1F20A

Crystal structure of rat neuronal nitric-oxide synthase fad/nadp+ domain at 1.9a resolution.
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
435
structure length
435
Chain Sequence
SWKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the FAD/NADPH-binding domain of rat neuronal nitric-oxide synthase. Comparisons with NADPH-cytochrome P450 oxidoreductase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords NITRIC-OXIDE SYNTHASE
total genus 141
structure length 435
sequence length 435
ec nomenclature ec 1.14.13.39: Nitric-oxide synthase (NADPH).
pdb deposition date 2000-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00667 FAD_binding_1 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.990.10 Mainly Alpha Up-down Bundle NADPH-cytochrome p450 Reductase; Chain A, domain 3 NADPH-cytochrome p450 Reductase; Chain A, domain 3 1f20A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1f20A03
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1f20A01
1R5BA 1NJID 4C0SA 2R6HA 2RC6A 4Y7CA 2YWFA 3WYAA 1DDIA 2BM0A 3VO1A 2QN6A 1VQLB 4QHYA 1TTTA 2QTZA 1FDRA 1N0VC 1GVHA 1QFJA 1DARA 5H5JA 1N0UA 1W34A 5AN9A 1D1NA 3OZWA 4YALA 4YAWA 4DQLA 1CNFA 4RJLA 3I56B 3W2GA 3CCUB 4TMXA 2BF4A 1VQKB 3JQPA 1KK2A 3J81k 3ZBUA 2C78A 3VO2A 3QE2A 3WBKA 4ZGNB 3FPKA 2PIAA 5TV2A 1D2EA 4G5GA 4B48A 2ZITA 1FNDA 2YWEA 3JQRA 1F60A 4ZCLA 4TMTA 1EXMA 1FRNA 4PC3A 1A8PA 3MHPA 1G7TA 1OB2A 1ELOA 2YWHA 1FNCA 4EH1A 1XB2A 1J9ZA 4PC1A 4Q7JB 4TMZA 1S72B 3WXMA 2GQFA 2BPOA 3AVXA 4MYTA 2EIXA 2B7BA 1CQXA 3CMEB 2VZLA 1Q7YD 1EP1B 1ZM2A 3OJXA 4RCZA 3MMPA 1VQNB 5H59A 1BX0A 2PMDA 2XEXA 4M4SA 3LYUA 1VQMB 3CC4B 1JJ2B 3PENA 4RD4A 3OZUA 1E63A 5HXBA 1K9MD 3I1FA 3W2IA 1OGJA 1FNMA 1TUIA 5THXA 2CRVA 1YJWB 1KK3A 3MCAA 4IW3B 3FJOA 3QFRA 1EFTA 1KJZA 5GV8A 2B5OA 1GJRA 2BGIA 2XNJA 1GR1A 3CRZA 1FNBA 2EFGA 2VNJA 4LBYA 1S0UA 2QTLA 4RD2A 4UAJA 4M53A 1YJNB 4PC2A 4RD3A 1CNEA 1DDGA 4ZGQB 3E20A 1BQEA 1QFYA 1Q86D 3WBJA 1G7SA 2HDNB 4TMWA 1H85A 3ZBTA 3ZZ0A 2DETA 4MYUA 3VNVA 4P3YA 1TVCA 4J0QA 3W2EA 1N8RD 3VMFA 5TR9A 4HE5A 5JBQA 2FX3A 2DCUA 3CC7B 1U2RA 5GV7A 1IJFA 1KRHA 1VQ9B 2GPJA 2VNKA 4C43A 3QFSA 3V76A 3CCJB 1GO2A 2BVNA 3CB4A 1BJKA 4G1BA 3QSYA 1F20A 4RD6A 1KD1D 3W2FA 1KK1A 3U6BA 3JQQA 4YAFA 3E1YE 1R5NA 2RC5A 1W2BB 5FA6A 1JB9A 2NPFA 1QUEA 4Y9RA 2QDXA 3W5VA 2BM1A 2OTJB 1OB5A 1D8TA 2VNIA 3B8HA 4LBZA 1QUFA 1KTVA 4ZCMA 3AVTA 1B2RA 4AC9A 1YHQB 4YAUA 3QFCA 1EP2B 1ZM4A 2C77A 4LC0A 3CXCB 1E64A 4BPRA 1ZM3A 1KQSB 2BGJA 2J7KA 1AIPA 2XNCA 1QFZA 3AVWA 3U2QA 2B7CA 3ZC3A 1TLLA 3LO8A 1EWYA 4H9GA 3CCEB 1JA0A 2BV3A 4LBVA 1G7CA 1QH0A 4FK8A 1KK0A 1JNYA 4K1XA 3OZVA 4PGOA 5KSWB 1QGZA 3WNCA 2AHOA 1VQ6B 3WNBA 2QA4B 1GAQA 3CC2B 1SM4A 4P6VF 3ZZTA 1Q81D 4N3NA 3ES9A 1UMKA 4LBWA 1IJEA 1SKQA 4PC6A 1QX4A 1K73D 4R71A 2CNDA 3AVVA 5EMNA 3ZZUA 4YAOA 3G71B 3WNDA 4ZV4A 4N3GA 4WQMA 1ZM9A 4TMVA 1HA3A 5TY0A 3P26A 3CD6B 1QGAA 3OJWA 3U6KA 1G7RA 4ACBA 4B3XA 1R5OA 1ZUNB 3SJZA 1GAWA 4NBSA 3CCQB 1VQ7B 1VQ8B 1BX1A 1M90D 2BSAA 3I55B 4ZCIA 1E62A 3W2HA 1EFCA 4DQKA 2E1RA 3CMAB 3AGPA 1H42A 3P27A 4FN5A 1WDTA 2DERA 2X3UA 1I7PA 1W35A 2D74A 4AF7A 4U9UA 1VQPB 1VQOB 4M2LA 2PLFA 4ACAA 4B47A 1QGYA 1YI2B 4B44A 1DG1G 3OW2B 2DEUA 2OTLB 1QVGB 3LVBA 4TN1A 4F7DA 3A1FA 4PC7A 5DSZA 4Y9UA 4RD1A 3G6EB 4G1VA 2OK8A 3B82A 1EP3B 1QVFB 3WY9A 1KC8D 3W5HA 2HCJB 3CCLB 4B43A 4RD0A 1Q82D 1B23P 3CCMB 3AVYA 4QFMA 1W87A 1VQ5B 3LRXA 2HMAA 1EFUA 4FWTA 3CCVB 2QEXB 1K8AD 3CW2A 1XE1A 2VNHA 1VQ4B 3B78A 3CPWB 4HE6A 1FRQA 1AMOA 3VNUA 2BN4A 1OGIA 3AGQA 3CCSB 3G4SB 4M0LA 4RCYA 1YJ9B 1NDHA 2YWGA 1JA1A 2QMUA 2OK7A 4AF6A 3CCRB 2DY1A 1QG0A 4NCNA 3AVUA 4B4DA 3QFTA 3W5UA 4M1KA 1YITB 4YHBA 1IB0A 1YIJB 2VYQA 1M1KD 2BMWA
