1F20A

Crystal structure of rat neuronal nitric-oxide synthase fad/nadp+ domain at 1.9a resolution.
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
435
structure length
435
Chain Sequence
SWKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the FAD/NADPH-binding domain of rat neuronal nitric-oxide synthase. Comparisons with NADPH-cytochrome P450 oxidoreductase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords NITRIC-OXIDE SYNTHASE
total genus 141
structure length 435
sequence length 435
ec nomenclature ec 1.14.13.39: Nitric-oxide synthase (NADPH).
pdb deposition date 2000-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00667 FAD_binding_1 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.990.10 Mainly Alpha Up-down Bundle NADPH-cytochrome p450 Reductase; Chain A, domain 3 NADPH-cytochrome p450 Reductase; Chain A, domain 3 1f20A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1f20A03
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1f20A01
3PENA 5HXBA 1Q7YD 3AVWA 1BQEA 1VQPB 3W2GA 2VYQA 3VO2A 3AVXA 2BMWA 3CCLB 3I56B 3W5HA 3OZUA 1CNEA 1GJRA 4EH1A 1DDIA 3OZWA 1FNDA 3CCJB 3CCUB 1K9MD 4RD3A 3OZVA 1KJZA 1EP3B 2EIXA 2DEUA 4RCYA 1QVFB 1DDGA 1K8AD 1VQ9B 3CCQB 4B44A 4RD4A 3CCSB 3JQPA 1JB9A 1ELOA 1TUIA 4RD2A 5TR9A 3B8HA 4LBZA 3LO8A 5GV8A 1IB0A 5H5JA 3AVTA 2QTLA 1XB2A 4BPRA 1B2RA 5H59A 3OJXA 4B47A 4YAOA 1F60A 3AGQA 1VQLB 1QX4A 2X3UA 4DQLA 4PC6A 3ZC3A 1KK0A 2QTZA 1AIPA 2GQFA 5JBQA 3W5VA 4M53A 3VO1A 1FNMA 1ZM4A 4N3NA 1UMKA 3LYUA 1JA0A 1QFYA 3WNCA 4QHYA 4WQMA 3ZBTA 1N8RD 1VQ8B 1OGJA 2XNJA 3LVBA 1EFCA 3CRZA 2YWEA 4TMZA 4M2LA 1VQOB 1QGYA 1FNCA 2XNCA 1KC8D 4Y9UA 3WXMA 2DETA 2DERA 3CCVB 3WBKA 4FK8A 1M1KD 4ZCLA 3U6BA 1GAQA 3W2IA 1Q81D 4P6VF 1K73D 2BPOA 4M4SA 1E64A 4PC3A 1EWYA 3MMPA 4PC2A 3ZZUA 4PC1A 4B4DA 4B43A 2YWGA 3U6KA 2RC5A 4TN1A 3CC4B 1KD1D 4NBSA 2VNJA 4K1XA 1G7TA 1XE1A 4Y7CA 4HE6A 4AC9A 2BN4A 1BX1A 4FN5A 1YHQB 1KQSB 4AF7A 3I1FA 2XEXA 4MYTA 3QFSA 2BM1A 3QE2A 2QN6A 1D2EA 1W87A 4G5GA 4N3GA 1WDTA 2R6HA 4Q7JB 3OJWA 4YAWA 1EFUA 3AVVA 1HA3A 1NJID 2HMAA 4ACAA 1S0UA 3B78A 3WYAA 3G4SB 3W2EA 3G71B 3CCMB 3FJOA 3A1FA 1QG0A 2AHOA 4U9UA 3CMAB 1VQKB 5TV2A 2QDXA 1B23P 1OB5A 3VMFA 4G1BA 1R5NA 2OTLB 1CQXA 2C78A 4TMXA 1YIJB 4DQKA 1SM4A 1VQ7B 1QUFA 3W5UA 5THXA 1QFZA 2NPFA 2YWFA 4NCNA 1TVCA 2VNIA 2BGJA 2CNDA 3CMEB 1EFTA 3QSYA 2PLFA 2PMDA 1W35A 3JQRA 3SJZA 3W2HA 1KK3A 1QFJA 2OK7A 1E63A 3QFTA 1KK1A 4RJLA 2QA4B 2VZLA 1YITB 3OW2B 2HDNB 1IJEA 4R71A 1YJ9B 4ACBA 4J0QA 4UAJA 1JA1A 1FRQA 3CC2B 1EP1B 3ES9A 4P3YA 1AMOA 1VQ5B 5FA6A 1ZUNB 1G7CA 3VNUA 1W34A 2J7KA 1VQNB 4LBVA 1H42A 1R5BA 1ZM2A 1E62A 2B7BA 4G1VA 4YALA 2E1RA 3AVUA 4ZGQB 2HCJB 1FRNA 3W2FA 4TMTA 1TTTA 2GPJA 2QEXB 4B3XA 1G7SA 3CCRB 1EXMA 3JQQA 4C43A 2VNHA 1QGAA 3ZZTA 4LBYA 1FNBA 2BGIA 1DARA 4PC7A 3AVYA 4M0LA 1W2BB 1YJWB 5DSZA 1VQMB 1I7PA 1R5OA 2D74A 3CD6B 2CRVA 1GVHA 4M1KA 3U2QA 3LRXA 2BV3A 5GV7A 3QFRA 4YAFA 2BF4A 1TLLA 4TMVA 1G7RA 4ZCIA 1BX0A 3CXCB 4Y9RA 1M90D 1NDHA 1DG1G 4IW3B 3WNBA 4LC0A 1N0VC 3FPKA 3E20A 4RD1A 3V76A 4C0SA 3CC7B 1N0UA 5KSWB 1A8PA 3MHPA 1F20A 4HE5A 1OB2A 2DCUA 3CCEB 1JNYA 2BVNA 2PIAA 4LBWA 2OTJB 1FDRA 2BSAA 3ZBUA 3B82A 1GO2A 3G6EB 3VNVA 3WNDA 3MCAA 1YJNB 1OGIA 1D8TA 3P27A 1Q82D 1QGZA 1H85A 4AF6A 1KTVA 3CB4A 4TMWA 1S72B 4MYUA 2B5OA 1SKQA 1J9ZA 1Q86D 2C77A 1D1NA 4YHBA 5AN9A 4H9GA 2YWHA 3QFCA 2B7CA 4RCZA 1JJ2B 1GR1A 3WY9A 5TY0A 1VQ6B 2FX3A 5EMNA 3E1YE 1QH0A 2DY1A 2EFGA 1U2RA 3P26A 4F7DA 2VNKA 1QUEA 3ZZ0A 4ZGNB 1KRHA 4ZV4A 3I55B 4QFMA 3CPWB 4B48A 1CNFA 1IJFA 3J81k 3WBJA 4RD0A 4FWTA 2RC6A 4RD6A 4PGOA 4ZCMA 3CW2A 3AGPA 1ZM9A 1EP2B 1GAWA 2OK8A 1YI2B 1QVGB 2QMUA 4YAUA 1KK2A 1ZM3A 1BJKA 2ZITA 1VQ4B 2BM0A
chains in the Genus database with same CATH superfamily
1BEZA 1L5WA 1JI0A 1T2DA 2Q2QA 2RBEA 2VTEA 3MS7A 2IYFA 3AM4A 4RKWA 1P0CA 2NSJA 1O94A 2AXQA 2GN6A 4XORA 3H9QA 3PFBA 3QX7A 3BH7A 4IDFA 2P5YA 3MUFA 4K9SA 3ABRB 4LSWA 1OFUX 3OUZA 5HWSA 3SP1A 3NJ4A 3QVOA 1U0FA 4IWXA 1HDOA 4W5WA 3EAQA 4FOSA 2ZU6A 4TT3A 5DIZA 1MXHA 2E4XA 5GVRA 3O1JC 1SCUA 1Z0IA 4H77A 1NVGA 1QB8A 5A06A 3NMUF 2VTDA 1PVOA 1N1MA 2BRUC 3UPDA 5KS2A 4M22A 1M1YA 1F6BA 3LGSA 5C34B 1RWNA 4L73A 4EDFA 2NO0A 1YL5A 4IFEA 3FIUA 3V4SA 4XKWA 2QP4A 4K86A 4EG8A 1PZNA 1E5LA 1VQ9B 1OX6A 1GGVA 1X15A 2QSYA 3KXIA 1PAUA 4OXKA 4OYYA 3U7IA 3Q5GA 2ZIVB 1S1MA 2PA0A 3RRNA 2ZCJA 4N5IX 4X5OA 1MJGM 2W4QA 2X1HA 1CW2B 1DEXA 3DZBA 1M33A 1AA9A 5JAHA 4M9SA 3QFHA 1GRCA 3DNPA 3T38A 3DE0X 3DKKA 4WCVA 1BG6A 3CLTD 5IW8A 3HGMA 4DQUA 2FW0A 1WE2A 2EP7A 5DLYA 2QDKA 2AB0A 5F5XA 3RGWS 2PRSA 1OYVA 4OHPA 4LJ5A 3DE2X 5IH7A 1IG3A 4RSMA 2ZI6A 4YQEA 1IDN1 2V7VA 3G8YA 3W3ZB 2XUQA 3IGFA 2HWYA 3MCTA 2QTZA 1VFNA 3SX2A 1L7OA 4DPKA 1JALA 3PVCA 4RVUA 1W59A 3CLTC 1IBLB 1FMLA 2FQ1A 2PVCA 3CE6A 4EB6A 3DNMA 2CLOB 1FSPA 2BFWA 3AIIA 1PDVA 1E89A 4NONA 3VR3D 3V2UA 5ALEA 4F2WA 3MZ0A 3TOZA 4BCBA 1GCIA 2J33A 1YDGA 3C43A 4A8JB 1JHXA 2B82A 2VQ3A 2P9TA 3D8NA 3KP1A 2OD9A 2IF2A 4HDSB 3UG7A 3UJ9A 2D06A 2PT9A 2ZP1A 1XMVA 1HSZA 1NXWA 1YNOA 2DBYA 2IPMA 3CEJA 4ZYTA 5HUQA 3AEKA 4TYNA 3QG5A 2GI4A 2XF8A 2OBNA 4TMZA 2R62A 4ROXA 2XSZA 4HGNA 4NPCA 4RPKA 