D4OA 1GFSA 2ZJ1A 3DB2A 1KVSA 4ND5A 1K6XA 3F5SA 4MP8A 4NHEA 2X1HA 4WPGA 5C7IO 4TRMA 4ALKA 4J2HA 1D1TA 3L4SO 3VHRA 4E5MA 6ADHA 1EE2A 1EMDA 4J9VA 3QVTA 2IZ0A 2WSBA 1T4BA 3FHLA 1N9GB 4RLSA 4NFHA 3UN1A 1GEGA 2BGMA 1RYDA 2NVUA 3GDOA 2C54A 4J3FA 4W7HA 4A2CA 3HDJA 4CM4A 3JQBC 2ZTVA 2OFPA 2PFGA 1YGYA 5JNLA 3GN1A 3R3JA 5IN5A 3RQSA 3OBBA 2O7SA 4INAA 3WGZA 3RBXA 3TZHA 4I9NA 4K6FA 3NAQA 4XB2A 4RZIA 3RUFA 4W7IA 4K1LA 2Y1CA 1PL7A 4NU5A 3WWZA 1KEVA 3ZZNA 3R3SA 1B2LA 2QX7A 3H8VA 4J4BA 1CRWG 4CMBA 3AU9A 2O3QA 3WQSB 3DBHB 2VHYA 2VWQA 3W8DA 5LCXA 4NK5A 4QO8A 1CYDA 7MDHA 4OSOA 5JBIA 3G49A 1WZEA 3OF2A 3GNTA 3ITKA 3ZN2A 1GTMA 4GSKA 1R16A 1I3LA 3JQCA 4TRNA 1WWKA 3BA1A 3EVTA 1WDLA 2GPTA 2QZ9A 3LF1A 3MZ0A 3FRJA 3ONDA 4EGFA 9LDTA 4CUKA 3Q1LA 5F3RA 5KVSA 1KBZA 3ZNNA 1MLDA 3GH3A 4TKLA 5JCJD 1DAOA 1DJQA 5MGBA 2HDHA 2JHFA 1BRMA 1PZEA 4M89A 3QHAA 2V6GA 2X8LA 1JKJA 4MDHA 3P5SA 2Z1MA 3QWHA 4IBOA 4OXNA 3VVCA 4E2YA 2HKIA 4CODB 4WLVA 3KTDA 2CF6A 4PVCA 3R0IA 3EZLA 4RZHA 4PLCA 3AWDA 3MJSA 1GADO 3EZYA 5JO9A 2ZATA 2I76A 5CG2A 2Y0DA 4RVSA 4DMLA 1KC3A 3HNPA 4PLZA 1UDBA 3KEQA 4TMFA 4G81A 3UICA 3WYBA 4IDEA 5IDXA 1V9LA 4TZTA 5BSFA 3B1KA 4ND1A 1V0JA 2DU8A 1ZNQO 5JAQA 5I7FA 2HSDA 2VYVA 3ROQA 4CV1A 4GX2A 1PX0A 1GV0A 3KYBA 4TKMA 3IC5A 4LCJA 4Q3EA 2FR1A 2EKPA 3ENKA 4KQWA 3NT5A 4U0KA 1ULSA 5EJ2A 5IG2A 1PGQA 3WR5A 3AFNA 4CMEA 2Q49A 5FEUA 4E12A 4Q3AA 1JQBA 1NPTO 1ZH8A 5KOIA 4YT8A 2FY8A 3D4PA 3AY6A 1IPEA 1EDZA 1FJHA 1PTJA 2WD7B 4GMFA 4FQ8A 3S8MA 5A06A 3CH6A 1E1MA 5B37A 3LK7A 4DYVA 3R1IA 5I9LA 2NLOA 1DC6A 3P7MA 4MP3A 4B4UA 4CLEA 1LDNA 3ZHZA 4C7KA 1LC0A 4NJOA 3I9LA 3HDQA 3RJ9A 2FWMX 4GQAA 3ZHXA 2PD6A 5U1PA 3N74A 1FDTA 4DWVA 2EGHA 3BHMA 3TL3A 4D3SA 4RPGA 2VHWA 4MKXA 3OJLA 3KXDA 1KYQA 5H83A 4ID9A 3L6OO 1IHXA 2XF8A 1R12A 4U8GA 1K2WA 4CM6A 3C7CB 4MVJP 1YH3A 2HRBA 3W4KA 8ADHA 1H2HA 2W2LD 2OP1A 5JDIC 5A02A 3NTQA 2JCVA 2X9GA 3JQFC 1OFGA 2PNFA 3WOHA 3GFBA 3I9OA 5CEJA 2NVUB 4YPOA 3KRTA 4BB5A 1YL5A 2B4RO 2I6TA 4R69A 3AW9A 1DAPA 2ZYDA 3MJEA 4JX8A 3HFSA 4Q3DA 1T26A 4ZN6A 4II2A 3ABIA 1RM4A 4UVGA 3ZHBA 1E92A 3EGOA 1YBAA 1Y8QB 2GZ3A 2VCYA 4N5NA 4BMSA 3PXXA 3G1TA 4N18A 1UXJA 2QHXA 5G2OA 1EEHA 1HLDA 1UP6A 4B7UA 4YAIA 5IZCC 3OIDA 3PWZA 4CMIA 3PQFA 1G0OA 4IS2A 1FXSA 3G0OA 1GPDG 3NRCA 3JQGA 3JQ8B 3LT2A 2FPIA 5FF9A 5KVCA 1H93A 3CTMA 5G0SA 1AHIA 3I4CA 3I9JA 2RCYA 5JDCA 3QVXA 1YQXA 4D42A 2AQIA 5KKAA 3SBOA 1ISJA 3NJ4A 4NIMA 2TMGA 1B3RA 1HE2A 4RPLA 3TZCA 3O26A 2ZTMA 5JDIA 2PK3A 4D44A 1Q7CA 2P68A 3H3FA 1CF2O 3ADPA 2Z5LA 3JQBA 1E5QA 4JJFA 3RUAA 4Z9YA 3WGQA 4OXYA 1TXGA 1QLHA 5AXBA 1QR6A 2UUOA 4CQMB 3JD2A 2J5KA 3UW3A 5CDUA 4MVJE 1ZSNA 1I3KA 3OQ1A 4UULA 3WJAA 2EJVA 3ANMA 3AOEC 3Q11A 4FJ1A 3VPXA 3E8XA 2JFHA 2O7QA 1BSVA 1O95A 3DZIA 1ZZEA 8LDHA 1D7OA 1R4NA 3CINA 4CLOA 4ND2A 1WZIA 3P2OA 2UAGA 4MP6A 4MVJA 4MINA 4FFOA 1QYCA 2FZEA 3VZSA 3H6KA 2DUWA 3HQ4O 3WICA 3I52A 2UUPA 3DZBA 1JAYA 4NK4A 3UF0A 4FC6A 4ZQFA 1EQ2A 3RI3A 3EW7A 4XIJA 5T8KC 4WE3A 1A7AA 3D4NA 1E3EA 1ENYA 3BTVA 1ZVMA 3HB4X 4KTTE 4BNZA 3AY3A 3G79A 2BHLA 1G1AA 4TVBA 4ZHSA 2GUGA 3I5MA 4D3DA 1TT5A 3DOJA 4UEOA 3OEYA 5C7OO 2G5CA 3V8BA 5IXYA 5MDHA 1CWUA 3FCOA 