chains in the Genus database with same CATH superfamily
3PDIB 2CFOA 3KKPA 4RL6A 2VSYA 3QVTA 2H5EA 4MI9A 3UC9A 3L06A 2VBGA 3Q3VA 2ADOA 2R8EA 3R09A 4GX0A 4IQ0A 2GM9A 4KO8A 4L85A 1NU6A 5CH5A 3R3SA 1ZQ9A 4R0NA 2HMWA 1WG8A 2G06A 4RF3A 3TRHA 3BTSA 3ZWPA 2OBBA 5J4LA 4ZYTA 4X84A 4FSXA 3EXFA 4QG3A 4B6JA 2JBAA 3ORHA 4CIBA 5KTNA 1FFXB 1DHRA 2JBHA 2VJIA 3L4BC 2BMAA 3QYAA 1WNTA 2QV0A 4JU9A 2BWJA 3EIFA 1HC7A 1G291 3FRHA 3GHYA 1KVUA 4N54A 4QGSA 2G1UA 1M73E 4WASA 3I05A 2ECKA 2VYVA 5HE9A 1XQXA 3I4CA 3FSRA 3VDRA 3KQHA 4LQLA 4YP6A 3NM6B 1JHMA 4B74A 2Q1XA 5HR5A 3FE2A 2D7CA 3PT5A 4IH1A 5HGJA 2Z8ZA 3OZWA 3O84A 2O3UA 1AZSC 4P93A 1UKCA 4QFDA 3K9WA 3FBTA 4CI0B 5HIIA 3ZHVA 4D9KA 2VP9A 3ZHQA 1FQJA 3S68A 1Z4KA 3HWSA 3O7WA 4FMPA 1H2EA 2CGEA 1L3IA 4JFAA 4UBLA 4AP6A 3K2QA 2DIEA 2JAOA 3FOZA 1V1RA 3R3XA 4MKGA 3DMYA 1IATA 1EUYA 3E3OA 5EFZA 2F8TA 2NPIA 4FYPA 1ORWA 2Y4NA 3PYMA 4L5CA 4D42A 4OYRA 4TX1A 2ADMA 5JALA 4MWBA 2E4VA 3SY8A 3QE2A 1K8RA 3SHWA 1EE9A 4KXFB 3T06B 3GLRA 1UPTA 2FVGA 2CYAA 8LDHA 2PM8A 3RSLA 3MK31 5BNZA 3B6JA 4QYMA 1YQXA 2R2AA 1PJ6A 4QDUA 4BNJA 2CBZA 2LKDA 3G5LA 2ZBRA 4PANA 2ZIGA 1HYGA 1Z45A 3HUUA 5AHXA 1FJ2A 2Z2IA 3M6UA 4LZJA 3SM3A 1XTBA 1U8EA 1E9AA 2XB8A 3L8ZA 4M0EA 1R6UA 5DM2A 3UM9A 3O4IA 1YZNA 1UEXC 4NV0A 1A8PA 1UBHS 2IK8A 2HOQA 4FGLA 5K7SA 4WJLA 1ZUD1 5FP0A 4A2QA 1ES9A 4FQ7A 4DR1B 3QVVA 3UK0A 3SMVA 1UL1X 5KJ1A 4ZEOA 3U4AA 3K8QA 3W77A 5K2OA 4EH1A 1LBHA 3K6RA 1JYFA 1PJ3A 1XLTA 3R3UA 4JFRA 4UTRA 3UHAA 2WF6A 4RULA 4IMJB 3U44A 2O1SA 4LHSA 5M5BA 1VIAA 4JDUA 3T54A 2AOUA 3LMKA 3MJEA 3OW7A 3ZTYA 5LVAA 1R6BX 4AY6A 1UOQA 2ZETA 1Z2AA 3Q40A 1SNYA 3IDZA 2J30A 4CMIA 1WUHS 1BHQ1 1CETA 1Q1EA 3NT2A 5GVRA 3JASA 3HPRA 2C82A 1GZ7A 3N8HA 2X2FA 4I50A 4YGYA 3RH0A 4LAFA 2DPMA 4ASUD 3OX2A 2CXOA 2XRMA 4KAFA 4LKRA 1Y7PA 4GPZA 2EJTA 4P58A 4J1TA 3ZS9A 1HQKA 4CTOA 4M4SA 3LYUA 3GRUA 4OHCA 1YB2A 1RABA 4J75A 1II0A 3C4QA 3HDYA 3O9MA 1FZQA 3UW3A 1WB4A 1YOVB 3OZUA 1G16A 1NKTA 1PUJA 3FLEA 3HXPA 3N87A 4WDRA 1LQ2A 3GUZA 4ZV9A 5KC9A 5ICCA 5KYNA 1C4KA 1SIOA 1YB6A 3NQ41 4AM8A 1F1JA 1X8XA 3G13A 2W90A 4EO9A 4HT3B 2OYCA 1O9HA 3T8YA 5KOYA 2JATA 4C89A 1HE8B 1WBDA 3ANMA 2DAPA 5B4VA 1BZYA 2I22A 1QE3A 3CU5A 2VDVE 3DEZA 1JU4A 3COZA 2XGMA 3T1NA 3LT1A 5LZ8A 3LH5A 4A8JC 3ZJVA 2ONYA 4WZLA 1PLLA 4S0XA 3IIIA 3QZUA 3C3MA 1UC5B 1GR1A 1IONA 2CNKA 1EA7A 2Q29A 5KQPA 3PQ4A 1VHDA 4ZDKA 4GC5A 2EQBA 4A0SA 3OPXA 4EF5A 5L51A 3L04A 3KTDA 3PRYA 2ZR9A 4HUJA 1XNRB 3PKJA 3Q11A 4TWJA 3KPJA 3N7TA 5BRNA 1EHYA 1MZVA 2QYTA 4WZAA 3TZHA 1ZOOA 5C8VA 3ER8A 3GOHA 4HYTA 2GZ3A 4DMLA 4ZEWA 3BE8A 5BQFA 4BMNA 4J16C 3EXAA 4IDHA 1M8KA 1BCRA 3A2NA 3ZDXB 2FFQA 3F8TA 4X8HA 2WBLC 1OASA 4WCFC 4HFRA 4HQLA 2D1SA 3UG6A 3X1JA 3R2JA 2YYSA 3RADC 1P18A 3DF9A 1ODLA 3WB9A 4ZKDA 2QMQA 4NBVA 1JFVA 4U9IS 5E1OA 4YY3B 1WXEA 4CFSA 4EL0A 2CV2A 4OHRA 1KQPA 4TZ6A 4C6RA 5AKHA 5I8WA 4RGVA 4W1SA 1GU0A 1EXDA 1VYVA 1Z12A 1G5HA 2RDMA 4IL5A 1XXHA 3LLVA 5C18A 3QOFA 