1F1DA

Crystal structure of yeast h46c cuznsod mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFCIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-ZINC SUPEROXIDE DISMUTASE
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 38
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1f1dA00
1S4IA 4A7QA 4A7UA 1SXBA 2GBVA 1SOSA 4N3UA 2LU5A 2Z7ZA 1DSWA 2V0AA 4A7GF 5KBKA 1SPDA 2ZKXA 3CE1A 1SXAA 3GZPA 2WWOA 2ZKYA 3F7KA 2Z7UA 2Z7YA 1TO5A 1N19A 3MKGA 2AEOA 3H2QA 3GTVA 1IBFA 4BD4A 3SODB 1HL4A 4A7GA 2ZOWA 1PZSA 1UXMA 2AQPA 1Z9NA 3K91A 4L05A 1OAJA 1OALA 4MCNA 2C9SA 4U4IA 2AQQA 3ECVA 2R27A 1UXLA 3MNDA 1E9PA 1JK9A 1KMGA 1YAZA 4MCMA 1PTZA 4OJAA 3F7LA 3CQPA 3QQDA 3GZOA 1OEZW 3ECUA 1CB4A 1IBDA 2K4WA 1SDYA 1E9OA 3RE0A 1SDAB 2C9UA 2VR7A 1SXSA 1RK7A 2APSA 2C9VA 3KM1A 3GTTA 2E47A 2AQNA 3T5WA 1SRDA 1XSOA 1P1VA 1E9PB 1JK9B 1ESOA 2GBTA 2WYTA 1XTMA 2AF2A 3QQDB 1U3NA 1YAIA 3HW7A 4A7SA 1L3NA 2SODB 3GZQA 3L9YA 5KBLA 1SXCA 3L9EA 1E9OB 2ZKWA 1COBA 1QUPA 1Z9PA 2WKOA 4BCZA 1EJ8A 1IBBA 1XTLA 4N3TA 1E9QA 2AQRA 1BZOA 2E46A 1CBJA 1HL5A 3CQQA 3GQFA 2WYZA 1OZTG 3ECWA 1F1AA 1JCVA 1YSOA 2JCWA 2AQTA 1EQWA 2WZ5A 3KBFA 2Q2LA 1SXNA 1SXZA 2VR8A 1PU0A 5CU9A 1BA9A 3H2PA 1AZVA 1OZUA 2WKOF 1DO5A 2WZ6A 1FUNA 1MFMA 2WZ0A 2Z7WA 3KM2A 3HOGA 1F18A 1TO4A 1IBHA 1N18A 2WWNA 1F1DA 1B4TA 1IB5A 3KH3A 4OH2A 1E9QB 5KBMA 2GBUA 2NNXA 1B4LA 2AQSA 3KBEA 1Q0EA 3LTVA 2XJLA 2XJKA 3HFFA 4A7TA 2VR6A 4B3EA 4A7VA 3KH4A 3S0PA 3PU7A 4BCYA 1F1GA 2JLPA 4FF9A
chains in the Genus database with same CATH superfamily
3NGBB 2V7NA 4IMLB 2UWEB 1EHLL 1WE5A 4YHPB 2VQ1A 3PJSB 2Z1PA 5EBWA 3UBFA 5ICYB 2VN3A 4ZMAT 3EJCA 2E6QA 3TVMB 2I32A 3QNYB 2ZKXA 1FORL 4OCLC 4PUBL 1CR9H 4JMNA 4N8CL 1T21B 2Z7YA 3QG7L 2BX5A 5KVEL 4MA7H 4MDJB 4PJ9C 1ONQA 2E86A 4CW1A 4HOMA 2I5YH 2FEEI 5DDHB 3KNBB 4PJIF 1MI5E 3PJNA 3SCMC 1MG3C 1UXMA 1YJDL 5E70A 1AR1C 1CG9B 5GRVK 1YDPA 2H32B 1OP9A 4X6DA 4JFEA 5GRZA 2CDFA 4I18B 4Z9KB 3LV3A 1NFDE 3RWEA 3IF1B 4NYLB 2DTSA 3BKJL 3HG5A 4F7KA 2YRLA 3HN5A 4HIPA 1Z5YD 4JQVA 2UZPA 4PRPA 1F4WH 2WXNA 2VSDA 4KKCD 1A6VH 4NN5C 3FO1B 5IB3B 1N12A 1SDYA 5IW1B 4Q4IA 2YD0A 1JWSB 2H26B 5E8NB 4A55A 4HLZG 1PJWA 3HZ3A 4GW5B 3U0TB 1QFUH 3EJQA 3CN1A 1CDHA 4MA8H 4ZPTA 3X14A 4OCSL 2FJHA 3Q6GL 4PD4J 3LRGA 4XODA 3UG3A 2XZQH 2F15A 2AZUA 4ISVA 1TYRA 2BVTA 2BZCA 5DJ2A 1Q9WA 1WEJH 2LHAA 2BRRH 4LLUA 3WTSA 4Y1TA 3DETC 4M7JL 5BOPA 4Q9QL 3CIAA 1MCDA 1ES0B 4HCRL 4K4KA 3G6DH 4ZO6A 4I0CC 5AQ0A 1KLGB 5JPMB 5D2LE 5DD0L 4W9HC 1EHXA 4OIFA 4UQDA 2CKBB 1OE3A 2E46A 5DO8A 3SBWA 1I8LC 1SLWA 4WNQB 2JCWA 5K59F 4QXTB 5IUCA 4AL8L 3LVEA 3KPRE 5DWPA 1JNJA 1UT2A 4NHUA 2PYFA 3KHQA 2OP4H 3F58H 4K3DH 5T1LB 1N7MH 2FZ3B 4TMPA 4P9HH 2UX6A 3VXNB 3K1DA 1U8MB 5ICUA 1BQKA 4ZNEE 1HXMA 2IMMA 5IB4B 5EF3A 2FX8L 1CDIA 3UJIH 1MDAA 1PZ3A 1GOFA 4OZFB 3FQTB 3G5YA 2K45A 5JIHA 1L0PA 2Z8RA 4JPVL 2ZJSH 3GS4A 1RU9L 1G6RB 4NUGL 5EOCL 3TBSA 4PJ8A 2NSQA 2V5MA 3KLSA 1TVDA 3IJEA 3D18A 4JN1H 4NQSA 4ONGH 4OZHF 1HQ4A 1F3JA 1T1WA 2VDRL 2BC4B 5D6CB 5EORH 2YMXL 3MRNA 4LPUA 4OZHB 3U9PH 1KIRB 3QJFA 4R4FH 2QTVA 1UATA 5FM4A 1YEJH 1BPVA 2EYSB 2UXFA 1IGFH 2EC9T 2ZWNA 4Z7IA 4PRBA 5KANI 3DTXA 2VLLB 3ARBA 5JO5A 3DARA 5IB5A 1QMUA 1OCCB 1H0DA 2AK1H 4YHNB 4JFED 2EYRB 3MKGA 2JELL 2YD2A 3L3OC 1A0QL 3MLYH 3IB4A 4NP9A 4Q6KA 3JYBA 3QH3A 3TFKC 1MVUB 4HAFA 2M26A 2BSEA 3PWLB 2BDNL 4PRPD 3MV7A 3QCVL 3B1TA 3CSPA 3MOBL 4NNPH 4PY8I 5INCA 4KUCF 2PXYB 5CGBA 4U49A 5AG9A 1FYTB 3RL2B 2ZUQC 3KLDA 4M7ZB 1WFOA 5IT2L 3JBG7 1RY7B 1T3FA 3L4XA 5LXVA 4PWKA 8FABA 1OAYH 1P4IL 2A4EA 4R8WL 1NCGA 2EIZA 4Q2ZA 3MHZA 4UT6H 3T8XA 1BQHG 3SY0B 3AC0A 3WEXA 4LRIC 3FU8A 4NO0B 5F7DA 5CBEA 1PZ5A 1R5WA 3N42B 3VH8G 5BQ7B 1F86A 2X10A 3KM1A 4G5ZH 3AG2B 3BLKA 3I9GL 5DD1H 1GL4B 2X70B 3CC1A 3BVDB 5BJTB 3TEYA 3Q2VA 3V9CA 3C08L 3K72A 1NDMB 3OPZL 5BZDB 1S9WA 2NLJA 3K2UH 3P4OA 2KERA 4C4BA 4ESKA 5FYKD 1NGXA 5I73C 2I27N 3CN0A 3VXOB 3GMNB 2GTWA 5L2JB 3ABGA 1AS6A 3WAJA 4IDJL 3W81A 2EO1A 1DTUA 3A47A 3M07A 2NY2B 1GGBH 1UZ8A 1XAKA 2VABB 5DMGC 1GTNA 3SGDH 2GCYA 3HBZA 3BN9D 1IU1A 5GGSY 3B9VA 1O9WA 2YAQA 4KVNL 3LIZH 3O6FB 3L17A 4XGZA 1E4WH 2PN5A 4PJ8D 3SDXF 4AIEA 5I6XC 5B38B 4JE4B 4HLEA 3ARFC 1KZYA 4DEUA 1NIEA 1PFOA 3S2CA 3IPFA 4ZXBA 1E27B 2OMUA 3N85L 3NZ8B 4YL9A 3SDAC 3APDA 1VFOA 2JKLA 4O4YL 4OD2A 5F8RC 3INOA 3TEZA 2LFEA 2ENYA 3A6BL 3H9HA 2XN2A 5K39A 3SDYL 3R18A 2JIXB 2VMJA 4TS6A 4WFGD 3VXPA 1IC7H 4QJ4B 1W72A 3VW3L 4A7VA 3MJGX 1AG6A 2HFFA 3ARBD 3GRGA 2GJ6E 2KQMA 4BGLA 4OU3A 1YN6B 2FK9A 4E9YA 3BVUA 4PLNC 4XPHL 4KNUA 1JPTL 2BP3A 1N59B 1TJXA 5J13C 4JFOB 2BSED 1SBBA 3LS5H 1OT1A 3MV7D 5GGSA 4OLXL 3BQUC 3O2WH 3LKOA 4OCXH 2O26U 1IGTA 1E2VA 4E9XA 3WUZA 1BF2A 2E5EA 2Y24A 3MPCA 3PGCA 2NY5H 3O3UN 4HWEL 1Z9NA 3NRPA 4JM2A 3KBPA 2QADB 3MSPA 4QLWA 5DD6A 1PX8A 1BCIA 2CZNA 4M6AA 4BFEA 5T5NG 1G9NL 2J8UA 4G7SB 1K4DA 1U42A 1I9IL 3FUDA 4GAJL 4PQXA 3HRZA 1KB9K 2ORBL 5FYLL 2AEQH 4Z3TA 4H26B 2NQCA 3WNKA 2V7HB 1DEEB 1NFIA 1ET7A 4W1TA 5I1JL 1E4XH 5GS2D 3OHXA 5ADOL 1SN5A 2B3IA 2EDFA 4WHDA 4CMHB 3DV4A 2W9DH 4LAQH 3FQUB 4L23A 5D7KE 2E47A 1QPXA 2ZKHH 