1IE3A 1HYEA 2AG8A 3OFSA 4FIZA 1FF9A 5H82A 2A9FA 3BIOA 5T6BA 3ZNOA 1GY8A 4D43A 4GX1A 2P4HX 4W82A 1GQ2A 4EZBA 2EHDA 3WLFA 2O4CA 4BNNA 3ZV4A 4DC1A 3LQFA 4EJ6A 3AM3A 2GN8A 1C0PA 1CERA 4S1VA 1KY4A 1HT0A 4FPXA 4NG5A 1NP3A 4LVCA 4AJPA 4CQLA 4CMEC 1BW9A 4IINA 4CM4B 2WM3A 3DDNA 3TN7A 4AJOA 1LXCA 3DFUA 4B7CA 2HJRA 3DZHA 4ZJUA 4PLGA 2HAEA 4NFYA 5JXWA 2X5JO 3PQDA 2C5EA 4LMRA 4GGPA 3L4BA 1YB5A 3CMMA 4M49A 1QYWA 3K2EA 2RH4A 2ZTLA 4OH1A 1U4OA 3M1AA 3H3JA 2FZWA 3R6DA 3E6AA 5TC4A 2DPHA 3PYXA 3DTYA 1I3MA 1C1XA 4PFJA 1ZBQA 4RF2A 3K92A 2JAHA 5L9AA 3GG2A 5CP8A 3EK2A 1HXHA 1M76A 3Q3CA 3F47A 2EJWA 5DNAA 4FGSA 4R3WA 1PS0A 4IGEA 2DPGA 4RGBA 5EERA 3G3EA 2PZKA 3JQ7A 3RFXA 3BMQA 2AE2A 2BKAA 4BGEA 3MJVA 1ZK3A 3L9WA 3GNQA 2NTJA 1FMCA 4O6VA 4OXKA 5B4TA 4R5MA 1XWFA 3FNEA 3H7AA 3H9UA 1JVBA 4PLWA 1HZJA 3S1LA 1T2DA 5HA5A 2WTBA 5KKCA 4URFA 3TFOA 4XGIA 3INRA 2E6UX 2IEDA 2DKNA 4TSKA 4YQYA 3VTFA 3WQQA 1S6YA 3VOSA 4RQUA 5DOVA 1PZGA 4UREA 5GMOA 5JAMA 3OJ0A 3OIGA 4AFNA 1PU2A 1ENOA 5JAZA 4CM8A 2W4QA 1A27A 5JYEA 3ETGA 4D79A 4CL3A 1GZ3A 2Y0CA 2DC1A 2W8ZA 3VH1A 3F5QA 1DJNA 2C2YA 5BR7A 2WWRA 4L4XA 2ZTUA 3BYZA 3OECA 1UZNA 1N1GA 4J0EA 2O3JA 2YJZA 3GUYA 4R54A 3IAHA 4E33A 5JDCC 3DWFA 2DBQA 1K3TA 2LDBA 5FFFA 2PY6A 2OMEA 4IY1A 4GH5A 3SX2A 2P5YA 3V2HA 4PG8A 1MA0A 1T24A 3JTMA 4Z9FA 5IJZA 4OQZA 5L53A 1MV8A 3QE3A 3RUIA 4JXKA 2RAFA 4GMGA 3SXPA 1ONOA 4LCEA 4CM8B 4LISA 3WS7A 1GYRA 2ZB7A 3ZU2A 4XZ3A 1GPJA 3AOGA 4ZQHA 4PG6A 3QQPA 2YDXA 3QWIA 4XKJA 3QRWA 1ADBA 4I1IA 2UYYA 1NAHA 2Q1UA 3UGKA 1Q0HA 4E3ZA 1YQDA 3LLVA 1LSJA 2FR8A 1ZXBA 5EPOA 1AE1A 2PH3A 3ZCXA 2VYNA 4QXMA 2O2YA 1KS9A 3RC1A 5DN9A 1Q1NA 1MG0A 4BQRA 1BMDA 2CNBA 4CLRA 1QRRA 2C2XA 1HZZA 1U1IA 2VUTA 4ND4A 4XYEA 2G1UA 1Q7BA 5DZSA 4XQCA 4D45A 4YT4A 2OXIA 3U4HA 1HYGA 3PLNA 3TZKA 3WIEA 3GDFA 1GQYA 4BKOA 1R0KA 2PZJA 3JQGB 4QQRA 1E0DA 3OMLA 5HM8A 3SVTA 1O9BA 3VZRA 5JMPA 3FNFA 4CQLB 3RC7A 1GDHA 5JS6A 4J4TA 4PIVA 5CG1A 3RKRA 4PLTA 5COAA 5KJEA 2AEJA 2B69A 4R4JA 1UP7A 1X7HA 3NGLA 3BXXA 1PEDA 4ILKA 4CMAA 2Q1WA 1LJ8A 2PGLA 5ADHA 2FSSA 2B36A 3KBOA 3ZW9A 3H5NA 2WE8A 3WX0A 3HZZA 2GRAA 2HMVA 3EVNA 4H7PA 3GGGA 5A04A 5CEEA 1T1RA 1PQPA 5B1YA 3DHEA 1LDBA 3E9QA 4QT0A 1GUFA 4HY3A 1YVEI 2GDZA 3D3WA 2ZYAA 2DQ4A 3VDRA 2VHZA 4MKZA 4PZEA 2XXJA 3DZKA 3BMNB 1NM5A 1YDEA 4UVIA 4YRAA 1H0KA 3WTBA 1DHTA 5JC1A 4E2WA 2YFQA 5A5FA 4IIUA 1QYXA 1ZIDA 4W4TA 1MP0A 5FI3A 4E5YA 4BMNA 1P1HA 2IODA 1RYEA 3I9MA 3ZHYA 3BMCB 5L4LA 4K26A 5HWSA 3BTSA 3C8MA 3EAGA 3QIVA 3GEMA 4R9SA 4ALLA 2VWGA 1ZK1A 2X86A 4I8XA 5DP1A 5JCJA 4B7XA 4XDYA 4UUPA 1GUZA 2O3SA 5KVQA 5LC1A 9LDBA 1A9ZA 1YXMA 1ISFA 2Q99A 3PK0A 3GG9A 4OQYA 5KVVA 4AJNA 1M6WA 3LYLA 3QJ5A 4L74A 2B4QA 4A7PA 1YQGA 1W73A 1XELA 1H9BA 3VPGA
chains in the Genus database with same CATH superfamily