1WUYA 4OUDB 3W7VA 1ZNWA 3E61A 4R4JA 3T7SA 5IF3A 3R0QA 3JD4A 2WQ6A 2IHNA 2I4OA 4HX2A 4J1SA 1TU0A 3AOEA 4AZ0B 4JKIA 2ZIFA 4X1KB 4C5CA 4CNQA 2F8MA 1O5IA 3ABOB 2JZOA 1WVGA 5B7NA 2GPJA 4XIFA 1XP5A 3KOMA 2BGWA 1NVVQ 3L8HA 3WSTA 1KH1A 3VR5A 4C6TB 2I71A 2C2WA 2FSHA 2PUAA 5E2BA 1AGNA 4P33A 4HX9A 3P4YA 2TMGA 2EP7A 3D4BA 5J2TF 4RD6A 2HIHA 4QU9A 1KWKA 3N2KA 4BU1A 3KFVA 4Q16A 3S70A 2KQUA 4GMGA 3VQTA 2JD0A 1I1HA 3F9RA 1LTHR 2I4RA 3QPDA 1NUUA 4DNRB 2PPLA 2VH1A 4ZZ2A 1JR4A 4MQMA 3DAYA 1FYVA 1V4BA 3RC2A 1ISIA 1CUFA 1PK9A 2R00C 1XPJA 3BORA 3KD3A 4N9WA 4LGYA 3CISA 3HCOA 3THSA 4PS0A 3RR2A 3UMBA 4D3SA 5E1MA 3S0JA 1W30A 4C2AA 4V02A 4BRZA 1WUKS 1XMOB 1V11A 1YZKA 2W2XA 3NP7A 5KX5A 4LBZA 4HDNA 1VL5A 4YUVA 1OZ0A 1XZFA 1LNSA 1IY2A 3I9LA 1I4LD 1I3NA 1T10A 5FO0A 1TO2E 2YW9A 5DTEA 1TKAA 1KNQA 3FPSA 1CW2B 4OQDA 3EPLA 4R51A 4E4RA 5FBLB 1A04A 1WSBA 5FKJA 3V1MA 1B2RA 4LI0A 2C97A 3DBLA 4J0KA 5EWMA 2ZCJA 3IC5A 4OLHA 3CR7A 2NSJA 4JGGA 3H2GA 2QU7A 4QO7A 1C29B 2V55B 4DANA 3U5ZB 1V48A 2XQIA 5CJ2A 1R8XA 5DLYA 3O1LA 3ISVA 1Q1BA 2FSPA 3R3HA 4F5EA 5LLDA 2DUNA 3OJCA 3Q6RA 3E22A 4AROA 5AW2A 3EJ6A 5C5CA 4YVFA 5CXUA 4OF4A 3U7RA 3P9PA 1IZZA 1WV1A 5BV2P 3TRIA 3GLHA 5HCNA 3U48A 2O7SA 4KRGA 3DEJA 2ZSHA 3T35A 3N7AA 4AUMA 3U7HB 1M6WA 4FD3A 5DLQC 3GRAA 1YU9A 4JBYA 4R8VA 1G0NA 5TVGA 1PBTA 2AC7A 3C7DB 3EMKA 3V7WA 4A5SA 4TQAA 1YRQA 2IY8A 3ZE0B 1LPBB 1E6WA 4JK3A 2I78A 5CVVA 2C0CA 4U6SA 1KFKB 1L4EA 1JNYA 4QBGB 5TE9A 2NO6A 3OWXA 4OB8A 2D0DA 4CG2A 2BH9A 2J45A 5AUNB 4OBXA 2FQXA 3WKEA 3KM0A 2W48A 1Q21A 2AG8A 2NO9A 3EVAA 3MW8A 2V65A 4GI7A 4H4EA 4K28A 4ZXFA 4E33A 1UBKS 1UFKA 4NYMQ 2R7MA 4PYIA 5FEUA 4WK0B 4WJKB 1JIIA 2GAJA 2ISCA 4CWAA 1P7ZA 3IQHX 3EARA 3FKSA 2GTPA 2XXBA 4IDFA 3DMPA 3R5KA 4Q19A 5AM1A 4C30A 5A2QA 3PYXA 3UH1A 2XXAA 4A03A 3W6UA 1NN3A 3KEQA 3I01M 5H8WA 1QX4A 3T7TA 4LI3X 1K73D 1IPFA 2ZPTX 3DEIA 5KI6A 2Y1FA 1UKVY 1L7PA 1IZ8A 1D7OA 5J1SB 4W8HA 1MD9A 1RHUA 3ZVNA 1BE0A 1J97A 1BA3A 1OA1A 2CJYA 4TT8A 4XFKA 3MWEA 3IV9A 4PGFA 4UNNA 5ALUA 1SXIA 4A6PA 4PRLA 3UOGA 4Q37A 2Q6LA 4KNWA 2WYIA 1ZM9A 5ULLA 5JS2A 3QA3E 3AI3A 1C9MA 1HA3A 5JEDA 2AFHB 3EXG1 3D7MA 4UAUA 5D1HA 1GPYA 4HRAA 2BGMA 4YUYA 4F2GA 2VAVA 2KBEA 5CB4A 2VBFA 1LWNA 3L4EA 4XCXA 1PX0A 1TJ4A 1ZC4A 1XQ9A 4DNXA 2NU8A 4QOEA 2QG9A 5HX7A 1N2BA 1RYEA 5DT2A 4CCWA 3KQWA 2Q3CA 4UUBA 5KYUA 1B1AA 2J3IA 2PWZA 2L69A 4CM8B 1CKEA 2J3EA 4CIXA 1L9XA 2XUZA 4YREA 3PFIA 3G85A 4DYDA 5C4IA 3EVFA 3KPYA 4M6WA 2G63A 3VYSB 3RPEA 3GI1A 3IAXA 2W2TA 3ZHRA 4XLLA 3JQ6A 3SXUA 1LV8A 1X7YB 2GEDA 1AA9A 1WQ3A 4RMHA 4B46A 3W5CA 2CMDA 1XIVA 3AHEA 3ZCUA 1XQBA 1LDMA 3AZPA 4QUBA 3TB6A 2EJBA 3THYA 1RXVA 3CMAB 1E0KA 2QI9C 3NEAA 4QG7A 3VHLB 3HWWA 6CHYA 1AKEA 1XTPA 3HY6A 3GRZA 2GK4A 2H1RA 3PUWA 1I7PA 3Q4GA 3BD7A 1YQUA 1UBEA 1VJTA 2G5TA 2MOKA 2JAHA 4YP1A 4TLEA 4S1VA 4IVQA 3M6MD 2CJWA 4OGFA 3SSMA 2OL4A 4URUR 4RTNA 5CIQA 1Y1TA 2H9YA 3PPIA 1PG2A 2OG2A 3L0ZA 2C00A 2BFCB 3RVJA 2HADA 5KNBH 3FJYA 4FDTA 3K0KA 4GNRA 4OHPA 4JHLA 4GICA 2QWXA 2OTCA 1G5PA 2H3EA 1O87A 3NX4A 1VPWA 1P9NA 1ZM7A 2HWKA 5DHTA 4J3JA 1YRHA 1JEAA 3OPOA 1Y4UA 1V8BA 4BIMA 4J4HA 2WTUA 2YN0A 1ISFA 3LHFA 1PP4A 4KR9A 1Z22A 1O5OA 4EVQA 2J3KA 5HG0A 3PNKA 4TN1A 2DWUA 2XQJA 4MZXA 4NK4A 5HJEA 2AN1A 3VSDA 2VIIA 1C4OA 2G04A 4Y2UA 4ETNA 4ZZ0A 2VXOA 5FAXA 3GA7A 3G6EB 4RD1A 1YQWA 5KJ6A 4TXMA 2M1XA 1A98A 4DQDA 