1VB9A 1T22B 1GZPA 3LD8B 4EAEA 2ZUYA 4P2QB 4KPHL 1MIEH 4QTIH 3WS3B 2F5AH 2PNDA 2WXMA 1KCVH 3X1GA 4FS0A 4N0CD 1A5FL 1BFOA 4MHHG 1BOYA 2M2DA 4M56A 2R56L 5K9OA 3NFNB 4LCIH 1XH3B 3MV01 4JRLA 4Y4FC 1KJ3L 3WJLC 3M7OA 5EZOH 3F64A 1F02I 5KVGH 1QLRA 1WG3A 4ZX3A 3FDWA 3L5WB 4FD0A 2N59A 3DUSA 2WCPA 4HCGA 2CBTA 3ML9A 3ZDZE 5FB8A 4I48B 4BINA 1ZANH 2BINA 5DK3A 4ZXBD 2NY4C 2XQYK 1PU0A 3CMOL 2V2WB 5JW4M 3ARQA 3CZFA 3NP4A 3TA4D 2OSYA 4TNEA 1OGTB 1DVYA 5B39G 2PPCA 1XXFC 3OKDA 1ZEAL 4ELKB 5J57B 2BZDA 3AY4C 3RY6C 1NEZG 2P8MA 2H0FA 4GG8B 2JKJA 4UTBL 5J8OA 5EDSA 1P53A 2OZ4L 4PBXA 5B3JE 5EF0A 5HI4D 4R5TA 5EG6C 4OI8A 2NDFA 2WIIB 3RPIB 1A9VA 3NGBC 1DZ0A 2WGXA 3QNZA 1WWCA 4BCYA 1LL1A 2JI1A 4ZFOA 4HS6B 2JJVA 4NAMA 1AGEB 2EILB 3TVMC 3VFNA 3DX9B 1JV2A 3QJOA 3PNRB 5IVZA 2OKMA 3HE6A 4J4PC 4WWKD 1MXGA 4QO1B 4JM2D 3T1FA 5KYXB 3B9KA 1KENH 3GZPA 4L1SA 5CXPA 1BQHA 1KJVB 1ZIBA 4LL1A 1D5XA 3CFBA 4ZDHA 3VH8A 4DZ8A 1AZCA 2DW5A 4LXFA 4U1LB 4HX1B 1I53A 5CZVH 3WJJA 4KKLC 2NUTA 2FWUA 2CA3A 4HPOL 3BSZA 3NCYS 3VE0A 3VVWA 4YS4A 4BFFA 1UA6H 1OP4A 3DK2A 4DP2X 4XNAA 3QQ4B 1NBZB 4PS4L 2XXFA 1KBVA 1TCRB 4OW6A 4A2LA 2CMRH 3GLDA 3W2DH 5IEKA 5AYUH 1HC1A 4S0SD 2X3AA 1JGDB 2FR4B 2VDRB 3ARWA 1W2KT 3GB7B 2JQAA 4M1DH 4PWGA 4D9LH 1M1XA 3E38A 1HHJB 5F6HJ 5C2BL 3LZOA 4GP8B 2I7OA 3ATAA 2ICES 2EH7L 3SE9H 5C0JB 4FQ2L 2YA2A 5SWQA 1FZMB 1ETZB 2ZF9A 1IKNA 3WHE1 1UQSA 1F0LA 4HH9A 3TEXA 2QQLL 2Z4QB 2VR5A 4MJIB 5KSAC 3NYKA 2HT4C 1XB8A 3KXFA 4Y4HA 1JSYA 1BLIA 3FB7B 3GMLA 3HZYA 2QKIB 2ZX5A 4H8WH 1QLFA 4A2EA 2AV7B 4NJ9L 4O51A 5JPMC 1YZZA 4HIJB 1A47A 5MENE 1UD5A 2LLGA 4BCZA 3RNKA 4NUMA 2AJZA 3GQFA 4YSRA 2GC4C 3FCTA 2LAGB 1RUKH 3ARPA 5FUZH 3V5HB 2WXOA 2OI9B 1WC7B 4W6XB 3RAJL 5HHOB 3BVXA 4AGQA 5C0EA 1EDQA 1QNZH 2VAAB 1T80A 3ME0B 5E5MA 2F1BA 4B7IA 1IIKA 5D7LE 4GG6A 4QHKJ 2DMHA 3HB3B 1OM3L 2IALB 4XAWL 2DQEL 2VMEA 4F33A 3EJSA 3V0WH 2V17H 5J12B 3H4HA 1DBML 1FAKT 1AY1L 2C1OA 2OTUB 4UIKH 2BCKA 1AQDA 1WA1X 1HI6B 2VN5A 3IJYB 4JB9L 4ZYKB 3BWZA 1QABA 5J7CC 1XEUA 5DO2C 1CD1B 3HE6D 5GGQH 4ZX4A 3RHWF 3VFMA 3BAIA 2HKFH 3NTCH 4N0FA 3B9KD 1CD9B 2TSBA 3NMEA 1HH9B 2FNBA 4KAQH 4XBGA 4EUPH 5BRZE 1OO2A 4APQB 2WZAA 1JZJA 3WLBA 3GLAA 4OQTH 2A77H 4MJHA 5EBMA 2X4QA 3I6KB 4LCCC 4G80A 4MJ4A 4UQ3A 1K8IA 4MMZC 2AEPH 1SFDA 2TRYA 3ZU8A 4Z23A 1WZMA 2JKRM 4HV8A 3ZHLA 3K71B 4YO0A 2FUTA 3FFDA 2QGDA 4X42A 2BNQD 1X5GA 3PHQB 4PJFF 4OIIL 2PXYC 1AHWB 3W11C 4M7ZC 4MS6A 5DTFB 2XACC 3F7YB 2FHCA 3DPDA 2AANA 1EAPA 4JRYA 3EGXB 4M6OL 3TV3L 1ANUA 4PJFB 3BH9A 3KPMB 1PJ9A 2R1YB 1JWUB 5LGHH 4FYRA 2D9CA 1T83C 1Z6JT 5HD8C 1NGPH 5H2BA 3F3HA 3PP4L 1ZLUH 5AZ2H 4C8XA 3BVTA 1A66A 3FSWA 5CINL 2YQBA 3PHSA 1GPOH 1IAIL 3EDJA 3A21A 1MCBA 2ZUWA 3BVNB 4KKNA 4MNGA 5AW0B 3S37L 3KXFD 3NCJH 5KS9B 4Y4HD 3NJXA 2YD9A 1JXGA 2E6PA 2W88A 1XSKA 2DYPB 2VQUA 4FEMA 2XY1A 5JIQA 1CTOA 1Q90A 3ARDA 4MB3A 4U7SA 1AMYA 1MQKH 1Q0XL 3B2UC 5HYSB 1PX4A 4LPXA 2DH3A 5ID1B 3OZ9L 4L1DA 5E1GA 4FL4B 5KSUB 4JFDB 4V11A 4ILDA 1TTGA 2CBPA 1LQBC 1NEZA 4G7YH 3F7QA 1SXCA 5KTEH 1YY9D 2WO3B 2DQJL 1VPOL 4MJ6B 1DEDA 1R3IH 4G59C 3MC0A 3ZTJG 5CSZA 4FXKB 3O6FC 2X4TA 2YLHA 4OAWB 4ODWA 3W3BA 4HPHA 3L95B 1WAAA 5BV7H 4J6IA 4LEXL 2ZP0T 4OZ4A 3TZVA 4NNXA 4IHOB 3OXSA 1KXHA 4CKVX 4NO3B 2QSCH 3LPOA 4LHQB 3TA3A 5EMYA 3UTQA 2GY7B 2IBBA 1PQZA 1G7JA 3QUXB 1JF1B 3DGCR 3ALPA 2WXFA 4HUKB 4JG9A 1UGKA 4WEBH 3EFFA 2AZAA 3AM8C 3PY9A 1K5NB 1OGPA 5IK3A 3TCTA 3N04A 1UYWH 2XN9A 4QRRB 5D70H 5D72H 3MRFB 3N55A 1FSKB 3APFA 4YAQB 1LO3L 4HJGA 1PCXA 4YXHL 4QYOA 5B22A 2L04A 3GUTA 2B2XH 3P9LA 5HVHB 4RGND 4RDBA 2V0AA 4NM4H 2WQRA 3MCLH 4N4YB 5I2IB 2ZCHH 4OFVA 4XNMB 2H9GA 1ZE3H 3APNA 1A4AA 4JPIB 4GRWH 3V55A 2H0PA 4NFBA 4JRYD 1ERNA 3TH3T 3L3GB 3GTVA 4W9CC 5IV2A 3R06A 3SYOA 4XN5A 1RD6A 2QADC 3U6RB 1V7NL 1KIUA 4H0IA 5GS0C 4X6DE 2ADIA 3BT2L 4EJ1C 1MCRA 4PJGA 2CUMA 4ZUWB 1MHEB 2EDXA 5HDBF 4FG6D 2XPZA 1WK0A 2QVTA 4OJFH 1DVZA 5F3HA 4D8OA 3GKWL 4KFMA 1X5KA 4KU1A 2Y7QA 4LSDA 4Z7UF 2CJTA 3MGTB 4YBLB 2XUWA 3JVFC 1IGIL 4Z7UB 5GISH 3ARDD 1VESA 3CX5J 3SPHA 4CMHC 2IBZX 3RDJA 1C1EH 2IC2A 2VXSH 5I9QB 3S35H 3GSNH 3RDTB 1QR1B 3F5WB 2LU4A 3DV6B 4XZ4A 2K7PA 5C3LD 4EI5A 5D7EA 5ICZA 2MRYA 4QI3A 4OM1H 3L9BA 5DQJA 1DQTA 1QATA 5FLVA 4XX5A 3U1PA 2A83B 4GAYA 2DI8A 4PJCB 3ZY7A 3K4DA 3GBML 4MQ7A 3HR5B 1BBDL 4O02H 1T4KA 3TNMB 1XGYL 3W38A 3KVDD 5FYKE 3TZVD 4M6NH 2OQJA 4U6YA 3TPUB 4TULH 4K5LA 4FZEL 3KCWA 5CEZD 4HKZB 3CFTA 3ZL4L 3TA3D 4L8BA 4WU5A 4WEUD 1W0VB 1UWGH 3CXDL 4ORGA 4FQCH 4M8QA 4XNQB 3MFGB 4PJ9A 1SXZA 1NIFA 2O6DA 5HDQL 4HALA 3ES6A 5CCJA 1FFOA 2DLFH 2XN9D 3EJPA 4BFBD 5DJDA 1A7NL 1S9KC 5CP7B 3F65A 1AR2A 2CM6A 2CRMA 2H1PH 3FUNA 4R4NC 5C08B 4KZDH 2AJUL 3ESNA 4YOKA 3AT9A 3BPNC 3BUTA 3A6OA 3I50L 2J4WL 4PMEA 3DXAA 1G7LA 3UTTA 1QFPA 1IBYA 1UWFA 4Z3EA 3GXUB 1E3XA 2B20A 2FL5A 3MRHB 3WIFA 3CDCA 1UA3A 1YQVH 4LL4A 5FCUL 3F85A 3EJZC 2YGVA 2ZG1A 2NNCA 5T5FA 2PR4H 5DZLA 1U91B 4WFGE 1RZ7L 3VSUA 4AL8C 2K8QA 2WHVA 2EO7A 2YPLE 2WSDA 2CHNA 1F3DJ 1SPDA 2XVKA 4KJQD 3RX7A 1J0JA 1SXAA 2YMOA 3R19A 2VZ1A 3MA9L 5TQ2L 5A6MA 3HPJA 2XICA 3QPQD 3T4YA 3RX9A 4YSSA 5I17A 1NAMA 