1Q11A 1Z8HA 2RK3A 1T5EA 3TE6A 1SOMA 4EW6A 5C51B 3CGGA 1U7UA 5FWYA 2BFMA 1FJHA 2FN8A 3QU9A 2K7FA 3LO5A 1JAYA 1YRBA 4TZTA 4CMGA 3BSYA 4AM8A 4LAFA 1OZFA 3EXFA 4M86A 1IY9A 3ET5A 2IOHA 1Q3KA 2R7AA 3R5TA 5SZKB 3T0GA 2C4VA 4QDJA 1WSAA 4M83A 3GY0A 2IKSA 3RIXA 3EHDA 3GV0A 4L0MA 3QPCA 3U4MA 3IDZA 3BHJA 3KYBA 3ZCTA 3FCAA 4G81A 1JLLB 5K3FA 5DCYA 2W8BA 1V5IA 1DG3A 2KX7A 4PC3A 2NV2B 2QRVB 1NATA 1YZYA 2IY9A 4KNWA 2I65A 4L9SA 4AZ3A 1P5JA 1LVHA 3WLHA 1FTWA 3LX6A 3GT0A 1Z4QA 2QVZX 4GG1A 1MO3A 4MP8A 5KQGA 3C4VA 1KY4A 2UZ1A 2W2VA 4NBSA 1A9QA 1W30A 4XFJA 4Z4QA 1KRWA 3O7WA 4WK2B 5COBA 2AG1A 1NQOA 4IJUA 1H8EA 3W8NA 4K6KA 4EBBA 1O96A 4FN5A 1C7JA 1ZXBA 1X1TA 2GD0A 1TT5A 3PFNA 3VR3A 3S7ZA 2XUOA 2Q8PA 2H5JA 4BB9A 4ZAVA 4C7XA 3QFFA 3GJRA 3KWLA 4TRNA 2VBFA 4UE2A 4AI6A 3CW9A 4KDRA 4LFCB 1T4MA 2TSYB 5IYZA 4RMIA 2IHUA 5CVUA 3MS2A 3BRWD 2G06A 4JLBA 2G36A 4DCUA 4BRZA 4PYKA 2PZJA 1OPRA 2JCXA 2JFHA 4PZUA 5TQ0B 3QXXA 4NABA 1VLQA 1OLXB 1VI6A 5FUVA 2WIAA 2YVKA 3F4BA 1U4NA 2BZ0A 3M7IA 3GGDA 1SXIA 4YAWA 5FLXA 1UBSB 4HGOA 1VYVA 2D13A 4LNUA 4ZCTA 2YXPX 3KRTA 3W6OA 4JZKA 3LMKA 4ND1A 3CG4A 1Z08A 1DOZA 3NPMA 1ODCA 3IEMA 2OGTA 1WRBA 1A5AB 4IRMA 2R8EA 2YY6A 2B0JA 5HRUA 3B78A 4JJ7A 1EIWA 1YB6A 2H4ZA 1BEEA 1M34B 2YJZA 4EFLA 1GKLA 1XD2B 3BDIA 4FMCF 1U2GA 4OQPA 3HJRA 5CK4A 2Q9AA 3SWWA 3OQIA 1ZL2A 2CDAA 3PT5A 4TLLB 1RCFA 2QEQA 4MV3A 4X61A 5F2EA 3M6AA 3T56B 3WDSA 1TFRA 3IKMB 2WYRA 1JB1A 3GFVA 4V39A 2ZWAA 2P5SA 3IUQA 2XYHA 4MR8A 1TM3E 1ODJA 1XZBA 3GD7A 1PR4A 4X7MA 2FWBA 2VHUA 1JR6A 1C7ZA 2H4FA 1QSGA 3HHEA 3VC7A 1KXJA 4MA0A 1ZD8A 1A9PA 2XTAA 5AHKA 3CUTA 1WV1A 5DMXA 1YIJB 4L5YA 2BD0A 4G3XA 2ZQ5A 4GP7A 2ZRMA 3FNEA 4M8KA 5TQ2A 1QUFA 1Z6PA 2FR8C 3HMKA 4HDNA 1TLFA 4QOFA 4JJFA 1NRWA 3J81A 2Z1DA 4FMBB 3RS5A 3OA0A 1N57A 3LBNA 4R8RA 4P4SB 4DNXA 5BUQA 5A0TA 4M1TA 1NYRA 2BGJA 3SNHA 4G6ZA 1JKJA 3UA4A 4OX9Y 3RT9A 4ZKDA 1A88A 2V8OA 3VZDA 5IT9A 3OQNA 3R6WA 2D5CA 4EFNA 4WKBA 4E4YA 3O8DA 5K6AC 3RT7A 1DC8A 3FHCB 4H27A 5FAXA 5FR2A 1E96A 4ZHQB 3AL0C 2RCNA 1CJVC 2I4TA 3I9KA 2OCGA 2ODAA 4DDKA 4ER3A 1RVDA 4OFZA 3B53X 1G21E 1KOFA 3RKUA 1EXVA 2ZRAA 3RSLA 5I4CA 5E0KB 2HPVA 3HWRA 5AH0A 1L2TA 4L28A 2ZKIA 3UAWA 4L07A 1Y6JA 3KDPA 3BQNB 3BD6A 1ZMTA 4ZVUA 1I9GA 2Z08A 3E5HA 3FSGA 3L7LA 5GWXA 3K0SA 1SXQA 2FI1A 1V26A 5LWQA 3HA2A 3ASSA 1EP1B 2R60A 5IKPA 1GPKA 2Z95A 2VP9A 4HF7A 4YRAA 1SC9A 3GZNB 2A59A 4MVJA 2ONJA 3WR5A 2NZYA 1KO4A 3B2QA 4G89A 4R6WA 1ZOIA 3RVNA 3TIXB 4CMKA 2QZJA 1XZEA 2X0EA 2FEPA 1II9A 5CNJA 4HRYA 1X87A 5E6TA 2IY8A 1HE2A 1ZRSA 3OX1A 3JQ6A 1NE2A 3MUNA 2DU8A 4RUKA 1ZGHA 2VF2A 4A92A 2EJTA 1XJ0A 2V6JA 3D3KA 3CZPA 4TV9B 5JAOA 5JH7A 2WWGA 5L3SB 2Q3CA 1XFDA 2OUKA 4KLCA 4G25A 5EZYB 1ATIA 1KAQA 1V5WA 2ZLBA 5ALHA 4JGBA 1U9IC 4ZEWA 4ZT5A 2VYFA 1CR4A 1W1IA 2H9AA 1YMQA 4XSGA 4YN3A 3UXEA 4TTSA 3RAFC 5J59A 1UMBB 2C88A 3QBTA 4J3NA 4XARA 1QGAA 3UJ3X 4GI1A 4YRQA 5IRCD 3DSRA 2A84A 1HK7A 3LC7O 4FXPA 4X44A 4DLSA 2O3JA 3M5CA 4C3OB 2AS0A 2X6YA 1QVVA 1LS1A 2RHBA 3U3MA 3GN2A 3C3WA 1FOEB 2P62A 2PHZA 3T7DA 4O4LB 1Z83A 3AY7A 3IO5A 4WOPA 4D02A 3L1IA 1BE1A 2QTNA 2YR0A 4O2BA 3I1YA 3RO7A 3RVPA 4D9FA 3GJZA 4UZFA 1W5FA 1JJVA 1U04A 4NU5A 4AXBA 5DYIA 4E2YA 2WF9A 4MWGA 2R1TB 3KJEA 4ZV9A 4RPDA 3R7DA 4RE6A 3W90A 1TM4E 1NI3A 3H2YA 5CG2A 4MWZA 1XLTA 2B4KA 4ZRNA 3BEDA 5P8WA 1L7AA 3QFRA 1W5TA 2OXIA 1RJWA 1EE2A 4NEQA 5AOCA 1UK8A 2IP1A 1EFDN 4NJEB 3BHIA 2O2ZA 5G4LA 3V8RA 3W7BA 4DWVA 3A9TA 2WU8A 3O4IA 2O5RA 2Y0EA 4HQ0A 2HO4A 3CPEA 4ENQA 2HHJA 4XRGA 1M90D 4YT5A 4Z0PA 4DV4B 2C2GA 2EU8A 3DDUA 5C5EA 3I76A 4XQFA 2AQIA 1O95A 5AI6A 1P2BA 4PO9A 1V7PC 1P6QA 1FS5A 2G9ZA 4Z4SA 1DFGA 3B2NA 3NYQA 2J8ZA 2CV2A 1KBZA 2RH9B 4NPHA 4DW8A 2FSVA 2A9KA 5I7OA 1X7HA 3K8QA 1KE2A 5JXGA 1YDEA 4CM1A 2XIJA 3GH1A 3E15A 3N2KA 2AOUA 1BPLA 3MOGA 2XXAB 4H3VA 1B41A 2VQ6A 2X42A 4K2AA 1DKLA 2B8EA 3E58A 3RREA 1CEYA 2KWIA 1Q95A 4NH4A 2GFQA 3QW2A 1FIUA 1T35A 1ULHA 1J42A 2QRLA 1UWLA 2FPIB 4PSDA 1BHJA 3WMEA 5C1BA 1NURA 2HK6A 3ASUA 2J30A 2JFNA 5ENDA 3W9SA 5BW5A 2E55A 2IUSA 1OH5A 3QWBA 4IG4A 4BFVA 3KKZA 4YRBA 2UU9B 1JFVA 5HK8A 1FMJA 2AL7A 4JR2A 2ORYA 5CXSA 3VDMA 1Q1QA 1JKFA 2BSAA 1U0GA 4G8JA 3G8DA 3LFUA 1NLUA 1Z82A 2C2BA 4HAYA 3WGYA 2ATEA 1HNNA 2C9CA 2TMDA 2ZYDA 3RYFB 1DUSA 1WKCA 1IN6A 4IXTA 1P1CA 3S0JA 2ZJYA 2A30A 5CXQA 4HNSA 2KS6A 1WPCA 4XGIA 4AZTA 5K3OA 3A9RA 1E5QA 1I6MA 1RPTA 2ZJZA 3OEEA 4OOXA 3B3AA 3GAFA 4RF4A 5E6SB 3UUGA 4BQOA 4GKBA 4DXHA 3H97A 4QM7A 3NGLA 4J16C 8LDHA 3I9V1 4AF6A 1DEAA 4UU0A 1IK4A 1YI8A 4LXYA 4CU2A 4YAKA 1VPWA 2GEDA 3FHTA 2WYOA 1K92A 4KXYA 2X40A 1YB5A 2GPAA 2ZSBA 5JU6A 2GAAA 4KVZA 4Z7OB 4GICA 2VDJA 5IN5A 2QORA 3FETA 2HBQA 3JYHA 4LTNA 3VJKA 3EWNA 5CNIA 1GQSA 2O7VA 2Q2WA 4JJEA 2MYTA 5H3CA 3REQB 3DDHA 2DFLA 2C77A 2JFWA 2JJQA 4AJNA 1RZUA 2C58A 4DG5A 4N7BA 1GQFA 4GXQA 3FBTA 3WRXC 3KYDB 3LPDA 3EBOA 1JAZA 1XZMA 3H8VA 1Q50A 5IUJC 1VIAA 4V0KA 4CFYA 4RTMA 1RCUA 4F46A 5TY0A 1XNHA 2XLBA 4OYHA 4MVJH 3ERCA 2DIEA 4GZ6A 2NXJA 2WVJA 5AUOB 2O8FB 2IHJA 3ORYA 2BP7B 3E1YE 1YB2A 3VU9B 2RB4A 1B15A 4Q4AA 5LMCA 1I51A 2WHRA 5KYUB 3HUUA 4NCXA 1AXGA 1IQPA 1VJCA 3QE0A 1BXKA 3TXXA 1HX7A 1SXJD 3ZIDA 4OUKX 3OCWA 5JPCA 3DGFC 4XCQA 5CM9C 2PD4A 3F6RA 1TD9A 