1E3XA 5DNWA 2GPWA 2PZKA 3P0HA 3T1QA 3TNJA 3VR1A 4JT8A 5JBNA 2V5UA 1NKVA 1RE1A 1KC8D 2R47A 3BAZA 5DHRA 3WE7A 4BFXA 3FNQA 1YC2A 3CCLB 4O2AF 5K3FA 2OUIA 4ND5A 4QBTA 5EY5B 1UODA 4B43A 4L76A 1YKGA 2LDXA 3R1IA 2PDAA 5K3OA 5KYWB 2I2FA 2GJAA 4KTVE 4GL2A 3KFLA 1RWPA 1IOLA 3LY9A 4C0KA 1TF5A 1P0MA 2NZUG 2D7JA 3RFUA 3PX7A 1TJ3A 4ZXPA 2HSJA 4N0PA 4DHWA 5I4IA 3GN2A 2A5JA 2B82A 3NWBA 1IIRA 1I24A 1IUOA 1RQNA 2RI1A 2VPYA 4HQKA 2LV8A 3ABIA 3WBBA 1ZJWA 4E5MA 2BT4A 4YMIA 2NUTB 3SLRA 2IHJA 2AKEA 2EARA 1P31A 4MIEA 4LC1A 3W7AA 2QEXB 1ZOPA 2IZ0A 4EECA 1Z4MA 4AU1A 4DCNA 1N33B 3IQGX 5AKJA 1XZLA 5CIWA 5L4NA 1HETA 4B83A 1BRTA 2W58A 3KAJA 1VQ4B 1JSCA 1M1YE 1PL7A 2C99A 2PD6A 5AI6A 4BCCA 4PYJA 5B2EA 1MG0A 1N5KA 1WTCA 2H4ZA 3I45A 2Y1KA 1L1RA 4RIFA 4MVYA 1G20E 2AL7A 2HU7A 2I2DA 2WWIA 1Y1LA 1M7HA 1N2GA 3DKRA 4MVCA 3SJUA 1KAMA 3H8JA 2WA1A 4ZJUA 9LDTA 2C4TA 3SZGA 3D7KA 2X8JA 4HGPA 1C1DB 3U60B 2QVGA 2JFOA 3CLSC 4UUOA 1H8HA 4X8IA 2VRCA 3K5HA 2DFKB 2YOHA 1CRPA 5ALMA 3WQRA 1CYEA 3BDAA 1HMPA 1X3SA 4EZBA 3L05A 5FUBA 5CBKA 1U0JA 3WDLA 4N76A 3B7GA 1QRTA 3BX1A 3JRWA 1RP1A 1N5DA 2QLMA 5B64A 5TT0A 4K9RA 2E89A 2W6IA 1BW9A 4LVUA 2QG4A 1JAXA 3KEGA 4XJSA 1PIWA 2JLSA 1BVHA 2C1EA 2XB4A 3O8DA 4HD8A 1XDBA 3E9MA 3ADBA 2Z8XA 2AF3C 1DUSA 3H65A 4AZWA 4HDOB 3NGXA 4MYCA 1ZAYA 2XAAA 1P2VA 1A71A 1Y4AE 2Q4OA 1V4NA 2E7ZA 3ANNA 3KEMA 3EK2A 4PRZA 4QPJC 2PZEA 4WRRA 3G2PA 1GZ4A 1UJ2A 4Z9XA 1JAIA 4QVJA 3SKYA 1U5AA 3H7AA 1VLYA 4WZBB 2AOTB 1ZNXA 1U28A 5DCLA 5CP8A 4FDLA 2B83A 2C8JA 2HXGA 4HAUA 2PJRA 4MVJH 3I9NA 2FZCA 1HZJA 3BFJA 1JW9B 3D4OA 5FUVA 4ZOCA 1IUNA 2Z3ZA 4W1RA 1W46A 3SOZA 1SQ5A 2F43B 4CMHA 3PXBA 4JI3B 2ZM5A 3GGSA 1VJGA 1SKYB 3ROXA 2V3WA 1RJGA 3P2JA 3VPXA 1S2IA 3E05A 2QX8A 1ISJA 1AXRA 2CXQA 3A4NA 4FKZA 2XVYA 4BHTA 1NUQA 3GXOA 1AHNA 2XHZA 1PR5A 5EJ2A 1J9EA 4X7MA 4QV2A 4EJ6A 1BWQA 4OQXA 3TDMA 2FP4A 4F46A 1N0VC 3TLMA 4GX2A 3TE7A 1KZHA 3KKEA 5A1TA 4XX0B 3WLNA 3ICEA 1NJSA 4KVFA 4RVUA 3COJA 3IKMB 4O0MA 3R0ZA 1ID1A 1NR7A 3KJZA 4QLAA 2R97A 4Q3KA 4QGGA 4YAWA 2AC2A 5IDYA 1UBGA 1X8JA 5FA8A 4W5NA 2NZVG 3KE8A 4JLMA 3Q8WA 3ZU6A 2CXXA 4M8LA 4N5HX 1ULHA 4C7XA 1PSZA 3KPWA 4ENSA 1GUBA 3FZGA 1L5GB 3L77A 4LRSB 1AMUA 1NNUA 3QUAA 2OC9A 4M1ZA 1K5HA 5HXAA 3BIXA 1WMEA 3CSUA 1EEHA 3I53A 1HM5A 2C3MA 2MMGA 4KKUA 2W6ZA 1N7HA 4ZYZA 3T15A 3DP7A 5JYEA 1Z63A 3RWOA 3BQJA 3VHRA 1EA5A 1FS5A 3FN4A 3ZWCA 1V5WA 4X65B 5LM3A 3OD1A 2P8SA 3SU8A 2GPSA 5C81A 3BEOA 5JYDA 1S8OA 1QJ4A 2GEKA 1X9GA 2JIPA 1U65A 2OHFA 4KQMA 4X20A 5BNIA 4HQNA 3I5MA 1ZXBA 3WMWA 1XALA 4Q93A 1MAVA 3VSAA 1WUIS 4D45A 3WWOA 3F78A 5GM1A 3G88A 2AEFA 2YJ5A 4PQFA 4Z6KA 3T7DA 3MM4A 3BKXA 1YBFA 3CA8A 1D2AA 1YDGA 3GRFA 5SY6A 3IQXA 4L4UA 3VPAA 5HRCA 1SC1A 1JHQA 5JZMA 2RE8A 3TR5A 3VFDA 2O19A 4JP8A 2PJUA 2XZOA 4FW8A 5AW3A 2H2IA 3UJBA 4PFKA 1FP4B 3DW3X 4G97A 5FPYA 1WEKA 3F0TA 3LXMA 4CIWA 4A15A 1IHOA 2QNIA 3ADCA 1FNCA 2CXSA 4YASA 2C83A 5EPUA 5IW8A 2WTXA 1XDDA 4UNIA 1IE3A 5HMMA 3WXMA 1S2DA 2GQFA 1N6RA 1YRYE 2IU4A 2XODA 4NU5A 1WCXA 2GEJA 1JFFA 3TZCA 1HQDA 4O4HB 5L3QA 2H2FA 4P7FA 2X0EA 2AG0A 2GRJA 1SXHA 3GUVA 5E0KB 1NVDA 1I3LA 4YJFB 4BN0A 3OTHA 3M4XA 1QF9A 1YQEA 4Y6LA 1R0BA 1QE0A 1TGVA 1T4CA 3OJXA 2FPIA 2P68A 2ZB7A 3FPHA 2PZGA 2TSYB 4ZAWA 5G3ZA 4X62B 1YJXA 1VB5A 2E1PA 2W6ID 3ZVLA 4MCHA 3M7IA 1RXUA 4CEIB 1ODIA 4HOYA 4OMDA 2O3TA 5LKRA 5IP5A 4F5WA 2YVQA 