3FXIC 3QDJB 3DX3A 2EXSA 2Y7SA 2HFGL 2BVOB 4U6HA 2WBXA 3VSTA 4AY0A 4NUQA 2E27H 3IXTA 3MV7E 5C0FB 4KTGA 3MV9B 5C8JA 3QZLA 3UZEC 5A2KH 3HAEG 4M7LL 1WISA 2DEWX 4FGMA 4U4IA 4UWQB 4BZ1L 4N2KA 4DN3L 3VXUA 2DIJA 5LXGH 2VISA 3OGOE 1MRFH 4GW1B 4KOBA 1I8MB 4JLRB 2YRZA 3MLWH 3STLA 5IJVB 4ETQB 4S1RL 3F12A 3NIFE 1CI3M 4WHTB 4ZUTA 2YPVL 5DJXA 4HS8H 4P59L 1P9MC 3J07A 4EI5D 2ATAA 3WFBH 1KGJA 1UD3A 2F54D 2ZOTA 4QRUA 3P4MA 3VFUA 3BDXA 1KIQA 1K5WA 3BP5B 5CS7A 2PCPB 4YZWA 4WSKA 1HILB 1SN0A 4RDQF 4X9GA 3X1FA 5I19H 2EIJB 3TBCA 2HG5B 1FIGL 1HVXA 3GI9L 5DS1A 1NEPA 1KGWA 5ESAB 3O3EA 2VDLL 3SQOH 3QEQA 4CA4A 4K3JH 2PTTB 4XPTL 5AZEH 3N6YA 4J39A 1E40A 4X8CA 1L9PA 1K72A 1FNSH 2QKIC 3COOA 4M6ML 5FA3A 1MG2C 5A2IH 5IMMB 5DR5L 4IJ3B 5F9OL 4LF3A 3UPRB 4WKZB 4PB0H 2ZNXA 4PJ9D 4TQHA 1KYDA 1H3PH 2OSLA 1WJ3A 4B9PA 4HIHB 5D1QA 5ISZB 1AGDB 2NCEA 3Q8BA 4HIEA 2WYZA 1R5VB 4N8PA 2VDMH 4W68A 4BQCA 2H8PB 5FA4B 4FABL 3VNYA 3MJ9H 3LKRB 2XZAL 1AIZA 3DXAD 2RA1A 3UTTD 2FGWL 3IMSA 2E7LA 5INDA 4FFZH 5CJBA 4GQZA 1JJUA 1T1ZA 2H6OA 2VRKA 2Z8WC 3ULUL 1BZ7B 4FMFA 2DQUH 4QRTA 4JVWA 5IJKA 4D0CB 2G30A 2VXQA 4JFQB 3L3KB 4JY4B 2J1KA 4HC1A 2DL2A 4Y4KA 1KGCD 2EDHA 2EEBA 4KTEL 3D6GA 2ZYSA 3D4GA 1BX2A 1CE6A 1X7QA 3O3BB 3ZL2A 5HP5A 2DQGH 5MEPA 3DGGB 1XSIA 3MRGB 4AEIH 3PCYA 2B5IC 3B3BA 4FP8H 4ALAH 1S9YA 5JOFA 1EGJL 4X2UA 1F1GA 4FYSA 5IR1B 2CHZA 3DETD 5SWSB 4EXPX 5I5IA 4JAMB 1FN4A 4XP9H 3ZHDA 5DUML 4IOFD 3UC0L 1WH0A 4I3RL 4GUPB 5LBVA 3O11B 4FQ1H 4HFUH 4BRJA 4Z7WF 1FYHB 7PCYA 4H1LB 2VCOA 1HZHH 1I3UA 1U8IB 3NAAH 3KDMB 3RQ3A 3D0VB 4Z7WB 2OW7A 3VXUD 5I82A 3X12B 1LO0H 1QTYT 1P7HL 1AHWC 5CZKA 5KVDE 4Y88A 4LSUL 5CLWA 5DMKB 3ECQA 3AACA 3QUKB 2AJXL 2D0GA 3QQ3B 2J8UE 4OFIA 1CL7H 4L4TA 1DUYB 4M61A 3L4ZA 4XBEH 4IMKC 3RJOA 5DLLA 4LLYA 3VCLB 4WV1B 4UOZA 4M1GL 1KSRA 1CJYA 3MLRH 4M8VA 5CJOL 2Q8AH 5IB2B 2OJEA 3BVWA 4TVSa 4X5QA 4XVTH 2EQDA 1SJXA 3BSGA 4AIZA 1EHNA 3QEQD 2ENSA 2IQ9L 3ARFA 4K94H 2YRBA 1E67A 3KCPA 3V9FA 1UKTA 1DL7L 2FX9L 4QRPA 5FECB 1CGSH 1YEWA 3DK0A 2B08A 4FQXC 5C0NC 3Q2WA 1JK9B 4DPAX 3CH1A 4OFDA 5E9DB 1BD2B 4KK9C 1ACZA 4YHMH 5IQ9B 4QXUH 5D1QD 2ADFL 2LU3A 1MCJA 4XCCL 4J2XA 3EG9B 2FYVA 3X3FH 1CDUA 2J20A 1G9NC 4XO3A 2CDGB 4P46C 1FG2B 2XU9A 1OK8A 1P84J 4G1EA 3TFKD 4X9YA 4NN7B 2YSSA 3RZCB 2X4RB 3AXIA 3BQUA 2WTOA 5DRZA 3GXMA 4JBSA 4K55A 5CAYB 4E9WA 4Q4EA 3UG4A 5KBDA 2J7LA 1IUZA 3QUXC 1CLVA 2R2HA 4J23A 5F1SA 5HGAB 5L8LB 5FEBA 5AYQA 2G0LA 4X80L 2V8MA 1CICC 5F7HA 4PGJA 2QKSA 4X7TA 2Y7LA 5IM7A 1CXIA 4D0BA 1KG0A 2X3CA 4YR6A 3U4BL 5C0DA 4ELMA 2A6DB 1MHHA 2EEFA 5D7SH 2EKSB 3BAWA 1DJXA 1E6JH 1KN2H 5I6NA 2BNUA 1RP9A 3N0PB 4N9GA 4UT9H 1QSEB 4OTXH 4ADGA 2WXQA 3IXAB 2QZ5A 3ZHKA 1AD0A 4G6KH 1A6WL 3VFOA 3HAEA 1ZPUA 4GI8A 4BGDA 3G04B 1UCBH 4FFYH 4A2GA 3MBXH 3I2CL 3TBWA 4U7MA 4AUUA 5HVHC 3ZE1F 5FDWA 3U46A 1X6LA 1D5IL 3EGDB 4A7UA 5E99L 5I8OH 2VXTL 3DX8B 2CNZA 4POUB 4UINL 5KSVB 3ZE1B 1ET5A 1FA4A 3FO0H 5EH1A 4M9PA 1UXSA 4WO4C 1QFOA 5E4AA 4HOWA 3VXQA 1F41A 1CQKA 4L4TD 2VQTA 1JF5A 3DSFH 2JTYA 4AITA 1JHKH 1U21A 2CR0A 1A9EB 4Y4FA 1JXFA 3ZSTA 3NT0A 2OTWB 4X6BA 2IWGA 5CN3A 2AQPA 3NZHH 3DURA 5AVWB 3FT2A 4Y5XB 2HLAA 2OMZB 2BNQE 3ARFD 3ZGIA 4KUZL 5DD3L 1W0YT 5TD4A 2Q20A 4QRPD 3K0YA 4UM9A 2VM3A 2C3HA 1N68A 2MSPA 3K2KA 3KPLB 2XG5B 4BZYA 2IIJA 1BVKA 3FYIB 5I9QC 3SHSA 2FBRA 3RDTC 2GTZA 1EXUA 1J10A 2Y5EA 5I8EB 3MRCA 3ZE2B 1H3TA 4GXUM 3RWIA 3QUML 1T2QH 4J8QA 2KH2B 2E8ZA 4EBQL 1UB6A 5D7IE 3KXFE 3CQFA 3POHA 3ASOB 3PFUA 3GMMB 4LKCA 2H2SC 5IOPB 4W9EC 3QJQB 3T0XA 4FLQA 1CXLA 1M3IA 3P0VH 5FX3A 3BI9X 4X5XB 3LXAA 3DHJA 3CPLB 3BQUD 4RAVA 2RFXB 4OD3H 2Q3XA 1QI5A 4OD1H 4AUJA 1U8CB 4AWJC 2LFGA 3O3AB 3GHPA 4YLCA 2HRLA 3ARZA 3EYUL 3NDYE 2FRGP 1GZHC 2CAKA 1CIDA 2AABL 4HFWB 1E3FA 1OZTG 1Z3RA 2AJSH 3VD3A 1XD1A 3WLWC 1D6VL 3KNBA 4LPVA 3ULVC 4WJKB 5EDXA 2Q2LA 1II4E 4KQ3H 3BUYA 1L5GA 4GG6E 3LZQA 4ODTH 2PP8A 4IOIB 3VJ6A 3BHBB 4BZ2L 1XR8B 3PGFL 1AO7A 2VDLB 2JXMB 1A4CA 1YYMH 4AE1A 2FQGA 4JRXA 1HDMA 5F2FA 3NA9H 2DWXA 1V5JA 1K9TA 1EDYA 1U9KA 1F2XK 1BWMA 2D7OA 3ZW3A 1ZKAA 3IVKA 2GPZA 1B4RA 3CFJA 4L9DA 3GWJA 1BLNA 4ANVA 1A22B 1YC8A 5ELIA 1AGCB 1IZJA 3B1UA 4Y4FD 4ZTPL 5FYJH 5KSAA 4ZQKA 1TVHB 1WCBA 1T0MB 1QI3A 3ULUF 3A3YB 1UASA 3FBQA 2PUQT 4RGNE 1Y0LB 1RJLA 3QORA 3KG5A 3IGUA 5BXFB 1YG9A 4F3FB 4NZRH 1TMQA 2V37A 35C8L 4FTVE 4R7NA 1PZSA 4UM9D 1DFBL 3DA0A 3MLXL 3HI6L 4GAFB 4JRYE 3RB7A 5LAPA 3LN4A 3LN9A 4X8JA 4G8EB 3VD5A 4PJ7E 5I8KL 5AG8A 5L88L 3T77A 3GK8L 4WNSA 1M9WA 3PDOA 2XWTA 2JJUA 1AXSA 1XCTB 3RPBA 1ZGLP 2AFNA 1TTCA 3CFEA 1OY3B 5KSBF 3RVVC 3WIAA 1CT8A 5IUSA 2CLVB 2XWRA 5AKRA 3L1OH 1IEHA 4XNYL 5KSBB 1EO5A 3W37A 1E5ZA 1ZXQA 1NJ9A 1V3KA 4GMSL 3D39E 4LHUB 1XF5A 1EEZB 5C2UB 3KYMB 3P1VA 2WLJA 4G7QB 1FJ1A 4IJ3C 4NLAA 2N7SA 2KDYA 4HJTA 3TYGH 5JDJA 1NGZB 2XPYA 4XXDA 1FLRL 1MY5A 2IH8A 4LPTA 3SKMA 2WUCH 3WFHB 4RMBA 3V0JA 2G4EA 2L7QA 3ZX1A 4AC2A 1YUKB 2CD0A 3EYOA 1M3JA 4ZK8A 3MR9A 1GC1L 4JKKA 1QWNA 1HINH 3AB0B 1WAAE 2DQFB 3PV6B 4LCCA 5AVZB 3OZLA 4MMZA 1D5BA 2PF6A 1MDTA 4PJHF 4JO4H 5A7BA 1AO7D 5L6YH 5CEZE 2R83A 2KZBA 2DEYX 5I1LB 4XBPA 1J5OH 4W9FC 1KJ2H 1M2VB 