2K2WA 2Q4BA 3EAFA 5FA6A 4DAEA 1JV2B 2HT1A 3GP3A 3IAS6 5KNCD 1ISHA 4FYYA 4EI8A 1Y3IA 4H15A 4CG1A 1TA4A 1R9NA 4BB6A 5C81A 1FNCA 4Q4HB 2GAOA 2IV2X 2PAAA 4GYKA 4KH0A 1UXGA 5LDHA 1T8RA 1Q0ZA 2SKDA 3PZBA 4KN6A 4G1CA 4V0NA 4G5FA 3FB1A 3I5XA 3RYFB 5DWVA 4PEVA 4OTZA 1BMTA 3IVGA 4MWOA 4XQGA 5CW1A 4ZAZA 5FTJA 2OV8A 2WG0A 4C6TB 1CY8A 3CKLA 1AV7A 2WSMA 1SWWA 1QHHA 1XJQA 3KDPA 4RNDB 4BASA 1LPMA 2X4GA 4CV3A 3KVNA 3B36A 4UBKA 2PXAA 5JSZA 1HNZB 3P94A 3EVAA 2PFSA 3HB5X 4JV5B 3IP1A 5IF9A 3RC3A 2PT5A 1G4HA 1O08A 5JHGB 1PF7E 1F38A 2WUEA 2XOEA 3AKCA 4WL0A 4E4YA 2F3QA 5K8TA 3HA7A 5LUAA 2VDOB 4L75A 2IHKA 2QN6A 2ZPUA 3JQFA 1OV6A 1N7GA 5KWEA 2CLFB 3DWIA 1HTWA 3KKQA 3PX2A 3EHEA 4PO1A 4EB3A 1I36A 4I9UA 5H9VA 3GLGB 3IKTA 3ZXUB 5HIIA 1CLEA 1W4ZA 3PUIA 2H54A 2GCIA 3WLMA 3BILA 1NPYA 1E3SA 4IM7A 3HUDA 3PGKA 2ZXEA 1QF9A 4R9RA 1LC3A 4X1IB 1PZHA 4KPUA 4E08A 3N5KA 4UTRA 5AKZA 2QV7A 1CRLA 2OYRA 3UJBA 1SGWA 2ALJA 3DT9A 3BJIC 1Q0LA 1Z2OX 2C7BA 1XX6A 4CIBA 2OTCA 2V7TA 4UDOA 1SKYE 1XMVA 3CXRA 4BO7A 1RPZA 4MX8A 1W7AA 4GGOA 4R68A 3KUUA 3WGTA 1MO3A 1WBDA 3OLWA 4PXYA 3TRDA 1EG7A 1BROA 3BMOA 4YJKA 1NUTA 4JI2B 2Y0EA 4DIOA 2FX2A 4PAOA 4DLTA 3L46A 1G5PA 1R8QA 3BA6A 2BEUA 2RHCA 3L6BA 1QQ7A 3O3NB 3G1WA 4ZT6A 3TTWA 4C01A 3D7MA 3TZ6A 4EFKA 4YRBA 1NTOA 1I0IA 4C4RA 1EKXA 1PEAA 3MJ4A 4RV9A 3TL2A 4BQSA 1A5SB 2X2EA 3OZBA 4QTYA 3SIRA 1SVMA 3VZPA 1QP8A 1F8FA 2ZYGA 3KZ1E 4MS1B 3NUZA 4NE9A 4NENA 4EPWA 5EIXA 1J70A 3GQBB 4EKDA 1Y48E 2GBLA 4PPGA 4XD7D 3G0IA 4CMHA 4MV8A 3TB4A 4BLUA 4EI9A 5JJCA 1XNHA 2V3WA 4XWYA 1C9KA 2ZB8A 1VMKA 3VGPA 2P4UA 2IDZA 1KQNA 2LW7A 2QZ4A 4BJHB 4XJXA 3U3RA 1HT3A 2FW1A 3UCEA 1HFEL 3IPXA 4DXAA 3ICQB 4REQB 1F8UA 2BGGA 4QO7A 1ZM2A 1KO7A 1S2DA 3O4VA 4IIJB 5F33A 3IDOA 2ZIXB 4EQ6A 3C97A 3NEJA 4ETMA 4FFPA 4F93B 3IT1A 4N3GA 4X0EA 2NTYC 2ODNA 1ZHHA 4MKHA 2DM6A 1KI2A 3PR1A 3ZV3A 1TLLA 2IBMA 4J0DA 3WRXC 4ZO6A 4FOLA 1P91A 1IXSB 2WHPB 4UPEA 2IBSA 1KEWA 4HXEB 5C5CA 4C06A 4FB5A 3D7KA 3FH0A 4WNCA 3INTA 1PGNA 1GPKA 4DV6B 3UFXB 3OZTA 2JCXA 5EEGA 3WXBA 3ZTWA 4NZMA 5HNKA 1IBKB 1CVRA 3H9JA 5DTQA 2O2ZA 3IEVA 2QAGA 3QWFA 4DNPA 4KOEC 3JX9A 3SFZA 3HTXA 1NURA 1Z5PA 2W00A 4AYWA 1H8EA 1ZNYA 3B5IA 1I7NA 4Y6PA 5CVDA 5F4ZA 2WAXA 2A67A 4IZHA 1RAGA 3BH0A 1C3EA 2MMCA 2ZWVA 3NQ41 2HV9A 4RXMA 1V3TA 1WR8A 2ZSJA 3DEIA 4OX9B 2ZVPX 1GJRA 2HMUA 3OE1A 4KSYA 2GVNA 1DKQA 3TI7A 3VR6H 4AMBA 1S2GA 1X19A 3TXAA 2ZS8A 3LCRA 4N9QA 3U1BA 2P5TB 3MRVA 2Z3ZA 4IGAA 5FTWA 3RODA 4UUQA 4C4PA 2GAAA 2WICA 4FD3A 5JAOA 2G0TA 1P1BA 2FYTA 1YU9A 4ZYVA 2YRXA 1T9DA 3BXZA 1W5AA 1SOAA 1VMAA 2AK2A 3K1TA 4HYEA 2V7WA 2CE7A 2HNAA 4P5EA 1Y9EA 2XTNA 1AHHA 2NUTB 2P91A 4EENA 3EGEA 3RWBA 3AJAA 1B74A 5SY6A 1E9AA 2VATA 3SZRA 4TZ0A 4UHBA 1TTTA 4AN4A 1SBQA 4DQXA 2ZIGA 3EOBI 1NATA 4OP1A 2VAVA 4LDNA 2OL4A 1N36B 4N9WA 2AUTA 4AZ0B 4P4LA 1J8MF 1ESNA 1S9DA 5FTKA 4EI2A 4YRKA 4PIMA 1W9HA 3DO6A 4M37A 1C0KA 2P9YA 3H5OA 4A2QA 4GVLA 1IM2A 1JX6A 1K98A 4X66B 2AJCA 2ZPTX 1XXHA 2PSEA 1V8PA 3G0CA 3ICVA 4QUHA 4ZOAA 1UBGA 4B71A 1IN7A 1TOAA 1HDIA 1V16B 4A27A 4CUZA 2OCDA 1LGYA 1XALA 3QKWA 1Y3BE 3OQPA 5F5LA 1M2EA 3OMXA 1JQAA 1RRFA 4D0GA 4NV0A 2NSDA 3FYUB 4MDEA 3EUEA 4C7VA 3IBGA 3IKMB 2ZWAA 4NFLA 1Z4PX 2IPXA 1CF4A 1X13A 4UUBA 5TXGA 2FSUA 4A6DA 1Q95A 1V71A 3DOIA 4ZI5A 3OLXA 1XDZA 4LC9A 4Y6LA 1RCFA 3AEXA 2IZZA 1PNQA 4BBPA 4D46A 4PRKA 1TK9A 5IJ9A 5FBWB 2EHJA 3ELYA 5KTOA 1ZD8A 4RKQA 3I3SR 3E5NA 1KSHA 1ONSA 1X8LA 2VT6A 3W6NA 1QPBA 3RT7A 4BV8A 5LJLA 2NZWA 2LRHA 1B8UA 3CH5A 2NU8A 1Z7EA 2GM3A 2O7NA 5LYJB 2JFFA 