1M6VB 2ZE7A 1H2RS 1VGQA 4ID3A 1GIAA 5EZYB 1DWOA 3P94A 4Q7LA 1JJ2B 1TTQB 4PGHA 2X5OA 4E3ZA 3THWB 1Y9JA 2Y0PA 4DBVO 3UC5A 5TJHA 3TS1A 2VJMA 2YMQA 1YV9A 2B21A 3I34X 3PF8A 5H3HA 3CYFA 3QWIA 1LJLA 2X4DA 2JFNA 3HVJA 2DM6A 4AMYA 2CJXA 1RRGA 5JJLA 3QX3A 3GK3A 5JO0A 5AQEA 2GT1A 4YMVA 5FWYB 5FTMA 4CL0A 4AI6A 4KSBA 2E4YA 1AE1A 4MS4B 2V6BA 1DNPA 4R2IA 1OT3A 1NRXA 3VYVA 4RPCA 5FWXA 1T9AA 4J3NA 4ITVA 5DWDA 4OX9B 1O95D 1OFIA 3ECAA 1ZAKA 2WHPB 4HH0A 2J7PA 5H9VA 4D9GA 2YHUA 3EJWA 4RX1A 3Q9SA 1HT2E 1KMCA 3FZQA 2P3QA 3QVSA 2EWMA 1Z2EA 2HCFA 2ONKA 3ADOA 1E3SA 2J6HA 3PPWA 3V1KA 3HU1A 3HNPA 5FT9A 2RHOA 4WXHA 4U7JA 1KP2A 1T36B 1XELA 5BUQA 1VIVA 5A5EA 1C8VB 1IQ0A 4WZAE 3TKLA 2IRWA 4YQEA 4MRMB 1KSHA 2E3JA 1IMJA 3WO0A 5DGDA 1WTAA 3ON5A 2QMOA 4WV3A 5CLGA 3H9JA 4IIJB 3A6ZA 4G84A 1L3BA 1R9NA 3DL0A 3MRTA 1MDFA 3PNMA 4NG5A 3T7KA 5EJ7A 2HHAA 3KG2A 1K7XB 1VHJA 2QR5A 3H0EA 1DUIA 2ZVQX 5T4HA 5K0NA 4ENQA 5BP7A 3V8NA 3KXLA 1LA2A 2HK7A 4MUXA 4UTNA 4AN4A 5B1YA 1CULC 3VZBA 1JFSA 5HM8A 5LQCA 1N5IA 3GEHA 5F2KA 3E18A 3WNVA 5CNMA 1ACJA 4I1SA 1EFRA 1VG9B 1XZKA 3AL2A 3FDFA 4KDCA 2JIRA 4GRIA 3AYXB 3H5AA 4ND4A 5KHAA 1QS0B 3Q87B 4FR5A 2OHHA 1P4HA 3N76A 2Z2JA 3EDCA 3OCWA 4U7DA 3K15A 1Y3BE 1BVUA 2Z2KA 3INYA 4JJEA 1WPCA 1FU7A 3GGGA 2GKGA 3AF3A 1OHHA 1PF7E 2ZIEA 3P9SA 4ITUA 5SYNA 5FOQA 3IPXA 3QFSA 4XI9A 2M9MA 1J0EA 3GJSA 3PDCA 4E32A 3OKFA 1E20A 1I1QB 3QSYA 1W49A 4LXTA 2BBOA 4NE9A 4NH0A 3N5KA 1MFPA 5F3DA 2I2WA 4O2LA 4EB6A 3EH1A 4MKFA 1LH0A 2H2GA 4QNRA 2VDJA 2JGEA 3A9SA 4K6HA 3EZ9A 4YAFA 1QZXA 1Q0RA 2C8LA 4FYXA 3KV3O 4KWTA 2V31A 4E0BA 2IZ5A 4ARVA 4BMZA 3RYHA 2GCEA 121PA 3U13A 1IN7A 1HY3A 1ULZA 5IJAA 5DGXA 4US2R 3C6MA 1E6EA 2AYXA 1PDVA 1IXRC 3FX2A 4QOJA 5JANA 1GTMA 4BRWA 3IHLA 1DQRA 2VYVD 5ALJA 3I9JA 1H4VB 3CUVA 6REQB 1ZGJA 2H1LA 2X8BA 5LA6F 5HIAA 3FMVA 4Y0VA 1WORA 5KWVA 1UBSB 4XIIA 2XADA 3WGNA 4IJQA 3W3AA 4PYKA 2F17A 2VZ0A 2PSHA 1V3VA 2F6RA 1TD1A 2A0KA 1KMHA 1J49A 1QV7A 1XKXA 2V03A 2WKWA 3B1VA 3HM2A 3NTLA 2QX9A 1ULSA 2GN4A 1KXJA 3M6LA 1MEJA 2YYYA 2MSEB 2CBGA 2O6LA 5COQA 3TSAA 2AZXA 1NNEA 1PYDA 2ZT5A 4YMGA 2AXNA 2ZI9A 2REBA 4F38A 4HS4A 4NZPA 1J8DA 5IEBA 1L4MA 4RMIA 3DWFA 3REFA 2FEXA 1NI3A 4HGNA 1D2CA 4P2GA 5AJVB 1QYCA 1WHSB 3DTVA 3ROKA 4EA9A 3LKZA 3AQIA 4DE5A 2HDHA 2VAMA 1BE6A 1JLLA 2VHYA 3OMWA 4D9MA 5I7RA 1C0EA 1E7YA 3DZGA 3O5AA 5AJXA 2QX6A 1PNQA 1WMBA 2NAPA 2X85A 5F4JA 1KI2A 1RWQA 2PMKA 5JU6A 4LPSA 2GXAA 5I4CA 4OO3A 1ZSYA 2GN8A 2DYKA 4B3MB 3S4YA 1G38A 2QD4A 4LYYA 1ODCA 4NU6A 4DV1B 4LHXA 2WG0A 3RYCA 3U7FB 1JG7A 1BE1A 2ZBGA 3Q3IA 4Y2XA 3AJAA 4TUYB 3ODGA 4B6FA 2F1MA 1M34B 3CP8A 2VAXA 3GGPA 3JD2A 1A9YA 3KUKA 3N2IA 4WW0A 5FFNA 5GONF 3O31A 1ACLA 2Y77A 3GT4A 2HF9A 3IUJA 2F1JA 3WDMA 2I4MA 4BJ6A 2B98A 1BGWA 5LZ5A 3I72A 2QRJA 7MHTA 1O96A 4IY1A 5ADHA 5DPMA 1QC5B 4WUTA 4DRXA 1OZGA 2TRSB 3EASA 1Q0PA 4O2BF 3TMAA 3UWKA 4G1MB 1JMKC 3WTCA 1Y98A 2R11A 2VO1A 1JR3A 1ZHHA 2TECE 1RWBA 2J5BA 4RFSA 1GRNA 1KDRA 1E2MA 2JBWA 2XUOA 1MEEA 4PSUA 1ODTC 2R6FA 5IBCA 3EAGA 2ISQA 2G0TA 3X1KA 1JH9A 1AXGA 3NM5A 4QUKA 1WJGA 5EJ9A 3PBKA 3ZW8A 4FINA 1IHXA 3PDHA 1F6DA 3V6MA 4CF4A 5KYYB 1XCGB 2PGLA 3HCWA 3CE6A 2XB2A 1BSVA 4GR9A 5K3BA 3UENA 3FKJA 1FXWF 2WDPA 2C58A 1ACMA 4L8JA 3IVAA 4WQMA 3B1ZA 2FFAA 4ECEA 4KV7A 5IHPA 2ZL5A 2XD9A 3MC1A 4IQGA 3B1XA 1GPH1 1EFDN 2RKOA 3ZG6A 1P4AA 4D57A 3VNAA 