1VIVA 5AHXA 4HRVA 3QLUA 1QDEA 5E3IA 4B79A 4H1HA 5K3AA 3KV3O 1D2RA 1HDYA 4X3CA 4HDMA 3KT6A 2A14A 3MHTA 3I09A 2WSIA 1JHYA 1F8FA 1FA9A 2AZTA 4N3BA 4NH0A 1MMFB 2VSQA 2FPPB 2ONKA 3F98A 2BR4A 3KCQA 1MIHA 1GU7A 1T10A 1FS6A 2FHSA 2J6HA 3FDZA 4MB0A 4E30A 3E84A 4UTRA 1F4VA 5CDTA 3ZGOA 2IBSA 1KETA 2ZJBA 4D4KA 5HM6A 3FOZA 4G0VA 4R7ZA 2P90A 1NI4A 5EG5A 3IS3A 4H4DA 2X3FA 1RVV1 2AOXA 1I1OA 1TEVA 4PSKA 5KNLA 3GDFA 2H65A 2QT1A 3FWPA 3HB0A 2VUIB 1PNTA 1RAHA 2P77A 3KALA 4J0JA 4MAMA 2NZXA 3E2IA 1LPBB 3I12A 4UNPA 2AE1A 3M5PA 3RHTA 5CD1A 3FYCA 3T9CA 2EZ4A 2NV6A 3CT6A 4QVKA 5KTNA 4JWTA 2QPLA 3EDCA 3LLCA 4OB6A 2ZZMA 1E1LA 1P9RA 5AJVB 2DKFA 2FPKA 4BEJA 3MWLA 5HG0A 2CFSA 3SI7A 3HXOA 3A6FA 1NFQA 2HFKA 3L92A 1FXWA 4NFSA 2RBGA 4DA7A 4E2FA 1ZH6A 3OQJA 5FWNA 3T0IA 4BZZA 2ZIFA 4RK1A 3TTUA 4TLBA 4JOSA 4BIMA 4CMCA 2J0UA 4D97A 5JD4A 5K0TA 4FD2A 4PZEA 3G5MA 2HW8A 1M1XB 5K3EA 3GZTB 1VLJA 4TSRA 3HDQA 3TK1A 4DJ5X 2DJ5A 2YUIA 3PU6A 3AEQA 3ZE9A 4QECA 5KC9A 4HZUA 5LIRA 1BWRA 3I04M 1GWNA 1GZ6A 1NQ5A 3OZVA 1U2ZA 3T3HA 3LBYA 2XZTA 1V1MA 1XEWX 5AXBA 3SHQA 2B4YA 1HY3A 4XM2A 1PJ7A 1KF0A 1UIMA 2Q1TA 2ZUBA 3BT7A 1OJ7A 4QYWA 3HKCA 2PSFA 3M9WA 2O50A 1W5SA 3C14C 4Q47A 1SHUX 1ZD5A 4RJJA 1Y3HA 4KODA 5KJ1A 4X3OA 1RAEA 3NWOA 1D07A 2Z0MA 4YB8A 4ZT7A 5NULA 4AIRA 4YT2A 4CCWA 4LBZA 1FX1A 5REQA 2NUPA 5FHQA 4BQIA 3NV7A 3LH5A 3ZK9A 1W88A 2H92A 3OE7D 1KSHA 1RLJA 2XCTB 3CZRA 3AWDA 1PT9A 2VQSA 4YV7A 3V7UA 3GARA 3AP3A 3N39C 1E2NA 4U7WA 3PNBA 1IXZA 4PFKA 3H2HA 1B8PA 5HBGA 1JBQA 2RGCA 3FPFA 5M3BA 4P3KA 4ZIRA 3QITA 1GILA 1FTNA 2QX9A 2Z9BA 4DMKA 5CB4A 4LI0A 1VJRA 3LUDA 5C4IA 5HEKA 3RWOA 3KFLA 1GPJA 2RFLA 1CUXA 2FSUA 3SBDA 4D44A 3FSJX 4AY6A 1ZVQA 4I1OA 2LBPA 4C89A 1DIBA 1FNMA 5CDSA 2ZPTX 2Y1WA 1JG7A 3R7NA 3R8FA 2YJTD 3GUZA 1P3DA 4CXMA 4RMHA 2EZ8A 2RBKA 1R8QA 4ND5A 3FFTA 2EOAA 4PU0A 1C29B 4L4RA 1T5SA 1XKXA 3PKJA 5JSFA 5LP6A 1SG9A 2WMOB 2VYNA 4MUFA 3UJ6A 1XD9A 3CP2A 3H5IA 4INPA 4XPIA 4QUHA 4BQNA 3RBXA 4CF3A 2XUFA 3BFPA 3L1UA 1ZN7A 1VQOB 3MRVA 4OA8A 2VSFA 2G72A 1QGYA 2UVPB 1A7UA 2VHCA 1KC8D 1BGVA 2G5CA 3DOCA 3K72B 4BWGA 3WQRA 5KVCA 1SVWA 2Y4NA 1DCFA 3ZDZB 5EC8A 2B8WA 2FE1A 2DERA 4ALKA 1LA2A 4NQZA 3QWAA 4BPBA 3EJ6A 1SUPA 3QMPA 4HS9A 4R1NA 4OLAA 4EZEA 1Q5PA 1RU3A 4KIUA 3L4BA 1BHSA 3HU2A 3F5DA 1GPMA 3DONA 1WU8A 4OAPA 4PGHA 2AF4C 3K92A 4L6CA 4LF5B 1YCGA 3MJSA 3OJFA 4X97A 5SZIA 3X2SA 1QCYA 1KGSA 1UIRA 1X94A 1LC0A 5K8TA 2IUTA 1CZUA 2EYUA 3DEAA 2ZUUA 1KEKA 4P6VF 1C81A 4DB2A 2B1QA 1X42A 3L6RA 2W2PA 1KI6B 1NXVA 1G59A 1X7WA 3UHFA 4TZKA 4J16A 2Q3DA 1DU4A 1EB8A 1SCNE 2B4AA 3ETHA 2NO9A 1CR2A 3DT9A 2GEVA 4D8YA 3NBKA 3RC3A 2GLUA 4XA8A 4ESOA 1R0BA 2O0HA 3BB1A 1V0FA 3E27A 4KIJA 3TLGB 3R0VA 1KD1D 4MUXA 3B5IA 4WN9B 4O3MA 4RENA 1XE1A 1L5VA 3CH6A 4TRMA 1U8TA 5JLAA 1TE2A 2QA5A 4KJXA 2QX4A 4U7FA 3EDRA 4UM8B 4F04A 1DZ3A 1GL7A 1XBTA 1VBNA 2QF7A 1T0UA 3G8CA 1FRZA 3NCHA 4HNGA 2ZIAA 1GT91 3DHNA 1XG5A 5BSUA 3VKUA 4LECA 5BRJA 3DMNA 3OPYB 3GFFA 3DXXA 4I55A 4MROA 3V9PA 3IA2A 4FQ7A 3V7FA 1YH3A 1F2TA 1RYBA 3G5LA 1SOWA 5FNVA 2BDTA 2D3TA 3AU8A 3W9BA 5EHQA 3WLRA 2FMTA 3FNBA 3ANXA 4DLUA 1JIIA 1WSRA 1A95A 4JP2A 1SBQA 4RFSA 2PLAA 1EFPB 3SX4A 3W8EA 4ZGWA 2X8JA 2XNKA 3VV3A 3U7FB 2PM8A 1JSCA 1XDBA 1XIVA 2B78A 4D1YA 5LLTA 4HCJA 5TVKA 4BMDA 4IJWA 3QOWA 5CBPB 4E0FA 1PZGA 1MV8A 3EQ8A 5C4GB 3R0IA 2M32A 4ZVMA 1KR2A 4REMA 4H6VA 3PNYA 1NRJB 1SWVA 3HZHA 4ONEA 4UJ5A 4GEKA 3BJZA 3ZGNA 3SBXA 3E2MA 2Z58A 1X9HA 1SD2A 2WT4A 1QHEA 4YAGA 1BVYF 1EWRA 4FYKA 4W9RA 3B51X 4R8SA 4Q1AA 3WYAA 2NTNA 2X8BA 2NXWA 3LGAA 4MXDA 4DLKA 3DDWA 5FX2A 4A8HA 1KS9A 1GPUA 3SQLA 3TQQA 3M3HA 1LDMA 1VM6A 3CLUD 5DN6D 1ORIA 1QG4A 1ZCJA 5KYYB 4ZODA 4F71A 3W34A 4E15A 5KYXA 3RSSA 3D2CA 1D6NA 4OHOA 3QXSA 4RK6A 2C98A 2O23A 3M4ZA 1RYHA 5DEIA 5EZQA 3UFBA 1TO1E 3V48A 4E2ZA 3F1LA 1NU8A 3GVCA 4P36A 3IR7A 4BOYA 3OUUA 3IA7A 4P5DA 1UPAA 3E9QA 3KOWA 5TRTA 2C5EA 2PL3A 2VYVD 1XVUA 3T5PA 2VFAA 3IAEA 4CKCA 2WI8A 3P0IA 1B0ZA 4F1KA 1OFVA 2Q4EA 2R6R1 4QSHA 4P80A 3IBFA 1KJNA 3D2BA 3I04A 3LP8A 1KDYA 1ZWKA 5LYJB 2V6FA 1BVUA 4JGGA 3KELA 1QFZA 3JYLA 3NHSA 2ZS9A 3OCJA 3T3IA 1GDDA 1EJ0A 4PSVA 5ALDA 4K9RA 3EE6A 2I87A 2NU9B 5INTA 3D31A 3QF4B 1PJ8A 2IEAA 2NZJA 4FLEA 3TAHA 5EGNA 4JMPA 2WB2A 3VU3A 3K4HA 3MGBA 2OC9A 2Z4TA 1NVUQ 2SKEA 2ZXEA 4OKSA 3C4JA 1EVJA 4AZ0B 3BERA 5AR1A 5HZAA 1ORRA 3HSKA 2IVZA 1AZWA 2QS9A 4YJHA 4M3NA 4MMYB 1KK3A 4RVFA 2DFDA 4BGEA 2WAYA 3GLUA 4D4MA 2Y92A 2J59A 1WORA 1J9EA 3DGEC 4UAUA 4D6YA 3H9BA 2JZOA 3SZRA 2QA4B 3K31A 4FMCB 3CRMA 4JX9A 4TQGA 3F3YA 2DX7A 4Y6RA 4E22A 1T6ZA 4WVFA 3E1KA 1I01A 1KOJA 5AVSA 3PGA1 4H3HB 4O59O 3ZI0A 1VDZA 3A2MA 5FBRB 2GBPA 3GCDA 4MPJA 5E8JA 2VYCA 1HFKA 4QUIA 3C2QA 1FSFA 2HTEA 5BSTA 4EM6A 3G7NA 3D26A 1FRQA 2P9BA 2PX3A 3NWPA 3OM8A 4PS0A 2QQFA 4Q9LA 5AO9A 1O97C 1RWPA 4YJDA 4F8JA 1FZQA 2M5SA 5JAQA 5C7IO 2D1FA 1Q0ZA 1OKKD 1SULA 2QJRA 2VSYA 5GP1A 4C76A 4ZXFA 3FYHA 5KYVA 2ZU0C 3VA7A 1T9KA 1UKCA 1ZI6A 3NC0C 3OE5A 9MHTA 4QU9A 5AOVA 2XHEA 2QN1A 3FMFA 1MX3A 2FPXA 1BRTA 2K6GA 4P4NA 4OBXA 3HJBA 3T5CA 2GK4A 1K9SA 1G5FA 4NIMA 5JSZB 2L42A 2WAXA 2WKQA 3AF4A 3QX8A 1QHIA 5EJ9A 4LWOA 5BVGA 1YRLA 1E6WA 2XB6A 2XGMA 4J9UE 4NNOA 5HTOA 2PXXA 2E1RA 1N7IA 1L7VC 