5EPUA 1SKYB 1XMSA 3ZWWA 3FI0A 3E81A 1EFRA 2BHNA 3DWGA 1T2EA 3N3BC 3LHDA 4HN9A 1BGVA 3D1VA 4X00A 3F9CA 3ELUA 5LA6A 5AVUA 5BNZA 1OLUA 4J8PA 2IYXA 1I13A 2PEZA 2V03A 5B7NA 5JXJA 2EZUA 3PUVA 1SXJE 2ODTX 3NXSA 4JJ8A 4L8GA 1AF7A 4PYRA 4BO1A 1R6VA 4BP8A 1CYEA 4H7EA 4HUQA 2GWRA 2JAPA 4RFLA 3DVAA 4J2TA 4ZCPA 4AMYA 3OPVA 1JR3A 1JIKA 3Q6NA 4O0MA 1QV9A 2CHFA 4JZKA 1QMPA 2EG9A 2ORWA 4KDFA 1XF1A 2ACKA 1E6KA 4OUDB 2DWOA 4IFTA 3CLKA 2GCGA 3FPBA 4ZRDA 2WTNA 4I46A 5DWDA 3ZKWB 4N48A 1CEYA 3U6BA 2FMTA 1DO0A 3V1TC 4ZA2A 3NC1C 2HJ9A 4GVXA 3K8ZA 5AKGA 2A94A 2PZMA 3PT5A 5EIFA 1SXJA 3CLSC 2X41A 5EG5A 3COVA 1E5VA 2C9CA 2V8BA 3GJ7A 4KH1A 2IU4A 3NV9A 4YTEA 3H5IA 5JNWA 3GJ0A 1ZOLA 4P81A 1SZCA 5C5EA 2V0CA 4Q02A 3TVDA 5ENDA 3P27A 4IJVA 4U63A 4N54A 1LPSA 4XRGA 3I8SA 4P84A 2VQEB 2YVAA 5FQOA 1ZA2A 1LF0A 1EAYA 3IP6A 3HDGA 1M8KA 3H5VA 4H3VA 2EFCB 5ESXA 3OQ6A 3ZDDA 1UMCB 1W4LA 4L3OA 4V39A 4MROA 3NHAA 4EY6A 2Y1FA 3RSSA 4A0HA 1BDHA 3A1TA 5DTRA 4ARAA 4XPIA 4L7QA 2CGEA 2A0XA 3B3FA 4I50B 4C7JA 1TF5A 1J06A 1RLUA 1KEEB 1XD9A 4IEEA 5H3LA 3U7QA 2FUG6 4FLFA 1VA5A 4WXYB 4NLLA 1G63A 3T4UA 3FPAA 1Z8FA 3KQSA 2IKQA 4O4IA 4Q6BA 1XVTA 1ITZA 4XW2A 4QFDA 4AZ0A 3ZJ4A 1HFWA 3L8MA 2H7CA 2YASA 4RDIA 4B45A 2PUCA 3GRZA 4J7AA 3W8EA 3OSZA 1GZ4A 4JROA 1XHLA 3FIJA 5GINE 4MQEA 1ULZA 1ZD4A 2ODWA 3EQ2A 5CIQA 4YN3A 3SE0A 4J1SA 4HAZA 4Q3OA 5BV1A 1I2ZA 2P0AA 1SHZA 2I4IA 3EXG2 2DERA 1NV9A 3FOCA 3MS4A 1L9XA 2VDRB 1GG9A 2IL1A 2ZI7A 2O8FB 1IC6A 2VA9A 4RELA 1I1HA 3TBKA 2IXFA 5KREA 1QVWA 5CCBA 3R7DA 4LV6A 2DB3A 2IF2A 2VBIA 3MOIA 4S3MA 4I3GA 3RRXA 4CT0A 4DLRA 1E7WA 5AJTA 1WJGA 3V9PA 1B8PA 4OHVA 4Q4AA 4DIKA 4FFRA 5TPZD 2Y6VA 1NVGA 3FOFC 3FTFA 1V6SA 1S8FA 1YRQA 3KQTA 4PU0A 2JBWA 3HDHA 3X3HA 3BQ9A 1E60A 3RM3A 1T35A 3MJCA 2J9ZB 1Z0KA 5LN1A 3QU7A 2BV3A 1JHVA 1L5MA 4FZRA 4RTJA 4LJKA 3IHLA 5IBPA 3ZDBA 2GK3A 2REBA 4RW0A 1PX2A 3CRVA 4JJZA 1UUFA 3I53A 1XTIA 4WVLA 3LPLA 1J0XO 4XM0A 5KDOA 2NO1A 3ZY6A 1LZKA 1U6IA 4AJ1A 4OK6A 2IHJA 3V34A 2UUBB 1FSSA 2HU7A 2QIPA 1FTGA 3H2KA 4P98A 4R83A 3GLFB 1S3GA 4QDXA 2OBNA 1BQ4A 4J9UE 3EZNA 4UTZA 5E9JA 4EB0A 3K4HA 5ALHA 2NXNA 1ADFA 4RVCA 1KK1A 4I4LA 3ZKWA 2VJNA 3P0IA 2ATCA 2HQSA 2R96A 3KL2A 4RMHA 1HOTA 2GYWA 2R7AA 5BPHA 1T5OA 2QTVA 3WVNA 5KUTA 3DCIA 5JU6A 5J2UA 4IDOA 3H83A 1G6OA 2QL7A 3AILA 3KSBC 3EVEA 4PXAA 3ZWDA 3PJEA 4Z53A 1WSDA 2BFFA 4AO6A 3VYSB 1TGVA 3MF4A 1VE3A 3FGZA 1CE8B 4E2FA 2PQ6A 4OI4A 4ZV7A 2ATXA 1APBA 1K7EB 3LT4A 2Z4TA 3PE6A 3L7DA 1T9CA 5U4QA 1GR0A 5FYQA 4R3NA 1Y89A 4EA9A 1C8BA 4L6AA 2XMDA 4DNOA 5K05A 4BP1A 2QDXA 2AXEA 2Y76A 4BIIA 1O89A 3N28A 3IO5A 3KXLA 3QV1A 2YDYA 1PWEA 2JI4A 3GVIA 1UM9A 3U4QB 2VQSA 5DGDA 3H6GA 3PNLA 1KIMA 1LPPA 3SIPA 1K8RA 3AFHA 3GUZA 5I4CA 1C7IA 4PFKA 3RSHA 4YH1A 5CVVA 5GOZA 4ADSG 1ILWA 1E2HA 1SZPA 3JPYA 4XWAA 3RU7A 1CY6A 3ESRA 5J4HA 1DBVO 5KNDH 2BCEA 3CVJA 4RV5A 3TR6A 1N7HA 3DAHA 1PR3A 2B8EA 3KZVA 1E4OA 4ONEA 3E7WA 5KPJA 1HTBA 3HJRA 3U3DA 4OSPA 1NLMA 2G4LA 1TC1A 4X6LA 4C78A 1BVRA 2YIVX 3AI1A 1Z7BA 3EEFA 4HN2A 5E38A 1MFPA 4D4HA 4LRUA 2EFGA 3HN6A 3B8EA 2YUTA 1D2CA 4KN5A 1L4FA 4RK0A 2JANA 3KLMX 4PGMA 5I6DA 4OHYA 1X3LA 1U02A 2WPNA 2QU8A 3AZQA 