1ZK5A 4PJHB 3FBKA 3U4EB 1FNLA 4JRXD 4ICWA 2ZKMX 3U6XA 1G4RA 3Q6FA 1KBKA 2XN9E 4C4KO 1H6EA 3HLAB 2GBUA 4KHTL 3KBEA 1PIGA 3GXPA 1RJCA 3CHRA 3BLBA 3CUPB 3FCBA 3NVQA 4IIQC 4RVBA 5KSAD 2HT4D 3LYRA 1A6UL 4NQCB 2QEJA 3Q5TA 4UTAH 3DX7B 2YGQA 2WLKA 5LVEA 2IDTA 2W94A 1RP8A 3QORD 3LKPB 5ITFB 1U95B 3B6SA 2NY1C 3PIQB 5BVJB 3K81A 1QTSA 4RA0C 1SHSA 2ADGA 3F84A 1I85C 3QPXL 1QZNA 4X6FB 4XPGH 5KBKA 4TF4A 4MAYC 4LFHG 3WDJA 4N87A 4HCFA 2RBLA 4QLRA 3SEPA 3ZXAC 2P8LA 4BK4A 1CFMA 4ZMZA 3RFZB 1ASQA 4LEOB 1XO8A 5F97E 4IRZH 4QAMB 1OE1A 1JPFB 4PRHB 2OX5B 4ZD3H 1TETH 3V8OA 2Y1YA 4RISH 2D03L 4I9XA 4LGRB 1MVYA 4O9HL 4ERSL 3V4UH 2A6JB 5AD0A 4WV1C 1CLZL 4FXGC 4WW2F 3OKNA 4MCMA 2NYYD 4U1JB 5TQ0L 2BXYA 1TEYA 2DQ6A 5FV2A 3KYNA 4OLWH 4WW2B 5IMKB 5FW8A 4F9LC 5I6LA 1IJ9A 1CGXA 3SKNA 3BIAX 4UB0H 4IU3A 3VXRB 3Q48A 2EDEA 3BDYH 4TTDC 5DQ9A 5A43C 3DIFA 2IANA 3O2DL 1S7WB 4UQ2B 1SJEB 1U8LB 1PZUB 3GRWA 3LKSA 1T1YB 3AM8A 2F54E 4FADA 3QC5X 4QTFA 2CGRL 2IXQB 2GUYA 5J9PB 1OPOA 1ZLSL 4NPKA 2YD7A 4IGBA 3BWAA 4MBRA 4L37A 1WT5C 2VKXA 3LQAH 5EWIH 4MNHA 3QJXA 2RGSA 3D5OF 4FI8A 1WPCA 3CXHK 1MFUA 5FF6A 5E1QA 3U6XS 3D2TA 5TK2A 2WVSA 2ZYHA 3QO1B 5AUMB 4TNWF 4C83A 4PD4K 4YUEH 2R29A 3BEWB 3MNVB 4QGYA 2YEZA 4DO4A 2CDEA 3CAFA 1JD7A 1BBJB 2QQQA 4K8RL 3RZCC 4K2UH 4B96A 3CQQA 4YVNA 2ZCLH 2JI2A 5EEZA 4I2XA 2D3NA 5EOTA 4LKXA 3GO1L 4KGJA 5CNHA 1UM4H 3QXAB 2IOIA 4KRPD 4BKLA 1QUNB 4XNDA 4JJ5B 3SGEH 4KJYB 3QXDB 4XRCB 1N5AB 2BP0A 3EH1A 4Z8FH 3T2LA 1R3HB 4XVUD 2ALWA 3QUMB 3TCXA 3DXAE 2WLIA 1T7ZA 3A67L 1KT2A 5IB1A 1U8KA 4M5SA 4YBQD 3LNIA 3F6JA 2J1YA 4P9HC 1H9VA 1MAKA 3OAYH 4MDIB 4AX3A 4OLVH 2W0LA 4XP4L 1P6FA 3QISA 4MCZB 2WYHA 4OJDH 5CEXA 3B2UD 1A25A 2FBOJ 1KGCE 3Q8CA 1OW0A 2HX7A 1FHNA 1GSMA 1MLBA 3ZHNA 1DLHB 2GFBB 3GD1C 4AYDC 3QRBA 4PH8A 1A1NA 2ZXBA 3H0TB 3QI9B 2VGLM 5FKPA 3LZPA 1LEGA 2Y5TA 3CVHA 2DQTL 5E6ZA 2AJYL 1KFAH 3DLQR 5E4EC 4YDLB 1S3KH 2WUBL 4KNSA 1WA2X 5F21B 1XF2B 5CGYC 3EFDL 2Z65C 3BUBA 4H13C 5EIVA 1J5DA 1WZ1H 4ZPVB 4LDLB 5IMOB 3T8MA 3L7FB 4EUPB 3RIFF 1L0XA 2WOBA 3QA3A 4GEJA 2R9HD 4WUUB 4Y5XC 4DF9A 3NSDA 1JDCA 4HG4K 4ODVL 2JCCB 4PJBE 2FB4L 2NX5A 4K7PY 5E6IC 1OD9A 3VXUE 1EJOL 1HEHC 2CG9X 1F4YH 4JKMA 1DN0A 2FJFB 2D31B 3Q44A 2IAND 2IAMB 2CLRB 3ZKXB 4BA8A 5CSGA 5DHEA 1NIDA 4XMPH 1IGML 5HYSG 4BH8B 1YEFH 3FRPA 1OEZW 1S7VB 4XPBL 3ZDXE 1F6AA 1J12A 7TAAA 4IGBD 4OJYA 4I3SH 4L4JA 2VIRA 4BQBA 2EVGA 2GT9B 4BBWA 2XX0A 1LILA 2WXLA 1KXQA 4NQEA 4MJ2A 4YHIA 3ZT5A 3QEQE 4P3DA 5CZXC 1W91A 2FJGB 3MOAH 1YEHH 2OZNA 3VGGA 1T89C 3OAYK 5DZJA 1FVDA 3MRPB 4G7VL 2EE2A 3UIYA 2XXMB 3FB6B 3OLDA 1IGJA 1G5GA 1X5AA 5I66B 4R84A 4N8UA 3DIVA 2DLTA 1JRHI 2BJML 3CFUA 3OAUL 1FZKA 4P3CH 5TH2B 5F7AA 1HYSC 3MLTA 5D1QE 1CK0L 1FGNH 1RFDL 2OXGA 3D85A 3HUJA 5DFVD 5GS0D 5LNGA 1BIHA 4I13B 4JPQA 2KLTA 1WBZB 2MHAB 1I9JL 2DWEA 3JV4B 1RZKL 1LD9A 4Z7VA 1F1AA 5FGBA 5I1EL 1KWGA 2J1ZA 4YSAA 1J05B 2VN4A 4XO4A 1YMHB 3LX9A 1ZSDA 4QHUB 4ZFGL 3GSRA 2LV4A 4PRNB 5C0BB 1YYLL 1CIUA 2G0KA 3BQVA 5AW2B 1LP9F 4PS8A 3S88L 1EBPA 2P45B 1K6QL 1TZ8A 1KY7A 1UB5A 1LE5A 4HWBH 4XNXL 1LP9B 3CLFL 3G7TA 5DI8B 3QNXB 3BGMB 1ZVYA 4B5EA 1P9MA 1NCDL 1NKOA 2OFQA 3RKDC 1KUMA 2XJLA 4MMXB 5I1CH 3UP6A 4PW3A 5HGDB 3GSVB 2UZIH 5B1KA 2F6AA 2CJUH 2J12B 3GIVA 4L4VB 3ZHFA 2BOBB 3BAEL 3MRLB 4XC1L 1OGAE 4KVCH 4U6VH 1EK3A 4G42A 3NH7H 3QR1A 5CMAB 3B3IA 4ZSOB 3JTBA 4ZMPA 4WEMB 5GJTH 2NX5D 1ZTMA 4RFNB 1GGIH 3UX9B 5D6DC 3X2QB 2AMGA 3JWDL 4GKNB 1KTBA 2F7IA 4R9HA 2ZXWB 4R2GB 4JQXC 3DJRA 1SYVA 2GC7C 2KYIA 3GGWA 3L2MA 4L4TE 4F8QA 1RUQL 1V3JA 4TRPH 5E2TH 4DOHB 4M4RA 3BZEB 3OJVC 1SF3A 4R4ND 2E59A 4B9GA 2NY5C 2R2CA 2DJMA 3OXRB 2AXGB 3GBEA 5ID0B 1QWUA 4NQED 4EKXA 1MW2A 3UADA 1IAIM 3A0OA 2APBA 2BOCA 4JG1L 3HE7A 1E6OH 4HGKC 4W9ZA 1B9ZA 3WIIL 1FL3A 2DIAA 3LHPH 4H8HA 4QRPE 4Y5VC 3TEUA 2R1WB 2W38A 4YE4L 5AOKA 1CFQB 3DKHA 4W9IC 4L2LA 2UUDH 3IWUA 4WVRA 3Q5OA 5KVFE 4NCDA 2GSGB 1HH6A 2HTLC 3E0GA 5J56B 4I88A 4RMVA 3IFNL 1ZT7B 3D85D 4EIZC 1EAOA 4ODSL 1NANI 4UAOC 2NZ9C 3R4DA 4NKIL 4NXKA 2XG4B 2DRUA 4KC3B 4K23H 3KWTA 4JHWL 5FS5A 3IDMA 4OIAA 4X4MA 1T04A 3AB0C 1A6AA 4N2AA 1LEKB 4ZFFB 1DJYA 1KGIA 4TQEL 2XQ0A 3IDJA 1CLOL 3VXSE 5DS2A 3ZIYA 3ARGB 1QZ1A 4NX0A 2AKRB 3FTYA 3P3RA 4O02B 4XZUA 4CADB 2BSBA 1WO2A 1R5IA 3GIZH 4FG0A 1AHWA 2AJVH 4H8PA 2DQDL 3OKYA 5IBUB 1EO8L 4HCIA 4Z7OE 1Q1JL 3II2A 1THAA 1ADQL 1GY1A 3HOGA 4UOQA 4ELME 2A6IA 2FX7H 4ZMYA 2G5UA 4IMKA 4OCWH 5EN2A 1TSRA 1CN4A 4OCYH 5JR1H 1WBXB 2FH8A 4FNLL 4TOYL 5MHSD 5IREA 1WWBX 3W5NA 3KLHC 1R3LA 4MWFB 5EC1A 3MV11 3NSXA 1Z0MA 4C57C 3H3BC 1XSJA 4U0QB 2XZCL 4FQXA 4QXWA 4R90H 2CO2A 2FNWA 2UUDK 2FWOB 3BMVA 3DJTA 4I8DA 4LEBA 4RWYH 1FCCA 3MACH 2CGZA 4J3BA 1KTLB 2R2EA 1E4KC 4HS3B 3KW7A 3C8DA 5E8EA 3V4PL 1L9SA 2YBRA 3BKYL 3O4LE 3TWCL 4GUOA 1MY7A 1T0PB 3WL9A 2NCMA 3TEWA 5I74B 3OWRA 2WNGA 3IKKA 3VFPA 3TBBA 2YO3A 3NIDF 4P46A 1FE8L 4F93B 1YNTF 2CIIA 4HKBB 3CC5A 3LNGA 4JO8A 4L5FE 5J1SC 1J1XH 5I16A 3HE7D 5AW4B 1YNTB 4XMKH 1OAKL 1AXTH 1L7IL 2C3XA 4D0DB 3F6LA 4OKVA 4BE6A 5DQDH 2BHZA 4C56A 2WBWB 2R0KH 3RUGA 1RZPA 4YHYC 3FKUS 1H6FA 5B1JC 3TNNB 3FCGA 5ANHA 1CICA 