3CD6B 5L3RA 5SY9A 4YB8A 5CXQA 3MT9A 1DKPA 1TVKB 1O8CA 1J2YA 2AUTA 4RPBA 1V11B 4RPKA 5E8JA 5FPSA 3V1LA 5JMWA 4BVGA 2HDOA 2QTAA 5DMXA 3EEFA 1E69A 5BUZA 3MWDB 3P45A 2HGSA 4ODIA 3OX3A 3L49A 2QTTA 2Q9BA 5EKDA 3VYUB 3O21A 2NSLA 3E4CA 1J2RA 2GDJA 3S55A 3P2IA 3ITKA 2PZ8A 3ZHYA 2QD2A 3E6AA 4WK2B 1KH2A 1OVGA 5T41A 1YRAA 1DEHA 1KYXA 2P2ZA 2Q3HA 4RGQA 3VU0A 2XJ4A 5EHQA 4ENUA 5JJCA 1YA4A 3PK0A 1RDFA 3BH6A 2OD9A 5CPBA 3T1TA 4C04A 1G21A 1D6SA 5BN5B 3CB2A 4B7AA 1YT5A 4IWYA 3VNBA 4R1NA 3KQTA 2E1RA 4D5EA 5CA1F 1XK7A 3K71B 1LTQA 1H42A 1NBAA 3C97A 3MOSA 4UXIA 2GLTA 4LGVA 1KIFA 3ML1A 4MQ4A 3R6JA 4DLTA 5JTTA 1Y33E 3FW1A 1NBEA 3SQXA 3GVIA 1SG0A 3ODPA 4LY9A 3KK0A 4YXFA 2XRFA 4UHJA 1HDYA 4Q9KA 1G42A 1X1CA 4B34A 5I3CA 1RFGE 3LKBA 3U3OA 3MUFA 3KTOA 4C2BA 3U16A 3OFVA 5JZOA 1OLXB 4MUKA 5FXMA 5KNCH 1GY8A 2VLIA 5FR1A 4YV0A 3K2IA 2IHUA 3KYIB 1QOPB 5ALIA 3DOCA 1EFVA 1LKZA 3LS2A 4QJ5A 4XX0A 1FYXA 1B73A 1CXZA 4RJKA 1N9ZA 1EESA 3RIXA 1UUFA 4TXNA 4X7EA 1JKMA 4MVJE 1MX5A 3KO8A 3BA1A 4C08A 3C14C 1QVGB 2ZUVA 5LWQA 4ZAGA 2WIAA 2PCJA 5E1DA 3WGHA 5BT9A 5EHIA 4DA0A 4DMKA 3EDRA 2PE3A 1D09A 1NNLA 1Y4ZA 4LVCA 3RU7A 2FKAA 5DSZA 1KEVA 5K8LA 3IMGA 4NFLA 1FP6A 4GW3A 3WR5A 1IBLB 5EYPA 2VJJA 1DKNA 1GUDA 4ZO8A 1T29A 4V38A 2P1RA 1RSZA 2A9RA 3A1TA 3F3YA 2J09A 3C98A 3QWHA 1XCBA 2VRWA 2XBMA 2A2ZA 1U11A 3BHJA 1LLQA 3RJ5A 5J59A 3DFUA 2XUAA 1QG6A 4ZN6A 3VGJA 1ZN2A 2WYUA 4UQLA 3GY0A 1E5TA 3L5OA 4OQLA 5HS6A 2RH8A 2V4MA 4R1TA 2G9VA 3THWA 1DLIA 1E3WB 2JVIA 3R3WA 2MR5A 3T3IA 2IYOA 4S12A 1EX9A 1TADA 3OZFA 4UMEA 4YP5A 5HTKA 2HLHA 3VU9A 1JPNA 4R8KA 4Z4QA 4LF9B 2C9ZA 2P9GA 3F5DA 3KHTA 1X14A 2SICE 1PG5A 2IBMA 3FTCA 3DE1X 1C3EA 1UAGA 2EV9A 3K53A 4DMGA 5BORA 3FNIA 3WL7A 1QX3A 4GPAA 5DF1A 4PZ0A 4KO1S 3MPOA 1Z16A 2GTIA 2I8AA 3EXHA 4OGLA 1PZHA 2CCGA 3WYCA 2BGUA 3M3DA 1JQ3A 3ROFA 3L7CA 4QQKA 4KI7A 4DC1A 5LU9A 3WGIA 3PQ3A 4GBGA 4YA6A 2J5QA 2WK1A 1XQVA 2GN2A 1FLAA 4V0RA 3OI7A 3QKIA 1EWQA 5LQNA 3AGQA 3FPEA 5CLHA 1E2JA 3ITDA 4KFUA 2NO7A 4URWR 3P0JA 1T0UA 5ALZA 1RRKA 3MWLA 3ADPA 1B15A 2P77A 1XZAA 3DF7A 1Z8FA 4KJXA 1VJSA 1OFVA 4XW2A 2ASVA 4F3KA 4YN3A 4LFAB 1Z5UA 3NWOA 4OU5A 1V7QA 4GLOA 5ERGB 4EJSC 1J8MF 4IKPA 4ZGBA 1YVPA 3C15C 1J0CA 2P2LA 4Q15A 4CM8A 1P1CA 4LQCA 1JALA 5ICMA 1V41E 2A30A 1GNVA 3QITA 1DJOA 4Z49A 3IT1A 4HR7A 4PY2A 2VS1A 3AF4A 1ZUIA 1MJHA 3IUPA 2JFZA 1GPAA 3KS9A 3MCWA 1YCGA 2CNNA 3MJSA 3NH6A 4HZUB 4NCJA 4RHEA 3IERA 4OA8A 2VH2A 5KHOC 2GCNA 3WP1B 1UD3A 2C96A 1T1IA 4MWTA 1IY1A 2FZ5A 2PUHA 2XWJI 4MUNA 5IU6A 3ZD6A 4X07A 1DBQA 3T9AA 1CZLA 1I3MA 3M5WA 4IMPA 4KBFA 1GZHB 1R66A 2G88A 4UBJA 3U7JA 4BAGA 4BFUA 2V96A 4IOJA 3DMNA 4ZCPA 3WGYA 1R5BA 4PAOA 2YYZA 3ZXUB 3FGZA 1YDWA 5IWAB 4F8YA 4DR3B 3OD5A 4BMDA 9LDBA 1RPAA 2QZZA 5TMDA 4QOIA 3L41A 2HHCA 2OR3A 1JKIA 3U49A 3JZMA 1KHHA 2XMRA 4KKVA 5KQLA 4RHFA 4Z4TA 3JZFA 4Q24A 1I94B 3WSVA 3ORFA 2ZTHA 1M2WA 4RVFA 4B73A 1WOPA 1NT2A 2IW1A 3I76A 4URYR 1RJ9A 3G0OA 3WDSA 3I5YA 1H2BA 4C0WA 1FFBA 4WD3A 4LC9A 3OLWA 2B8NA 1K8XB 1NJ5A 2DBRA 1IZ0A 3D6HA 1K5GA 1WP9A 4WK6A 5EKSA 3VOSA 1VKJA 2GJ9A 2I4LA 4CLOB 4KFRA 3B8EA 4L8GA 1D9XA 2WUFA 4FGKA 4D3ZA 1SGWA 3F6RA 2R6CA 5A03A 2VBUA 1XFDA 4M9ZA 2DG2A 2V4UA 2XDQB 4KPUB 4BNNA 1U7UA 4ARIA 1RM4A 4TZKA 4BAZA 3EQZA 1UEIA 4I1IA 4BJ3A 3NDRA 5K6RA 2ZBVA 5G41A 3P2KA 2VATA 2KB0A 4X1YB 3THXB 1KRXA 2NACA 4MXDA 4K5QA 2N47A 