1F1DA

Crystal structure of yeast h46c cuznsod mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
b'VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFCIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-ZINC SUPEROXIDE DISMUTASE
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 38
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1f1dA00
1DSWA 2WZ0A 1AZVA 1E9QB 1UXMA 2WKOA 3L9EA 3CQQA 1SDYA 4BCYA 1UXLA 1E9OA 2ZKWA 4A7GF 1F1AA 1CB4A 1OZUA 2AQTA 2AQPA 1N18A 1F18A 4OJAA 1SXNA 2AQQA 3PU7A 1KMGA 1SXSA 4FF9A 2C9SA 1B4TA 1PU0A 3SODB 2WWNA 2V0AA 1SXAA 5KBMA 2APSA 1F1GA 1U3NA 3MNDA 1TO4A 2AQNA 5KBKA 2AF2A 3F7KA 4N3UA 1SXZA 3F7LA 3HFFA 3CE1A 1OEZW 1HL4A 1Z9PA 2Z7YA 3L9YA 2XJKA 4L05A 1DO5A 3KM2A 3S0PA 5KBLA 2Z7ZA 3HOGA 4A7UA 1XTMA 1IBFA 2GBTA 3CQPA 3GQFA 1F1DA 3T5WA 1SXCA 4U4IA 2VR6A 1E9OB 1HL5A 1E9PA 4B3EA 2WZ6A 3KM1A 2ZOWA 1SOSA 2WYZA 1OAJA 1JK9A 1YSOA 3GTVA 1YAIA 1COBA 1OZTG 1ESOA 1OALA 2AQRA 2C9UA 2ZKXA 2JLPA 1E9PB 2WZ5A 1JCVA 3GZOA 3K91A 2WKOF 2Z7WA 4A7GA 1FUNA 3KH4A 3LTVA 4BD4A 2WWOA 3KBFA 2NNXA 1XSOA 3QQDA 2XJLA 4A7VA 1BA9A 3GTTA 1S4IA 4A7SA 1IB5A 1PZSA 1SXBA 3H2PA 3ECUA 4OH2A 2GBVA 1EQWA 3QQDB 1EJ8A 3KBEA 2LU5A 1XTLA 4N3TA 1QUPA 4A7TA 1PTZA 2AQSA 3GZQA 1SPDA 2E47A 3KH3A 3RE0A 2GBUA 1N19A 2AEOA 2K4WA 2VR7A 4A7QA 1SRDA 1B4LA 2C9VA 3GZPA 1MFMA 1IBHA 2E46A 2WYTA 4BCZA 2ZKYA 3HW7A 1YAZA 3ECWA 1JK9B 2JCWA 2VR8A 1IBDA 1P1VA 2R27A 1Q0EA 1SDAB 1Z9NA 1L3NA 1CBJA 4MCNA 1RK7A 1E9QA 1TO5A 2Q2LA 2SODB 3MKGA 1BZOA 2Z7UA 3ECVA 4MCMA 3H2QA 5CU9A 1IBBA
chains in the Genus database with same CATH superfamily
3PAVA 1E9QB 4F57L 3CQQA 3VXQA 5F9WB 1WS8A 1CDJA 1ET5A 3NACH 1A7BA 5D7KD 2APXA 3U0TB 2FR4A 1GCYA 3NJIA 4DQAA 3QRGL 5J13B 1WIUA 5EMYA 5E8OA 4AYFB 1ZLVK 4DIXA 4UZGA 2X4RA 5IVXE 2OZ4A 4JPIA 1UJ3A 5JR1L 3L3KA 4C83A 1RP9A 3FQ4A 3GXTA 3OKNA 2OM5A 3MV8B 5CIPA 2F7QA 1GMIA 3T2PA 4H8PA 4HPHA 4I0PA 5GISL 5BVPH 4UINL 4W4OC 3HS0B 1DL7H 1LEIA 2WLIA 3BKYL 1NEUA 2XV6B 4OZFA 1IAOB 5DYOB 5E23A 5FYKD 2XQBL 4XVSL 5SV4A 1HYSC 5KSUA 4AIEA 5AVXB 4OQTA 3NK4A 2HX8A 4P3DA 2YKLL 1RK1B 1VPOH 2AMUA 4QWWC 4LSPL 2RH0A 3WE1A 2F7PA 1RUAL 5D5ME 5I6XC 1FYTB 5IIEA 1WQVT 3IT8D 1BJ1H 4ZOBA 1G94A 1T7VA 4WK2B 2P44B 4UILH 1G0XA 5F7FA 2R8SL 4P9MH 1FH5L 4NRXA 3E2HC 3VVWA 2HFGL 1OD7A 4YFLI 7PAZA 2EKJA 5HVWA 5E9DE 1NSNL 4X7CC 4Y19B 1MCWM 5E0QA 3PWNA 1EXUB 3VU2A 3QDJA 2A6KB 4LVNB 5DZPA 1DVUA 4KK9D 1I1FB 2IANB 2HA1A 4I0CC 4E9TA 1WCQA 2FX9L 4CAGA 4TUKH 5IQ7H 2W5PA 2WJ7A 2F53E 2H2PD 2VL5B 1BG9A 4Z7NE 1NUGA 4NRYA 1HZHL 5D2LE 1XAKA 2JB5H 3IXTB 4TULL 1HXMB 2F8IA 5D93C 1PTZA 4BHUA 4HWNA 3IPEA 3T8MA 2EC9U 1DJWA 4ZUSA 2W9DH 4AEEA 3LZQA 4YJZL 2EE3A 5A16A 3V6ZB 5DJZA 5AALA 3U48A 2WXPA 5D7IB 5DHYB 5D6CA 1U8OA 1CT8B 2YD2A 3UBXI 4Y2DA 5I1GL 2VDRB 1S5IL 3EG9B 4KNTA 1KFGA 4BA0A 1AQ8A 1AS7A 4MZ3A 4DEUA 1PJ9A 3BAYA 3T8XB 3BGFB 4LLDB 4AH2B 1NCTA 1RK7A 5FGBA 3DK0A 3TO4D 1D5BA 3QEUA 1GC1H 2G3NA 2KYIA 4WHTB 5EO1B 3RGVA 1CGXA 3VI4B 5F6IC 4L1LA 3V7MA 2NY1C 3F7RA 4C57C 2FIKB 3WBDA 1GY1A 3OAWA 3WLBA 1TG8A 4MA3A 4GW4B 3WTVA 3F7QA 2WBJC 3OR6A 2B0SL 2DJ4A 5C9JB 4ZX6A 1ML0A 1ZGLB 2JQZA 3V8OA 4GG6F 5BW7C 2JI3A 1FZOA 3MRQB 2D3VA 32C2A 4H8WH 5CUSH 3KHOA 3ARFB 4P2RE 2A6DA 4FZEH 2JE8A 3VFGH 3EYVA 3AACA 1FZJB 3ULVC 4D8PA 1ZT7A 3DX1A 2ETWA 3CZNA 1KTLA 4Z78A 4KKQA 2FHCA 3RWJA 2BVUA 1EEZA 3QH3B 4JREC 5F0MB 3V0GA 4RSYA 3ETBJ 4HKJB 5LNEA 1SVZA 1KTBA 5IP4A 1MCFA 3PHQA 1RIHL 5EWIH 4CGUB 1OT1A 2LGNA 2WVVA 3NIGB 3NIFE 1G9NH 1G6RA 4JQXA 3HMWL 5TD4A 3FU0A 1C5BL 4N2OA 3ELAT 4JFWA 1SXCA 4XB3A 4QXUL 2Q87A 4DQOH 1VEPA 3N0PB 4UDTA 3QR2A 3CZSA 1XZWA 4S10A 5E8PB 4D3CH 3SJVA 3C6SA 3U46B 3AGWA 3BWZA 3VGAB 4YUEH 5KYYA 3RUGE 1PZDA 1R24B 3QPXH 4B7IA 4KKAD 4EUPA 1E5ZA 4NHUA 4AYDC 4ADIA 4MAYC 1UYWL 3UJJL 1UHVA 3SYAA 3T4YA 1EZLA 2EVGA 1IGIH 3NJHA 4K9JA 4L0ZA 2VSCA 4AQEB 5SWZA 3AUVA 5JW5A 3QUZC 3X12B 5GQBA 4F7CB 1D5IH 4XNBA 3L7FA 4PB0L 1HCVA 1IILE 1YCSA 2XZAL 2R51A 1X5FA 3EKCA 3QUKB 5LAPA 2EEFA 3WFZA 3UTOA 4Z7OE 5GPRA 5HYJA 3LXAA 4J4PD 4NQDB 4ZX3A 5BRPA 4YK4B 4GFTB 5EBMA 2PXYB 2CHZA 4NI6A 4BUHA 2AXFA 3U6XA 3BVTA 1Z9MA 3DJSA 1X5LA 1DBBL 4NN5C 1EBAA 2QPEB 1AQDA 3A6BH 3IDNB 3OM3B 4PSPA 1HOCB 3STLB 4ODTH 3VFRA 4U1HB 3C9NB 4MDIB 3LSOB 2Y3NA 2IVFC 3LH2H 2Y1VA 5E2UL 1NBQA 3NZUA 1F3RB 3H2QA 4JW3A 5JHLH 3C5ZD 5CU9A 4XMWA 4P2OC 4JFQA 3VFOA 4KQ3H 4B9IA 1R3LB 2HSIA 3QJFA 4NUGH 4ZO9A 4N25A 4YSOA 3SKJL 1S3RA 3FCTB 5J1AB 3STZB 3L54A 4G7VL 4OLXH 4YSTA 1UZ6F 3C08H 3CBKB 4RRPA 2DWYA 3MNMA 3EBHA 4HHWA 5IMOB 4QHUB 2VOTA 4TRPH 4MNQE 2QADD 1OO2A 3OSVA 4RGMC 2XFXB 5F7EL 5AVQB 2P3YA 3IRPX 2VRQA 4UT9L 4AEIL 2CO6B 3NSCA 4FFVD 2AQNA 4QF1B 3D8MA 4G42A 1TZIA 4WY7L 1S9YA 5JOFB 2M26A 3DIFB 1OSZA 3FO1A 3I3DA 5GGVH 4UCFA 1JGIA 1AE6L 1TDQA 4Z7WF 4HC1A 2VN7A 1VZIA 4W93A 4D9LL 1ZSHA 5H94A 5F3BB 1U3ZA 1WZ1L 3QEQE 2X1PA 4HWEL 1KGXA 5D93B 3X1NA 5EZOH 4HSAC 3DVGA 3SCMD 1UH4A 3PWPD 2O5NA 3WIIL 5MEOA 3W38A 5E94A 2ZNXA 2AJSH 1MNUL 1NLBL 2BP8A 4M3KB 1WHOA 4C4KT 2IAMD 2B7DT 1LO5B 2HVBA 3BQUC 1TCRA 1TTGA 1RV6X 2NY2D 3D9AH 3CXDL 4NP9A 4EBQL 3L2LA 3LNIA 4HOXA 