2OMTA 1JFQH 2AGJL 2WLHA 3VXMA 5DJ0A 5LG6A 1N5YL 3TBVA 3D87B 2AV1A 3CSYA 1DQJA 1MI5B 5F96H 1NMBL 1NUGA 2D9QB 4TLSA 1YEGL 4QGTA 1NFDF 1OAXH 3US1A 4KMTL 4XWOC 3ZMNA 4RH4A 3RVUD 1NFDB 3RWFA 5DVPA 3L1FA 2O93L 2IQAB 1MPAH 4U1SA 3UTOA 4U1IB 1DBKL 2X12A 3GSXB 3Q06A 1KLUB 4LSVL 2HUEA 5GZOC 4BWWA 4BFIA 5JIMA 4QCIB 1CXKA 4UM8A 1I1RA 4WO4A 4H8WC 4TUKH 1U58A 4J12A 5T1KA 5HVFB 1MJ7H 4G11A 3QFGA 3NJFA 1I7ZA 3JUZA 2H2PC 1A3ZA 4OB5H 5ALBH 3ZLQC 3RG1C 1NLDH 1IC4L 1XGTA 5E8DH 3VGHA 3HS0C 3HMXL 2DF3A 4BWTA 1JYVA 1OSZA 1D2OA 4NKOA 3FQXA 3GPSA 4QF1A 2BWIA 2P26A 4TLKA 5D2LF 5GPRA 2OXHB 1TXKA 4I89A 4P4RA 1A9BA 3QEGH 1P4LB 2DJUA 4JS7A 5EZPA 3CZEA 4CSPA 2HWZH 4JRXE 4LDOB 3S8WA 4FQXD 5D8JH 3Q43A 2X0VA 2MEJB 5EEWA 2VDOH 3MCYA 3RDTA 1X5JA 4X4XB 4KK9D 3D08A 1UZGA 3QCUL 3MO1A 2ZOOA 3GUFA 2G5BA 1CGWA 1S6NA 3KPRB 5I0WA 1G9HA 3QI9C 4G83A 1NBCA 1OXYA 1PG7X 1QBAA 1BAGA 1TTUA 1AXIB 1XZ0A 4P46D 3RWDB 4HJ1A 3RNQB 3U9WA 2JK5B 3MGOB 2EZ0C 2PYEA 3UZQB 3H3PL 4YDLC 1BEYL 2WWMD 3QEUA 5DVMA 5K69A 3UYPA 1IEAB 4N2IA 2A0LC 4P5TC 2IV9A 1ZS2A 1JS4A 5L4IA 2VZSA 1HHGA 1M9SA 2GITB 1VAHA 4R6UA 1YECH 4KX8A 1Z9SB 1UOVA 1VCBC 3TESA 2IFFH 4KMLB 3I9AA 4NQDB 4C56D 3ARSA 5FCSH 3UJJL 5DYFA 4NEHB 1L9TA 1GZHA 3T0AA 3X13B 1NCBH 3N1PC 3BKCL 3Q9PA 4IEFB 2IAMC 3QC6X 2NTFB 5I30H 1FC1A 2WKLA 1CICD 3BRGC 4J3SA 2O61B 1J48A 5HI5C 5HJ3A 3VRLE 3VXMD 4RSYA 3KYAA 1RZFH 12E8L 2OJZH 3SOBL 3IFOA 4CUCA 2DH2A 3D48R 3MRQB 2FCBA 1GKEA 1CFSA 3BE1L 1NICA 1PSKL 1WS7A 3WAKA 4GKZB 3VGFA 4GXVL 1KPUB 4WGKA 1OLLA 3FPYA 3MJ8A 4UANA 2XHNA 1ZLVH 2H5UA 15C8H 1KYFA 2ZUSA 5EZLB 4Y1AB 3UAFA 4JZJC 1H3XA 3B56A 1BDYA 5CLTA 1DLFL 1I8KA 4S1QH 4M00A 1R0AH 1H5BB 5H94A 2P46B 4M62L 2YK1H 4TL4A 5HHXH 5A6LA 4WO4D 5E2VH 1S7XA 2R7EA 1F5WA 5T1KD 2BS71 4K7FB 1UJ3B 4PJ6A 1GOGA 4KTDL 2A74A 1R3JA 1NL0L 1HOCB 1YUHA 4GLRI 3T0VA 4ZW6A 4LLMB 4BDVB 4LOFA 4RAUB 4PWFA 2EXWC 3WIHH 1FBIL 4S1SL 2X88A 1QBMH 2AK4A 4TNWK 1NGWB 4M9OA 1N70A 3HRPA 2SEBA 3VXSA 2XZZA 2W0FA 3THMH 3FK3A 3DSNB 2A9AA 4GKSB 1ZA6A 2XWJB 3JVGA 4PIRF 4NZUH 5LAXB 3RGVA 1H3VA 1N10A 1AC6A 4JDTL 4Z0XA 1G1YA 2NY7H 1SJVA 1KF9B 1IT9H 3F7RA 3E6FA 4PREA 1G7PB 2DWDA 1WUZA 4D3CH 4PV8A 3RDTD 5LN8A 4GY4A 4LSTL 3BSHA 3GMOA 1CVRA 3KJ4B 3GSUA 3GBNH 2VITA 4OF0A 2OSWA 1Q0EA 3FH7A 2E76C 5B8CB 3SGKC 1LDSA 2O4EA 3ISRA 4DUXA 5IFJA 1GYCA 2PYED 3IMTA 1OWRM 2H3NA 1A7BA 5CU5A 5B1BB 1QKZH 2H2SD 4I9WD 3S9DB 4XVSL 3NESA 3AQXA 3P73A 4JFHD 1JXKA 5EO0A 1ZLVK 2VRAA 1DQQB 4HGWA 4CVZB 7PAZA 4FLOA 1PW3A 1UFUA 4IRSB 2H6UA 5IKCA 1EZVY 2X4UA 2CO4A 2VDPL 4Y19A 4XNUH 4AXWA 5IESH 5JXEA 2HRHA 2W0PA 5GJSH 2B16A 1KBBA 2ZXGA 4R2GC 3GS0A 1NCWH 3ZZLA 1VFAA 1TKWB 3ULVD 3ZQWA 2E6JA 4EIBA 1UEMA 1DE4B 2GJ6B 5MEQA 4YX2H 2EXTA 4LBEA 1XIWC 5F7WC 4D9QE 2Y36H 5CJQL 2AERT 5FFGA 3SBPA 1PCSA 2ZP9A 3DO3A 2PPEA 4D8PA 1CU4H 5JHLL 1T5XA 1HJBC 1Q9KB 4MXQC 5DUBA 3V4VL 3ZKMC 1UH3A 4FEIA 1J1OL 3QRGH 2IANE 3QBTB 3HPLB 1FI8C 1ZDQA 3AU1A 3RA7L 5I1HH 5AAMC 2R0WH 1EMTH 1BF8A 2JB6A 2O6PA 2VERN 5KAQG 4ZAKA 1H15A 4G43A 1JF6A 3V4PB 1QRNB 4P4KB 2FBJH 1X6NA 1QSFA 3KPOB 1MLCB 3V6FB 4IIQA 4XWGL 3HHSB 2AK4D 1YY8B 4GMTL 2FATL 2HA1A 3AJ7A 5B7EA 3VXSD 1MAJA 3BDBA 1A6PA 1AHKA 1L3NA 1F3DH 2WSPA 4QOKA 4UQCA 3RGVD 3QG6B 4EIUA 3L9EA 4RFEA 3UROR 3KJ6L 5DURB 3ZKQD 1H19A 2ITEA 3ARGC 4OGXL 1KN4H 4MAYA 1J11A 3OKLA 4I2XE 4PV9A 3V5DA 1Y18A 4I0PB 2ZOUA 2NXZB 1MCPH 1BJ1H 5CWSA 2HH0L 3OM3B 4PBWD 4QWWD 3S36X 4E5XG 1M7IB 4ORZC 5HDWA 2VSCA 4GXUN 5JIIA 1BZ9A 4Z77A 5FO8A 1RULL 3RVVD 2WP3T 3QR0A 2YD6A 5DEFA 4FXGA 5JPNA 4U1MB 2JB5H 3KWUA 3BAXA 1ASOA 3W9EB 2DBLL 4GSQA 5FR3A 5JMRA 5LWYL 4YXLH 4BQ9A 2DMKA 5C0AB 3V6ZB 4N2HA 3ZDZF 5DJZA 3GHEL 1VGEL 4F9LA 4LCYA 3D9AH 2VDQL 2A1WL 4XMUA 3ZDZB 2J88L 2BLFA 5KN5B 3OJDA 3RB5A 5I1AB 2IADA 2IG2L 4P2QE 4Y19D 5DMYA 1F90H 2H45A 3IAPA 5JXED 1J9TA 1GXEA 4F9PC 4TTGA 3WNOA 1SYSB 4MD4B 5I0DA 1S9XA 2CWRA 3H1ZA 1QYGL 2XQYG 2F7PA 4JO3H 1WT5A 3FH8A 3TCLB 5DUPH 3NJLA 1BGXH 5GRWA 5AAWA 5B3JF 1IX2A 1UXWB 3V0HA 4Q97A 5FO7B 1FZJA 1KGUA 4G6FD 4GXFA 4X5WA 1SEBB 4DNLA 4F7EA 5PCYA 2EE0A 4RQQA 1ZHNB 5IHLB 3DX0A 4A7GA 3JV6A 5B7FA 2NX5E 3JWOH 1JHLL 4PGCA 2O72A 3VD2A 5TFSH 1GZQA 1ZVNA 1W15A 5KEZA 1YCSA 1GGYA 4YQXH 5K9QG 2IPTH 5C9JA 3PL6B 3PWUB 3SDCA 1AAJA 1RUMH 4PJDA 1Q38A 2BMKB 1ZV5A 5JNYB 3L3DB 4HMDA 3VWJA 3FN9A 1UKSA 2Y06L 2YEQA 3T6VA 2AXJA 1WGOA 5DMJB 1AD9B 1Y7VA 4R7VA 1QFWL 1SY6H 1XH0A 1QSFD 2XPGB 3P3SA 2OTPA 3AT0A 1KXQE 3ML8A 4NZTH 4TPRH 2UV3A 4J3UA 3SYQA 5HY9B 3EYSL 4A6YH 3VI3A 3K74B 1PDKA 1J5IA 3IPBA 3QUZB 5T3ZD 4QOKD 3U2SB 2NY1D 5FYKL 5HPMA 4OCRL 4NO5B 5E8PA 3LZLA 3V2AR 1NC4A 1O6SA 2FO8A 4IM8A 5ADPL 4MAYD 5A2FA 2F74B 3QWNA 1BM3H 3C5JB 3GZQA 1ZOXA 3HUJE 5DWUH 2Q7YB 4AIOA 1OARH 1SZNA 2CU9A 1JGEB 1KELL 4WEEA 4Z7VE 2RCSL 3B7SA 1I1AB 2HKHH 2OR9L 3EYFB 5JDSB 2Y0SA 3B9DA 1IM9B 4F7PB 1D7CA 1M6OB 4ZUSA 4NENA 4QTHA 4LLWA 5ITBH 1CUOA 1RURL 3TH4T 3ZKNC 3N40F 4PBDA 2LTQB 2WKOF 4N2EA 1FGVL 1U8OB 2Q8BL 3Q8FA 5E6IA 2HFEA 2RHEA 1CO1A 2VDKH 1O0VA 3I3EA 2BHYA 3IFPA 4TTDD 2F61A 5KYWA 3T2NL 1C12B 2JF1A 3VRIA 3CDFA 5MENB 1FNGA 3DOSA 4CU8A 4K9EL 3VRJA 3V7MA 1AQKH 