3WBKA 2QPAA 1XCOA 2JH8A 2JK1A 3T5BA 3TNFA 1EUQA 3KBBA 3PFGA 3UK2A 1XT6A 3H6HA 2BHNA 4J91A 1ONBA 4IGFA 1AM4D 4E30A 1AV6A 4RK7A 1W76A 2VSOA 4QTXA 3INTA 2Z5VA 3UB3A 3UN1A 3CW8X 2GZAA 1IPEA 2DHDA 4QGBA 2EW1A 3ZDZB 1GCIA 4MLPA 1RMQA 4XARA 5F9MA 2XECA 3RVDA 5GP1A 4ZQFA 5AKKA 3OQOA 1SURA 1RU3A 2PD4A 2OMEA 2NN3C 5EIEA 3O6VA 4XLEA 3L2OB 5IS2A 2ZQ5A 2O8FB 4G4IA 2IYEA 4BNMA 1KMHB 4JYMA 1AGYA 1OILA 2J1LA 4GQBA 3HB5X 3U7GA 5A04A 4ADSG 2O4UX 4K9KA 3P5BA 5CK4A 2ZWAA 4R1LA 3CX4A 2X22A 2POQX 3RIGA 3FROA 4L8LA 1J9ZA 1WZCA 4B8ZA 1S72B 4AUNA 3QX9A 4XKWA 5DBHX 4KAJA 3W90A 4JX8A 3MIZA 4Q1BA 4WIAA 1KA9H 2GEBA 3JQ8A 5JWOA 2B2NA 3JVIA 2HN9A 2EX1A 4OU4A 1RYZA 4WOKA 1UD4A 4O33A 1T5IA 4PIVA 4R3NA 3G9XA 1DQSA 5H80A 1LBIA 1CQXA 3K0AB 3TXYA 2WWYA 1N36B 4GGOA 2XZLA 1YBAA 1ZM2A 3TFQA 3COSA 3FUXA 2MINA 3TCNA 4BLPA 2X2OA 1U3TA 4NDNE 1RI1A 4EELA 4WOPA 1W9MA 4J1TC 2Y0CA 3FOWA 4BVEA 1OIXA 1BX0A 2BGTA 5FAKA 3W1WA 3X1XA 1XNQB 3NHMA 1NRIA 4Q1AA 4L5BA 5HF8A 5D3MB 1P4MA 2VL7A 1T34A 1TKBA 1FC0A 3BWXA 4HQOA 4CLRB 4CF7A 5LZ4A 2MSCB 2WJVA 2ZT7A 1GGMA 1E2NA 3HKEA 5KAPA 3QUBA 5AO9A 3RRZA 4E5VA 3QK7A 1JF8A 3IE2A 3O95A 3P9XA 4QDKA 1I0ZA 1X38A 1DTSA 3GYGA 4S3MA 2IV3A 2FPOA 2ODQA 1FZTA 3CINA 2C29D 1Y5NA 4YRLA 1UKAA 2PMCA 4OB6A 3EMBA 3D6MA 3CXRA 3QHPA 4TYMA 1C1YA 1N6LA 2YXLA 1KK3A 4ARSA 2C7QA 1CJKC 1KJJA 2C2OA 3JZAA 3V4PB 5FUWA 5JJBA 4LHEA 4DV5B 3C3CA 4JBXA 3LP6A 2G6BA 4PYOA 2HA2A 4X64B 4BMSA 2B5OA 1THZA 2R9VA 2OCGA 4KK3A 4YAJA 3JQGB 3D7RA 4NZOA 3AXSA 5K3SA 3JALB 3RRYA 2CJFA 3C70A 3SHFA 3T7IA 4US1R 3WOVA 1VZ2A 1O08A 4ZTBA 2HA3A 3ENVA 2Q8NA 2RKWA 2YYAA 1OBOA 1T5HX 2P2YA 2YV5A 3BTOA 1VIYA 5KKNB 1QRAA 4JUAA 1MC1A 4PXAA 5E9AA 5TNXA 5F2NA 3NTVA 1MAWA 1SN7A 4EM6A 4HWKA 2FVXA 5E6RA 1UD8A 3D6AA 5DIFA 2V7PA 2R87A 3R0VA 4QYWA 5DWQA 2O8BB 2I29A 3AOGA 1DJQA 2G08A 2AMFA 1SCAA 1H8HD 4NV3A 4BU0A 2ZI4A 3AILA 4QXPA 4BC0A 3ZBTA 3TTTA 4BVKA 5CA1B 1RRPA 1Y7LA 3EEQA 2HNAA 4J03A 1WXQA 5A62A 1UBFA 5IFKA 3VR2A 4P3YA 1CY2A 4GNKA 5HBRA 3SM9A 4BB9A 3NATA 3L0YA 5GJVC 1Z5PA 1XXHE 3DFZA 4YWHA 5KNDH 2CDAA 4LISA 4OD0A 5TSDA 1W44A 4XD7D 4HE5A 2QUIA 2FX3A 1U81A 1HE1C 1NN5A 2JEZA 3QLVA 4E2ZA 1II8B 1LK7A 2V6JA 3DT8A 3GRRA 3UB4A 2CLMB 2WHEA 1TIPA 3IHTA 4UU7A 2D2IA 2YX1A 4DGQA 3B70A 1R6DA 2D5CA 1VJRA 3HWRA 4RTKA 4X61A 2E21A 1NLFA 2ZUFA 5A06A 5I5EA 4AT1A 3UGJA 3AHHA 5JCXA 2OHXA 1X7ZA 3KTAA 3BMQB 2OSVA 1ZJZA 3B2QA 1FCJA 5E6UA 5IM4A 4C43A 1EBFA 1O97C 1SC9A 2YH2A 3AR6A 2VDMB 1S2GA 2YY6A 1IXSB 3LPMA 3T5GA 2QYOA 1YWGO 3FZNA 3T7AA 3PE4A 2Q9UA 3EFOA 4YIHA 5HGXA 3Q8KA 3OOWA 3VDXA 1J70A 2Y9PB 4HMQA 2HA7A 3SHQA 1VHEA 2FHPA 1IM8A 2A8YA 4A1OA 4YJ2A 3GLFE 4XLCA 2AXPA 4M8KA 4K1LA 4PGAA 4NJEB 4MR7B 4TTJA 1N78A 1A7KA 2X9VA 1VL2A 4RF5A 1M6VA 3KAQA 4Q1CA 2QL9A 3KJEA 2EKDA 1ZYUA 1DV1A 4MKXA 4R31A 1E1YA 3RVOA 5LZ9A 2Z43A 1JXMA 3MJFA 3K0BA 4EUSA 3H5WA 4LF7B 1RAGA 3FYUB 3ZIAA 4ZQGA 1W0KA 4FFRA 4DCMA 2GHIA 3FPBA 2CNWD 4BX9A 4D4LA 2DSNA 4TL6A 3FCUB 3S2EA 1P1RA 1A7JA 3K09C 3VKGA 1EDEA 2P6UA 3MTBA 2FWPA 4BFCA 2G70A 3PFCA 2O59A 4PYQA 4XGNA 3EVEA 3KDSE 3VAYA 5BXQC 1R0LA 3BMOB 5K3AA 5J40A 1NBWB 4MR9A 5GINE 3Q5GA 3EQ8A 2A5YB 4BFZA 3CSDA 1KU6A 4NOLA 2ZJZA 2DMRA 3GIDA 1CR1A 3GVXA 4Z86A 4DWWA 3K96A 5LXTB 2WUGA 4Q82A 4RIHA 1ILWA 1LBEA 5F12A 2JI4A 3EG5A 4TWZA 3U3ZA 4YCNA 3WGKA 3IP6A 2DOGA 2W0MA 3DDUA 3QMPA 3VOBA 2HV9A 