3QW9A 3GK8H 4TTDC 3G5VA 8FABB 4KK5D 4PP2B 5KS9A 1PZ5A 3FO2B 2G0LA 1DP0A 1XEUA 4FG2A 4JB9L 1SLVA 3KGRA 2YXFA 3G5ZB 1BD2D 1NAMB 4HDIA 5DZAA 2H41A 2IWGA 3O2WL 4YOKA 2O93L 3BP4A 5DEGB 1J9QA 3V4VB 3HBQA 3ARBA 2ZXCA 2WBJB 4K3HA 4M8RA 3OV6A 5DQJB 2Q6WB 4CC0A 1LE5B 1P7KA 3DYPA 1D6EB 2Z64C 2BOLA 3CHPA 1QLEH 5H37G 1UZ8A 3WFBL 1JGUL 3PJSA 1BZDA 1CTNA 2AEOA 5JW3H 3QI9C 4LP8A 3QORD 1SRDA 3CHRA 5FYLH 4KZEH 4S2SB 2NY0B 4YC2B 2VM3A 3U25A 5T3ZD 2BSSA 4QKTA 3HBGA 2A6IA 1S7VB 2IQAA 3FU6A 4EKXA 1I7ZA 4YHZH 2QKIA 1LL1A 6PCYA 5I16A 2N0KA 3BX7C 1QHPA 3ZDYF 3QIBB 2JI1A 1OAYL 5CMAB 4PRNA 5A43C 2YJQA 3L17A 4MS8D 2P52A 4OLYH 3GINA 2R1WA 2XQ0A 3O0LA 5AW6B 4BK5A 1IE5A 3RL1B 5BQ7A 2IH8A 1KCVL 4PGZA 5I1JL 4OM0H 4P4RB 1FVEB 1NGXB 3IFOA 1M2VB 4K94C 1ACYH 2R23B 4U31A 1L0PA 3ZDXF 5B1JC 4HEPA 4NUQA 1E8YA 3WJLC 4NZTL 2XN2A 4FYTA 1YPZA 5BVJB 4A2HA 1FCGA 5IHLB 1MHPL 1ECYA 3DXAB 4JO1L 4JVPA 3GUFA 5JO5B 3UGUA 2N01B 4RAHA 4W9FC 2APVA 1WAAE 3P9MA 3FFCA 2K9UA 5FM5O 3FT4A 5ICXA 3MHZA 1PX8A 1A7PH 2H3KA 3WFHB 3SBWA 2YPVH 1CDUA 1FNSL 1XSIA 3MXVH 5GHWL 2H1PL 3MRDB 2NNFA 3OHMB 4NQVA 1CLYH 4KY2A 1U3HC 4JFEA 4JN1H 4GLRI 4HZ1A 3LKOB 5F9JB 4WW1B 1E6JH 1F1DA 2KI6A 4LPCA 4YSSA 3EHBC 1DANU 4U4IA 3P4OA 3PIQB 3SGJA 3MA9L 1T04B 4AKPA 5IHZA 3L9RB 1RAMA 1HQ4A 5F7NC 1AANA 4IK7A 3PQYE 3FTYA 2YQBA 3PAUA 4GT0A 3ARGD 3L1FA 4LNRA 1JGLH 1UM5L 3QZLA 4NXKA 2VLRA 3THML 4PJFF 1QBLL 2ICEC 15C8H 1CXKA 1LNUB 2FNBA 3FYIB 3QS3A 2Q20A 4G7RB 4WDIA 3ZRFC 4DCQA 3MRJA 4POZD 2DQEL 3I02B 4G9FE 4PY7B 1TQCC 1NBYA 4LEXH 1ZK9A 2AJ3A 1RSFA 3QFJD 2WGXA 4LLMB 4PJXB 5KZCD 1IB5A 1OP3H 6FABL 4Q7DA 2EYSB 2OSLB 4CJ1A 4F7TB 4GT7A 1EQWA 3U4AA 1V3KA 1OB1B 1GGCH 4NO0D 5KVDH 1Y6KR 1OOAA 3LIZH 1CLCA 2X40A 5IESL 2R2BB 1SPDA 1H3WM 1H8NA 1U42A 3MV7E 1P5UB 4O5LL 3DJTA 3DPBB 4JRXD 5AW4B 3OXRA 4FABL 2V9TA 4FXKA 3MX0A 4EDXA 2AEQL 3HAEH 3MV9A 3OHXC 3D1MC 1A7NH 2Y5TA 1UD8A 2WY3B 4NC1C 3KEDA 5T1KB 1I8IA 2QQLH 3QG7H 5EUOB 5AAPA 1F4YH 1DUZB 2HVKA 3MC0A 1QFUL 4XBGB 2Z7UA 3UPCA 4AM0B 2BS71 1EHXA 4R4BA 1P4LA 3BT2H 1IBBA 3QUMH 2VUYA 5HJ3A 5F1IA 3FMGL 4MA7H 3VXMB 4BWTA 3OZKA 5A3IC 3ARDD 1J0KA 1PMYA 5ANME 5C0BB 2GY7B 5JYLA 4LGRB 3OJDB 1LHZA 1JHTB 3VWKC 1NCIA 4YEFA 1QO3B 5F6HI 1HI6B 3FTZA 3KGUA 4JRYE 5HPOA 3UBFA 2BSRA 1TVHA 3GSOB 3BQUB 2DKUA 3SQOH 5GZNC 4L1DA 3H9HB 3FYEB 4ZX4A 4X7SL 4EIBA 3ZQXA 1KYAA 3MLRH 2GBAA 4P2QA 1UB6A 1QPKA 2X1OA 2X4UA 2FL5A 3H9SD 4LLQB 4YHLH 5EB9A 4DVRL 4GW5B 4E9XA 4ELMA 1AQHA 2FWLB 4MD5B 2EH7H 1YNKH 5J8OA 3S8FB 5L7XH 1ZLUK 4X8GA 2UZYA 1HCFX 4JFOB 3BZDA 2ADIB 1INQA 1ZT1B 1A9EB 1NOAA 3FB5A 3M46A 1HHGA 2VABA 3FO0L 5DQ9A 3U9UB 1M6OA 1OE3A 4NZRL 3FT9A 4HCRH 4GRLB 3U9WA 2YRBA 4U1GC 4A7UA 1NQBA 1K9TA 3EYSL 1MLCB 1E2VA 3VG9C 2OQJA 2IMMA 4LLWA 3UTTD 3EJZC 3MRIA 3KPLA 5D7SH 3EDDA 1V05A 4NXSA 2QR0A 4CMMA 5EA0L 2B4CL 4V1DD 1MCJA 3P02A 1L4IA 2ESVA 5D7LB 1JS4A 2LU7A 5DSCA 1NMAL 5AZUA 4AI7A 4OFIA 4XZ4A 4P5TC 2NNXA 3JUYA 2MQCA 4IRJA 4PB9L 2DICA 1FC1A 1GCFA 2JELL 3GM0A 1E90A 1F2QA 3IDJB 3OKKA 2V6HA 2C3WA 2XU9A 2F74A 4OJFL 2BM3A 4QRSA 3D09A 3QUMA 3QAQA 3RZCD 4XNQB 3L3GA 1QUNB 2X70B 1V10A 2WIMA 4XNMB 2P8PB 4G1MA 4RDQF 2F7OA 5C09A 5HYFA 3HE7D 3IFLH 5F7WC 4G6AC 3JWOH 2X2JA 1PX3A 4EZMA 3TZVC 2OCJA 3CUPA 4HG4J 1JDDA 3V9FA 2LV4A 5EDSA 1U0QA 2VZ1A 1IM9A 4K15A 1U8KB 2RB8A 2BX5A 1I31A 1N6UA 3PWLB 4AZ8B 1UWGL 3WFCL 3CX5K 4ZFZA 3HBPA 3IGFA 1J5DA 4MQXC 2VN4A 2VMEA 4G6KH 2QQNL 4WKXA 4M8QA 1A6WH 3RDTB 3PV7A 4FXGA 5ID0A 4Q56A 4FNRA 1U3HB 4GRWB 2P5WE 4I5BB 4XMLL 5CJOL 1TETL 1GC1C 1SDYA 2NYZA 2VC2L 4BCYA 1S7XA 3GHBH 4RLDA 3EHBB 1CC3A 3C60D 1KIUB 2QVKA 3UP1A 3VX0A 4N0YH 4OCSH 5T33L 4NUPA 4XVUD 1A1NB 4M6NH 5CF3A 4ZZKA 4G5ZL 4XO9A 3JWNH 4L2YA 3CMGA 3MRFB 4LK4A 5JIDA 4MA1C 3ARPA 5D72H 5E6UB 3J2PA 4QIRA 3V0DA 2FR4B 4BFJA 1M1SA 3FOLA 1DLFL 4YIQA 5HY9A 1A3RH 3R19A 3GJFB 1TJXA 2I85A 1JZHA 2YGPA 3HRZA 4XZUB 2KDGA 3R4RA 4Q89A 4H8WC 2Y7NA 3DUUB 5TQ0H 1G9MH 1T4KB 2YPKA 2VAAA 1K6QL 2O5ZH 2F54E 4PJ5B 1JPTL 3AB0C 3L3KB 3QUYC 4QOKB 1IGTA 3C6LC 3FBKA 1AD9B 2BZDA 1YHPA 1DUYB 2AGJH 4RDQG 4QI3A 4LLAA 1CYXA 2WLIB 1TFPA 1HEHC 1O0VA 2G9HA 4OZFB 4ZX5A 5MENB 2VDLH 1A4JB 4UM9D 3FQXA 4P3DB 3GDCA 3CZKA 1G9NC 2ATKB 2EVFA 2WOBA 5SWSA 3JV4A 1N8ZA 2WVUA 4BK4A 1Q9LA 3OHXB 1U30A 1A3QA 3T65A 1T1WA 4KJPD 1FQ9C 2Z7WA 4LEBA 4XCFH 5B3NA 1NMBL 3UERA 2X4QA 1GHFL 5B8CC 2KZWA 4GBXD 1T20B 3MGAA 4HJGB 4P5RA 4LMQI 2D2CC 4EIZC 1HE7A 4QTFA 1NBZB 2IALB 1OTUC 1T1ZA 2AZAA 4FNSA 2YEZA 3O3AA 2I25N 2NY4C 3HB3C 3QDJB 5L6YH 4YZFE 2A7BA 2VZSA 2ZKHL 2ZF8A 3U9PL 2IADA 5KSAA 2KQNA 4WHYG 4DP4X 2ATPA 1AR1C 3TNNA 2J8OA 4PJBE 4UQCA 2LVEA 2XYBA 4B50A 4YSAA 5CFAA 2XHNA 4DGYH 1N7ML 3MBEA 5IF0A 3CU7A 2Z91A 3KYAA 3RTQC 3ZTDC 4XTRC 4DKEL 1FI8C 3SDAD 3GSVB 5DJZB 3FB6B 4IMLA 5L2KE 2P5PA 1U8OB 5HYSG 3K74B 4Y2DB 5E7FA 1BREA 2DQCH 3ZE0E 3PL6C 3LYRA 2WPGA 2A5UA 4GP4B 4DZBB 3II3A 2BVEA 4MMZC 3WKQA 1F58L 4JO8A 5I66B 1JXDA 2DQHH 2BW5A 3P73A 5B22A 1CU4H 2DPKA 4LSRH 4L1BA 2X10A 4YSUA 3HNSL 3V0EA 3VG9B 1DQDH 4IGBA 4J3WA 3HKZA 1NGZA 4OF8A 1HZKA 2OJZH 3WLBB 4FLSA 4EMZA 1PFCA 2FECL 4JLRA 4JY6A 4MA3B 4B0MM 1SXSA 3O81A 