4UU9B 3JT0A 1MFEH 3KLQA 3IGLA 4W70A 5MHSE 3WD5L 1H8SA 3MU3A 1DSFH 1BAFH 5FAAA 2MNUA 3GF8A 4UT6A 4PRDB 3B4NA 1RJYA 3Q9QA 4HWUA 4MVBD 4G6JL 4F7TB 1YHPA 3RZCD 3I74A 1NSNL 3GXFA 4OI9A 5DMIH 4MB5A 3DGDA 1A4KB 1T20A 5MP6L 4NIKB 4BWUA 3H2QA 1ZA3A 5CCKH 5F7UA 1E2WA 4JUSA 3SDCD 4QY8A 5HDOA 4XHJC 2X2HA 5D1XC 3VG0H 1AJ7L 4WWOA 3QAQA 1M4KA 4JEGB 3VWJD 4Z76B 1MW0A 2KLRA 4KFZC 1JGLL 2CLZA 2R27A 3GSQB 4X4KA 1E9PA 5DFWH 3SPVB 1YMMA 2G9KA 1XGQA 2BP8B 2X4OB 4EI6B 2BM3A 5KW9L 5BRZB 1LNUA 2CO6A 4PCSA 4JL2A 1NBYB 3VX1A 1OAUL 4Y89A 3RILA 4P5MB 3LDBC 3LIZA 2R8SH 3TO2A 1PIFA 4U2YA 1IZKA 1NC4D 2HJFA 2XCMC 3LZFL 3T1WA 4FQLL 4OT1L 2IGFL 4X7SH 4PP1D 5C0CA 4BEIA 4CJ1A 2DKMA 3EYVB 3AITA 2VDPB 1U8QB 5E56A 1M42A 3LRSA 3V4LA 4E5XA 4K94C 2AQ2A 1LWRA 1FCGA 1LYQA 3HI5H 3JWDC 4FNTA 4QHNA 1YEEL 2P24B 3HCVB 3S96B 2CHXA 2X7LB 5IFHH 2F5BH 1G1KA 3ZRFC 2Z92B 3JTSB 1EZUA 1U3HC 3D2UA 1IBGH 5CILL 2H3KA 5IHWA 1ET8A 5KJRH 1AGFB 2X1XR 5GHWH 5CGYD 2GG1A 1H8NA 3K8KA 3OQRA 3BXNA 4AC4A 2DL9A 3O6LH 4ZFZA 4YSDA 5G2NA 3FB8B 5DRWB 3MRKB 1EFQA 5E6ID 1CLYL 2KHAA 3TBTA 4FMVA 1C5CL 3C9NA 3V4VB 1Z3GH 2P52A 4KO7A 1MSPA 4B9IA 4DGYL 1EFXA 4X6CA 1IEBA 4JQXA 3C2AH 3N2JA 1W72L 1I4FA 2XQYA 3DIDA 3L3HB 3EOYG 3U7WL 4DEPB 3KJ4C 5T1DH 1AGBA 1WZKA 4N0YL 4X4YA 2J2ZB 5B8CC 2ED8A 4J1UB 3QR2A 4QNPE 5KS9E 4UDUB 4PGEA 2BRQA 3HTLX 3LKQA 2O6EA 5CZXD 4AQAB 4Z5RA 4HC1H 4Y5VA 5DSCB 3E2HB 3HJEA 1MRDL 4HHAA 4EUPG 1P5UC 3JUYA 4LMQI 1DANU 1GAFL 1RVFL 3GDCA 4J3OH 1FDLH 1J1PH 2G9HB 1CD8A 3FTVA 4G8FB 5F7MC 5BRPA 2DKSA 4JFDE 5TDOA 2OMVB 1MWAH 5KVDL 1RIVL 5C70A 1BXUA 1HYSD 4CVXB 1WWAX 3JZYA 3DVNA 4UOW0 2IWEA 4G8AC 4IIZA 3S97C 1MAML 4NQVA 3OC5A 5F89B 4PWHA 5GRYA 4C4KT 1YMMD 1G7QA 3KE0A 2VC2L 3BLPX 4OM0L 4EMZA 1JNLL 1ODAA 4M43L 4IDLA 5CEYB 1FC2D 2VAJA 5EU3B 1DQDL 4J8RA 1D5RA 2Z31A 2V7NB 1KCKA 4GBXA 3E6HA 2VQ1B 2JKWA 3EH4B 5EBWB 1IC0A 4C56E 3L5HA 2OMYA 4RZCA 2ICWJ 3CQPA 2DM2A 5C0CD 3JWNH 4EN2A 5E6YA 2NY0C 2B4CL 4PTTA 3ROOA 4F5CA 5IGXH 3VXME 4CW1B 4DQOH 1GW6A 1ONQB 5DHDA 4X5RA 2FWSA 4LESA 4X6DF 4QRRE 4GSDL 5SWZA 2RALA 3D2UD 1YDPB 4P4KC 4X6DB 5MI0B 3VUAA 4JFEB 2CDFB 1L0YA 3BW9A 3LV3B 5I0YA 5AOMA 3RX8A 5JIDA 1PG7H 2YUXA 5C0RH 3RWEB 4V1DA 4UT7H 1X5XA 1LEIA 4XOEA 4JDVA 5I1DA 3RRQA 2NW2A 3K6DA 3IBOA 3EBGA 2Y25A 4PRPB 1UACL 5CHNA 1OP5H 4RRPM 4AH2A 2IH3A 1RMFL 2YD3A 2VWEC 2VT0A 5E7FA 5FC9A 1CF8H 1EFXD 2X2JA 3LXCA 3OGCA 5GXBB 1E4KA 4AG4L 1CDCA 1I8UA 1J18A 3PWJA 3US9A 4BA0A 3FNKA 3A6CH 4RESB 4I0PC 5B7MA 7FABL 3GMQA 4GKOA 4ZPTB 3X14B 4ZS7L 2IF7A 2FJHB 2M1KA 1C16A 2AQTA 4J6RL 4XH2A 4ISVB 5DJ2B 2QL1A 1Q9WB 4KK6C 4NS0A 3LHAA 1AZVA 1HCFX 4LLUB 2APVA 3QK0A 2V4LA 1CGUA 3KH3A 4ZFOL 2F2HA 4IBSA 2V33A 1RK1A 3F00A 5C07A 4AZUA 3TTSA 5ESVA 1GYWA 2KKQA 5FUOL 5GRJH 1N9PA 3TX4A 5B3NA 3VQMA 2HTLD 5E00A 2ZAGA 1NMCC 3P4LA 3NUKA 4HIXH 3HG2A 3AW5A 3HN8A 4ODHL 4GIPD 2BVPA 2PYFB 4NHUB 5EBLA 4ZBJA 3LH2L 4CDHA 2NZ9D 3T9WA 3B9AA 1ND0A 3RYMA 4LVEA 3N41F 4PJCE 4TV3A 1HXMB 1SOSA 4JPWH 5FV1L 4I9WE 3BSZL 4R4BA 3G5YB 3N41B 1XL4A 4JFHE 4CGUB 3TBSB 1JN6A 1T66C 1IRAY 4JHAL 4LGPB 4PJ8B 5AKSA 2YGNA 1CPUA 4GBXD 3IJEB 4ZODA 1HK6A 3D18B 4NQSB 1HQ4B 3V5KA 1F3JB 1T1WB 1C5BL 3AT8A 4A39A 4YWGL 1OP5K 1S9VA 1VIWA 1RQ5A 3MRNB 5D1ZC 1INDH 1JGVH 3AG4B 4DPRA 3QJFB 3BYYA 1B3IA 5L7XH 1X3DA 3BT0A 2MTAA 5BRQA 4XX1G 1UZ6F 3PL6C 4PJAA 3ULVE 2F7OA 2XQBH 3FULA 4PRBB 5F7LB 3LS4L 3DTXB 4PJIA 3ARBB 4B53A 4HQQL 5IB5B 5SWZD 1E8WA 4W6WB 1H0DB 1U30A 3QIBC 3SQBA 3HS0A 3UYRL 3QDAA 5E4IA 1GIGL 1WHOA 1KCSH 2BVYA 4V1DD 3ZKSD 5DYOA 3QH3B 3MKKA 2NYZA 2VR7A 1G1CA 3QUZC 1N8ZA 4RGMC 3WFDL 3MV7B 5L4JA 1XT5A 5INCB 3KLKA 5IBTL 4HUWA 4HMCA 5AL0A 2GYSA 3ZR5A 3ZZ1A 3OMNB 4K3EL 2R39A 3NIFF 3QQ9D 1T3FB 3T09A 3WY3A 1U3NA 5JHBA 1HKLL 3GPEA 8FABB 3FFCA 4LSSH 2GQHA 3NIFB 3H0TA 4DGIH 2EIZB 4Q2ZB 2QQKH 4MB1A 3T8XB 2GI7A 1JZIA 2APTA 2PO6C 2UYLA 4JPKH 4RZKA 3CG8A 5F7DB 2DTML 1I1AC 1PZ5B 1R5WB 3QP3A 4ODBD 4U3HA 1U93A 3TT1H 3I3DA 1CGVA 4KQ4L 3K2MC 1FQ9C 4P5TA 4X5PA 2H6PA 3MLSL 3K72B 1TZGH 1S9WB 2NLJB 3IDYB 3P4OB 5IBLC 3UDWC 2FSDA 4GOSA 2DQCH 2LTQC 1NGXB 3U7YH 5CU9A 3O6KH 2NOYA 5C07D 2GTWB 3MREA 1SEQL 3FN3A 1KTJA 4DTGL 6TAAA 5I15L 1FZOA 1KCLA 1UZ8B 4RIRA 1DQLL 3B2VL 2P8PA 3RWHA 3QYNA 3V8CA 5F7KC 1I7UA 5TE6L 5BVPL 2GCYB 2FEEL 3GMRA 2XTSA 3FUIA 5E24E 4WI2A 1A14H 2CIKA 3LQZA 3HR6A 5F3BA 1C7TA 3V0IA 2R69L 1IKOP 4HISA 2X4PA 4XGZB 4XWOD 3NQIA 2BERA 4L0ZA 2OCCB 3TC9A 2ETWA 3B8YA 3I9IA 3PU7A 4L1BA 25C8H 1MNUH 2SODB 3B43A 4GW4A 1IGCL 1TQCB 4JZJA 1LTXA 3QXVA 4JHBA 1HZLA 4H25A 4KTYA 4Y19E 1XCXA 1ZS8A 1ZTXH 3NJIA 4ZXBB 3VXTA 4HHWA 2OMUB 4J2QA 4U6XA 3KHOA 2EUVA 2IO5A 4EDWH 4N8VG 3UXFA 1FFNA 1RZIA 4OD2B 4BELD 2LGNA 2IEPA 4BHUI 3H9HB 5A16A 1FH5L 5E1HB 2BHUA 3VXPB 2QMJA 5K39B 1PKQA 2DEXX 3L5IA 4FQHA 2V2TA 5F6IC 2W92A 1W72B 4QXGL 4WI0A 3WKNA 2H2PD 2HFFB 4P07A 4ES8A 4R5VA 1B2WL 3WKMH 2C7UA 3S36H 1A65A 3ILQC 4Y7OC 1CFNA 4KDTA 3CPUA 5J1AA 3RP1A 4XP5L 1DQML 4JL1A 5E7BA 4P0DA 4E0RA 4DP1X 5GGSB 3LKOB 1IBDA 2W07A 1IGTB 4JM2F 1MFAH 2VR3A 3CFCL 3PGCB 1SDAB 4UILH 4TLTA 3FFCD 4JM2B 1L6XA 2J8UF 2QV4A 4UQBA 1CBVL 2I9TA 1YLBB 