3T0GA 2OD7A 4GT1A 4RDCA 2DHQA 4PHCA 3GOQA 4JYCA 3GHYA 1BCSB 1E0SA 1ZWLA 1P6QA 1W34A 3CF4A 4G5OA 1J0EA 1RHKA 4P3NA 2DWPA 3W2EA 3E0XA 3DDOA 3WAJA 4C7OB 2ONKA 1U1CA 2D3TA 1Y6QA 2CY0A 3TDMA 4BZPA 1RE0A 3LW7A 3QFHA 5KYTA 1U81A 3TLMA 2YOHA 3GWZA 2Q6TA 3ZDQA 2W6ID 3THWA 4AKGA 3COJA 3T5GA 1NG1A 2YFKA 3FAKA 3A7EA 1INLA 2IIQA 2Q3BA 3ODPA 5IM5A 2P1DA 4LRQA 3TI9A 3WKBA 4R2WA 3TX2A 4DS3A 1DFGA 4A0FA 2JEZA 4DZTA 1QHNA 1QG2A 1MZVA 1VG0B 4R7TA 3S99A 5LFAA 1XTJA 2C03A 2RARA 2RFLA 4KFRA 4JLPA 5KNDD 4XAQA 1YS9A 1RR6A 4ZT3A 5D3MA 2BFOA 3FYDA 1KJWA 5L3ZA 5A4JA 1U3GA 2OCXA 1USWA 3GLFA 4UZFA 1NAIA 3GLTA 5AOAA 1Q2UA 4MPPA 2HU5A 1QAQA 3MBOA 3G0HA 2IYOA 4KSCA 2VG8A 1JU4A 4DMHA 4DQ0A 3PLAE 1S2LA 3D7RA 1WOYA 2WI8A 4KLAA 3X1XA 5AVXA 2DGDA 2YW9A 5H4GA 4GMXA 1ML3A 4ZV9A 3V8VA 1JALA 3LYAA 5KCMA 3JZMA 5M34A 3VZDA 3W5SA 3QX7A 3VOBA 4D98A 1NQ5A 1E2LA 8ABPA 4B34A 2V4ZA 1G8YA 4BNMA 3IYLW 1PR2A 1LBIA 5FLXA 3HKCA 3RT1A 4TYMA 1RWQA 4HZIA 3DGFC 2PZFA 1WULS 5D85A 3DDSA 3G7SA 5ALFA 1G20A 1FS5A 4C3VA 2VDQB 3B8HA 3AGQA 3BHIA 4XLLA 3L77A 3U26A 5LQDA 1DXOA 4AULA 4BRSA 3KTFA 1W85B 3AH8A 1YE5A 3NC4A 1EQAA 1QKIA 1DRKA 2C8JA 2XGGA 3CZ5A 3E8SA 2C7RA 3WHLA 1Y80A 4IMIB 4O63O 2QRKA 1C3OB 3CBQA 3F1LA 4MZXA 4XCVA 3I9NA 3K0KA 3GEDA 1Z37A 3C74A 2NT4A 3RANA 3K0AB 3OOEA 1R10A 1CNEA 2AZDA 1TGYA 3LBIA 5F2EA 4Y0VA 3VM6A 1EP9A 3GMSA 4HO1X 4RESA 3EPLA 1DAMA 3TLZA 4AIRA 5J4VA 3DZCA 1PFGA 1L8AA 5K8CA 1W2HA 3KM0A 3A3PA 4NJEB 2ZR8A 4YV7A 1AGXA 1JLRA 2FQYA 3GT3A 2LD4A 4LZNA 2VK2A 1CIVA 4G5GA 5DF1A 1KKUA 5A3SA 4GBJA 4M8NE 2J6BA 3OFNA 1GU7A 1T8PA 1OC4A 1QRDA 2VJMA 2OBXA 3LXXA 3JQ8A 3F3YA 4BIMA 1Z16A 4K9QA 4DWJA 2WAOA 1KNQA 1SCBA 5TQVA 3HM2A 1I9GA 1JDPA 1UJMA 2C82A 3HN2A 4U2EA 3OPYB 1SHLA 3QLTA 5HZHA 5JNSA 2OESA 4R1PA 2G04A 2V7QA 4GBED 2FUG1 4RY8A 5EUCA 1OLOA 4DEVA 5LP6B 3VO8A 4D92A 3FZQA 1S2NA 1LUAA 5G3ZA 3RS9A 4BO0A 5KOHA 4L5IA 4BO8A 3N2GA 1M1YA 1UKZA 2HO5A 1EA7A 5TQ2B 3IB3A 3WZMA 1U3UA 3K0HA 3VKVA 1GPUA 4TMYA 4F6CA 2WA1A 3AEQA 4Q1VA 1RWBA 2PM8A 1N5MA 1V7QA 2BF7A 1IHUA 2JIPA 2IH2A 3NR2A 2WU8A 1J5XA 1M6NA 2I3DA 2XUOA 1R8YA 4PC2A 5B30A 4NZYA 1AKWA 1UP4A 4GKBA 4JC0A 3ILVA 2X8JB 1Z08A 2PS0A 3G88A 4ME6A 4ZU3A 1Y8RB 4RH3A 2Z0MA 3DDHA 4XD2A 4B32A 5KNCH 1ZVKA 1CBUA 1M1YE 2FOLA 2G7ZA 1J2TA 4WLNA 2FSVA 1OD6A 1D2NA 1ZM4A 1AF4A 1NUAA 2CFSA 2AT1A 2BZ1A 3H5RA 5DYNA 3GPIA 3UA4A 3FWNA 5GJBA 1D6MA 2ADFA 1FPQA 2VZLA 4NBUA 1HEUA 1F14A 5B1SA 4B6OA 3OIYA 4QUAA 1UXIA 1M73E 1CRZA 2HPZA 2ZJ5A 1CKEA 2F1HA 3C6ZA 2CEAA 4HYTA 4X7RA 3GGCA 3U7RA 5AQ1A 1U9IC 3LIPA 3CB2A 3KV1A 4NF2A 4TMKA 1D0SA 1TQDA 1R0YA 4TLMB 4Z3OA 3OBIA 1S02A 1NZJA 1U94A 2Y1EA 1OXBB 3EZ2A 2QVGA 3PQEA 1P44A 3Q40A 2I7DA 2CMFA 4KQKA 4Q7LA 5T57A 3F96A 1K6JA 3VXKA 5I8ZA 2ID7A 1US8A 2OO5A 4LHZA 4HQRA 1QU3A 1A98A 1A8UA 4OD0A 3O83A 1M1NA 1RWMA 1U7HA 2QX4A 3AR8A 1DG1G 1N3IA 4TKUB 4NU8X 2QRMA 4PANA 4Q9HA 3EPPA 2ZQZA 3O8CA 4UBOA 1M2OA 3D7LA 3TCXB 5LMNB 1JMKC 4AF7A 1C3OA 2EX4A 3EQ8A 3RIXA 3SVZA 3V1MA 1E3QA 1PNTA 2NO0A 3RS0A 1BFUA 1GRCA 1QH1A 1U7PA 3I6ZA 3FSGD 4JT2A 5EINA 1UK8A 4L7VA 4ZC1A 3TX6A 4PYKA 1UK9A 1WXWA 1QO0D 2WK1A 3DPIA 4IX1A 1KOLA 1NSTA 4I4IA 2EDAA 4ZTZB 