4GMTH 3V7AG 5BS0D 1MJ7L 1PG7W 3HI6L 1I7RA 2FRGP 2R0KH 3EOYG 4LCIH 1PEWA 3AXLB 4I77H 3WFEH 2L7UA 4F92B 1WAPA 1A3ZA 3QSKB 3VNZA 1FZOB 3O6LL 1V7NL 4QXGL 1QVOA 5FOBB 32C2B 5CXPA 1YNTA 4P5TB 4IBYA 5IBLC 4YE0A 3B1UA 1NGYA 3TT3H 4DGVH 2A6DB 1KJ2H 5FECA 2B5IB 3EYVB 1J0HA 2BIHA 2XNAB 3WE6A 5D1ZA 3IMBA 4XWOD 4D8PB 1ZT7B 3EO9L 1SHXA 1OP5K 4DNLA 3M6DA 1EDYA 4KK6D 1Z0NA 2MOGA 4Z78B 4LSVL 4UIKH 3ES6B 4R7NA 1VFMA 1NPJA 2AK4A 3SE9H 4E9LA 4IRSD 2N7BA 4HXAL 4OZHA 4H0GA 5GJTL 5KANG 5DJXB 4HAGA 3FC8A 3TZVB 4MBRA 2YPLD 1QR1A 3RVUD 3E9UA 1BVLA 2WVVB 5AWNH 1NCCL 3LIUA 1QABA 5I1HL 1AKPA 1G6RB 2AV1A 2CHWA 2MCAA 4WU7A 4JQVC 3KPPA 3AITA 1OGTB 4UDTB 2EH8H 2QZQA 4LEEA 3BH9B 1AHWA 1FG9C 3C6SB 5DJCA 3U1SL 4FP8L 3N1PC 3GMLB 4G59C 3CSBA 4LOEA 4ZODA 4EUPB 3B6SA 3KWUA 3S3DB 1W8OA 1OPGH 1RZJC 4PJAF 3V0WL 4ZTPH 3D4YA 2KDYA 4U1LA 5JW5B 1U8PA 5FEBA 3ARZA 1KACB 2OP4H 3V0JA 1ZMYA 3H3PL 2DTSA 2BFVL 4WWKD 4CVZA 4KQ4L 2BIIA 3AADB 4F37K 4PJCF 4MA1B 1FH2A 1S7RB 5KEZA 4QGTA 4CMHC 5C0CA 2R0LL 4YS4A 5CJBA 5HYJB 1NCDH 2ZJSL 4NWUH 5EBMB 4KY1L 1ID5I 3UJTL 2A9AA 4NM8H 3S35H 3W0WD 2XN9D 2H2PC 2BP3A 5A2JH 1AQDB 4NCC2 4P05A 4PTUB 4OBRA 1RHHA 2DJUA 3OKYA 5BO0D 2X9WA 1T5WA 5EOTA 2QGDA 3VFRB 1BF5A 1NL0H 1QSEA 2NQDA 4PRHA 4C4BA 2ZCZA 1CI3M 1DN0A 3AG2B 5DVNA 4ZSOB 3GS0A 3RWDB 1UWXH 2AEWA 4Z95L 2AQTA 4JFQB 4OW6A 5C70A 2B16A 3UYPA 1CDGA 2JJSC 3VSQA 4UB0H 5JIHA 4NPYA 1C1EH 1E4WH 1AKJA 3ZQWA 5KJ7E 5ALBH 1JF6A 2ZWYA 3EBAA 2P24A 1E7UA 4K8RD 3TO4C 4C59B 3HR5A 4Z7QB 3OSKA 4ZFFB 4LXFA 4EN3A 2VTFA 1HNFA 5IHHA 4NQCE 3L1OH 5FGRA 1JN6A 4Y4FD 4RWHA 4OZIB 1QZNA 3IJ9A 4MLIA 4G42B 1TZIB 2D03H 2BZ7A 1S9YB 1T0MA 4ALAL 3KS0J 4UZSA 2QQKH 2H32H 1I3UA 2QSTA 1RI8A 1QRNA 5FHBL 3SO3B 1H3TA 1VB9A 2VJ0A 3QCUL 3UTSE 1J88A 2FHFA 2FE0A 4O02L 3SDCD 3DC0A 3NAAH 1AR1B 2EDHA 3DLQR 1AIZA 4B5ZA 1RVFL 1MG2C 1JRHL 2IWEA 3IFPA 1T5XA 2FX8H 5E6ID 5E1HB 1BIHA 1SYVA 5HHQB 1DQVA 4FRWA 3WN5C 9PCYA 4HOZA 3DI2B 3F62A 1TQBC 3FN9A 4UDUB 5MEOB 3MBXH 3WYRA 4XN9A 3JYCA 4NENA 5JHDE 3LEVH 3NCXA 3NFSH 4ONHB 5GZOA 2KH2B 4HIIA 1IGJA 3LN4B 5JTWA 3BZEA 1TCRB 3ZE1E 2WSPA 4G2AA 1VFBA 2ICWA 3BIBX 4N6RA 3C5JA 5IVZB 3V52H 1ITCA 4M1DL 2LR4A 3VTTA 4OH2A 2F0CA 4QRRE 2DLEA 5KOVC 3OLIA 4HS3A 4IKIA 4NN7C 2N3JA 3P0VH 1CLZL 4JDEA 2VXUH 1J86A 1NCAH 3LXUX 3ZTJH 2L7EA 3N41B 4LHJB 4NZDA 4R5VA 5DQDL 4KKAC 4FX5A 4M6OH 1YEDA 2PYEA 4HFUH 3RP1A 3HFML 2LTQC 3K6IA 4LRIA 3ARBB 3H54A 4X80H 4KDTC 1P7KB 4M62H 5FOJA 4LCCC 4MB5A 4XO4A 1W8EA 4Q6IA 4ELKA 3UMNA 3EGXA 3O8XA 2JJUA 3MTXA 3R4DA 3S5ZA 4HF5H 4TYUA 4YSDA 3F84A 5IVXF 1DJGA 2IH3A 3NA4A 3F7VA 4KGLA 3NFPA 1CK0L 2BSSB 2EYTA 2A6IB 4I0PD 5IR1A 1KIPB 5LDUA 1I7ZB 4H88H 5DJ6A 2QKIB 3WMPA 4J4PC 4K3EH 2WGNB 1MXGA 1D9KA 1CDYA 3IDYC 4PRNB 1J0JA 3IJYB 4EI0A 4P4KD 2QTEA 3U7WL 3ARTA 3WTUA 1NM4A 1WISA 1A6AB 1MHHA 2HG5A 3JZYA 3P77B 1EBPA 1NKRA 3EJYD 5I19H 1WHPA 1TTUA 1QKZL 4TF4A 1Q38A 2E8ZA 3DIVA 4JHWL 1EJ6A 5D5MF 4GP8B 5L88H 2XY2A 3TN0A 1GKOA 2VR3A 3C5ZC 4PW4A 3B9VA 2OFQA 1NANI 3ATEA 4M7ZC 1XCTA 2ZWNA 1KUMA 3OX8B 2Z92B 4JFYA 3FPYA 1XXFC 3RHWK 3DX7A 3MSPA 3UC0L 4IBVA 1GZHC 3P9MB 5DC2A 3S3BB 1YN7B 5ICXB 1MCWW 4A1RA 3F5WA 5EOQH 2WAQA 2VDKH 4ZMLA 2NR6D 2OR9L 2QADC 3L3OC 5BRQA 5AW3B 4KROC 4CKVX 4M1GH 5K1VA 2H9GA 4Z7NF 2YSSB 5D2LF 1I8LC 3CXHJ 3CVIH 2HMID 1RUPL 1EFXB 2Y0SA 3BKCH 5BOJA 4BZ1L 3GSWB 3BJ91 4HK0A 5JXAH 1QLEB 1UXSB 2JVUA 3GZKA 4ZMTA 1MJ8H 3ULUL 2DQFB 1HQ4B 1FUNA 1N64L 2F5BL 2YQ3A 3VW3H 5BNXD 4NQEE 1GPOL 4N6QA 3UTZB 4PJEA 2ZUXA 1FRGL 2Q3ZA 1BJMA 1JGDA 2VLRB 3NCJL 5E6SB 1C8PA 1S7QA 1NCHA 4PIRF 2IQ9H 2R4RL 3MRNB 5IMMA 5J6SA 1KN2H 1WA2X 3RGVD 3AGVA 3U0PB 3QYMA 4L8SA 1R5WB 5EBLA 5I6KA 2AJ3B 2LQRA 5KTEH 3SB3A 1SY6A 2FLRT 2IAMC 2ZUQB 5DJAA 3DNKA 3SY0B 4B9JA 5IY5B 2CZNA 3DI3B 4WUUE 2NY2C 4GKLA 3JVGA 1YA5A 4HBCL 1IC0A 2A77H 3MRBB 1U6AH 2K6ZA 3TIEB 2ZZUT 3ZMEA 4N26A 1H3PL 1QLFA 3CFKA 5IW1A 2ZXQA 4JFDB 3P4MB 5FYKL 3TOPA 4HKXA 1MWAA 4QTIL 4QRTB 3TO4B 4JN2A 3EGSA 3LQAH 4OIIL 3U7YL 5FB8A 1Q9WB 2F2HA 3AM8C 3BDYH 1UD4A 3AY4C 3DX4A 2EIKB 3QJVB 4JAMA 3LKQA 4J3BA 3OXRB 2VLME 4ZNCD 4GMSH 2LU4A 4FXKB 1GJIA 3B5GA 2VL4A 1FWXA 3MV9B 1WFOA 2JQAA 4LDEB 1BGXL 4QJ4B 2WXKA 4FTDA 2Y5TB 3LHAA 3K0YA 3L3DB 2BS8A 2CBQA 2HVJA 5IB1A 3SBQA 1I8IB 1GYCA 4DO4A 3MJ8A 3F05A 3QORC 1N0XH 4MAZA 1TFHA 2ZIDA 4WFGD 4RGNC 4TQPA 2CK0H 3DBXB 4WNQB 3HMXH 2UX7A 1RZFH 4OGXL 3NIFF 3A67L 1XR8B 3BKJL 3EYUH 4UT7H 3VXRD 3SJVD 1UB5A 2G5BA 3BSZL 4PMFA 3KPSB 4TXVB 3FRUA 5KBMA 9CGTA 2BSRB 4G43A 2W91A 2WZPD 3JWNC 1TVHB 2D0GA 3SOTA 4E42A 1NIFA 2C9XA 2EDXA 3Q1SH 5JMRA 3RUGF 3P2BA 3LMJL 4S11A 4N4YB 3FN3A 1PGRB 4P2QB 1EAPA 1QI5A 2BS9A 1KLGB 4RAVA 5SWZD 1HHJA 2X4UB 2FL5B 4GUCA 5BQDA 4NHCL 1QNZL 1G9MC 2VLJE 4NN7B 5KUMA 4N2GA 4AGNA 3RIAK 1WIOA 1D5RA 1ERNA 1INQB 1O6SB 4BH7A 3GJEA 3FB5B 2CXGA 3MI6A 5CILL 4XR8C 4XWGH 4WKZB 1M6OB 3IN0A 5PAZA 2JCCE 2A83B 4Z7OF 3TEUA 4EXPX 2OQJB 1DVFB 3OJVC 4YBQC 2IPTH 1UH3A 4AV4A 2HAZA 5F0LB 2D0FA 4NKMA 5ETUB 1WT5A 2ARJA 1ZIBA 2H0EA 2Q9OA 2LFGA 3KPLB 3N55A 3HAEB 2QR0B 3SPHA 4YO0B 3GTTA 3EBGA 2B2XH 4MAUH 1XX9C 1DJSA 1RURH 2ESVB 3GGWB 5DSCB 1IFHL 1ICTA 1NC4A 