1WCIA 3SNKA 3W2FA 1KYZA 1CY7A 1KA9H 1ODSA 2IHBA 3M1YA 3W8RA 3GCWA 1F38A 1Z38A 2BHTA 4HJXA 2F43A 4YFYA 3ROEA 3HXKA 1B8UA 4BBAA 1CJCA 4TMTA 1WP4A 2R3SA 4G9EA 4J3FA 1B3RA 3PRKE 3P5BA 4JI2B 4PNPA 1R8YA 3OWOA 3C5EA 4MVJI 1TDJA 2I80A 2Q29A 1VLLA 2FXVA 3GR6A 3IIKA 4KEAA 4YWJA 5FA5A 4TYYA 4EMBA 2GHQA 3HABA 1KMQA 2P79A 4EG3A 1PBNA 5JNUA 2CXOA 3LDUA 5TMEA 1W2BB 3G0DA 4Y2PA 2HA7A 1RBYA 2X8WA 4KO8A 3M2PA 1JPUA 3JU3A 1U80A 2NM0A 3C41J 1CQIB 3PQ5A 4FTWA 4J9VA 4LZWA 2X58A 4MMZB 2C7VA 2NXNA 5E1OA 2G8NA 1KVUA 1OIVA 3ZLJA 4Z4EA 1VLHA 1ZJYA 4MGHA 4LVOA 1OC4A 4NDNE 5E2AA 2CF6A 1P5ZB 3Q7PA 1UQRA 4YCLA 1GNRA 3PLRA 2XDAA 3GGCA 3NORA 2A4KA 4KQMA 2OILA 1EFKA 3JD2A 2WMNB 1LBSA 3K3PA 1U2DA 3QLTA 2J09A 3DT8A 4RPGA 5HJ7A 1V25A 5E9WA 1XU4A 3KWJA 4K9MA 4IQ4A 4X20A 4BU1A 1YRQA 4KO2S 1Q1GA 2HUNA 5KNDD 3RJ5A 1VSTA 3U4IA 2RI1A 4Y6PA 3I1IA 4YCMA 2W11A 2QU7A 2V9ZA 1BN6A 4B3DA 1NI5A 2CV1A 2E85A 2ZYRA 4JLOA 1XLVA 3LNCA 3VKFA 2CYAA 1DKNA 5EPEA 5CDFE 1KFEB 1REQA 2D7CA 2C7GA 2LP4Y 3O4RA 3HR4A 1TB4A 3MN1A 3USCS 4AUEA 2AR7A 3P94A 2LE0A 1XHFA 1ZI8A 2FPWA 2MMGA 4CLEA 2EF1A 1WMEA 2QTBA 1D1PA 2BLLA 4IS2A 4Y6GB 1XL1A 3PXGA 4ENRA 3IV9A 5EJ7A 3FDIA 3OZXA 4YRKA 4XIYA 2VF4X 4WX2B 1BJRE 3ND7A 2ZRJA 3U5TA 2ZZNA 3BM5A 4WNCA 4GT1A 3JQ7A 2Y2VA 3QW4B 4IFBA 3OX2A 4KWTA 1F20A 3GNQA 1HETA 4RH0A 4UEQA 1Q7GA 1WVGA 4FX2A 1KY5A 1PS8A 1NQAO 2W42A 1H9AA 1JQDA 5A5DA 1M2JA 3V6MA 3OIGA 5KNBA 3IULA 1Y0RA 2D4HA 1G8FA 2XNSA 3DB2A 3GJ8A 3QWIA 4N6GA 4EB3A 3HC7A 3R5HA 5BPHA 3GH3A 1F51E 4MLZA 4YAJA 5CIQA 3TLYA 1GFZA 3M8KA 4BLSA 4QEDA 1FDRA 4A2PA 2YWRA 3ZD7A 1LPSA 3B82A 5C35A 4OLBA 2FDXA 3OQBA 1B3BA 4W8OA 1K98A 2F3SA 1POXA 2D2FA 3TRFA 1PFUA 1WBJB 2CFOA 2FHPA 2FQQA 4XYLA 2RGUA 3OKPA 3A8IA 1BFKA 3TTWA 1VRWA 4DCJA 1FFXB 3ZEIA 3C6KA 4G5FA 3NW9A 4OHWA 1G8MA 4I1VA 4AJLA 5BVHB 4PQGA 4ZMRA 2NVOA 3ZLUA 2ZSFA 1J00A 2DUNA 1NJ8A 3L9WA 1H85A 1I4EB 4EVIA 3DHEA 3L41A 2B36A 3WIUA 2GZHA 5JDIC 4MYUA 1FMCA 5AMXA 1E1RA 3EPHA 3SJUA 4EI7A 2F1OA 4JDPA 4L5BA 2P2YA 4DRYA 2K7ZA 2A5YB 1LV8A 4MHOA 5B2EA 2FPGB 1OREA 1YJ5A 4DQXA 4BATA 1FRFS 1KH1A 4MCIA 4B40A 1LUAA 1XMOB 3NYRA 4IIJA 1W85B 1EQAA 4PBTA 4RVOA 4PABA 3QFCA 2FMKA 3MLEA 4JC0A 4ND6A 3ZIUA 4UUOA 2OHFA 4X84A 5D3MB 1Q77A 5C46F 3G2MA 1LBHA 3UMBA 2RE8A 3GPCA 1Q1AA 3UV3A 1CEEA 3JSXA 4F7WA 1RJ9B 1N8TA 3GLRA 3RD5A 5EMNA 3UWSA 2I7TA 1P73A 1YUNA 2AFRA 4QXMA 3SE0A 5CLJA 1DTEA 1PW7A 5CH5A 4KQXA 3LCVB 5IKMA 5JFTA 1PG2A 2JLXA 1LY1A 1KOGA 3GVXA 3UUWA 8ABPA 4DG8A 1MD9A 1PWXA 5FAKA 4QJIA 2FSSA 3QENA 1XQVA 4YDRA 1S2GA 3TSAA 4L2IB 2HYIC 4H0NA 1L3IA 3PGXA 3RWMB 1LBQA 4O6VA 1DQPA 2AMYA 1K3TA 3D3WB 1F3LA 2C61A 3ZK8A 2PFSA 3DXFA 3PGKA 1FYVA 3HQ4O 4HWKA 4KB5A 4P08A 2BTQB 4LGCA 2WU0A 3OPOA 2EKLA 1X7YA 1NFFA 2DUMA 2IT1A 5IAKA 3DPIA 4EGQA 1IPEA 1UT5A 1ADYA 5AI5A 1GPDG 2N47A 2ZVJA 4AX8A 8OHMA 5AVZA 3ILVA 3T3OA 1EP9A 4B3GA 3KZMA 1PFGA 5D3KA 5ECGC 3L0BA 3ZV4A 1YHYA 4HATA 3A6ZA 4YO7A 5K8CA 2M6LA 3CNHA 3AJRA 1ZX1A 1P7CA 2YVLA 1E7SA 4ZCMA 1TYEB 3IUEA 3SF8B 3V8PA 5B1YA 1G5RA 4MWBA 4AJPA 3U37A 1ZO8A 4ZFNA 5FP0A 4OATA 4EKDA 1ZM9A 4B34A 1E94E 2YBDA 1U7WA 5JMPA 3OAAD 1GAWA 2QPAA 4BY9E 2BI4A 1GDTA 3B1WA 3S6JA 1GZ7A 3Q3GE 3QELA 4V0ME 1LLQA 2WF5A 1IHXA 1K0UA 2DWQA 4JIGA 4YCDA 1H93A 1SNYA 3SN6A 4KSBA 1UR5A 1XALA 1I3CA 3OZTA 1AHNA 2WC1A 1ZEJA 3F2IA 1AQIA 3AVWA 4RSRA 5I9MA 3SX0A 1MG0A 3LCRA 4FHFA 5A4MS 1WBDA 4RNCA 3D3EA 2CXXA 1ZCFA 1AS2A 1P17A 4MQFB 2EQBA 2XAUA 1Z16A 1CF2O 3FDFA 3B7PA 1D2CA 3ZY6A 2BH2A 2G04A 5KSYA 2VT7A 1NP6A 2XQFA 1SHKA 3AEZA 3KCNA 2ZCUA 4IH4A 6REQA 3L77A 4ZO8A 4TKUB 1O77A 3KTFA 4B4VA 1NFRA 4GLJA 1QIIA 3EGEA 3FOWA 3IQEA 3LZCA 3CJRA 3QE9Y 1FW8A 5FPKA 1K9MD 3B6JA 5T8KA 5FTLA 2QV0A 1GEEA 3D1LA 3FR8A 2DM6A 4ZK2A 2PUFA 4AY2A 1T5BA 1KAHA 4EBFA 3MOIA 1AUPA 3GQBB 3NVMB 3BQJA 1R3UA 3LV8A 3N2IA 1Q2UA 1OAAA 1USWA 2IP4A 3B13B 1GNVA 3F3SA 4K26A 4RQAA 4BEVA 1PEDA 1SURA 2IXDA 1GUDA 1UXHA 2OBBA 3KL9A 4WOCA 3JRXA 5JNWA 3SPXA 4BNWA 1Z75A 2L69A 3RS0A 5CGZA 1FP7A 2QQEA 2ZSKA 4GI5A 2YRFA 4ITUA 1E58A 2BE9A 3W4IA 1W96A 2CHUA 3GQVA 3Q5EA 4Y9SA 1CG6A 3HJHA 2PUTA 2PEYA 1G2QA 1SQFA 2XMPA 3DZJA 4G56A 4YI5A 2X0KA 4KFRA 1MEEA 1O94C 3AY3A 2WNIA 3AJ8A 3FAKA 4DIEA 3RI3A 4CIBA 5LC1A 1U99A 3IEIA 3QKRB 5EXXA 4P7KA 1RTKA 1YU9A 4B76A 2D5LA 1UDAA 3AT1A 4MS1A 4TV8A 5ALXA 3VC2A 3WYNA 2PG3A 2Q2NA 4JBLA 3TZKA 2VG8A 3CZ4A 4BN4A 5GMOA 4MQEB 1OZGA 5AVWA 1H9BA 4BMSA 1M8GA 1T8SA 3I4FA 5A5GA 5EKTA 1ZXXA 4DL9A 2JGMA 1C1DB 5CX1B 4KFTA 1SOVA 2WZDA 4A16A 1S8FA 4HX9A 1G8PA 3N0TA 2NYVA 4GDFA 5FOUA 3G2KA 1C8LA 1YZQA 3DQPA 2IPAB 4MKFA 4JT9A 4XH9B 5CDYA 5ICGA 1N8RD 1L1FA 4N76A 3N0WA 2ZRQA 3C6MA 4IX9A 1DAEA 5F5NA 1B6SA 1U5BB 4D3DA 1UD6A 2I54A 5AHWA 2HF2A 2C7RA 3I5UA 1WZIA 1R6BX 1U0RA 2R48A 4I5GA 5FBLB 3KEQA 2BKVA 1MGOA 3BWEA 4D74A 1QR6A 3ONEA 3IDAA 3X1KA 1XSEA 2YHSA 4G4SP 4JL8A 4ZAYA 3PFIA 2CLHB 3I9V6 5B1HA 4UPEA 3HKDB 2X6TA 1K7SN 2IGTA 3L7DA 5EWJA 2ISQA 4QLAA 3WBKA 4O2LA 5GIOE 4HDKB 1ZVMA 5GGXA 2IYVA 2ANCA 1LLFA 3EDYA 2OOSA 4ZEXA 2I1LA 5KCMA 3CUWA 3VNAA 4B7UA 2Y6UA 2HA2A 1LRLA 1E8MA 1JMVA 1OHHA 1TIKA 3PL1A 3R0XA 2PRIA 3LPLA 4OLJA 1QH1B 5EEGA 5FJJA 2CHQA 1W9MA 2WD8A 4MGIR 3MF4A 3H9CA 1JZTA 3DL0A 5LLSA 1RM5A 2QP3A 1QHHB 