4Z0NA 3H11B 5FTNA 5BN4B 3QU4A 2LKDA 4BQIA 2W2VA 5K0ZA 9MHTA 4L4UA 1US8B 2F4VB 1NBME 2E89A 3CLRD 2XODA 5F23A 3O4IA 2OFWA 3PIDA 1WP9A 2DP4E 3QOFA 1CJCA 4I5EA 4MR8B 3SJAA 5JV5A 4M7OA 4LWOA 2OLKA 3NWBA 1JUDA 1O6CA 3T41A 2KLBA 3BBPA 3BE6A 2A5DA 3AUYA 4KBFA 3DBHA 1JR3E 1J8FA 3KQOA 4HDAA 4NE7A 3DC2A 3KJHA 3GVXA 4P0PB 1A9YA 2ASEA 4YXFA 3FF1A 4KUGA 1BG6A 1GPWB 1VJ5A 5THKA 4TT3D 4N0DA 1WV1A 3CNOA 4OMFG 1IDN1 1OBHA 1FNMA 2QN2A 4YRDA 3MYRA 3S2FA 2HXGA 2AI2A 3QF4A 4GC9A 4ZCSA 1EHCA 4BU1A 3OE4A 5M7EA 3BZBA 3EODA 3U9LA 3WK9A 4EG5A 4M1MA 1A72A 3KLPX 2RB5A 4A16A 3H1GA 4D9EA 1VA4A 2F8MA 3ZVNA 4NSNA 5DNWA 5AM4A 5C8VA 1VL1A 1KY3A 1AG9A 4OLJA 4WD3A 3WK6A 3IKJA 3ASVA 4WW0A 2B6HA 3EMVA 4FGLA 4GOMD 4IH9A 5KNLA 3K2BA 4E21A 1FSFA 1NNLA 2EBWA 4HMQA 1FRNA 3SLKA 3HXPA 4BNUA 2BKLA 2REQA 1EYZA 2NN3C 4W5RA 5ECWA 3IAFA 2AOUA 3TPZA 1KK0A 5K6AC 4BO5A 3OA2A 2IYAA 1ZYUA 3D3QA 4IMRA 4B6JA 3NNDA 2ONCA 5I7WA 4H7DA 2FXIA 4ZO8A 4URWR 4Y6OA 2HUNA 2GN9A 2WYOA 4ZARA 2BKVA 3AUTA 3FTNA 4K88A 5D7NA 3ULKA 1HDZA 2PKWA 3IQDB 1EZ4A 3QHPA 5E7QA 3S28A 1P2VA 5DIFA 3BB4A 3CZPA 1FRZA 1V8DA 2Q3EA 5CTJA 2O9JA 3QMMA 1WAMA 1KQOA 3ONFA 4P86A 1F6DA 1NYTA 1TADA 4IXWA 4EDHA 3I1FA 2XOXA 1FDVA 4MULA 2QD5A 5AI9A 2KQUA 2P6RA 1OU0A 4WV3A 3B1WA 3EHDA 3P2JA 1CUSA 4F56A 1R6XA 2J30A 5KHOC 4P3OA 1KP9A 3CEHA 5CDSA 2YCLA 3PPXA 4B2LA 2FH5B 1CTQA 1VCMA 3CGWA 3GCGA 4I9GA 4XE5A 1Z62A 5I9TA 3JZIA 3V46A 1UFOA 4B2IA 4AS1A 3SBXA 4N8EA 3NBXX 4X45A 3AKZA 3TLGB 5IVHA 4S05A 4DBLC 3BJMA 4DILA 1UJ2A 1Y4ZA 1JZQA 3BD7A 3ORFA 3PL1A 4HSEA 3AIMA 1KKLA 1F0NA 4FBLA 1FP4B 3GLSA 4G5HA 1CUCA 1SUEA 2JZNA 4MVJH 1MAHA 4OM7A 3W1VA 2DHEA 4EBBA 3T1QA 5TV2A 3NATA 1Z88A 2JIRA 1QUEA 5KYWB 1UAGA 5CH8A 2C58A 5BUCA 1JKFA 3M6MD 4YCLA 3C85A 5JWHA 3GAFA 2D00A 3EXFA 4KR7A 2XUDA 4P4SA 3VR4A 1GA1A 1GGKA 1G64A 3ACDA 4UPDA 4WVFA 3WKDA 1XN1A 1LX7A 1NQVA 3ZWVA 2UDPA 4M4SA 3U60B 1PG5A 1AS0A 2ZITA 1QO7A 1M6HA 3HBFA 3K9BA 3C6BA 5HGXA 2QYSA 1GOTA 4H4CA 1OZ0A 1DV2A 1SUBA 4M8KA 4O2AB 1G8HA 3ZI7A 2JFZA 3VDMA 1N25A 4QODA 4CLHA 2XGOA 4EMBA 5LP6F 3COSA 4CKEA 2I2CA 3CN7A 4UATA 2WUDA 3TTYA 5LWHA 2PBRA 2BZGA 1A4UA 2J3IA 4KQCA 5JJLA 3CIOA 1QH8A 1SXQA 3C6KA 2IYTA 4J2OA 5KTMA 3F7NA 1ZJ4A 1NJGA 4CIVA 5DHRA 3EXHC 3D8HA 4D3XA 1T3HA 1RVV1 3GD5A 5CLQA 3BSSA 3WISA 1DPGA 1LU9A 1TQ8A 3JARB 5K01A 2W4IA 1ECPA 1ZJYA 4UUOA 3V33A 3HYSA 5JMWA 2P9GA 1TCCA 1RHQA 1OLSA 1VSUA 2YXEA 4UNQA 3RG8A 4YUYA 1JAZA 2R7NA 2QRHA 3FSEA 2ZDHA 2OCKA 2CJWA 1VL2A 2JIQA 4ZOLF 4DJTA 3OAAA 4M88A 2XJ9A 4EVIA 2GCNA 3WLSA 3WMWA 4L73A 5GY7A 3RE1A 1ZN8A 2WHRA 3FB4A 1NKVA 2WP0A 3LBNA 2COEA 4CT4B 2D8MA 4CCYA 4CZ2A 4HKTA 1F0PA 4EHFA 2A5GA 2FJUA 4MW5A 1P60A 1ZMXA 3WHPA 4CM3A 4Y2PA 5JPIA 3NFRA 1JFSA 1XDUA 1RHMA 1OI7A 4FONA 4UM9D 1WETA 5DNDA 3F74A 4I6GA 2O8DA 3G9ZA 4W5WA 5CNIA 2HK6A 3WP0A 1I8TA 1F60A 1W49A 5HSGA 5HFAA 4DDVA 2VTBB 3JALA 4QG7A 2GDJA 4MQUA 6CHYA 3ANNA 2KBEA 2OG2A 2ZXUA 3JXEA 2DHDA 1E3LA 2ONZA 3F98A 4FN4A 3LWNA 4FS3A 4OA5A 1ULUA 4CEHA 1DIGA 3ZWBA 1U0TA 1L3BA 5FBLB 3R5JA 4TZKA 3TJMA 5T8KA 2N75A 6YASA 1HE5A 4JLOA 1E3WA 3SAJA 3BDIA 4DWWA 2KBFA 2OAEA 4EBFA 1O0SA 4I6JA 5JECA 4KXXA 2QYOA 2F9MA 2A7XA 