4UTBH 4GO8A 4FDWA 1T3FA 1DVYA 3H1ZA 4M00A 3TBSA 5LBVA 5TTRA 3ARGC 3OKKB 5FUOL 4QRSB 1BVNP 4QRFA 4RVBA 3QUMB 3DTXA 3G7TA 1KEML 3L3GB 2GW5A 3KXFE 5CEXB 1N19A 4HJTA 4JG0L 1AYOA 1JJUA 2DEYX 2Y4SA 4KTEL 5TPWL 1JPFB 4G1MB 4Y4HA 1H3UA 4POZC 3ASWA 4E9QA 4MNGE 2MRYA 1I4FA 3CUPB 4HT1L 5TF1H 2VR8A 2LLNA 1N9PA 4CJ0A 3BVWA 4OF6A 4X9YA 4Q4IA 4M7ZB 3OGCA 5AL0A 5G5DB 4PGCB 2ZYRA 1A9VA 3ECBB 3INUH 4ZUTB 1D3CA 4FTVE 2ID5A 4ZFZB 2E9IA 4K3JL 2VO5A 5TJWK 2NSXA 2YFOA 1HHIA 4XBPB 4PRPB 1BIIA 4M8QB 3ATAA 3NH7L 12E8H 4NZJA 4O58H 3PXJA 2AITA 2P4AB 4DUVA 4KROB 1YUHA 3AU1A 4UOQA 5CCKH 1B3JA 1E5AA 1Q0XL 5DLMH 2GQHA 3D25A 4PJGB 1S7XB 3L5HA 4P57B 3BOVA 3GKWL 2EDRA 2OI9C 3IFNH 1SEQH 4KFZC 1Q9OA 2AFNA 3QEHA 1Z9OA 3KPQA 3LKSA 5B3JE 2Z8VC 4IS6A 3FTWA 4FULA 4AXWB 1JTOA 4AKQA 1BJ1J 2VDMH 2JLLA 2C3HA 1TZ8A 3DOIA 3FOLB 3O2DH 5CD3A 3ZHNA 5BRZB 3HRZB 5B38G 3BPLC 2HP4A 5D4JA 3GYRA 2YPKB 3VFTA 1FF5A 4TNWK 1S2EA 2BOCA 4FKEA 5DVPA 2R9HD 1R3JB 5GRVL 3V4PA 2GUOA 4A67A 3OAZH 3T5WA 2UWEA 1UWYA 2BIOA 3PP4H 5C3TA 5B1BB 1FVDB 2BSBA 5LNDA 4N0UE 3VD3A 2MCMA 1MH5B 2C7FA 4PJHA 2E27L 4NFBA 4DKAA 2G9HB 3FQYA 1A4KA 3IMRA 1Y0LB 3LV3A 1AGDB 1TJHL 4XOEA 3SGEI 3IU4H 4OR1A 1JCVA 4XX5A 1P5VB 1J5OL 2BSTA 1DQIA 2YAPA 3QUXA 3QQDA 3LRHA 1N8ZB 2FJHB 1XO8A 3FQNB 5AEAA 5LWYH 4I13B 3T65B 3MUY1 1T1WB 4DW2L 3D7PA 2D7TL 2AJYH 2CUHA 1H5BC 4EZLA 3D52A 2X4QB 5GRJH 3WUWA 3GMQA 3K4DA 2Z6FA 4HJSA 4RGNB 3RPIB 1JK8A 3QQNA 3SN6N 3CLEL 2P43B 1T1ZB 1M3JA 2YEZB 4JL2A 1ZWIA 1MZZA 2FGZA 4FD0A 3OKDA 3MRMB 2C9VA 3QZBA 5KSAB 2V2WB 3TNNB 4BSVB 5AZEL 1HVXA 3RA7H 1P1VA 3MCKA 3FT3A 3RZCC 1D6VH 5D2NC 2YGQA 5IF0B 1NCBL 3FFCD 3X1BA 4K71C 2R2HA 5DUPL 4XBMA 5IEHA 2BDNH 1HINH 1DFBH 3HE7C 3UFIA 1WAAF 4YLQT 5C08B 4KXZI 3WTTA 3UJIH 3FZUD 4IMLB 1I85A 1ID2A 1VKXA 3NRPA 1DQKA 4LLYA 5GJSH 1RHFA 4B0MB 1OGAD 4AGOA 3OZ9L 1CB4A 4YHNA 5D7KE 3O11A 3ILPA 4Z0BL 4HJ0D 2QHRL 3JZ7A 1L9SA 2GFBA 5H4YA 5LDSA 5LNGA 4ZMYA 3D33A 1NCGA 2EIDA 2VDLB 4X50A 3DURA 4OCMC 4IGBB 2QQQA 5DD6A 1XZ0B 5B21A 1NGZB 1VENA 3EOBA 3V95A 3BZFA 4FHJA 1M7UA 4FXTA 2NY5L 3TTSA 4JLRB 2VDNL 5IWLA 2NXYD 2BHYA 4LL9A 1I7RB 4PRIA 4YGAB 3MOAH 5I18H 1AG0A 1RZ7H 4ODVL 2Z65C 1E4XI 1QVOB 3C60C 5IMKB 5FYKE 4RNRA 4BFGA 4NN6C 3BAIA 3MODH 1MCOH 5FECB 5LQBH 1S7UA 3WE6B 5D1ZB 3WN6A 5J6GA 2B08A 1CMOA 4FG6D 4PP1D 1NFDB 2FDBP 5BO1L 3U82B 4Q2ZA 5L8KB 5A7EA 3QIUD 2AK4B 4PG2C 4OZHB 1HSAB 4B9ZA 5INCA 2DDQL 4IOIA 3WNMA 1C5DA 1LVEA 1QR1B 3GZOA 4ELDA 2HTLC 4MVBC 3QWRA 1SN5A 2ZOUA 5I76A 1HILB 4X5WB 5BXFB 5FFOA 3MRKA 2YD4A 3BUDA 2AV1B 3ZE2B 1E2ZA 1D2PA 3ULSB 1KBBA 3VM5A 1MCNA 1Z0MA 4WU7B 1WVZA 2Z31D 3KPPB 3N9GH 4DAGL 2AJVH 5MEQB 4LRNH 2MFNA 1B9KA 1LEKB 5DJCB 3IK2A 3UTPD 1NCWH 4YDNA 3B6SB 1LDPH 1TYRA 2BNRD 2NNAB 1JSYA 4DZ8A 3OQ3B 3WDIA 3LN9A 1PQZB 1E4KC 4HIPA 3CC5A 4LLVB 1BDYA 4PBVC 3IDIA 2P28B 3WOVA 5TFSH 5F96H 1IEBB 2P8MA 1OAKH 2Q7YA 3U2SA 4CVZB 3ALWA 3L8QA 5HTSA 4OUUA 3D05A 5C0CB 2SODB 1IUZA 5B39G 2WLHA 3CCHA 1TMCB 3WEAA 1ACCA 4AGQA 4JKKA 3BPLB 2W0FB 3P9WB 3Q5TA 1KJ2B 4JDVA 1IT9L 4JFFA 1ZS8A 4TSBL 4LVOC 4IJ3C 3VXNB 1A0QH 1RHHB 3VXPA 3ZZLA 3B7UX 4C4UA 5MERA 3NA9L 4BCXA 1KXTB 5DS8A 3SDAC 1QSEB 1S5HA 4PRHB 4JR9H 1DN0B 1JF5A 3LZLA 3NEEA 4WI5A 2JKXA 4CA4A 1U8JB 2YARA 3KL5A 1NWPA 1AZNA 4PJ7F 3MJ6A 2BSDA 5F0PB 3STBA 4EI5D 4GSRA 4NS0A 3IJ8A 1UACL 2R56H 4NPYB 4Y5YA 2BNUA 5I8OL 4KK8D 1F4XL 1WWBX 5ABDE 1DLHB 2TRHA 1PAMA 3HR5B 4IRJD 4YDKH 2JKWA 2Z7YA 5CP7A 1H5BB 1IBGH 2OXHB 1WICA 4GKSB 5C71A 2V9RA 1M6UA 4EN3B 1G7MB 5JQ6H 4O4YL 4LAQH 4U0RB 4MD4B 3VWJD 3KYOB 1F00I 3SE4A 4G7YH 1OT2A 4BFKA 2IDTA 2H1XA 5C09D 4LSTH 1QOKA 1I1CA 1T0MB 1TTAA 4FE9A 4UU9A 1JZDC 1CFVL 4KNUA 3QISA 3B37A 2A2QT 4HIJB 3GTVA 3NEOA 1VGKB 3G5YA 5ADOH 2B1AL 2FQGA 3D4GA 1BYNA 3SGKA 1IM9D 3O9WA 2D4FA 1T5XB 1OTSD 4BELD 1DJYA 1SYVB 3ESNA 3TJEH 4R26H 4KTGA 3QPQD 4BQ9A 4NIKB 4OGQC 3MNZB 5DMKA 4K7FB 2PPCA 1ITBB 1E42A 1LWRA 3DX8A 4YNYA 5C3IA 2ED8A 4DP6X 1NGWA 4HIIB 4UT9A 1NBVH 3F6LA 3KBEA 4RZKA 3RVUC 4BSJA 1PG7X 1ILSA 3TF7C 1WZMA 3F6IA 3II1A 5EU5A 4ZMVA 2G30A 1LO2H 3FU7A 4G6JH 1CGSL 1Z3GH 2JIXA 3CN0A 3BN3B 5D1QC 5I1KL 4HS3B 4U7SA 1EDHA 4YHYB 1MHEA 5DEJA 1G5GA 3W9EB 2V5YA 1MI5A 4M02A 5IM7B 3QZWA 3LZFH 5E8EA 1N70A 1UT9A 5D7JD 2W80C 2PYEB 5LB1A 4NQSB 1Q0EA 1Z9NA 1Y18A 2OKMA 4ZDHB 5BUPA 3GNML 2RAMA 1KCBA 4Q6IB 4ELKB 1P4BH 2FATL 1J5HA 3EGXB 4KMTL 1GS6X 1A6TA 4NN6B 1E4JA 1YY9C 1GYAA 3IGKA 4OT1L 4I18C 3VQLA 2Z93B 1WYJA 3N43B 3F7VB 1MCBA 4WWKC 4CBZA 2ROXA 3GIZH 5J3HC 1K5NB 4P5MA 2W0LA 5I9QB 5DJ6B 4RISL 1KBPA 2BVOA 3RVTD 3L4ZA 1OZUA 2H32B 3TH3T 2NY3B 4J3OD 4AZUA 1D9KB 4HBQA 5I2IB 3BAEH 3MTRA 3RFZC 4GXUM 3PWUA 2XTJD 3BLPX 1RLBA 3QNXA 1W0VA 4KVNL 5IFAH 2AEPH 4P04A 1K72A 1MHHB 2K78A 4AQOA 2HG5B 4TVPL 2GEQA 1XCQA 3GHEH 3ISYA 4YHKH 3CMOL 3OKEA 4OTXL 2V3EA 4M1CC 2R69L 1SXZA 3I9AA 5CJXA 1INEH 2VO8A 1N6VA 2HT3D 4YR6B 5DD3H 3SDXB 3TN0B 1E67A 2Z34A 4IBZA 3ZKXC 1XCTB 3CBJB 5EOCH 3D50A 1AQMA 2DJSA 3WY4A 2A4CA 4HWBH 4JFYB 3D39A 3W57A 2Y24A 3DX7B 2EAEA 3F58L 4AL8L 3GIVA 4PUBH 2WP3O 3FT1A 4K8RC 2Z8RA 3T77A 3L95A 4OI9A 1FBIL 1SOSA 1AOHA 1T1XA 1FNFA 1IGMH 1YQVL 