2VSMB 5DD6B 4P2AA 3LXBA 3SGKA 3U9UA 4HSAC 2J8UB 2D3LA 4Q8BA 1K4DB 5SWSE 5J3HD 3HRZB 1CXEA 3GM8A 2AI0L 2XRAH 5K9JH 2VC2B 3UBXG 3GJEA 5T3ZE 4P5TD 1NFIB 5LGKA 3VFRA 4TKWA 5B21A 2MMXA 4WCYL 5IWLC 3OHXB 1EEQA 3LQAC 2NRDA 1RSFA 2HRPL 5CEZL 3B5GA 3WMQA 3R7RA 4F2MA 3DV4B 4HLJA 1HWWA 4XPFL 4N24A 2WY3B 3HVDA 5DC2A 1MJUL 3WXWH 3OBAA 1GZPB 4TM9A 1U0QA 2YOAA 4WI5A 1CFVL 2VYRE 2XIIA 1RERA 3UAAA 4ZQTA 6FABL 4E42A 1L9MA 1BFOB 5DA0B 5K9OB 4DEPC 1JP5A 1XIWA 5GRUH 3O9WC 3JQOB 4DVRL 4KKBC 2XNAA 1IB5A 4JO2H 3ZQXA 2Q7NA 1QLRB 5HHMD 3SDXA 3DUSB 4JFTA 1DVFA 5FB8B 1PNCA 5AWNH 2HZHA 4JCWA 4LLVA 4P9MH 5AAMA 2ZWSA 3KVQA 3KH4A 1FVEA 2W9EL 3CZFB 4Z3HA 2HX9A 4IKIA 3NCYP 3OKDB 4NRXA 4A7QA 4HJEA 3N1GC 2J5LB 5K1JA 1BVOA 3WTWA 2HJLA 2P8MB 1I1FA 2CHWA 2EXWD 3GSNA 4U05A 4P99A 3UP1A 3NFSL 2CQVA 1TQUA 4OSUH 3U1SH 5D4JA 4YFLF 5JZ7C 1DBAL 1RZJL 3WNPA 1BJMA 4OF7A 5CUSL 3X1BA 5I26A 3RY5A 1UWYA 1FAIL 4JN2A 1EH9A 1R33A 3INUH 3QNZB 2YGPA 4ZFOB 3GEFA 3VFNB 3NACL 1JV2B 4PJDE 2BIMA 5IVZB 3VWKC 3MXWL 4OLZH 5KUKA 4PMFA 2IPKA 3STZA 3HE6B 1UVQA 2ROXA 5HJDA 3T1FB 2F8XC 5EZIL 3B9KB 4NWUH 5K1VA 3S3PA 2H4EA 2MQ0A 4M5YH 3X1EA 1BQHB 3VSQA 1D5XB 5JQHC 1KCUH 3CFBB 4ZDHB 3VH8B 4DZ8B 1D6EA 5CGMA 1QEXA 1QLEH 4O2CA 1QSEE 3MRBA 3VI3E 2NUTB 2TRHA 5MI0C 4KXZI 3WO4B 3WXVL 4MKMA 4Z3JA 3VE0B 3FTSA 4TYUA 3HG3A 4F58L 4IU2A 4BE5A 5HTSA 1Q72H 1T6VN 2VXUL 5IEKB 3OKMA 5L9DH 3EF4A 3VDAA 3TIEA 3FB5A 2ZG3A 1TG8A 2Y1ZA 4UQ9A 4HUCA 4Y5YA 4AEFA 1M1XB 1VA9A 2VERA 1X4ZA 4LPWA 4Y0GA 3DHMA 5J89A 4F9PA 4GAGH 1NFKA 4KQ0A 1K3ZA 2C1PA 4OI7A 1BYPA 4BYHA 2NNFA 5AEAA 3QCTL 1PAMA 4PG2A 3WFCL 5SWQB 2XFGB 4WY7H 4OV5A 1UUSA 1X9LA 5D7IF 1I3GH 2MNWA 1UQSB 1XIWD 2R29H 3Q2LA 4HH9B 4NC1E 2XWCA 1Z0NA 3EXJA 3EBAA 2EC8A 4Y2LA 1U3ZA 2JKXA 4U3SA 3KXFB 4P2CG 3S34L 4Y4HB 5FM5O 2VDNH 3GMLB 3HZYB 1MCHA 1DVFD 1QLFB 4PLOB 4O51B 3EJYC 4F8LA 1ITBB 3T2QA 5EEYA 2V5SA 4MYWB 5T5FL 4N8VA 3KPSA 1DBBH 3RWGA 1V3MA 4M7LT 3RNKB 1OGSA 2AJZB 3D7PA 4Z0BH 3ZMEA 1MELA 3FCTB 1KYUA 1UD2A 1YEKH 3NCBB 3HFMH 2D4DA 4TSCH 2GK0A 4JKPH 2JVUA 1AFVL 1T03L 4AEHL 3ZE2E 1IAII 4GG6F 3BN9C 3M46A 3PREA 2BIHA 1S5IH 5C0EB 1PY4A 4OLUL 1U6AL 3R0NA 1NAML 1A8ZA 5E5MB 3AVEA 4GG6B 4DKFL 3H42H 1HHHA 2DI9A 3GM0A 4DZBA 1MEXH 3K80A 3FT0A 4HJJL 5C1MB 2X9YA 2BFVH 4F33B 2NTSP 2EVHA 2C1OB 5C3IA 5DS8A 1BMZA 1BWWA 1A6TA 3DX2A 4Y16C 2BCKB 1AQDB 4KY2A 1SQMA 4QT5A 5LNEA 2A38A 5T5NF 3R0MA 3QQXA 1M53A 3CVHH 3VFMB 1AQHA 4N0FB 3BP4A 4PGDA 1LK3H 1JUFA 2ZCKH 3SKJH 4B6ZA 1YMME 2BZ7A 3ETSA 4O2EA 4U1GC 4MDRA 1NMAL 4P2RA 2F18A 4AMWA 4XBGB 2N1KA 5F1NA 3UBXA 4OLYL 2MPAH 3DPBA 3TJEL 4AV4A 3WLBB 1ZXKA 2DQIH 4AMKH 4KHXH 1E50A 2X4QB 5EBMB 4G80B 4UQ3B 1K8IB 1N0XL 3SOTA 1K8DA 4HV8B 2B0SL 4YO0B 3FFDB 3QJTB 4RGNB 3LEVH 3MJ9A 3OWEA 5C0CE 4RNRA 2ZICA 4ENZA 3UO1L 2V9UA 2YZ1A 1MREH 4LIQH 5FOBA 4FFZA 4FE9A 4PJ7F 4LNRA 5IOKA 4HIIA 1EAPB 4JRYB 1DVUA 5ES4B 3BH9B 3FHAA 3DDFA 3RI5K 2X3BA 1JDAA 5EEUA 1F3RB 5H2BB 1NCHA 3MNZA 1LHZA 3UABA 3CU1A 4MNGB 3EJRA 3N1MC 1OPGH 4HZLA 43C9A 4KO5A 1IL1A 4X5LA 1RUPH 3IDYC 4YHKH 1G94A 2VXQL 4ZMQA 1BAWA 3ARDB 4X6CE 3KPSD 3QJSB 3OJMB 1Z32X 3L5XL 2R4SL 3OSKA 3IU4L 5D1XA 5TJWK 1OSYA 2FECL 1NEZB 3GLEA 2C4XA 2D4FA 2WWKT 1N18A 1OHQA 1MJ8H 1NM4A 1PLBA 1PD0A 1RUAH 2QPEB 4N0CC 4NFDA 2ADYA 4QKTA 1WAAF 5DXWA 5CSZB 3L7EA 2IAAC 2VN6A 2X4TB 4ODWB 1PZAA 3MMEA 4OZ4B 1IQWH 3ZVVA 1VJSA 3TZVB 4NNXB 3OXSB 3MUZ1 4RMUA 1NC2A 2VZOA 3HC4L 4Y1AA 3TA3B 3E8UH 4L9LA 3WKQA 2WZ5A 3UTQB 3IMBA 3SZ6A 1PQZB 1G7JB 4ZXBC 4LVOB 1YQ2A 1G7HA 2Z7ZA 1NOFA 2E7BA 5IK3B 3EFFB 3CFDA 2UY7A 2DDQL 3V0FA 3V52L 5J6HA 2XN9B 1R3KA 1U3HA 4P2RD 3IRZA 2Z7UA 1NWOA 3SZKC 4K5PA 1KEGL 3PV7A 4URKA 4ONFL 2Q9OA 3H9ZA 4HJGB 4JMXA 4PI2A 3ULSA 1OCWH 1A3LL 4QYOB 1AANA 3GUTB 3QS3A 5SX4I 4OJEH 1XCQA 2XVLA 3P9LB 2X9XA 4QR7A 3QFDA 2FHFA 2ROYA 5KVGE 3QYMA 1XF4A 3Q13A 1JZEA 4XPAH 3E7JA 3KS0H 5AOLA 1GCYA 1R4XA 3U30B 5AKTA 3KYOA 4F5CE 4MJJA 4ZUUA 2H9GB 2R2BA 5KVFL 1JYNA 4FG4A 1WRFA 4IBUA 4B9ZA 1E7UA 5IV2B 3R06B 4JM2C 5IHZA 4ZW7A 3LRLA 5SWZE 1KIUB 4ES9A 3QAZB 2ITCA 2ADIB 4PJGB 5E5UB 3U7AA 4QKXB 2Q3AA 4KX7A 3IT8D 4V1DE 5F3HB 3KAAA 4HK3J 5DF0A 5TE7H 3K5RA 1QEWA 4TNVK 4RGOH 2Y7QB 1VLXA 1BECA 3ATEA 5J1TC 2GJZA 3DECA 1A3RL 1KEMH 1I9RL 1IKFL 1P5UA 4B50A 1FV1A 1HE8A 3OHXC 4NGHL 1P4BL 1SHWA 4UT9A 3X3GH 1IO4C 2WQAA 5BNXD 1CFBA 4LASH 2F19L 5EU5A 3DC0A 4FFWC 4FFYA 2ZZUT 5D1XD 2CR6A 1MFBH 4WKXA 4EI5B 4ACPA 4N0UA 2B4CC 3EBIA 3P2DA 5ICZB 4LL9A 2X41A 4PJXB 5DQJB 4E9QA 2IBGA 3MUGA 1J88A 1ACXA 4GAYB 3O81A 3HNVH 2WW8A 4IBZA 3QFJA 4MQ7B 2WN2A 4KK8D 3BEVA 2XXGA 2O5YL 1T4KB 4ATWA 2EDOA 3BUQA 3O6ML 1P6WA 4PRIA 2L7JA 1NGQH 4Q9CA 3FT4A 2OQJB 4U6YB 5C07E 1NC2D 3CK0H 4JG0H 4Y1AD 3JYCA 5F7EL 1X5ZA 1I3VA 4MSWA 4L8BB 4EXKA 4I4WA 4WU5B 5GZNA 2IWFA 1AE6L 4AYFA 4ORGB 4WI8A 4M8QB 4WHYH 3QT2A 4PJ9B 5AZUA 5AB0A 3DVGA 1NQBA 2A5UA 1E43A 3ES6B 4BHUA 2DMGA 3EHBC 5BO1H 4PRAA 3QHFH 1FFOB 1IAOA 2NUPA 5DJDB 1F58H 1U3HD 2C5DC 4RMTA 3T3PE 4AQOA 1NZRA 1B2YA 3ARYA 1Z9MA 3DX4A 3RU8L 4V33A 3V0EA 1NCJA 2DZEA 1M1SA 5IEHA 1LMIA 3OR6A 5CLYA 3ZZQA 3TP4A 1OAZL 2P5EA 5DEGA 4L5FL 3DXAB 1G7LB 