2WT9A 5JARA 1WCIB 4JLSA 4YUVA 4MCIA 3PCXA 1NN5A 1RHRA 3QE0A 1DAFA 1I2MA 3MRSA 3NBQA 4WXMA 1JHAA 1II9A 2Q4RA 2LIVA 2AF3C 2L18A 4R9UC 1NVUQ 3J7TA 4ASUD 4NYMR 5I8WA 2VWHA 1N4AA 1IQPA 3M6WA 2BFFB 5EA2A 2VL7A 2CL0X 4FOSA 2R1TA 1YQTA 3OIUA 1Y9DA 4JLAA 3NTXA 1JZTA 4QUBA 3VH4A 3PJRA 5E4YA 4HWSA 2Q4EA 3ZH2A 5SYMA 1KJ9A 1NE2A 2WMYA 1KO5A 2E1PA 1CUZA 3BM5A 3MMZA 3O74A 1RZUA 4GP7A 2HJWA 2ZT7A 2B82A 3B20A 3P1JA 4MGHA 1NBEA 1DBPA 1O6BA 3L18A 4I1YA 2MSCB 1EVZA 1QLWA 2FMXA 5BSWA 4WKGA 3CTPA 2RJ3A 4E5VA 3CM0A 3D6JA 4OGGA 1U2TA 1QYRA 4B80A 4MVXA 3FHTA 3ND5A 4DYHA 4D3FA 2H8KA 1U9JA 3GNLA 2FFQA 4NARA 4YBZA 2VJLA 4O1MA 4DQDA 2PXHA 3PI6A 5E9AA 3U48A 1R5JA 3KU4A 3NYRA 3HHPA 4QARA 3MGKA 1PGJA 1LLFA 1C14A 1XYGA 5C0OE 4BNIA 1N5LA 3AK4A 4ZQIA 4BHTA 5EXSA 3ZDAA 3NHWA 3WRYA 2A58A 2HH9A 2AYYA 4I81A 3ZY2A 2CLOB 2A92A 3KYJB 4Q19A 1C80A 1N1DA 3LDAA 2W6JA 5HJEA 4LWPA 3GRKA 3N6XA 4TX1A 4X85A 2O8EB 4LOHA 5DDIP 2CDNA 4ZI7F 2EW2A 4BX9A 5FFNA 4H6WA 4PTYA 1R50A 3LRTA 4JK3A 4J4HA 4L2IA 4RKYA 5JD3A 3HYLA 2ZIAA 3JASB 4MRVA 3M6XA 3PENA 4TXJA 4GWKA 2XQVA 2WYHA 3MRXA 1MB3A 1MABA 1U3VA 4L8VA 2K7FA 3HDVA 2E48A 1TU4A 3W5JA 3RVOA 5BVHB 1W36B 2XXBA 1YDMA 3AM1A 4INJA 1ATIA 4ND6A 2AMLA 2WHYA 1PD1A 1ZD9A 4TWJA 1RI4A 2WU4A 1MB2A 4Q4DA 4WLOA 5FUYA 1RKVA 1JA0A 2VXCA 1J8QA 1KXZA 4TQAA 3WJ7A 1KXJA 1NW8A 4B3HA 2NYUA 4AQ7A 4N7MA 2C5LA 4Q3BA 4ZK6A 3HXLA 3BK7A 1NXOA 4ASUA 3F78A 3UVEA 3OURA 1YZTA 3NIGB 4PG5A 4WXEA 2BGTA 3E3NA 1LCIA 1X86B 1SU6A 3NCHA 2JRCA 1WP4A 5K8LA 4TTTS 1RJGA 2W2LA 3KZXA 5DBFA 2XE6A 1N5RA 3OH8A 5E95A 4DJFC 2PX6A 3HPRA 3E48A 3GAZA 2PRIA 1W581 4A4DA 4H6VA 4EG1A 1E1LA 2ZUVA 4KP7A 1N92A 3GROA 3J80A 1ZO8A 3LPNA 2NUAA 5B1HA 3RVJA 3Q9SA 1A8PA 4GW3A 5U9CA 1FP2A 3OTQA 2QMOA 1VZ2A 5DRYA 5AW4A 4GLJA 4XTCS 3WTCA 2JB9A 1CDOA 1F06A 1NRIA 2YJ4A 2VP9A 2PX0A 3PGA1 2TMDA 4TS4A 1P62B 2X1VA 3ZU4A 4CF7A 4KLNA 1N4DA 3OWXA 3B6MA 4R8MA 4PAMA 4MUEA 2RG7A 3PDUA 4ZJPA 1ZM7A 3F6CA 1NMZA 3L79A 2XQGA 4N5MA 1NUPA 5HQTA 3OKCA 1UFRA 4HQKA 5DKFA 4HS9A 1JHOA 2H92A 3F46A 2BM0A 1AJEA 1YI0A 5GADl 1Z6QA 2CV0A 2V58A 3EBLA 2I1VB 3BGOS 2NO4A 3VUFA 2P9ZA 3OCVA 4CDNA 2RGAA 1TA9A 1SA0B 1YKFA 4RVOA 1HYBA 4PPNA 3AUXA 4I1SA 3RLIA 4EYOA 1QX4A 4FX2A 2PUBA 5AK4A 1AZTA 3TZLA 4W7SA 2BAGA 1I2AA 2VYFA 1YL6A 5IJAA 3VNRA 1ODIA 3GUHA 3HKDA 4DV4B 1UF9A 5K0TA 1E2GA 1CUIA 1FZQA 3O9MA 2FX3A 3RABA 4W99A 2CVQA 5ALOA 3VAYA 3ZI4A 1Q11A 4FZJA 2JL1A 3N39C 3HC7A 3LT0A 5AI6A 3FKJA 4COKA 2WMNB 4N41A 5BWBA 5KU1A 1DRUA 3GLGE 3Q8KA 3U16A 1EP1B 5ANRB 4V24A 3N87A 1N6RA 3GEBA 3V48A 5I7RA 1EUCA 2XITA 4B3IA 1NOIA 4KQIA 5FOSA 1XZJA 4MRAA 2DOKA 2PUFA 3FYUC 4RD0A 1XLTA 2OZKA 3KQMA 1YJQA 4WCFC 1AA6A 1G6HA 1JJBA 2YFYA 3DCNA 3RGWS 5AVRA 3FF4A 1QIEA 3CJRA 4KZKA 4FYWA 5C7LO 3ZD7A 4N03A 3BMNA 3O3MB 3D4IA 5C4GB 2R6DA 3NM5A 4GF5A 1ST2A 3K5IA 4AJ2A 1N77A 2QT9A 4K3VA 5LLTA 4URYR 2J6HA 3FCYA 5CDFA 4CCAA 4NNOA 1NLYA 3IPAA 4IRXA 1OY1A 4MRPA 2IPNA 1L5HB 2JGDB 3I64A 3U49A 4EHDA 2NO9A 4DMRA 4FMBB 4MVJD 5DMHA 3MTAA 2GBIA 2DLDA 5DYTA 5T41A 1ZNZA 2B0CA 2E1RA 2EATA 5HK8A 1IBRA 3E35A 3DW3X 3O95A 5DLPA 2QP4A 2E4AA 3VR6A 1QRUA 2RBGA 1JPNA 3EVFA 2J48A 3IOMA 3AINA 