3ENNA 4A2WA 1ADGA 4XGRA 3QF7A 4DREA 4F4IA 1XYGA 2QAGB 4QGHA 4V2IA 4H59A 3ESYA 3DOOA 4JBIA 5EMJA 1EVKA 2OXRA 1UDXA 4IDAA 5IX8A 4BLOA 5FL7A 1KWGA 3LA6A 4XGQA 2B2XA 1QVWA 3OI7A 4P84A 2Q1XA 1OA1A 1XVIA 3PEVA 4OP2A 2QY6A 4MA4A 1SBNE 3FBWA 1COWA 4MW5A 3KJIA 4E70A 5MFZA 4NXMB 3ZQJA 2P6OA 4INJA 2REQB 4X62B 4XX0B 2P2GA 3GYGA 1FFSA 5JAMA 4JKIA 3UM9A 2XOXA 4NG4A 2H1LA 2V0CA 1WZUA 2P9FA 3KPWA 3EWSA 1MUUA 1R64A 5BW6B 1AVTA 3PF9A 2EJCA 1ZZEA 3I1FA 5CRIA 2VJBA 4LFBB 1T5OA 4JVSB 1JT9A 2FMFA 1CCWA 1JG4A 3GXOA 4KQHA 2WJVA 1YGPA 2OZLA 2GJ9A 4WSOA 5SY9A 5BOSB 5I4BA 1P2TA 1SU7A 5BSFA 1N0IA 1LJLA 4UUMA 4EG6A 1RLMA 2AEJA 2R2GA 1IMJA 2IHKA 3L49A 4G6IA 5J2TB 1W87A 1X1EA 4MYSA 4ZV7A 3DBHB 4RM2A 4TLDA 1P1RA 3ESZA 2P9QA 5JRJA 4G5HA 4HN4B 1ZH8A 3CX8A 3TI9A 4UU8A 5TIIA 1QF9A 1E1CB 2YVUA 1LS6A 2QL6A 2LKCA 3EAFA 5HFAA 1GTRA 2LIPA 4WDRA 3TFQA 1UXIA 4JC8A 2R4TA 5IDYA 3FPBA 1Q0RA 4Z3DA 3O03A 3TMAA 1NZJA 2BFEB 4AKHA 1ORVA 2NVUA 3MWGA 3KJZA 1CT9A 5FYQA 4BX0A 2ECKA 3YASA 2O0LA 4A3SA 2HKIA 3OZCA 1O6CA 2PMWB 3BCUA 3CCFA 3NHLA 3QM1A 2JLCA 2ODQA 2GPSA 4MV4A 4M0KA 1JVSA 2OCKA 5YASA 3V4FA 3GA7A 3FFXA 4JC5A 4EQ6A 1D0SA 3Q41A 4GXTA 2CXSA 3MOSA 1R6VA 3A4MA 5AKHA 2R751 1G6Q1 2RAUA 1HE1C 16PKA 3KKNA 1A8UA 2ZSIA 3LUPA 3PD1A 4MYDA 4NZ9A 1KE1A 4N5NA 4WESA 4E5KA 2X0NA 1Y5LA 2C5GA 4DQKA 4URUR 1PD1A 1KJJA 4FGSA 4MRPA 1TJ5A 1YIOA 4J6EA 1JG3A 4HL6A 4MWSA 3I9JA 5LBIA 4JGIA 2BYTA 1DFIA 5THXA 4MWCA 3G05A 2ZAOA 1TVCA 3WIDA 1HC7A 4PNHA 3HEMA 3I0ZA 3EIFA 3LKVA 3Q6IA 4UDNA 1QE3A 2XDYA 3JQAA 5HHTA 1USGA 1V43A 1IUPA 4EJSA 4UE3S 4UVGA 5HJ2A 2WFLB 1UPTA 2EAUA 4N5DA 2ECOA 5FXMA 2JG3A 2X4DA 1Z4MA 5HW0A 2IHNA 3PC2A 1N6OA 5LQAA 3N2ZB 1ZGJA 2P41A 3NT2A 1JECA 1YZHA 2FSHA 3GLSA 4CQMB 4ZO7A 4D80A 6YASA 1EWTA 1E9SA 3QV2A 5FBWB 4QBHA 3PEUA 5AKIA 3HYCA 3CXUA 4X64B 3L05A 4PZAA 4Z6KA 1BA2A 1X9GA 3Q12A 3HVUA 3SOPA 1N5IA 4DV0B 4X8LA 1Z5VA 1CETA 5JAZA 3LM8A 4B3SB 4TROA 4HPJB 1JF8A 5EYPA 3U4CA 3D3QA 1TUBA 3JARA 4UVIA 1WW8A 4BQFA 1L4GA 3QI7A 4R98A 4HH0A 1VKJA 1PYGA 1FYFA 4M21A 4CUJA 1L1QA 2RGNC 2FWMX 3ICOA 1Z22A 3MVEA 1T3GA 1FFCA 4PO3X 4RZ3A 1TU0A 4ALMA 4DRZA 5H4GA 1YLOA 5JBIA 1QCCA 3EY4A 2O0MA 3K0AB 3WNQA 8ATCA 4HB3A 1AMOA 3HP1A 2OC4A 4Z4YA 5A4DA 1VA5A 2ZIGA 3R8CA 1G5PA 1NUSA 1JHRA 1VKRA 1OLUA 2JGDA 4JJGA 3RS3A 1E6LA 1KI1A 2VJLA 4HWTA 3DOIA 4YXWD 3F4KA 2VPQA 4MUBA 1L6RA 1Y1LA 2E4ZA 3A9SA 3P52A 5ECWA 3LIPA 1QZTA 4B9AA 3K15A 3VV2A 1NVVQ 1FDTA 3R6JA 1GV0A 2JDIA 5KIAA 4LF9B 2XPCA 4ZGQB 4DJEC 4F6LA 5BN3B 2IWHA 3ZS9A 4EGAA 4Q05A 3DUFB 1JXQA 4OJTA 1EESA 2O2HA 4B3FX 4B2PA 4E5DA 5EWLA 1IJBA 1MOZA 4WK0B 4B3XA 3ORHA 1O3YA 1OLOA 1TIPA 3AKEA 3IVMA 4NZNA 1HE5A 3UUEA 5K6AA 3SBEA 3COSA 2A58A 6AT1A 2JIBA 1US8A 3GK3A 1V35A 2GZMA 1Y9AA 3HCBA 4EHDA 4J7UA 1Y5MA 1XZHA 3S2IA 3ROQA 2X4LA 1DARA 3PXUA 3VKWA 3NHKA 4CN8A 4DMHA 4E2WA 3IDSA 4KQ1A 2WYIA 3R6DA 3WOHA 1UK6A 3A9UA 4AZSA 3CFYA 4KGDA 4Q4DA 3E7FA 5EXEA 3H3JA 5JH7B 3PX2A 5JTTA 3LE8A 1S4MA 4P26A 4UFOA 3GLHA 5LIPA 1M73E 2PCJA 2EKPA 3CD6B 3B1VA 1W7AA 4F6CA 4D0GA 1QPZA 3NFRA 2MCFA 4EPXA 2ZJ3A 5JCXA 4PPQA 2YJGA 4LZAA 2O2JA 4MUYA 4UEKA 2FG7C 3CEPB 3VI4B 2YYYA 5IYPA 2J5QA 1JDSA 2VJAA 3BWBA 4ZYWA 5HS6A 2A9OA 3WWPA 2HRDA 3I9MA 4N1AA 4C21A 1IFXA 2E21A 5A9RA 4PLHA 1PLKA 4OVKA 1Z5ZA 1BHQ1 1C4XA 2FG6C 3PC6A 4MYHA 1DSSG 2PIDA 3VQTA 4BV9A 1LSJA 3G88A 4YP6A 3T3EA 1A8HA 4KVFA 4TLAA 3DL7A 1JIQA 2F1IA 1DWQA 4I55F 4BFTA 4IGFA 3NLLA 4QBIA 2C9YA 3AK4A 3QEAZ 4WTOA 1UZMA 4PLVA 5BSGA 1N9GB 3NNNA 1VKNA 5FWXB 3ILXA 3LHKA 3R3WA 4HQKA 2X5NA 4DGQA 1ZK4A 3LT4A 3TQHA 1CDDA 4U0KA 2OBYA 1H2RS 1XF1A 3MBKA 4QOJA 4KFUA 2AOTA 2YVAA 5KTYA 3K0CC 1A2KC 3EEYA 3LQKA 4PG6A 4JBNA 5KSWB 1E4VA 2FF5A 1RC1A 2OGSA 4I1UA 4JY7A 4P5PA 4W82A 1U8EA 1J8QA 2B83A 3RVJA 1JIXA 2ECPA 4L0QA 1O0SA 2L19A 3ASYA 3CV3A 6PFKA 2C4TA 2WA2A 4YUXA 3SY8A 1U1GA 1G3MA 2IJGX 1JHOA 1QV9A 2P7HA 2CVZA 2W0MA 4NX2A 4PFQA 3L8FA 1KI9A 3B3FA 5I5GA 1U0EA 1YB7A 2VH1A 1QIEA 5FBZA 3K4QA 3O9VA 3PP8A 4MWDA 3RTCA 5A7FA 3GELA 2QU8A 5CVTA 2YXEA 3KHKA 4AW9A 2D7DA 1F48A 3X1MA 2ONYA 4I6GA 1XJCA 4MB6A 2A3NA 2WM9B 5HGJA 3VSCA 1EUQA 2DR2A 2H0RA 1Z7BA 5AIBA 5LVAA 1WDWB 1D2NA 1K28D 2YZ2A 3KUDA 1THTA 4LX8A 3ZG6A 1ODTC 4JLVA 1MVNA 5E4FA 5G4KB 3SHFA 3K20A 3LT1A 3GLFE 2FPIA 2OCIA 3WYCA 1EWVA 2OCDA 1YJNB 1O58A 2RH8A 4AQYB 4OSEA 4OHFA 1DUIA 3AUAA 2OR3A 4RSHA 1W25A 5D84A 5JJ5A 2RB5A 4GUDA 4R1OA 4OHZA 3L7MA 5BSMA 4V1CA 3EBLA 3SEJA 4B6GA 3LVFO 1BMQA 2O2SA 4EUNA 4ZT4A 4M38A 4HAUA 2Z2XA 3KTAB 1Z62A 1V9CA 3TOCA 3V7AA 3TXYA 1TC2A 4BU0A 2CWWA 4E31A 1OVGA 1GQ2A 2WVGA 4XJSA 5JDCC 2CHEA 3A58B 2FGJA 3FNFA 4B7AA 4MKZA 1CP3A 4Q7MB 1VZ2A 1GNSA 2JPDA 1KPGA 4M37A 4M98A 5C1PA 2VTBA 1QF7A 2TMKA 4L5IA 4FBMA 2PFKA 1ISGA 3DBRA 2R2AA 2Z6VA 4LRYA 2B7CA 1IULA 1U2PA 4UM5A 1QV7A 3MWDA 1SELA 3VH1A 4L4XA 1ABBA 1H8HA 3W2TA 5EJ2A 1Z8NA 3VR5H 4BN5A 1XK7A 2PZBA 4YASA 4N0EA 3ZVMA 1JQKA 3O74A 1VFPA 2ONZA 4TQ9A 2AOWA 4PTYA 1E9CA 2OP0A 1GQOA 1PO7A 4FXOA 3T4XA 3L79A 1MF7A 1VJSA 5FI5A 5SICE 2BISA 4Z7JA 3ZV3A 5KOJA 4KAXA 1M5RA 1NSFA 3U3ZA 4D4LA 4UBOA 1Y7TA 1AS0A 4PX5A 5KKAA 2B4TO 3OW7A 4BZQA 1KI2A 4HYQA 4J6FA 4UM9B 5KQSA 4KXXA 1K6JA 2RGAA 1QTIA 1XQWA 1VXOA 4EKNB 4EUHA 1GM5A 1MEOA 