4GEJA 4P5KA 2Q7NA 2NDFA 1NLDL 5DRWB 3UMTA 4Y1AA 1FORL 4X4ME 4PJBF 1PPIA 4Y4FC 3MBED 3B2XA 3FQTA 4KJWD 2X6AA 3AREC 1MCRA 1IQDA 4P3WA 4YX2L 4FNQA 4PRBA 4B9PA 3D2UA 1WIPA 2VITA 2G60L 3VFPB 4E5XG 1UH2A 1WFNA 4HA1A 3U4KA 3FKUS 3HS9A 5HI4D 2WQAA 1YYMH 5E99H 3VAEA 1BD2E 3JTTB 1BMZA 4PJEB 3SE8L 2MPAH 4IBLT 1UCBL 4CSTA 2KMWA 2PP8A 2EC9T 4LVOB 4AT6A 4F37F 1S7QB 1U8HA 3ZE0F 3MREB 5I8KH 5GRVK 3ZL4H 5IMMB 4FNUA 2OAAA 1EAQA 4L8SB 1GMEA 1NAML 2DLFL 5EBLB 1OT4A 4XXCC 1A5FH 4FMVA 2VUOA 4PCKA 4X7TA 4MMXA 4WFFE 3L45A 2QT6A 5IBUB 2I07A 4YGVA 2FWUA 5T3ZE 3MUUA 1GGBH 4NKOA 4Y0GA 3ESMA 1QLFB 1YECH 3CFKB 4RFNC 2CHXA 5KANI 1CL7I 1DVZA 3MJGX 4HKXB 4XAKD 2E8YA 3B2UC 4JN2B 4OUOA 8PAZA 2CLVB 3RILA 5FB8B 3D0VB 3HC3H 3ULVL 4MXVE 5FYJD 3LKQB 2ZOKA 2CKBH 4NO5B 4G6MH 3HJEA 1Z5HA 2CIIA 1YEGL 3ESVF 3RX8A 4DH2A 1GJUA 1YY8A 3FU8A 2WHVA 3F64A 5G2NA 5I75C 1FL6B 5IB1B 1DBJH 4QLWA 3EGDA 4DT2A 4BFNA 2J7LA 1II4E 3EFDL 2W1NA 3MJ8B 3ARYA 3HE6A 3IGLA 1PY4A 2X0VA 1PU0A 2CNZA 4ZD3L 4Z7VA 5I30L 3MLWL 1C8QA 2W9EL 4YWGL 5ISZA 5TF0A 5I6LA 1R0AH 6PAZA 2DWXA 3SQRA 2YGNA 5TDPB 2XC8A 1KYUA 3GO1L 4LIQE 1RU9H 4X6CB 5D1ZI 3UDWA 3HG0A 4JUSA 2B3IA 4L3AA 1CDBA 4C56B 3N2JA 2G5BB 4KH2A 4C47A 4L2LA 4P4KC 1ZHBB 2J44A 1AQKL 3DDGA 4G43B 3SY6A 3BI9X 2XJKA 3V6OA 4LCUA 4LSUL 4M6ML 4FLOA 5I1CH 1CZ8H 2H45A 1IKOP 3EJYC 1G4RA 1YNLL 4NKDB 3T2NH 5J6HA 1EANA 3A24A 1IBFA 4CGTA 1UWFA 2MOVA 3D4ZA 3UPAA 2E7LA 1X3DA 4J39A 4Z3JA 1U58A 1HH6B 4HHAB 1PG7L 4RAVB 3AWFA 3VRJA 1HHJB 5D1QB 3HI5L 4FFYA 1JNLL 2YD0A 3FUFA 2V5MA 5IBTL 1RXLA 1FZKA 2MTPA 1BZ7A 5GS1A 3B2VL 2DMBA 3V4UH 4OCYL 2A9NL 4OKVA 4R2GD 5DEFB 43C9A 2J25A 1U2HA 5D6DC 5EU6A 4L3ED 3FTSA 1WP6A 5KYNA 3S5LA 1GY2A 2NR6C 1HWWA 4W9DC 4KX8A 1BFTA 4NKMB 2ARJB 3MZTA 3T3PB 3BP7B 1DQLH 3S2AA 4WW2A 1B88A 3X1GA 4N5UA 2HMIC 4KO9A 1T83C 5LBSL 1XF2A 1BX2A 1YRKA 4PGBA 1EJFA 3RE0A 4X4KA 3RWFB 1C5CH 4AKOA 5EF0A 3TBSB 4L5FL 4YHMH 2YWZA 4H8HA 4JRXE 5KW9L 1ETA1 3DX3A 3PABA 4HK3N 3DTXB 3VQMA 4Z7UA 1R1CA 2PWEA 1AKJD 1TIUA 3RTLA 4FA6A 3D3VA 3K0WA 3SOBH 1XHHA 5KVFL 1TT6A 3NRQA 4AYID 3RGVC 5TE4L 3QWNA 4KZCA 1DO6A 1YYLH 1IM3A 5DU7A 3L5XL 4I2XA 4XP6H 1CG9A 1Q9KA 4W68A 2D4DA 2OCFD 1A6VH 3KR3L 4XCCL 3NIGE 3M8OH 3WENA 2VISA 3OGCB 4JM2F 5IQNA 2OULB 5CGYD 3B7SA 4A7GF 2Q0ZX 3WFDH 1F1AA 1K3ZA 5IJKC 1QRND 1KGJA 4WNSA 1QLRA 3JYBA 2ADJB 2ZYHA 4KKZA 1JZ8A 4QRUA 3KYKL 1BIIB 1MFAH 2YRZA 5DT1H 2ZWZA 4WHYH 1S8DA 2A9BA 3B9AA 2VZTA 1T1YA 1E6OH 3VFSA 2DZEA 3ZLQC 4HG4K 1YUHB 3AU1B 4Y4FB 3WIFA 1WDAA 4XPFL 1HKLL 2Y1AA 3RHWF 3AREB 3CD4A 4PLJD 3D25B 4Z3FA 3FUKA 1R5VA 2XWJB 1ZA6B 4H8UA 1RULH 4XPAL 1QHOA 4YXHL 2O5XH 5TK4A 4YLCA 3HZ3A 2OMXA 3DETD 3K8LA 4GS7B 4NUMA 4EDWL 2Y23A 1Q9OB 3QEHB 3RX5A 3KPQB 4Q0XH 5FW7A 5FF6A 1H3VA 3N1QC 4D7BA 3ZE1F 1TTBA 2EXTA 4TUOA 2XYCA 1R3IL 3ABKB 3UGEA 4Z3EA 5IUCA 4PJDB 5LCVL 1AO7A 1FG2B 1DJIA 4N8CL 2VKWA 2X1XR 1BQUA 3LVTA 4PJIE 3V10A 3HC2A 2BOCB 3VFTB 3MOQA 4KAQL 4H40A 4PV9B 4H20L 3TXAA 1XR9B 3MLSL 4YH6A 4ZZFA 4LARL 4V1DE 4BD4A 1A7OL 1Q0YH 2AVGA 3GB7B 4MKMA 5FCUL 2ICWI 1KXQA 3SQBB 1B4JH 4PJHB 3OB0K 1VCBC 3O8XD 1A4KB 1WD8A 1LD9A 4U3XA 2XZCL 1LTXA 2R2CA 2B1HL 3GSQB 1I9RH 2BSTB 4FG0A 1BFVH 2GHWB 3NJJA 1OSEA 3QQDB 5DO2D 5D2NE 5HHXL 4EOWL 2ZQKA 2BY0A 2DEWX 1NJ9A 1I3GL 1ZJAA 5GGTH 1KIQA 2PTUA 3R7RA 1OCRB 1JFHA 3PJLA 3BVVA 3WUWB 4Z3IA 4H1LG 4ONOA 3S4SG 1RLWA 3RX7A 5KG9A 3BWUF 1FJ1B 4K94L 2ADFL 1EIBA 1ZWIB 1IC4H 4FERA 3OKDB 3AQZA 3ZZSA 1LILA 4AK2A 1PLBA 2DIEA 4AUJA 1I3RA 1NKOA 3DSFL 3PG2A 1R17A 5KSBA 4GAYA 3BUYA 5E03A 4KRPC 4ZXBA 4NJAH 4FFZH 3FT3B 1NAKL 1AZVA 1U8LA 2VDMB 3CH1A 3NSYA 5HGHA 1CD1A 3VVVA 4K7PY 4A2MA 1C9SA 2VH5L 2R2HB 5IEHB 3QIWA 1NMCB 5C1MB 1IGFH 2WLYA 2APBA 3I9GL 3MU3A 3ZY7A 3T6QC 3TJHC 5L8LB 2FUTA 1VKXB 1BAFH 1VADB 2AQQA 4IOSD 3T2QA 4F2FA 4KO7A 2LAGB 5I0VA 2JKLA 2PW2B 4LCWB 5I1DA 5DFTA 3HG1D 4Y5XC 4YHNB 4WWID 3O11B 1CICA 2E9GA 3NQIA 3S3JA 1RJZA 3RWIA 3NPZB 2MQ3A 2XTSA 1A9BB 4P9HH 2A74C 8CGTA 3EOBB 5TDOA 2H8PB 1O5PA 2PYFA 1A02N 2WXJA 1BAWA 4WQOA 2R0ZL 3B8YA 3EO1A 3WEOA 2YWYA 3DTUB 3HNTL 4PRIB 1INDL 2OZ4L 3M1OA 4PFEA 3GI9L 4LMQE 5FM8A 4B3VA 4FEIA 1FPTH 5EORL 2YZ8A 3LNHA 2ADGA 3GSUB 2VMCA 1UOVA 5J57B 5HHPA 2QFPA 4X5QA 3ZL1A 3MA7B 1L6XA 3HZKB 1FVCB 4X0KA 4HOMA 3QZNA 1OALA 2VXTL 3H42L 3DX0A 3WHXA 2P46B 4Q2ZB 1RJYA 5BV7H 3KBFA 2O5YH 2UZXA 4OQTL 5INCB 4IOIB 2WN2A 1WWWX 1FLRH 1V7ML 4MJIB 1ZEAL 4J5VA 3MRPB 5E8NA 3NZSA 2V17L 3MRKB 4FQXC 4U6VH 4KWUA 4NIYE 1BYPA 2FD6L 2Q8AL 4H7VA 2RHEA 1OAUL 1XBRA 4Q6YA 5C07B 1JWSA 1PKQE 3US1A 2EDDA 3DXAE 4YHOL 3ROLA 3PNWA 2NX5D 4ES8A 4LP5A 4NP4L 3ZHFA 1ZV5A 4PTTA 4ERSL 4G5AA 2W07B 1LO0L 5B1CA 2X0UA 1HHKB 4XE5B 5TE6L 2HTKD 3RVVC 5B4MD 25C8H 5AB1A 4JJ5A 3O4LB 4GG6B 3CZJA 3IDIB 3NACL 4FLQA 1M9WA 1BJ8A 1SOXA 3U2SB 1UKSA 2CBTA 2Q7YB 1EHNA 5HI3C 5PCYA 1CD8A 5HGDB 5ICYA 4WFHD 5AAMA 3CCHB 5FPIA 4G8FB 2Y2TA 4PU2A 3KJ4B 2X09A 3OMNB 2YFNA 3ZU8A 5I1GH 4AYGA 5T1DH 3H0TB 4JFFB 1ZS8B 3IPFA 2ITCB 1FL5B 5DLLA 1DL7L 1F11A 2VR5A 4XBEL 5BS0E 1MJJA 2M1KA 2C1OA 2YMXL 5FGCE 3VXPB 5MERB 2BERA 2IBZY 4UMGA 4UNIA 2JKJA 5I73B 1S5HB 4N2EA 4XCYA 1VPOL 2JCCF 