3UTTB 4P5SA 3QHTC 2GSIA 1WCQA 5GGVH 3AFLA 2FL5B 4YDZA 1OTSD 1GJUA 1YYCA 5TF1L 3WIFB 1JMZA 4NN5B 1DDTA 1VF5C 1MFDH 1QPPA 5F0MB 3PLYA 3UEZA 2AQ3A 4JQIA 5FW7A 2AAAA 4PJAE 5E08L 1S78D 4NT6A 4DP8X 1BG9A 2DMBA 2EINB 3HE6C 3MX0A 4PJIE 4IKKA 2RIKA 1KV3A 3B9KC 3F62A 3QJHA 4XMLH 2XVBA 3EJJX 4NO2A 2OZ4A 1QFWM 3HPJB 3T4YB 3S3DB 3JV0A 5I17B 1NAMB 5TGBA 4BJLA 4P2OA 4U6HB 1X5IA 3UJTH 2VH5L 3IXTB 4TSBL 1WAEA 3FQ2A 4PJBF 2QHRL 5C8JB 4M7KH 2MCPL 4TQ8A 3WSQL 2B59A 2NXYD 3MRDA 5TDPA 2Y6SD 4LNVA 3VXUB 1KACB 1FO0H 2VISB 3OHMB 4LEEA 3FFCE 3STLB 4HSCX 3QB7C 1G7MA 3F12B 1NDGA 5IIEA 4ZUTB 3V0VA 5DJXB 3ZDXF 3GJFK 2OL3H 2DIBA 1R75A 4QRUB 4YDMA 1JNNL 3P4MB 3VFUB 1KIQB 1ZV2A 3G08A 3ZDXB 2A9MH 3AZUA 3D52A 3DI3B 2KT6A 5F9AC 1OCOB 4NSKA 4WZ9A 1T2JA 3QFJD 1CD0A 5F6HI 4Y9FA 3X1NA 2QGEA 3O3EB 3Q1SL 4PRID 3QEQB 4Y4HC 1TNNA 3DVFA 4KROC 3GHBL 4HETA 4I77L 1BFVL 5FA3B 5D1ZA 2BOLA 1HFUA 5IHUH 2CPCA 3CDGA 4DP6X 1N3NB 1V7MH 2H1LM 3GINA 2NY0D 1YEIL 3MOQA 5GZND 5ALCL 4LF3B 2J71A 3PG2A 3IE9A 4H8QA 3WN6A 2OSXA 2WWNA 1W8OA 2OSLB 5D1QB 4HIEB 3Q2CA 3QIBA 2HUHA 4GPVA 4HF5L 5HHME 2P5ED 1RIHL 1EDHA 2GHZA 1A7OL 1PZ2A 2EH8L 5INDB 4KX9A 1T1ZB 4B0MB 3K0WA 4QRTB 2X28A 2ZUQB 3BOVA 1G9MH 2YQGA 2IBZY 4GNKB 2JSFA 3BIKA 4XC3L 4Y4KB 1PKQE 2A6KA 1BX2B 1CE6B 1UENA 1X7QB 3BX7C 4QHKI 4DP7X 3ARTA 4OGQC 3FQ1A 4FJ6A 3E1F1 5MEPB 4XVJH 4I5BA 1UWEH 4XMZA 3SODB 4KK5D 2PO6A 5HDRA 1S9YB 4KK6D 2Z4TA 5JOFB 1M71A 4R26L 1X5YA 4UV7L 2YPKA 3MODH 4F1ZA 1UKQA 2RJMA 3EO9H 4HT1H 4J7RA 4ZTOH 1FN4B 1TTRA 4DUVA 1PTZA 4ZZFA 4F57L 3PGDA 1CFTA 1AI1L 3RWCA 1VZHA 4RGNC 4DIXA 2WTRA 1BZQK 4JM4H 2BXZA 2N7BA 2LR4A 1FFPA 1SLXA 1BSIA 1DQKA 4AKQA 1KJ2A 1ECZA 2RMNA 3QO0A 1M05A 4NC2B 4POZC 4DKDC 4LOUD 5L8JB 4C47A 4L4TB 1C8PA 3LEYH 4M61B 2K70A 3WUWG 5JW5A 1LJMA 3VAEA 3NCXA 1DJZA 4LLYB 4XNZB 3C5ZC 3BH8A 3NSFA 4XN1A 2OJEB 1T66D 4FG6C 4I3GA 3P30H 1D5ZA 1V54B 2K6ZA 4QDGA 5CN2A 1SNRA 4YDIH 3CLEH 4AIZB 1MCKA 3S3CB 3TF7C 3WJMA 3MRJA 5FYJD 4F2ME 3ARFB 4ICXA 2Y6TE 4JDEA 3KCPB 1NCCL 5D1ZD 2P80A 4CNIA 4QRPB 4UTAA 2Z1KA 1J0IA 2G5RA 1OB1A 4R0LA 1TZHA 3S8FB 5E2UH 1P7KA 2X2YA 1BMWA 3CH1B 4DPBX 4HK0A 3AAZA 2ADJA 1HHKA 2KQNA 2OK0L 2KPWA 2DWSA 1C5DA 2MH4A 4GRWE 4JO1L 3S2AA 1DJSA 4GRLC 3QIBD 2K9FB 2WZ6A 2CRYA 1TFPA 4RFOH 3QUYA 5LCVH 4AVHA 1HIMH 4CVUA 1BOGA 3P3TA 5J13B 5D4QA 2ZUXA 3F7VA 4IRZA 4G1EB 2N0KA 1E28A 2YSSB 3FU5A 1B4LA 1AQ8A 4K5MA 1RIUH 3BQUB 3TZVC 1O7VA 4L3CA 1JNHA 2DYSB 3ESUF 5DRZB 2D8KA 4FNPA 4XX1E 2ZSVA 3ZTNH 3TA3C 2D0FA 5ECGA 1XCWA 4Z7OF 3WG7B 2R2HB 4DAGH 4DN4L 4LVOC 4ELMF 2CSPA 2DY2A 2X2IA 1S4IA 5IM7B 1T0OA 4X7TB 4YXKL 4Z7OB 2LU5A 2Y07H 4D0BB 1KG0B 4H20H 2PO6D 4YR6B 2NW3A 4ELMB 5C0DB 1MHHB 1ROCA 1CMOA 1TENA 3B2DC 2BNUB 5AW8B 4N9GB 5FOJA 1Z5HA 4F1SA 2HVJA 3M1BA 1AD0B 4NWTH 4WK4B 3VFOB 5IBLD 3HAEB 5ABAA 2YMTA 1VGKA 4NM8H 3TBWB 4DO5A 4UZSA 4L0YA 5FDWB 2B7DT 5CZRA 2X87A 1FVCA 3U46B 1MF2L 2Z34A 1EUTA 3MBWA 4BH7A 3P11H 2BPBA 4K0OA 4N2DA 3U30C 3LXUX 3GRWL 1UD6A 1MCNA 2EEAA 3NJKA 4JRWA 4BK8A 1F4XH 1UXSB 4JY6A 5JQ6H 4IKNA 3JWOC 3H9YA 3VXQB 3NPSB 1FFQA 2BS8A 4LO9A 1CB4A 1GMIA 4KJQC 3O9WA 4Y4FB 1L7TL 2BIOA 4TVPH 4X6BB 4UAHA 3FQWA 3QPQC 4S0TD 4LVNB 1NLBH 1QO3A 1KCRL 2AQNA 3DURB 3FT2B 2ISDA 3UAEA 2HLAB 4HMEA 1P2CA 3L8QA 2WZPA 4WHCA 4MQSB 1U92A 2P80D 3UACA 3TO4A 4FN0A 3VB9A 1JRHH 3GS7A 4UM9B 2D0HA 3UTZA 1V3LA 1DCEA 1BVKB 3PXHA 4L1TA 3C6SA 5TE4L 3L9YA 2GTZB 4XCYA 1EXUB 4O58L 1CTMA 4EI5C 5GS0L 4WWPA 5EU6A 3MRCB 1XGRA 5DHVH 1SHXA 2X6BA 3O0RL 4PP2A 3RWIB 3B7RL 4OGYL 3WEMA 4KXBA 3HZMA 1ZY9A 4H5SA 3QUYD 1G5AA 5IFAL 1O7DC 1Y6NR 2DJ4A 1UB6B 3ILQD 5DJYA 43CAA 3GI8H 1BMGA 3L4VA 3LN5A 2CK0L 2ZYRA 3KGTA 4H88H 2PP7A 4LKCB 2P28B 5J5EA 4FTDA 5FHAH 1O5PA 5BMFL 2HTKC 4RAVB 2XWDA 2CR3A 1XGZA 2LE9A 1OB0A 1M2OA 3L1EA 4Q9RH 4WJ5A 4C54A 2CXKA 1TZAA 4I7ZC 3VWKA 4I1RA 4JKNA 4TSAL 4NRYA 5DFAA 4PLJC 4U4BA 3BJ91 2NYKA 4K9JA 1GHFL 3BWUC 4QRQA 5FHBH 1IQDA 5D9SA 5J06A 1N67A 3BUYB 1L5GB 4F7MA 3G9AB 1CVSC 5FWQA 3SGJA 1XDTT 3VJ6B 3AU0A 1J8HA 1A7RL 1IV8A 5AW6B 4Y9EA 3W5MA 2F58L 5I1KH 4IQHA 4NAQA 3TM6A 1AO7B 4N22A 5E03A 4G6MH 2ZAIA 2XV0A 4F15C 2HKAA 4PHXA 1JOIA 2NPLX 3WFEL 2B1AH 5JYLA 3GNMH 1RLWA 4JRXB 3FRUA 1HDMB 1KBGL 3NFPA 4HXAH 3HC3H 4XP6L 3T0WA 2BWDA 1NDTA 1MH5A 2R0ZL 1SOKA 5D71H 1J9RA 2OCJA 4HD5A 1DSYA 4DCQA 3IVKB 4P2RE 3RTLA 3WUWA 3CFJB 3MTRA 1KPVA 4JFZL 4ZRGA 2MCG1 4KITB 1BLNB 2GEQA 4N6QA 2O5ZH 3O9WD 1CC3A 2O5XH 3HZVA 4KKBD 5KSAB 4ZQKB 4UNIA 1WCBB 3A23A 5I18H 1N4XH 2OMNA 3MLZL 4WI6A 3C8HA 5CJ5A 3B7YA 3LKNA 4DGVH 4IOFC 4N6RA 4NP4L 2WZPD 1RJLB 3QORB 5HHVL 4YSCA 2IGTA 3E3QC 3KPNA 3TO4D 4R7NB 4F7CA 1E9OA 2XIDA 4G70B 2Y1AA 5E94A 2R4RL 4JFXA 4FZ8H 4ZO9A 4G3YH 4WSGA 1HAWA 3LN4B 5JA8B 2HLEB 4X8JB 1NANH 2QQNL 2Y3AA 3VRLF 4M48H 5FKAA 3T77B 3T0EA 3AABA 1UD4A 1S46A 2N4IA 4HWBA 3PDOB 3CZGA 2XWTB 2HT3D 2ZUVA 5EU6D 2ARWA 1AXSB 3EOBA 2W59A 3N44B 4K7PL 5ENWA 3MYJA 1PLGH 2EYTA 1SOXA 3CFEB 4AQ1A 4EF3A 5JZ7D 5E2WH 1TJHH 4OFYA 1CT8B 5KBLA 2ZPKL 5E5RB 4AJWA 4DP4X 4MXWL 1COBA 5C7XH 3D51A 1JZHA 4BZ1A 1AKJA 1NJ9B 3OMAB 5DA4A 4BFKA 4XO8A 2OMWA 1VRSA 1XF5B 2BWQA 4NQDE 4MRCA