4DR3B 4QQRA 3RHZA 2O2CA 2VJPA 2GFIA 3GW8A 4G0YA 3VU9A 1JIJA 1IJFA 2P67A 1ISRA 3J81k 3Q88A 4NAVA 4UFNA 1T2AA 1M8PA 2GDZA 2V7XA 1L1EA 1XA0A 3NXKA 3IP6A 1OIWA 1WOMA 2GVDC 4FKZA 1WL8A 3FUCA 4H0CA 4A4DA 5B5SA 1DT5A 4E33A 2ODNA 4EY7A 3IBGA 1SD5A 1UUFA 3ZU3A 4DLZA 4NAHA 3TGPA 3G2OA 1XTRA 2OMKA 2WSBA 3Q4GA 1GCAA 1W94A 5JJBA 3GRAA 5T6MA 1MA3A 4GQAA 4JWKA 1KYQA 2ID7A 1DDOA 2DQKA 3OA2A 3U13A 2FEMA 1UEJA 5LFAA 3TKAA 2X85A 3JQAD 4BB6A 5EJEA 2H16A 2P3OA 2UVQA 3IT2A 4RQBA 1GP2A 1KK2A 1RRMA 1U90A 1NM5A 4LYJA 1ES9A 1BJKA 4BO0A 3R9XB 5FYDA 2VXOA 3F71A 4R31A 2B92A 2APJA 2XVMA 1FVHA 2I67A 3PENA 1UDWA 2CZQA 4L16A 4Q9JA 4DA0A 1NNUA 1V3UA 2J32A 5F78A 3U5ZB 2VYQA 4KU4A 2ZZGA 1NT4A 1WB6A 4UHDA 4PZ9A 1D2HA 2A9RA 3DFUA 2AQ8A 3QPDA 4TTJA 2PXHA 3KO8A 4AYTA 4OPVA 5C8DA 1OBHA 5ILQA 2KLBA 1HF3A 3L6DA 2O8BB 1CRWG 3QPAA 4UVHA 3H3XA 1T0BA 1JPNA 3IR5A 1N5MA 3K2EA 1SCQA 3L06A 5JXHA 2CFCA 5KEIA 5LZ2A 2BWJA 1Z3IX 3WGQA 4KQGA 4N0DA 1WBBA 5A88A 5HFJA 4A8TA 1I14A 2EIXA 1PN3A 2FWRA 1FYWA 2GWRA 3GLQA 4ESHA 4ZTZB 3U4HA 2IU4A 3UW1A 2ZUDA 2O2IA 3HBLA 4B44A 1PL8A 5F12A 2JW5A 5TQJA 1L4FA 1BJTA 1BVHA 3GRCA 3JVUA 4JQZA 5CXXA 1JQ5A 3SM9A 5KNCD 3SQDA 1SC1A 2AMJA 5LMUB 1IBSA 4BLVA 2RHOA 1IB0A 1Z4LA 3HY6A 4MW9A 3EXG1 4H3KB 1XZQA 1CUWA 3WLJA 2JBAB 2OV2A 3ZDBA 1MABB 5LU8A 4RY0A 1XRJA 1VPLA 2C5BA 1YR6A 4X7DA 3HCDA 1GKUB 4LHYA 3JATB 2OCBA 3L6OO 1QKJA 2H08A 4L8VA 1VQLB 1E69A 2O6LA 1L5FA 5AW5A 1QIHA 4GYKA 3S1LA 5J1SB 2HIAA 2W00A 3ADBA 1Z2DA 4YS6A 4Z7QB 1KK0A 3KE8A 1DC7A 1H5QA 2ZAIA 3FYUB 2J3HA 2OWDA 1JBKA 3BUSA 3U4AA 4PYMA 1NMEA 1Y1RA 2NYAA 5J4HA 4R2HA 1E4EB 4E5PA 4MGKR 4Z49A 4X92A 5BNFA 2J0SA 3GRRA 3UFXA 2G9UA 4ZCSA 1U7DA 2FPSA 1N2CA 3JASB 2A5DA 1Z63A 2NZUG 1J7KA 2D1YA 1NJ1A 3ESQA 3EGOA 3ZBTA 4DLWA 4ZOLF 3I1JA 4CM9A 2WSYB 3V1LA 3HZRA 4A23A 1IM8A 1UPBA 1YCHA 1Z6YA 2E5FA 3A9CA 2EG9A 4ZICA 3DTNA 3K0BA 3MJ4A 3ELUA 4DYDA 3ZI7A 2I1QA 3CP8A 4DMFA 2HCFA 4JXJA 3JZFA 2FP4A 2KM1A 3PEEA 1NVWQ 1RHUA 2PJUA 4RXTA 2XZLA 4PLZA 1TM5E 3UTDA 1T9CA 4LQDA 4C7OB 2A1UB 1XRQA 2VT2A 3OTOB 4QYIA 1VZ3A 2JKZA 4YRTA 4W5OA 2LTAA 5ESRA 4MUNA 5KQLA 1AB6A 1GPH1 3IOMA 4KHPB 2NUTA 3VJRA 1UJBA 3H5RA 3TVYA 4X3PA 3C7TA 1QORA 5LA6A 1RYEA 2GM9A 1FX0A 3ET4A 3HSYA 1FBNA 3G9TA 3QU7A 1WZ2A 3L18A 3O84A 3C5CA 3PA8A 4CKYA 4A91A 4QWWA 3PDHA 4RGVA 4ZCLA 2IXAA 1I7SB 4TSFD 3G3EA 4W9NC 5I51A 2MYNA 1GQQA 3O4VA 3LTNC 5MF6A 2F67A 1TJYA 3PYMA 1Q6YA 4KG7A 5F21A 3TE7A 4D99A 4OB8A 4OXRA 1AA6A 4NBRA 2PYZA 1H3FA 3C1TA 4CKBB 1YXMA 3PEYA 1N3IA 3D8UA 1EWYA 2B0CA 2MIIA 3KYIB 3L1HA 3RRMA 4A8PA 3CZCA 3BWYA 3T94A 2DHCA 1GTG1 3M6WA 2NZ2A 1EJ2A 1T8WA 4EJSC 3K8OE 2BFPA 4I4TA 2R5NA 1BCRB 1GKYA 2JGLA 3AQIA 4N8SA 4BGIA 4EJ2A 2DTEA 1ZMBA 4YQFA 2GJAA 4Q16A 3PXEA 2VNJA 2Y0BA 2XMSA 4BHTA 5B4TA 1DV2A 3AB7A 1CVRA 4DMGA 2BJHA 3B7WA 4S05A 2BN4A 2ZM6B 2ID8A 2WLTA 3FPAA 2GM3A 4S1WA 1T6XA 5IYZF 3BQMB 4CODB 1U0NA 3OTHA 3SJBA 2ZRKA 1L4MA 1OXSC 3VGPA 3SVZA 3OFKA 4A2CA 5DE3A 5CDFA 2IOFK 1MX1A 2JATA 3C74A 4I46A 2WYWA 3A06A 4IQFA 1YQTA 1IIRA 3MAAC 1T8RA 4CDRA 3QUSA 2ACVA 1SXJC 3A8KA 1EDDA 2V59A 2V0NA 2WW8A 1EMDA 4NU8X 2OV4A 4S2UA 4XASA 3TLZA 4CLOA 2DPHA 1E9RA 2Y6VA 4P7BA 1E9BA 2A6PA 4RVSA 2BMVA 3I58A 5FOQA 1JDTA 3WQQA 4QTTB 4CWAA 3K0CA 5DBOA 3ROFA 1TZJA 2PAAA 5H81A 4CMAA 4OUDA 3F5QA 1P0QA 3S81A 4HDSA 4XL9A 4RABA 4ALJA 2HFJA 2GPBA 3DAFA 5E9AA 1FPMA 4XIGS 1R0CA 3HCAA 3ZDXB 5BY2A 1VE1A 1ZIDA 1M5TA 2VEDA 3B6KA 3HRKA 4AP9A 4MUHA 2JJMA 2DT8A 4YJKA 2V6GA 2PBLA 3I83A 2GNOA 1ULSA 3UV7A 1XF9A 1QLWA 4UNSA 4I5IA 3CE9A 4K9KA 3TH5A 3GRZA 3N7UA 3CMAB 4U2FA 3THSA 1I0IA 3KKQA 3BTUA 3L4BC 4HAOA 2UYOA 3ZXSA 3UUFA 1OPXA 4F5WA 1STOA 1EHYA 4X41A 5A6VA 1CLEA 5JH7F 3ZE6A 1H3EA 3SOZA 3ZCQA 1R5NA 2HEIA 4C2AA 4WZEA 4D96A 1U2QA 2Q5IA 2VSOA 1S9HA 1C5KA 3GT4A 4X66B 3UMYA 1G19A 2IXGA 1QIGA 1AUXA 1O6ZA 1T91A 2GBIA 1XKLA 4WJLA 1GRQA 1VBKA 2BBTA 2ZZFA 1YJBA 2RSLA 3O8OB 3PE3A 1U3DA 2XWQA 3ZQ4A 4CQLA 3SDBA 4ZVVA 3GHHA 4BCDA 5C9ZA 2W8BB 1AF7A 1SFRA 4GSKA 4K46A 3MD0A 5HGXA 1WA5A 1FBTA 1UC4B 1GPLA 4HR7A 2WABA 2NU8A 3QXHA 3OCZA 4E12A 4Q00A 4CM3A 1ADJA 4OMDA 3BFJA 3RBVA 3T1QA 4B6EA 3AOGA 3T1NA 4BNUA 5I7FA 1IOLA 2W6QA 4DSOA 2H59A 2KBEA 2PH3A 2YN2A 5T6BA 2J0QA 1D7OA 4TTTS 2GARA 3D3JA 4HEQA 4PZ0A 3QFTA 1L8QA 3PNKA 3QXJA 4RVDA 4M54A 2XUAA 3DM9B 3MXOA 3OM1A 4RIFA 4YIKA 3T3PB 4URVR 2CLDX 2Q8QA 2IUEA 1GUFA 4O2AF 4B0PA 2EJUA 1E8NA 3I2JA 2Q1WA 3DVRX 1M74A 3HCOA 1UXOA 2Z1NA 1RRPA 2P2LA 1M2KA 1H4TA 1VG0B 4H60A 3WLTA 2KLHA 4B6RA 5LU9A 1JDJA 1ONSA 4H2DA 3SLKA 2YV2A 4RTRA 4OI0A 3CSSA 3B36A 3G1TA 1M6VB 5H3LA 3HJAA 4X71A 2ZBQA 2Z83A 1RS0A 1G2OA 1L4YA 3BSFA 2J3JA 1ZAYA 4BMPB 1BOOA 2ZEJA 3R5FA 1PFVA 5DNEA 4LFAB 1Y1PA 1LBEA 2BE7A 3QY9A 1VYUA 1TZMA 3DTVD 4G5YA 3HCRA 1G1AA 3H19A 5LQCA 3GZJA 1Q74A 4G7XA 3LX8A 3CM0A 2XB4A 6CHYA 1PR6A 2AC7A 2K2QB 3PV0A 4NBLA 4ENWA 1OAOC 4H7HA 1BLIA 2IZOA 3HI6A 3CZ5A 4QOSA 3A1NA 4N3AA 5ES4B 1OZAA 1RYZA 3QYJA 3T61A 4IUCS 3Q3IA 4WN3A 4MV7A 3ON5A 1WXWA 4G5OA 4NTZA 2OPHA 4KSYA 2V4DA 3GC6A 1WW2A 1ONOA 4UU1A 5E38A 4BX3A 4CM5A 2B34A 2EFEB 1T8UA 4YVFA 5F23A 4FZJA 2QN9A 2XD4A 3T34A 2F3TA 3FDXA 3ASZA 1HMYA 4YNBA 3UWKA 5EJ4A 3LC1O 4Z5XA 1QFXA 3G6WA 3NWJA 4G5XA 5JARA 3E5MA 4RM0A 