2NW3A 4TNWF 3BHBA 5DFVD 5FA4A 5A2LH 1IKFH 5M7QA 3KPNA 1AR2A 2ZUUA 3ZBMA 3CVHH 2DI9A 4J6IA 1EO8H 4UILL 5A2BA 2BNUB 2WC7A 3EYQD 3X17A 1QFWH 2P8LA 2FT7A 4MJ5A 3QNZA 1LEGA 3RQ3A 2DYPD 3E6HA 2WLMA 3ABZA 5IGXH 2YPLE 4PQXA 4XNZC 4M5TA 4CC1A 4HUUB 1EERB 2H0PA 1JK9A 1FL3B 3CZUB 2NXYC 4PYGA 4GW1A 4KMLB 2CLRB 1W72H 2EP6A 5CNHA 4Y4HD 5IQ7L 1J8SA 2A1WH 4PCYA 1OPOA 3CDCA 5KVGE 1MZYA 3E80A 4G8AC 1RPKA 2JB5L 1BMWA 2UUDK 4PYHA 3U4BH 1G6RL 3MLXH 5GS2H 3O9WB 3REVB 2W9DL 4KRPB 4PP1C 4HJJH 2WUCH 5C0BE 4TPRH 3F2LA 4ICWA 2P1YA 4IIZA 5DMKB 3QIUC 2EIJB 2NRDA 3K2UH 1HWGB 3DX8B 5DC9B 3CZEA 4CSPA 3D18A 1Z5YD 2VLKA 4QT5B 4X6DE 5IEKA 2OK0L 3NOIA 5FKPB 2DBJA 2NTFB 5EU5B 4Y5XB 4YVUA 5IJDC 2WN3A 4PREA 2JIXB 2Z31C 2E7BA 1CDHA 4WIQA 4O02A 3SPCA 1R9FA 4WO0A 3VGGA 4HK3J 3W0WE 2XN9E 4RAUA 4PRDA 4NLHA 3T09A 1NZRA 1IZKA 1PLGH 5E8EB 2CNYA 3N5AA 4BH8B 4NPJA 2K3HA 1YMME 3CVHA 4FLHA 4ZOEA 1EDQA 4X6BA 2H3NB 4JANA 3BFOA 2Y7MA 5CUSL 5T1LA 4X6EA 4FZEL 3VFGL 5CEZD 3FB8A 4PJ8B 1N0LB 4U4BA 4OLWL 3KLSA 5ES4B 2P5EA 3LPGA 1CFBA 1G87A 4M7LT 3UIYA 4J6RH 4MQ7A 3GRWH 4N2CA 5E1GA 2YLHA 4Q6KA 5C6TH 4Z7WB 4WFEE 4G1EB 3TYGH 1DDHA 1W72A 2Y5EA 5J11B 4NEHB 1T21B 4XT1C 5DHVH 2YIHA 2JJTA 3VH8G 5EWIL 3C87A 1QG3A 1XEDA 5D70H 2AI0H 3WEMA 3WTWA 5I82A 1RD6A 1G1YA 4R96B 3U79A 1QFWM 1W2KT 1G9NL 2CJUL 2I27N 1JMXA 4WAFA 1FFRA 1X4YA 4H13C 3NCYS 1UT1A 2OPCA 4DQOL 1XCQB 3T0EC 4FQXB 5L0QB 2BMKA 3V6BR 1JNNL 4D3CL 2YAQA 4DP0X 5HSFA 2EUXA 3QQ4B 3MRRA 4U3SB 5EU7C 3CQPA 5TE7H 4YUEL 3VXTA 2BW4A 2J5WA 1CXEA 3MUHL 3QPXL 3OR7A 4I1PA 4KRNA 5GS0H 5DZOA 1NFIB 4UTAH 5DTFB 2A99A 2BSCA 4EI5C 4ECNA 3D39B 1P4UA 4E2OA 3VXSA 2HB0A 3VFUA 1T2QH 2ZKXA 3FQ2A 4HSQA 3PGDA 3T77B 4Y5VB 1KTCA 4GI9A 3EOTH 1BQRA 3OKMB 5A7BA 4APQC 1SGKA 4N2KA 4P5KB 4QRQA 2F1EA 2X3CA 4IU2A 4PV8A 4AJYV 1P4IH 4Y1AB 1U3JA 4I9XA 3VWJC 3N85H 1A1OA 2XWTA 3ECUA 5CJQH 2D9CA 4R0LC 2F58L 3TURA 4L9LB 4PRBB 1NINA 2VITB 1Q1JL 2QGCA 2Y07H 3QHZH 4LU5H 1QASA 3A6BL 3V0VA 4FZ8H 1C12A 2HFFA 4JRLA 3SPVA 2K4WA 1I1AA 2ZCHH 5C0AD 1L5GA 4ODTL 4AEFA 3ULUF 3EH5B 4W6WB 3BCDA 1USQA 3RWHB 4N90E 3LH2L 1LO3H 1B0IA 1QRKA 1DQQA 3VJ6A 3ARQA 1KTDA 3HLKA 1M2OA 3CXHK 5C2BH 1MVUB 3CFDA 4LVEA 3KLKA 3FHAA 2HFTA 4G3YH 4XHQA 1SEBB 3ILDA 4KQ3L 1MFDH 4NUGL 3IVKB 5E5RB 1A14H 3B7RL 1KT2A 3MPCA 4XO8A 5DK0A 3OBAA 4OLXL 4DKFH 3C08L 5FKAA 4NSKA 5EIIG 5AW7B 1IQWH 3CFMA 3PAZA 3AS2A 2ZWLT 3ATDA 2WKOA 4TRPL 4IBQA 1KB9J 1HSBA 2PO6C 1OP9A 4U1KA 2P9RA 2Y69B 1MQ8A 3NSXA 3P4NA 3DECA 3CC1A 1BECA 4PVNA 2ZOKB 3X11A 4LFHD 5D7JC 1X9UA 1NKGA 1ZHKB 1ES0B 4BRVA 3I50H 1MCDA 2CO3A 2NXYB 1AI1H 3PQYD 4TQIA 3TS8A 5GGVL 1TQTA 4U7KA 4J1UA 1KGIA 3EGDB 4QRPB 1AFVH 1F6AB 2B59A 3BSGA 4KHXH 1MDAA 3QWOB 1XL6A 2YXMA 4FHBD 2CM6A 2WIIA 2LLLA 1YEFL 2VN3A 2AKRB 4Z7VB 1J8HB 5AUMA 1ZLWH 1E5CA 4GH7B 2AJSL 4OF5A 1F90H 3RVTC 4CBPA 5K9KA 3ME0B 2GJ6B 2J88L 4WHCA 3D9AL 3NCCB 4CC4A 5KBNC 4N2IA 2XTJC 1UUNA 2IOOA 3CFCH 1GS8A 1CXLA 2WBKA 4JPKL 4LCUB 3MYJA 3KM1A 2DQUL 3V6FA 5HHOA 3SEPA 3FFOA 5GGQH 3UGXA 3ZX1A 5J6HB 1QWUA 5MENA 2L7QA 4P3CH 1JZ5A 1P0SE 4EIUA 3L3JA 1RK0A 4R3SA 4J28A 1U58B 3BKMH 4ANUA 3KCPB 5EIVA 5EO9B 4OGAC 1FHGA 2G3ZA 4F9PA 1FZKB 4C4KO 1RUQH 4UV7H 2F8OA 5GS1B 3DO7B 5FV2A 4WV1A 4U7MA 1QLEL 3COOA 4OKVB 1O7DC 3BEWA 43C9B 4P2RA 5BCAA 1N5AA 3BMVA 4MMYA 4ODSH 2QBWA 1NOFA 3GJFK 5FYLL 4KZEL 2J6WA 5FUZH 3L7EA 4GO6B 4LKXA 1X7QA 2CKBB 4E0RB 1BZ9A 2PUQT 1UWEH 4GYBA 4WW2B 1M71A 4KJWC 3FONA 3D0AA 3NCBB 1ZRUA 2IJ0C 3HLAA 4ZAKD 4OLYL 4KXBA 3ZYZA 2DTMH 2HG0A 5FLUA 1YEIH 2HFEA 3DA0A 3LJ3A 3VACA 4FJ6A 4OM0L 1W6WA 2DN7A 1KPUB 2FBOJ 5DZ9A 1ACYL 1CR9H 3T0EB 4FMKA 1U2YA 4DKTA 3DWTA 4KKRA 4AGMA 4WI4A 3GS7A 2CDGA 3DSNB 3KPOA 4LHUB 5DJ2A 3UBXG 1SJEA 3K6SA 4I2XB 4YHPA 4YQXH 1Q9KB 1M3IA 5AG8A 1HAWA 1UCTA 1B2WH 3FTVA 4WFGE 2EDWA 2YD7A 3HUJA 2ZOTA 2VISB 4EI5B 1NGQH 1AACA 1U3YA 3U4EB 2BC4B 4QY8B 3VXUA 3I75B 3VX1A 1JZEA 4JG1H 5LKNA 3JWDH 5L8JB 1T7XA 4JO2H 3MXVL 4PWKA 5F3HA 5I1LA 3L3HB 2WNXA 2VMJA 5DJ0A 1CLYL 4QRUB 3SJVE 1BBDH 4APQB 4ZFOA 1GVIA 4JN1L 3KVDD 1D2OA 3IDGA 1S8DB 4RSVA 3VFSB 3BWAB 3R8BB 3RJOA 1DJZA 3N6YA 4R0LB 1UD3A 5SWZE 5JXEA 2L8AA 1B0GB 4YEEA 3VFNB 4ZPTB 1GGUA 1KXVA 5A40E 15C8L 4XN1A 5JW4R 3NTCH 4OJCA 3P11H 3IGAB 4MX7B 1R3KB 4LEXL 2EVHA 3ET9F 1MCHA 1T6VN 2YSTA 3T8VA 4QHKI 5HYJE 3VSVA 1WTLA 2DB8A 1KG0B 1NC2A 2OTUB 1AO7B 1WBZA 3K91A 3V8CA 5BJTA 5JPMC 4G82A 1OKEA 3NPSC 5E4EB 5JR1H 1MI5D 1B0RA 2E74C 3ZGIA 4A2FA 3HI1A 3H3BC 3O6FD 4G8IA 3WJJA 1MLBA 5KVDL 2FWOA 3KPRD 3MNWA 4A7VA 5FXCH 1J8KA 3LIZL 3H7BB 1HT6A 3LHPL 5TQ2H 2R2EA 3VDAA 4HFWA 2IH1A 1CTMA 3IMTA 4JHBA 4XVSH 2PO6B 1XTLA 1A7QH 4ODUB 1D7BA 3AG4B 3KD4A 5DURD 2IAAC 1V3LA 2QPDB 2RQ8A 4NNXB 4XMTA 4H25B 4LSPH 1A7NL 1H6UA 3M17A 5CEYA 1J5CA 3GRBA 4KI5E 3QG7L 4QXTA 2IMNA 4R2GC 2NW2A 1NJ9B 4MXWL 2R8SH 4LGSB 2DAVA 4PJ9A 2BJML 5KUKA 1FH5H 1JERA 2WWMC 3F83A 2X1WL 3BT2L 1BPLB 1XSJA 3QEQA 3QUML 4UQ3A 2WO2B 2ADYA 3CJJA 4MA7L 4JY4B 3Q6FA 1CBJA 2ZUTA 4RFOL 4K55A 3DV4A 3UZQA 1O6TA 4AWJC 2LW3A 5AOKA 2Y6SD 3K46A 3QDGA 5SX4H 5FO9B 1MCKA 2F54D 2BP0B 4NPKA 2J8UA 2ZP0T 4TS6A 2GTWA 5F0JB 3SQOL 3NSFA 1SBBA 