4YWHA 5LZ4A 1DB3A 2GK4A 4KWHA 2NTEA 2PRYA 4URXR 4JSRA 1P2SA 3FVVA 4LHWA 1FYFA 5J2UB 1CS0A 3RVNA 3WMXA 3ZCTA 5DWQA 4V1CB 5DW0A 2C42A 4FSHA 3W9YA 1N2IA 2NUAB 1E7MA 1W88A 2IYNA 3GT4A 2ORIA 4HXFB 3C3KA 1TAHA 3U0VA 2EEPA 1Y4AE 1EX6A 4G67A 1J0DA 4NOKA 4PC3A 4PW0A 2UUAB 1ISGA 2R6R1 4JR2A 2CN1A 4YFYA 2Z08A 4O2LA 1TUEA 1O3YA 2IPAB 1QIJA 1P2TA 1T5IA 2XY4A 3GCZA 3JWJA 4GD3Q 4HRXA 4MEJA 4OQEA 3D9QX 2SHKA 3AVQA 3FWKA 5FBVB 2O6LA 5K3AA 4Z4HA 3K6RA 4L5YA 2W71A 1MEEA 3LDFA 3PPYA 1L5ZA 3S2IA 3MINA 3Q8MA 5ES4B 5FWXA 4KBYA 4R84A 1AKTA 3JVUA 4NWIA 3TM4A 4DREA 2XVMA 2YRFA 3RLFA 2JIMA 3CCCA 3IP9A 1MA3A 2JVJA 1PW5A 4H7JA 4LHXA 3UOGA 1TAQA 2V4MA 5EIWA 1PSDA 1TUIA 2V45A 3K5WA 1B0ZA 4LQLA 2WJVA 3OX1A 4RD4A 1QK5A 5B3JA 1WW8A 1Q77A 2C29D 4LSWA 3U4DA 5HJ7A 1ZQ1A 2A78A 4FN5A 1MU0A 3QVLA 2TYSB 3O3CA 5GOTA 3IR7A 5CDYA 4QECA 1J1ZA 3SQMA 4P83A 3P9RA 1V11A 5DT2A 2XDWA 2J3LA 3UHOA 2CXUA 3DEFA 5L3SB 1TTHA 2IOHA 5CH5A 1FRVA 1IULA 2A6PA 3WSVA 5A1TA 1ZONA 3QLVC 4KXVA 2WJHA 1W35A 4L02A 1OSNA 1HETA 1OFTA 1ORRA 2FG7C 1W0JD 4RK5A 4ZAFA 5JD4A 1EQUA 2NXJA 4G3XA 4K6CA 1XEXB 3OO0A 4Q4HA 3FCSB 3GDWA 3UAZA 5IFKA 1NT4A 4HB0A 4YNBA 1JYEA 4L3VA 1T15A 5L95A 2VNJA 1W5BA 1P5RA 3WIDA 6REQA 1DSSG 3NHBA 5AMXA 1FU4A 3QZUA 2CVFA 4D96A 4DT1A 5HF8A 1YK1A 4JL6A 4NP6A 4U02A 4HDMA 3ZV6A 4E51A 1U7XA 3Q3IA 4G4JA 1LA2A 3THWB 4H1TA 4BRUA 3BN3A 4XIGS 5IARA 3RSZA 4KLRA 3IMGA 4XGNA 3TM5A 5IYZA 1NGSA 1PN3A 3URMA 3GPDG 3GHHA 4CF5A 1IWBB 1OH7A 1KMMA 4CV2A 3NMUF 2IHBA 2JLXA 3VSEA 3SKVA 4DLAA 4WOCA 3N86A 4KJZA 4UEJA 1HR0B 1AKYA 2B2CA 4JUFA 1P5JA 4MQ4A 5JPDA 3QYAA 4QPPA 3G5MA 1PIWA 3A06A 4R1TA 5HQ3A 5CCEA 3L40A 5F98A 1XYVA 1HMYA 2I5PO 2M98A 1GGMA 3GYGA 4FB4A 2R86A 2B8JA 3CZMA 1ISMA 3KKEA 1R8XA 4OX9Y 1G55A 3B60A 5JMOA 4RGVA 1QDEA 4QPZA 1T2AA 2CUKA 3FD8A 3N2KB 4IIVA 3SJUA 3KOUA 1EFVB 1U3TA 2JGNA 4GPIB 1VBKA 3VR2A 3PD7A 4J29A 1J9EA 3TQIA 3ZWKA 3LUFA 1M34E 3NHSA 1ZR4A 4DCPA 2CDBA 2WV9A 3BWMA 4YCNA 4YI5A 2O8EA 3RADC 2W58A 2WD8A 4OKIA 3ZYCA 3NP7A 4QJBA 4TMTA 5CGQB 3RHSA 3ZWPA 3C7TA 2CD9A 4W9NA 5BUZA 3GRFA 1V8BA 5AOVA 3CVXA 5CVUA 1W52X 3OJEA 1SD5A 1XBTA 4MW2A 1QQBA 1XQWA 3NTUA 1YBVA 4QG3A 3A6DA 3DEYX 2PSSA 2PUTA 4YLYA 1M10A 4NMMA 2DETA 2GARA 1RRKA 5HDQA 3A6LA 5BWNA 5AVQA 4WZBE 3G2HA 4RWEA 2X4IA 1CZUA 2F9FA 2MOKA 2WUGA 3JQ6A 4H4EA 5E1BA 3SD7A 3ML1A 3IODA 3ZHRA 1KU0A 4BVLA 3WA7A 3DLCA 1FFAA 2W90A 2XSZA 3EJ6A 5E6SA 1TO2E 4B6GA 2O8BA 1MJFA 1WW3A 4YT2A 2DXIA 2AEFA 2CLSA 2W2QA 4FFMA 1O6ZA 5ALIA 4B4DA 4HTAA 3PF9A 5D5PA 5CITA 1N5IA 4WCVA 2A9VA 4Y2SA 5COQA 4KN9S 3JZAA 4V0QA 5EGSA 2BGLA 1AQNA 1F5SA 1ICEA 1Q17A 4IHQA 5HJ5A 1YSCA 3BXEA 4ZZ3A 5L45A 2XCTB 2IHNA 3L0YA 3DBRA 2ET6A 4WZBA 2VJPA 4UVHA 2IXDA 1MC1A 3WGUA 1CUAA 4MDYA 3MEQA 5JCZA 4EJ2A 1Z6PA 3AERB 2POCA 2IBTA 3A9WA 1XG5A 1Y81A 4PRYA 4OSEA 5BSRA 4YUAA 1IY8A 5LIRA 1P8AA 3LQKA 3A7DA 1LDYA 2BD0A 4RVFA 2X0JA 4DAOA 2R2AA 1YUNA 4QQFA 3AO0B 3WMEA 1CUDA 3AUSA 2ILTA 3ND6A 2BVNA 4K9OA 3G2OA 2PUVA 4Z4EA 1F3LA 1K27A 1LD3A 3CF2A 4WZAE 1ZCZA 1U28A 1DEHA 2GHQA 4X20B 4CCSA 4DC0A 2OHXA 2W4MA 2NV6A 5JXIA 3RW9A 4M9UA 2I3GA 1KZ9A 2MINA 2Z9CA 4J07A 4WBNB 2XUHA 2HSJA 4M9ZA 4MYDA 2D0IA <