1MHPA 5C1IA 3BMOB 2Z09A 5LKAA 4HV4A 3GEHA 5ELLA 5BUZA 2GPTA 4WGFA 4M0PA 3T7KA 1C4KA 1MB2A 1ZWLA 2BBOA 5D51S 4H1UA 1UBKS 4L4YA 1TMKA 2IW1A 4P8RA 2H3HA 1C0KA 3A25A 1JHVA 1H8ED 4UTOA 4W5HA 5D01A 4YX9A 1QAOA 2YMPA 2HLDA 2ZWIA 4Z4GA 3IURA 1X8JA 1K68A 3HYRA 2KJQA 3AOEC 4MRMA 3S2YA 2BF4A 1BSVA 1RWMA 3MS4A 3PDJA 1JXOA 1JFFA 3QK7A 4FI3C 2XNDD 4TWJA 4UDOA 3ZWBA 1KY2A 2PBRA 3TRHA 3DOEA 4XM1A 4EGFA 2AXNA 4CT0A 3F4LA 4JBGA 5TLSA 2DBQA 4DXDA 3TG8A 1BX0A 4Z4UA 2GA8A 4AJJA 2OPBA 4D57A 1ZBQA 4E5VA 1KMCA 4LQCA 2IS2A 4QG7A 2D1RA 1KJIA 5AK4A 2BIFA 2WVAA 2CXPA 4WLFA 4DDHA 5DGTA 2GREA 1T5LA 3UWDA 3V76A 3WL6A 5CFRA 4DVGA 1UKZA 2CE7A 2VPTA 4DCOA 1H6DA 1ZIYA 2C84A 2JH3A 1KP3A 1N0UA 1DX6A 2WIJA 2OKCA 3BICA 3GHYA 3TQCA 1KZGB 2BKXA 3A6LA 3R8XA 3KQSA 4HWPA 2J46A 3FSEA 5GPBA 1U02A 2VJMB 4AYXA 1MEJA 1WEKA 4WLEA 1PK7A 2DCUA 2P2CA 4DV2B 4D8TA 1O7JA 3UJDA 4QSMA 4YR9A 4YONB 2JAHA 4Y2JA 3BY1A 1Y5IA 5EXTA 3RC1A 1GPWB 3I5YA 3NH6A 1N7JA 4CUZA 1PV1A 3UCEA 3UPTA 2RARA 4QFCA 3Q85A 2AH5A 3PGJA 3VZCA 3ZWAA 3CZMA 3DC2A 4WXHA 1PT7A 4D4JA 1J20A 3O2SB 3QPUA 4H31A 1UQTA 1W0KD 3ZHRA 3BCSA 4XWGA 5DX1A 4DOMA 4AS1A 3G6EB 2BFDA 4GUAA 1A9TA 1C7QA 3W5AA 4Q7EA 4XUCA 3ZWVA 4BDTA 2WKRA 3PZRA 3MCAA 2V98A 1GZ3A 2J9FA 3DVSX 2YOHA 4OHKA 3RYIA 4CLDA 4WAUA 1BRMA 4J1TC 1M2VA 1CV2A 1Q82D 3P27A 1PR1A 2YOGA 1LF0A 3FH0A 5AWFC 1XN1A 4I08A 3ZHZA 2KI5A 2FA9A 3PNOA 5JSKA 1PL6A 4P53A 1GG8A 1ABFA 2VAMA 2WUDA 3GEBA 1OILA 2L2QA 2V6BA 1KSJA 3Q7QA 1UC9A 3BTSA 4RZSA 4UUPA 4BFZA 5IM4A 1DBIA 1URPA 2QVCA 3G0CA 5TEVA 3ROTA 4KN5A 4LHVA 3TLBA 1UBRS 1PJ3A 3BGSA 1CU1A 4QM6A 4TYWA 4Y9DA 2VDLB 5CA0A 2XYVA 3DCNA 2UYHA 1K0FA 1ULZA 3IT1A 3N70A 1W9HA 2H1IA 3AHDA 4IOJA 3P4UA 3TLAA 2QENA 2G5GX 3V7NA 2P2SA 3RFTA 1TVKB 4RCZA 1WD7A 2FY8A 1R00A 2HMVA 1V7QA 2QG9A 3DO5A 5DX8A 2WU4A 1NTOA 1HDIA 1NNLA 1O57A 2FX3A 3A6KA 4Y2XA 5D1HA 2CNKA 3EIQA 4C29A 1MRSA 4C22A 2C5AA 2QRQA 4MGEA 4L22A 2HNBA 2QNBA 3E9YA 4M9XA 4QXPA 2HZ7A 1D6SA 1H22A 2WM2A 2XUKA 4UBKA 4BUZA 1JA9A 4XUDA 4EHJA 2OWEA 2X9VA 5LZ8A 3HR7A 2ZETA 1L5HB 1OXBB 2C95A 2FN9A 2W2NA 3FBGA 4AX4A 3FZNA 3ZHSA 5E2BA 4DARA 1UD2A 2V7TA 3RSZA 3ZY2A 4KWIA 4AXXA 1KZ6A 3HH8A 1P5HA 1V6CA 5DM0A 1RJ9A 3CPWB 1X8XA 4U0JA 1THMA 2Y99A 1IHUA 4DGSA 1IAVA 3N2KB 3PUJA 2WD7B 1TD1A 4OL0A 3KQNA 2H00A 2IE8A 2JEZA 3QLJA 1NOIA 4XAQA 4BNFA 1MP0A 2PUVA 2R1UA 3AHFA 1WP6A 1SXJB 2FV8A 3CTPA 4XB1A 5TS3A 4DLTA 4RHFA 2XITA 4BQQA 1QOQB 3TPFA 3QVJA 1GITA 5IKXA 5JI3E 4EHNA 1SB9A 2IYPA 5EERA 3OP4A 2RGBA 2R7LA 4Q5IA 1SZCA 3GVKA 5G0TA 3U7JA 5AVVA 3RIEA 4ND7A 2ZUFA 2DWUA 4Y0NA 2BLNA 1BIFA 1YD7A 3OLQA 2VSXA 5LA6F 1UBUS 4LQLA 3PITA 1FQOA 5LB2A 4GXRA 4RSGA 4YDHB 3R7WA 5GTDA 1CUSA 1U1EA 1UK7A 1YDMA 2FK8A 4D3YA 2H29A 1ZM3A 2AJ8A 3IERA 1QS0B 5EXSA 3ZDDA 5G2OA 5BYBA 3A6EA 4US0R 5KSZA 1LVGA 2BM0A 2Z5FA 4EVRA 4M87A 4F5EA 4MGYR 4D42A 1Y1TA 2NPOA 2HJVA 2Z9DA 3B2EA 2R8XA 3D8BA 2CXRA 1G3QA 4BS9A 2B61A 4A0FA 1E7MA 3RVKA 5TC4A 4AO7A 1KGDA 3E82A 3AB8A 1D1SA 1GYPA 3QNUA 3IOCA 4OOFA 1YZUA 1I7LA 1E3SA 1N6HA 1L7BA 2WJWA 4GD3Q 1QWSA 5ALYA 3JPYA 1D4AA 2HXGA 3IH5A 2PVSA 4UDYX 1UD8A 1GAJA 1GZVA 1UP7A 2K87A 3EZGA 3FNRA 4AJ4A 1LPOA 3GA0A 2EQ5A 2Q27A 2ZRLA 4WNAB 3TBFA 5D6OA 5AXDA 1E7RA 1H1LA 5HIMA 4FBLA 3TTVA 1NE7A 4HOYA 5JNTA 2SCUA 4M7RA 2FRXA 4E5UA 2WT8A 3G1WA 2NXCA 1OAKA 2IYLD 5COAA 4KIFA 5DI3B 4IWYA 4N82A 1QPBA 1NYLA 1G4UR 2H2AA 1JEJA 1Y3FE 2QG6A 3CN7A 3ETGA 3N28A 4Q4HA 3PYLA 2JJ2A 2I9PA 3HN7A 1XELA 3R41A 4LPSA 5CHYA 3BA1A 4CM6A 1GZSA 3L40A 3ODPA 3Q10A 3M4YA 3EZ9A 1PG5A 2AG8A 5JJCA 1Z3CA 4UNNA 1DE0A 2VHVA 2ZYVX 3C6ZA 4GZ3A 3CUUA 3QH4A 1EVEA 1DOAA 2GVZC 4I1PA 5C32A 4Y67A 1KZ9A 2CXHA 1WHSB 2ADOA 1OLSA 4ZXPA 2CFIA 3G5TA 1KY3A 3CO0S 1ZN9A 1E2JA 4TTVA 4DXAA 4ENVA 1CDEA 1PS9A 2CYCA 1Q2XA 1IOVA 1Q7TA 1PKVA 1MX5A 1WQ4A 1WB5A 1WUHS 1T2VA 1XWFA 1YGYA 2H52A 4R2MA 5TS2A 3ROPA 3IQXA 4ZAGA 1I33A 1WKVA 3AINA 1E3QA 2MSKA 1L8XA 1FSSA 3HE3A 3NRBA 5SYAA 5C3MA 3LGXA 2D1TA 2OCXA 4NYMQ 3KETA 1UBCA 3RSGA 4R54A 3QPVA 3WLLA 4AAYA 5LD2C 1SK8A 2R84A 1OA0A 3UT6A 1YJAA 3W5VA 5CT4A 3IMFA 4JNCA 5HX7A 1ZM4A 3QVSA 4ZI5A 5KNDA 1UMKA 3SM3A 3HWWA 4JLDA 3G2HA 4PSCA 2ON6A 3V8BA 3RSCA 2PGAA 5HRCA 2CKDA 1Z2PX 2QW8A 4LRXA 1K8ZB 1G5HA 1OV4A 5IAEA 2PLNA 2BFFB 1VC2A 2HA3A 3D59A 1RFLA 3OFVA 4C1NA 4CRWB 3PUIA 2Q2OA 3A1EA 1G20B 4AJ9A 1ZNZA 2WM3A 2DCMA 3KJFA 4KNYA 4HNVA 3CRZA 4Q4LA 1Z74A 3L9XA 5EMLA 2P6PA 2DC1A 3NGMA 4M2LA 4NZYA 3LX4A 4AZ0A 4EB0A 5JZVA 4FFBA 1VSUA 3VNRA 4LRWA 4Y9UA 1NF3A 2E2WA 2ZI3A 3JWPA 4RJKA 4MUEA 2BCJQ 1N2HA 3CF4G 3IEXA 3RKSA 4EQZA 2R6FA 3V4OA 4DV6B 1NXXA 2OO5C 3NX4A 3U81A 3DZ8A 1P2SA 4S12A 2G1AA 1QE0A 3ND6A 5FTKA 2HK9A 1MQ9A 2HCTA 3CRQA 4PAGA 4R6XA 4CMJA 3GLFA 3ZH9B 2W2KA 4XOTA 4CZ2A 3MFYA 3CUKA 5IXJA 2ZIWB 1SBZA 4DG9A 3EN0A 3A6GA 3V1MA 2I7VA 4QARA 4Y6QA 1QZXA 3IT0A 3MINB 5ALJA 5AKXA 3VR4A 3ZW7A 4CEIB 5J35A 3W2IA 2W6CX 5BT9A 1VIDA 4BNHA 2IOQA 1A9RA 2ETXA 2C2OA 1E9FA 1H65A 2HWXA 4LV6A 3CX3A 4IDHA 1Y81A 4URYR 3AUKA 2Q0HA 4H4CA 4NAUA 1FP4B 1PSWA 3FZQA 4ZZ2A 4AU1A 2QT9A 4BJ1A 1QH9A 3BDVA 5EMMA 4F11A 1JR3A 3KPVA 3WRXA 3U56A 3GMDA 3LQ4A 1P2VA 1UMDA 3HKCB 3OIWA 1HRDA 2A9QA 4EA7A 4HLUA 2HQSA 2IEZA 2DWOA 4FFWA 2JAXA 4KUGA 4XVRA 5JR3A 