1I3RB 1UZ6E 4KBPA 3FUEA 3FF8A 3CSTA 5KSBB 1F56A 2FSDA 3BUYB 4W9IC 4ZXBB 3MLRL 5AOMA 1U8LB 5HYSB 5HGHB 1CD1B 4KJYA 4YHLL 3F3HA 3DRTA 4FF9A 3DPDA 2EH7L 1YNKL 3CTTA 3QIWB 4M9PA 2KUTA 3NJNA 4P23A 3Q8CA 5L7XL 1MQKH 2HJFA 2CH8A 4GEIA 1OL0A 2EO1A 4NC0B 1SMDA 2X6VA 1HH9A 1ET7A 3MCLL 5I1DB 4HCRL 3KWTA 3U6XS 2YD6A 1G7HB 5AYUH 4B6ZA 5CGYC 1ZLUH 1K8DA 2N59A 5KS9E 3D2UD 1KGCD 4TNGA 3AQXA 3U83A 1ZE3H 1RJZB 1E3XA 4HGWA 5D7SL 2E75C 2IWFA 4TNVK 3GDBA 2J5LC 2BINA 1EEUA 5TDOB 3ZTEA 4OD2B 1FSKB 3T4AA 3VI3A 4GFXA 2B0SH 1PYWB 2IGFH 2DWEA 1CLOL 5DZVA 4PLJC 3P3TA 4UF7C 1RFDL 3GEWB 3UZVB 3ZRSA 4G7QB 3D69A 1AHMA 1X9QA 2C7UA 3DETC 1SLWA 2CG9X 1FAKT 3E8UH 3TYFB 4L4VA 2EDNA 5EEUA 4X0KB 5DUBA 5DUJA 3EDFA 3JWOL 2C3XA 3WHXB 1FLTX 4ZT1A 1BZQK 5DGRA 3SDDA 2UZXB 4LBAA 3FF7A 1PLAA 2V3DA 2AXWA 2NUTA 1Y1UA 2WCSA 4AYFA 4FL4C 2HH0H 1YEJH 5CZVH 3BFWA 4XP5H 4NOFA 4G6KL 1QBAA 3PGFH 5EU4B 1CWVA 3CVCA 1A6WL 3MV8A 3B9KC 3HE6D 3NT0A 4G8GA 4PLOB 3R8QA 1YPZE 4JQIH 5IKCA 1AGFA 2Q7AA 3K6FA 2YUXA 4ZG1A 5ISZD 3ROLB 3PNWB 1TO5A 1UYWH 5DO2C 5DYOA 4PTTB 3TASA 3FFCE 1GJWA 4N0YL 2IO5A 3BMWA 4OCSL 1UZGA 3WEXB 4I1RA 4OIBA 3L2MA 1P6WA 3ENEA 1VZHA 4JJ5B 4E41A 1S9WB 3I3EA 1G4MA 5D72L 2WSDA 3WY3A 3ZDXE 1ZIAA 3S35X 5ITBH 4G9FA 3CHXA 1A3RL 2GIYA 2X9XA 4JFEE 1BG1A 4U2YA 3H6JA 4WO4D 1NIDA 4F7MB 4B97A 5TQ0L 3WNLA 1G9ML 5DMIH 3AROA 2XKUA 2UZIL 1PLCA 3MLYH 1NM9A 4KH9A 4Y19A 3T0DA 2W65A 2W60A 2VT0A 4FI7A 4AIZB 5D7IF 1I1FA 5L9DH 2IANA 2EO7A 1F11B 4KNQA 4I3SL 5JPNA 4B53A 2VL5A 2VDLL 1HIMH 3O41B 3Q01A 5EU6D 5BV7B 4MYWB 4BGDA 1HXMA 2UYLB 2CDEB 3JTSB 4FMFA 5HHMD 5KBLA 2DM4A 3BHBB 4AEHH 2GBTA 2J3SA 5FA4B 2H3XC 4P06A 3TWCH 5LG6A 4YDIH 4WI0A 4HXBL 2ENJA 3O3EA 4XCFL 5I74C 3SKJH 3V6ZA 4R5TA 5DHYA 1PKOA 5DUML 1CT8A 3DUSB 2LT9A 2KT6A 3EG9A 5AAWC 1WEJH 3SPJA 1YAIA 4IRZA 4L3EB 2OMUB 4NUJA 3ZT6A 5JIIA 5FYJL 3C8DA 2A9DA 4S1DD 4JQIA 3NSDA 3E6HB 5ANMA 4LLDA 3LTVA 4AEIH 1LM8V 2F7RA 3GMPB 3MR9A 4M8UA 3ELQA 4WHTA 4JKNA 5EO1A 1JWMA 2YKKA 3VI4A 1BA9A 5DK3A 1ZHLB 3LRLA 2QPUA 4OGYL 1IU1A 1BMGA 5LGYA 3D12B 1L6ZA 4XNYH 3M7FB 2CGZA 1EJOL 1IM3D 3BPCB 1AE6H 5IV2B 4N9GB 4GW4A 3BZ4A 5K39B 4N87A 2E4FA 5F89B 1A6ZB 1AY1H 1OWWA 4DGYL 1LP9A 4H0HB 3U36A 4KTDL 5CSZA 4RWYL 3K71B 4HWEH 2GC7C 1OHZA 3MRQA 4FJYA 1AZUA 3NIGF 2BNRE 2FTAA 2VDOL 3GS4A 2CJSA 1JZ4A 4X4YB 3L4XA 1MNUH 4N8VA 3CDYA 5GRUL 3P9LA 2DQCL 3ZHKA 3UCQA 2PWFA 3D18B 4EBQH 3CXDH 3HZYA 5IEKB 1A2YB 3NG5A 4XAWH 3BSHA 4EN2A 2J21A 3DX2A 4ORGB 1CU4L 3O3DB 1ZA3B 4DP1X 1DQDL 2PWDA 4XRCA 4NQCD 1XBDA 1QQDA 3NSJA 4ELME 3LD8B 2OJZL 2EDMA 3CSYB 1JYWA 3O6ML 1ZSDB 2BH0A 2XI9A 4GMTL 1XGZA 4PRDB 5DMYA 1VDGA 1PD1A 4LCIL 2R0KL 3OGOE 3Q1EA 2WINA 3CVHB 5E8PA 4GAGL 3U46A 1VFOA 3PCYA 4X6BB 4JANB 4UIMB 2WCPA 2NUPA 3MRCB 1JGUH 5T1LB 2YXWA 2MQGA 3TT3L 4DGVL 2YBGA 2HTKC 1H9DA 4R90L 5B4MC 3FB8B 3VA2C 2CHNA 5EOCJ 5SX5H 3S8WA 1KC5H 3QO0A 1VEOA 4PJIF 2K9FB 4XB8A 3UAFA 2VUKA 4M4PA 2ZXEB 1OSPL 5IG7A 3QHTC 3A3YB 2DWTA 5BMFL 1W72B 4HUWA 3X12A 2XOTA 4F7CA 4JS7A 4ZMXA 4I4WA 2ESVE 5BZZA 1JI2A 1VFUA 1T66D 5KYXA 3B5TA 3DO4A 2EDYA 2WW8A 1MCCA 2ZAHA 1KCVH 1J1XH 1QFOA 4FL4B 3L4YA 4HH9A 5ACLA 2Q86A 3FAXA 2QLYA 2BMKB 2EH8L 1PAZA 1SJMA 4KKCD 5C09E 5T5NF 2L0DA 3SYPA 2DOCA 1KCSH 3MRRB 3VXTB 4KJQC 3LZRA 5CM1A 3H3KA 1UFUA 1MWOA 3CSGA 4AE1A 5C8JB 1HOCA 3B9KB 2CDFB 4PH8A 4JO1H 5HYQA 1OPGL 1NGPH 1KCUH 3LSOA 1FAIH 2VM4A 4MDIA 4ZTPL 3GBML 3MLZL 3Q06A 3A23A 2EE6A 4GXFA 3ALXA 5FFLA 3EYQC 4JKWA 2YRLA 3PGDB 4AVJA 4GIPD 1R3LA 3KZ8A 1FNSH 2WWKT 4QRQB 3UXFA 1ACXA 3AC0A 4IU2B 2WLZA 3CFTA 3FSAA 4PV8B 4YFDB 5J1AA 5IREA 2UX6A 4PS8A 5IVXB 2XWTB 1NCDL 4NWUL 4QHUA 3S6CA 2R69A 3EJCA 3CLWA 3EZ8A 4Y4HC 2GAZA 5DWUL 4NM8L 3MA9H 3S35L 3WNIA 1QYGH 4JGMA 2C9PA 1ONQB 2FJGA 4FQIL 3V0VB 4BZ2H 4QF1A 1UM5H 3A5VA 3THMH 1OP3K 3PDOA 5E4AA 5JOFA 1L5GB 4NFCA 4M43H 3C2AL 4P46D 1B9ZA 2NXZD 3KDMA 2GJPA 1BOGB 1NL0L 1VGEH 4JKLA 2DQEH 1LLAA 3JT2A 5DHVB 1DQQB 4AIOA 3VJ6B 3ECVA 1CICD 2XQYA 3POHA 5F3BA 3NZHL 1A8ZA 1SQMA 1MN4A 5D5MB 2YOAA 1A8JH 2OW7A 1AVAA 1C1EL 1E4WL 2NYYD 4BFFA 5DK0B 1T4WA 5E7BA 1S9KC 4XC3H 3PWVB 2OTWA 4PW9A 4NSKB 5I74B 3SO5A 1MFEH 1XV8A 3DUHA 5F7KC 5T5NG 2B1OA 2WLNA 1HSBB 4LGPB 4NQTA 5E5LA 5E9DB 2YO3A 4U1KB 4FA8A 1D5XB 3L1OL 1FCCA 4OCXL 2EDFA 2VIRA 2XTJE 1NIAA 3HC4H 4F20A 4R7DB 4FABH 2WQRA 4KOBA 3ETSA 3OKLA 4U3HA 5SWSE 1RQ5A 3AU0A 3FO2A 1X6LA 1UURA 3FN0H 2X5PA 4AW4A 2F53B 4I8DA 3JWDC 4GQQA 2Q5BA 4JY5H 3RU8L 3NAAL 4LKCB 5D2LB 1DEEB 2C8NA 5D1XD 2B59B 2CGRH 3EDKA 3V4VA 2FX8L 1N12A 2WBJA 2WIIB 4MFHA 2Q6WA 3NABH 4QHNB 3RZWA 3CDGB 3FMGH 1DQMH 2V8MA 1TF4A 4LPXA 1XGTA 4KXDA 4YBLC 5BW7A 1F8TH 4NCDA 3LEVL 1MAJA 1JYVA 4S2SA 5K9KB 4WUUD 5T5FA 2RACA 1S7VA 1COBA 4BZ2A 1OXYA 4IBTA 4Y4KB 1ESOA 2ERJB 1HEZB 1J18A 3MYJB 4FQHB 1CFQB 4UANA 3UYOD 5I8EB 5CMAA 1FIGH 1S6NA 3W9DA 3L3JB 1RK0B 4KKBD 3P0VL 2VLLB 4DVRH 1OARH 5C0EA 2JKRM 1UXWA 2VXUL 2Q2EB 3MUGB 4X0NA 4HFUL 4OSUL 1NGXA 5EN2B 1M2VA 4IHOB 2IXQB 4AGLA 4X80L 1PSKH 3FO0H 4A7TA 1L0QA 3LZNA 3Q3GB 1AGEB 4WV1B 2GJZA 4ZO6A 4FGMA 1ZTXE 1T80A 4OCWL 3BEWB 1FO0H 4F7EB 1F3DH 4P2RB 1IC1A 4HF5L 4MMYB 1F0LA 2IDCA 4ZW7A 