1ESNA 1HBJA 2ZAMA 4ITRC 4ZRDA 3VVBA 1C3EA 1ZICA 2DBRA 1G7TA 1L4BA 2I3GA 2YHIA 4U7TB 4BDSA 2H1OA 1XU9A 2JFFA 4TKZA 5DLPA 3T6KA 1E2MA 2CW5A 3LJKA 4GVLA 1TO2E 3FHLA 4AF7A 2FX2A 2RI0A 5AW2A 3RYCB 1Z2NX 2OBRA 3KT8A 4B31A 3A1UA 4RV4A 3RG8A 3WJ1A 5NLLA 1NF8A 4R9SA 4GLOA 3EVDA 3B6IA 1EFVB 4MWOA 4DMRA 4R2IA 5G1PA 1PK9A 2R5WA 2G5PA 1DT3A 1N32B 3LWNA 3IUSA 4YJ3A 1FFAA 2PV7A 1KEUA 2FW9A 4OFXA 4Q7JB 1ND5A 1KVQA 2B3DA 3JR7A 4HLUC 3OJWA 3QVGA 2UUOA 2DHQA 1N6PA 3Q6NA 4UTXA 3B1FA 4XQ9A 4YJ3F 1Y9EA 3R09A 4I8IA 1EFUA 1PT6A 2QLBA 3A11A 3LSTA 4CEJA 2ZDQA 3MWEB 1XTJA 3HG7A 4AVYA 3CX7A 3NHBA 3FOCA 4LVNA 3JWJA 3U0VA 5IVKA 4EEKA 1QIDA 3DHWC 3FTQA 3GOHA 4H3SA 3ZGVA 3K5HA 3OT1B 5D2CA 1SQGA 1ZYUA 4F56A 1IQ0A 1TTHA 5KINB 1C3LA 4PEVA 3UGJA 1BH6A 4BNTA 1JR3E 5JFGA 2X6XA 4AG6A 5CAEA 2A5FA 3RFVA 3G7UA 2WQZA 4DCGA 1VHQA 1VKOA 2UVPA 5CH8A 5DTQA 4FI3F 3UXHA 1TAGA 3Q8XB 4DV5B 3L8ZA 2HCBA 3KYJB 1CVLA 4P4UA 5E3HA 4EMTA 4N8EA 2UZAA 4U9UA 5B3JC 5EE3A 4C0QC 3GVLA 2VDOB 4GQNA 421PA 1CZRA 5ALLA 4LSMA 3W6NA 4KR2A 1RZVA 1XDWA 1B23P 3Q0EA 3RVRA 1TFUA 1D9ZA 1G21B 1S2MA 2FLVA 1SHZA 3B6ZA 5IAGA 1CQXA 5LMZA 4TMXA 2BFAA 4ZOEA 1A9YA 4I5FA 4IIBA 3DC7A 5DGXA 4CQMD 1HNWB 2DTXA 5KJCA 5BURA 4BRWA 1HO3A 1IHDA 4XNFA 1U8YA 3BH4A 4NCNA 3GUVA 4QPDA 4BASA 4W5NA 2A78A 1BYUA 3SR0A 1RZRD 4PXAA 3D8TA 5ARDA 5JC8A 1XDGA 4W1PA 3JVDA 2PX5A 3BKWA 3TSWA 5ADWA 1JHAA 1B2LA 4JI0B 2FWAA 3LQ1A 4ZOLA 5FTWA 1TRHA 2G1PA 4RU1A 3H84A 3QSYA 2Y9MB 3T7EA 4LF6B 2R68A 4QXOA 4EHIA 1PTJC 1PJ6A 1SBCA 2E4AA 3BFKA 3E35A 4K81B 1FTSA 1A2QA 3KSZO 2LCQA 3EVZA 4O4IB 2YWBA 2HJRA 4V0LA 2XCLA 3PI7A 5D86A 1W8IA 4BFYA 4H7IA 4B3MB 1ONBA 3Q7TA 2JVKA 2N46A 1M3SA 1E79A 1HZEA 1NRIA 4HWRA 4TS3A 1WDKA 3WHIA 1TM1E 3O9MA 4BE7B 4BCCA 3AV0B 4YDSA 5T3YA 4G7WA 1AQYA 1W4BA 2PLRA 3SEQA 4M6WB 2HLHA 3ED1A 4EEZA 1VLZA 2HDNB 4MRSA 4Z54A 2IDJA 1S8AA 2QT0A 3DAYA 2C3PA 3MAGA 4H08A 5F7JA 2V9PA 3AETB 3PUHA 4DV3B 2E18A 5JS8A 1IY8A 3AESA 2WF7A 4YJFB 3WAKA 4J2TA 4UAJA 1E92A 1N8NA 1C7RA 4O0LA 2GVNA 2ZYWX 4OTZA 2PNJA 1E2DA 3ID6C 4XTRA 1HXHA 2FOLA 1EFRD 1ZJ4A 4QNRA 5CLHA 3RGGA 3DVQX 1VQ5B 3U9SA 5KVAA 3RIGA 2JJYA 2KVOA 5JJKA 1IN8A 5IAJA 5EFZA 5EHIA 5J2UF 5DBHX 2C92A 2WJGA 5FWYB 1WAMA 1U4SA 5ES3A 3U49A 3TTXA 3P19A 5JSQA 1AHIA 2D54A 2D62A 4JHLA 1AZTA 1TKCA 1SG0A 2OO7A 4RIEA 4WY8A 3TINA 5FOWA 1C4WA 3T5GA 2QWXA 2VK8A 3OPNA 4RW0A 5KAMA 3T7RA 4PFSA 2G67A 1N7GA 4ETMA 5AI8A 2GXAA 4PPNA 3PLAE 1RXEA 3T5MA 2ZQYA 1ZC4A 5BR8B 2OMEA 2I2DA 3L0ZA 3NYIA 3PXXA 5FPHA 3OQHA 3DW1X 4HNAB 1ZRMA 4E0BA 1Q6ZA 3ESAA 1DQNA 2FFBA 3CJTA 3TEMA 4Z7NB 4Z4CA 5LKRA 3ND9A 3H1PA 2DYIA 4I50B 4HIZA 3V34A 4WV3A 1Q15A 2PBZA 1ONPA 1Z6AA 2FN4A 3GU3A 4MI1A 4CLHA 5JQGA 1SC3A 2BGIA 2VJCA 2IDZA 4QYSA 1IVSA 4JEUA 3D1JA 4KCGA 2ZXUA 4CL3A 2D4AA 1X6VA 3UXYA 1ND6A 1OHHD 1RXVA 3FNQA 1KO7A 1MPXA 3D43A 5E7IA 2LUOA 5FOXA 3ZJYA 1TJPB 1KMIY 2UZ1B 2GLXA 3CO5A 3ZDAA 1Q0LA 3L6UA 3ANYB 1VYTA 1RMYA 2EEZA 5K3BA 4KOEC 5IDQA 1T4BA 3ENWA 4GZ5A 1SIWA 1SHLA 3LTEA 3DCJA 3V1YA 5JADA 2XIQA 5PGMA 3G79A 4MW7A 5HIKA 1G8KA 2R86A 1E0JA 1QYVA 3G2NA 2WQ6A 1OX4B 3HKEA 4KW7A 2GCOA 1G55A 2QW1A 3I52A 4UM7A 4NXNB 4TMVA 3FPGA 3KSUA 2HTFA 3P45A 3C6BA 4M1MA 1A04A 1G7RA 2JIQA 1C9EA 1WX1A 4PV7A 2GD2A 2OXEA 2FLWA 3I8SA 4GGPA 2REBA 3RFCA 3ZW9A 1TW2A 1TA0A 1JEEA 1N92A 2FR8A 2ZSUA 4U9IS 2C94A 3PNMA 5EE5B 2NSDA 4B6QA 1W36B 2Q5LA 3FW1A 5IASA 3I6ZA 5H8WA 2XQGA 4WEQA 3UBTA 1GRNA 3KKLA 4DY4A 4G4SO 5E9JA 1DG1G 1UF9A 4LOKA 3O82A 4N49A 4NG5A 4NMWA 4TLMB 5SY6A 1CFZA 1U2SA 1KU0A 3JSAA 3K5IA 1DCMA 4EPWA 2Q5QA 121PA 1G9TA 4KMOA 1UBOS 4G09A 3ZHBA 1U3FA 5BSHA 1FUIA 1HG0A 3V8MA 1R15A 1YA8A 1KTIA 1PV2A 1T4CB 3I42A 4KE7A 3MFQA 1R0LA 1M34A 4IXNA 1E79D 2O6HA 1PR0A 1XVLA 2ACKA 2C4WA 5DYNA 2H48A 3HWSA 3OM9A 5I5EA 2DLCX 3ANNA 2C57A 1ZGAA 2VEOA 3FY4A 4QJ3A 1HDEA 4QTXA 1IZ0A 4LNAA 2Q3JA 2X0IA 1FDIA 1DBQA 1E2FA 5L40A 2PR7A 1JRLA 2GRAA 4P3XA 4U02A 3LG2A 3H8WA 3TD2A 1ZD3A 1CPYA 2OHHA 3OSZA 1VJ0A 4E07A 4DRXA 2H1WA 5IEBA 4KQCA 4RDKA 3QU5A 4JXZA 2FB9A 3LFTA 3EOZA 3PUKA 3AL2A 1WR8A 2EBWA 2P0YA 2XMDA 3TUIC 1AO3A 4OQNA 4OAQA 1AN0A 1O96B 1R16A 2HNAA 4X8HA 3DDCA 3VNVA 4M0CA 1XPJA 3TX2A 5P21A 3UJHA 1GTVA 4EHLA 5DWVA 4YCSA 2PUEA 4RLHA 5HP4A 1F6WA 3CZ9A 2GBLA 3LP6A 1A8SA 5J3OA 4RADA 1JFRA 3FA2A 4L74A 1BN7A 2QTGA 1WETA 1T6NA 2ES4A 3R6LA 5JPDA 1CQJA 5FL3A 4XOIA 5CDUA 1YHNA 1IK6A 1XMSA 3Q3AA 3BAZA 2A8YA 3HB7A 1G0OA 1NKTA 5C7YA 2IU3A 1O4WA 1GLVA 4QOGA 4Q1BA 1TQ6A 4LC1A 2VRCD 1BXGA 3ZLTA 4Y8VA 1NXQA 1JYSA 2G17A 4X65B 3T9AA 2XX3A 4BAGA 2NYUA 5AW1A 1T1EA 1P4RA 3HA7A 2DSTA 1J9ZA 3SE7A 5JASA 1CUZA 3GFPA 1JIVA 1EM8A 3NATA 4A15A 2EQAA 1QC5B 4ZEOA 5JRZA 2JFUA 1MOQA 2NUAA 3AI7A 3BWCA 2PZ8A 5CJ2A 3HU3A 4LC9A 1A76A 3WL4A 3SQXA 2P69A 3JV7A 1GG2A 4WZBA 4Q7KA 5EIEA 3RAPR 1Y9JA 3CNBA 1SQ6A 3O8QA 2X9LA 5FJIA 4J1QA 1VCHA 3I8OA 3EIWA 1RLIA 3K1ZA 3WK4A 4RQUA 3IEVA 1K5HA 4EB8A 1YULA 4BMNA 4WXYB 1UAGA 4WLUA 3WV4A 1CR6A 1T6YA 5F9HA 2QMZA 3ELWA 1LKZA 3OM0A 3QJGA 4WRRA 1LH0A 4N6NA 4XDGA 4TUYB 3I2HA 3DBRB 4KLNA 3L8YA 4Q9KA 1O6FA 4J90A 1H2AS 4Y2YA 3FNHA 3RYHB 3EQZA 3OPXA 4UTPA 1O5TA 1R0KA 1UINA 3U7EB 5B6PA 2EFYA 3QQPA 1YF3A 2P0EA 3I55B 2QTCA 3ONUA 1LTKA 2FKAA 2Q4DA 5LP1A 1F5NA