1ZPLA 5JO5A 3K2IA 4WLCA 2GI7A 3I84A 3QRFM 5CZKA 4LKXB 1X7QB 4JFZH 2GCYA 3HIZA 4AG4H 5EA0H 3FUJA 4NO2B 4B5EA 3HG3A 5E51A 2WAHA 3QUZA 3F65A 1S9VB 3FONB 4LPWA 3SGDH 1CXFA 4UZUA 1SY6L 4URTB 1BZOA 3HLAB 3MRDA 3GXFA 3QQXA 4H26A 4HUVB 3NIFB 4XAKE 4PMEA 1KFAL 3TO2B 3FO9B 3U1QA 4WK4B 3X1EA 4NC2B 5F9JA 5HYEA 3G5WA 3BPNC 5K93A 3MQIA 5FYJE 1AGCA 3PIQA 1T04A 3UAJD 1BQHG 5E1QA 3L9RA 2YUVA 4HALA 1MWAL 1RP8A 4LOVA 4HISA 3U30B 4ODXA 1CJYA 3RUGB 4BKTC 5JMOC 1SJEB 1JZJA 2XBZA 3OLGA 1LNUA 1J9RA 2XZQL 1XVSA 4CSSA 3I02A 2ZUYA 1W9XA 3S9DB 2ENSA 3WFCH 3K4AA 4KX9A 3TFKD 1H15B 4JFXA 4LLMA 4PJXA 3VXUB 5L4FA 1A64A 4ZJ9A 5EOQL 5FS5A 5IFJB 1OW0C 2DMHA 2L4OA 2OSLA 4UTCA 1F45A 4P2OA 2CHDA 4DOHE 3P3SA 4M1GL 5DJ0B 5EUOF 4E9VA 5BOPA 3QE5A 1XGQB 1A25A 4Z7OB 1LQSR 4ODWA 2FGWH 3V79C 3WAJA 2YR3A 2WXFA 4DUXA 3S0PA 5ESQA 2R2BA 2BNQD 3HN8A 5JXAL 1CVSC 2PNDA 5CJOH 4N1HB 1FO0A 2VR6A 3DPBA 3RPKA 5C0DB 1HJBC 1NUDA 1ZE3C 5IB3B 1MIEH 5F1NA 4IJTA 5T33H 1IVLA 3N44F 4PG9A 2X44D 3SKNB 1JHLH 4W9ZA 3C09B 3BVNA 3TH4T 5HPMB 4LSSH 5DHEA 1BP3B 2IQ9L 1T6WA 5T1KA 4GUQA 4N0CD 2V9QA 3H85A 1DUZA 4X6DF 4JO3H 2WXHA 5KTEL 1G9HA 4I9WD 4AM0A 3LZPA 3UOAB 1KXHA 2F6AA 1NTDA 2MEJB 1NC2B 5HXMA 4WF7A 3QR1A 1SXBA 4LAJH 1K6QH 3VXMA 1JPTH 1G43A 2ZP8A 2WCGA 3BPOC 3FQRA 2A77L 1U6AL 3HI1B 2CM5A 4XPGL 5HJDA 4G8IB 2IWKA 5KVEE 1MLBB 2FWOB 1JHTA 3MNWB 4V11A 4G6FD 1QO3A 3KYNA 3RGHA 3LB6D 3L4TA 2E47A 2MPVA 1VERA 3LQAL 2IH1B 4HFWB 4MNQB 4PJCE 1LXMA 3BQUA 3BDYL 3GSOA 1BVOA 4S0SD 1D7DA 5CCJA 2P5ED 5C6WH 2L04A 3TU6A 4F9LC 5D55A 4WUKH 5FAAA 1UFGA 4GW5A 5K5YA 3VTMA 3WUZA 2BY3A 2NT0A 1JRHI 2NW2B 4M3JA 4MD5A 1ADQH 1T0NB 5K9JH 1ZJBA 3FSOA 4JFOA 5HI5D 3FTXA 1N0XL 1NMBH 2ADIA 1VLXA 1ZT1A 1A9EA 1ZLDA 3N1FC 2CK0L 1JI1A 3QEQB 4H2CA 5MI0C 1P1ZB 1SVBA 3U9UA 1ZANH 3Q6FB 4U1JB 1PD6A 3HR6A 1JHKH 3UZQB 3ZR5A 5F7HA 4NX0A 1MLCA 1JZIA 1JPEA 4KGJA 5JHDA 5AZ2L 3QI9A 1QSFD 1ZVHA 4ZAKC 1QRNE 5JHMA 1OVZA 2HLFC 2FQFA 3BYYA 5HHVL 1MIML 3NJVA 1XH3A 1F4WH 2IEPA 2X89A 5D7LA 4MRCA 3RIFF 1N7MH 1YMHB 2K8MA 3EADA 3FUMA 3OC8A 4OAWA 3WU1A 3HNVL 3VXSD 3IDJA 4DKEH 3DRTB 4P23B 4A2LA 3D0LB 1D7CA 3K6OA 4NZUH 4ZS6D 3WS3B 4LLUB 2ZX9A 5AVUB 4XNQA 1QUNA 2X70A 1Z9PA 2HJFB 2VQTA 4Q52A 4WENB 3V0HA 1WAEA 1SOQA 3QO1B 1RZGB 4XWGL 4YE4H 4WCYH 1F58H 3UC2A 4Y9EA 2XG5B 5B1JA 4A6YH 3E6FA 2ITFA 1F3JB 2PWHA 1GZPB 4ACTA 2DWDA 3WJLA 5JNYA 1IZJA 3GLZA 1DTUA 1HL5A 3JV6B 5C0GA 3X3FH 1I7TB 3IBOA 3RWGB 1U8KA 3E9TA 4UAOB 1FNLA 4HGWB 4AZ8A 3ZW3A 5JYMA 5IVOA 1XH2A 2VERN 1OZTG 1I1AD 1GW0A 4MAUL 4L9DA 4PS4H 3T4AB 3VI3B 2ATAA 3HI6H 1RURL 1U33A 3F00A 1UVQA 4MB1A 4UTBL 2UXFA 2PMZA 1V7NH 1WE5A 2CRMA 1IAII 4R97C 4YDVA 4XVTL 4XNXL 5ID1A 3GLAA 1RMFH 1UUSA 1PZSA 3D69B 5I1IH 1U3HA 2C7UB 4I5BA 3T2LA 2V5RA 3BPNB 4A2GA 4L4VB 1R4XA 1ZOXA 3QRBA 5DUBB 1NCNA 2DQDH 3F6JA 4DP9X 4Z0XA 4H4NA 3ULUD 1Y1DA 1TEGA 4W9LC 1P6AB 1A1NA 2Y1YA 2EKSA 4W70A 3CHSA 3MRFA 1A21A 3SDDB 1KJ3L 3EJQA 4V33A 5E08H 4M29A 2OLDA 2CRZA 2NY6D 2ICEA 2NUTB 1NCCH 3O6FC 3INUL 3GJFA 3VXOA 2KZBA 4XZUA 3QNFA 4DJMA 2V5SA 3W5NA 4MRBA 3DUUA 4ZUVA 1T4KA 2CIKB 1I3VA 1TPXB 4PJ5A 2CPUA 2C1PB 4QOKA 4G70B 1HJCA 4IOFD 3U1SH 12E8L 1J1OH 1YC8A 4LOUC 1E8XA 1AD9A 4WI6A 5IKCB 4G8GB 1DUYA 1AGFB 2WLLB 3NP3A 5CCKL 5J1SC 4GPVA 5LGKA 5DLML 3V0WH 4XVJL 2C9AA 3O2VH 5EZJB 5J12C 1A4JA 3PQYB 1T7WA 3OC5A 3IFNL 2ATKA 4BKSC 3MGTA 4HIHA 4E41B 1N2RA 4N5ED 2EDEA 4BKLA 5L4MA 3OHXA 2BFVH 1XIWD 4LASH 5ESAB 2VDML 5EHFA 2QV4A 5HHOD 3EBIA 4G9FB 5E8DH 3BH4A 3HG1E 2R0LH 2X4PB 2QSVA 3RBSA 5AKRA 5C92A 1T20A 1H6EA 4HJGA 4KY1H 4LEOB 4RDBA 4UOJA 2EE2A 1T2XA 4I88A 1YQ2A 4HSCX 1BWWA 1NBZA 2IALA 1TEFA 4BE6A 4TV3A 1HL4A 2W65B 2W60B 3BPOB 3ZO0A 4ONFL 4WEUD 1KPVB 4KU1A 3VWKA 5LHDA 4MZRA 3VQ1C 2CLZB 4LL4A 5JPNB 3WMSA 3MV7B 4NNYA 3I74A 3MACH 3MMEA 5GZNA 3VGFA 3IB4A 1I82A 2CPCA 5GRXG 3GWJA 4KDVA 1Z5LB 2XA8L 4OZFG 1YZZA 4M7LH 2MSPA 4P07A 1N67A 2WQVA 4PLKD 1X7TA 1CPUA 3GSVA 4WI0B 3O3EB 1X44A 2AJYL 3FB6A 2EZ0D 1ZTMA 4NBYB 5GRJL 4F5CA 1KEGL 4XOAA 4RA0C 1ASQA 3GXUB 4NUJB 4DZBA 2E3VA 4LO9A 5H2BB 4M7KH 1HNYA 1UADC 5DJ8A 3GXPA 4OGZA 5I66A 5ANMB 5C3LD 4FXLA 1SDDB 3MR9B 1M1XB 2W8CA 4K3DL 1HK6A 3V5DA 1JWMB 3BUBA 2RCSH 4JRYB 4XI5D 4L1SA 2HLAA 3FUDA 2FT8A 2JTYA 3IDXL 4ZAKB 3RA7L 4BSWA 3BZ4B 4PV1C 5E1IA 1Z2KA 4N2DA 3G6DL 1DBKH 1D6VL 3AXLA 1LP9B 3U36B 4P59L 5CSZB 3RWCB 3WJMB 5DJYA 4F24A 5FOBA 2NX5E 7TAAA 2BDNL 1HINL 1DFBL 1RZPA 4P5TA 2VLJA 2X6CA 3T3ME 3US0A 3D85A 1BVZA 1EO5A 4AUUA 2XDHA 3JBG7 3UJIL 3OMZA 2Q8BH 2XNAA 2TSAA 4N8VB 5GJSL 2Y06H 3P9LB 3QG6A 4FQCH 1F02I 4JFSA 1G84A 3ES6A 4AQ1B 4OCLC 3HZYB 4O2CB 3PS6A 1JAEA 4M1DH 5I0DA 5DJXA 3ATBA 3TZVA 5K69A 1CLVA 2FYVA 3AG3B 4X99B 4XRCB 2VAJA 4WFHE 1QQDB 5FHAH 3TX4A 1HWHB 4NYLA 2IV9A 2CSPA 5IMLA 4CVWA 4RX4A 1MELA 2TRYA 1N26A 2MH4A 3MKKA 3MFFB 4DKDC 2X41A 4XB7A 1OGTA 3MOAL 3SDYL 2GB2A 5I18L 5JA8B 1AP2B 2WINB 4Z8FH 1O6VA 3BH9A 4IQHA 3GMLA 2NUPB 4RIRB 3MODL 1REIA 5LQBL 3P1VA 2OMYB 1P53A 1IAKA 3KXFA 4JZJC 4PBDA 1F97A 2QMKA 1CK0H 3QO0B 2XWCA 4TTGA 4ZOCA 1EHLH 5IG7B 3KLLA 1TTRA 2UXVA 3G3LA 4HUWB 3FCSA 4WO4C 2N4IA 2BK8A 3CFNA 1ZS2A 4ZW5A 4I4WB