2QJRA 4CR8A 3WGVA 4L8WB 1SCJA 1ZD9A 3FUVA 3O91A 4AX4A 3RD5A 1MABA 4HDAA 4DCSA 3QEKA 1S89A 4BYMA 4F1WA 5KYXA 1OZAA 1Y9ZA 4Q01A 1GGJA 1A7AA 2IZOA 3AVWA 1YQDA 3R0JA 3BQMB 4JQYA 3SSOA 2B9VA 2FPPB 4O4LB 1NLUA 3R20A 4UDNA 3IR7A 2OCKA 2VOEA 1N32B 1PU2A 1EWYA 2ZI6A 4KACA 5ALFA 4F60A 2YWBA 4LRYA 3KQQA 4UHFA 1IOZA 3KYBA 3IUEA 4NULA 4BDTA 4LBVA 2QQGA 1MTZA 2XNDA 1VRCA 3CZQA 2R2GA 4IAOA 1GZ5A 3S2SA 3W1VA 1EIZA 4ZQEA 4CT5A 1AO0A 1KPGA 1I7NA 1SBQA 4N40A 4YGXB 1JTFA 4LECA 5LOVB 4GPIB 2HA6A 3IUSA 2X6XA 1USVA 4E07A 1VQ1A 4J7XA 3SICE 5I6DA 1YHZA 3QMVA 3U44B 2VTKA 2FCAA 3I6ZA 4JLDA 4IXNA 3DYVA 4D25A 2OBSA 1DL5A 1LS1A 2VWGA 4TKMA 5KSZA 4F85A 1GZSA 2O0MA 2V7XA 1I3KA 3O9ZA 4CUJA 3VR2D 4DA6A 5KPJA 1SUFA 1II9A 4H7KA 3G2IA 1IOWA 3DDZX 4GP7A 3RSHA 3SS8A 1AOXA 3T1VA 1NOIA 1QTQA 1RQ7A 3R7LA 1YDMA 4YCMA 2FUG1 2YIJA 4OI0A 4YAOA 3PJFA 4JNKA 3K9NA 5IBRA 3D8UA 4MWEA 2WE8A 3Q6IA 4CF5A 5KINB 3GJ4A 2BONA 4QYIB 1E8NA 3HV2A 1GD1O 3SYMA 1D1PA 2D13A 3VH3A 3P26A 3VPFA 1I3CA 3L7MA 3MJRA 3T1YB 2ECQA 1GHTA 2PKQO 2Y2UA 3PJEA 4HH4A 4M7OA 4QU0A 4RKYA 4WOBA 2A94A 4UTZA 3RBZA 3UJNA 4NBRA 1KQ3A 1NG1A 2C04A 3ZKWA 4F8EA 3G0BA 4LZPA 1IK6A 1T4GA 5JECA 1R5OA 5LBUA 3DB2A 1ZUNB 3HFJA 2BZ0A 2YHIB 3T5MA 1G9SA 1L5FA 1WD5A 3BE4A 4Q9AA 5DK4A 5JJKA 1ZIOA 2COKA 4ZVQA 4JI6B 2R1TB 5BOSA 4PWZA 4IJWA 1H66A 1YR8A 1HSZA 4ZU1X 3NGLA 5CFMA 4MR8A 4D96A 3E1SA 4KNYA 1DWUA 2DUJA 4F56A 1ZD2P 3HB1A 2G36A 3BPSA 3PEEA 2R7KA 4DLVA 1QZ3A 4UOZA 2YWRA 4RVSA 4AWAA 1PW7A 2LPMA 2JFXA 1UPBA 4HFNA 6ABPA 1T3SA 1N77A 2SKCA 3DAHA 1V6CA 4L08A 4R1MA 2DZDA 3OESA 2I7DA 4UHCA 5KAMA 4X00A 5BMVF 2Y93A 5MHTA 4CLDA 2D74A 2C61A 2VUUA 3D3KA 4M37A 5IK2A 5AVKA 4E5SA 4ZZ3A 5E9JA 1GNPA 1T3GA 4ND7A 3OQIB 1I5OA 1B6RA 3R6DA 4MWOA 4RPGA 4RWEA 1BRMA 4XQCA 1ZD5A 2WSMA 1QQBA 1QVWA 1YQTA 2O8DB 3EWAA 2QIPA 1Z35A 3L8CA 4JYAB 5BV8A 1Y0BA 1K06A 2WYHA 3QNWA 2YS7A 2FPSA 4LK3A 4QLOA 4XVHA 5K8VA 3C3WA 4EUEA 2IC5A 4ACAA 4FUTA 3GUYA 4GYKA 4KO4S 4ZVSA 1PJ5A 4AUKA 1KERA 2NSHA 2YQZA 4GZ6A 4C4XA 1DCMA 1QIDA 1O54A 5BVHA 5FHQA 4NOKA 4XQ0A 1DJNA 3O2SB 5K3DA 4HLCA 4NICA 1Z08A 2HRRA 3MFYA 1N5OX 5B6JA 4F9EA 1YAJA 5IBPA 4KBGA 2H18A 5DX1A 1VKOA 3ZQJA 1IQUA 1R74A 1TYBE 3DE6X 4D8VA 1H5QA 4NAVA 1Q0LA 3QKRB 4FHGA 5AOAA 2I6SA 3I0MA 2GN9A 5ALYA 2X0KA 4EG5A 4JHXA 1QHGA 3NJ4A 1DPFA 2OB1A 1HLDA 2OK8A 4JSYA 3B82A 1E5XA 1DGQA 1C7JA 2EZ8A 3BGDA 3ZWKA 1HNZB 1H2AS 4FWIB 1IK4A 1PJAA 2P9BA 1HNNA 1R4NA 4D8TA 5JNRA 5FDFA 1XLWA 3RVBA 1A72A 4OHOA 1BXKA 1J0DA 2AW3A 1JAHA 1GPDG 2ZJ5A 4DTCA 1EIWA 4UZEA 4UBKA 3N0VA 5JR3A 1Q2UA 1U6IA 4I9UA 1UOPA 3AVYA 2V3VA 2WHRA 3PGMA 2AYZA 2NV4A 2X23A 4RPHA 3RVLA 2MSDB 3DM5A 4QGHA 4C22A 2I3ZA 3EXHC 4E13A 3F6SA 4IF6A 1FVXA 4QQNA 1UBMS 2GM5A 2HMAA 1YVEI 2D54A 4O3FA 4XGQA 5K0LA 3STTA 2OWDA 5LQMA 1IHMA 1Q95A 4PZEA 3RUCA 5KTMA 4XX1A 4BNXA 1MT0A 1UDRA 4LZWA 1MJ5A 5E7JA 3H6KA 1GUZA 5B4TA 1FFHA 1NF3A 1E3DA 4CE6A 4H1VA 4IIDA 3KJQA 4N0DA 4RH1A 2JJ8A 4C05A 1CEYA 3T5AA 1QC5A 1LBTA 3TR6A 1DXQA 2PS1A 4FEGA 5DGIA 2PGNA 5HOEA 4D1YA 5JCOA 4DN6A 4RTJA 1ZH2A 4CCAA 5C9ZA 1USGA 5D3MA 1XZEA 3VNUA 2PKWA 1ZR4A 3D02A 3VSCA 4OFZA 3WQHA 4FZRA 3OSZA 2QM3A 1ZLYA 2XUKA 2AD5A 3KXIA 1BMTA 4NONA 2R8RA 2PQ2A 1YJ9B 1N2IA 4NWIA 2QRUA 3IIJA 4J4BA 3TXXA 2MSWA 3B3JA 4JI0B 5KYTA 1DKUA 3UAZA 1J8VA 4MIOA 5I45A 5K05A 3GMTA 4A0FA 5JXGA 1L8QA 4JX9A 2Z95A 3QLUA 4Y6SA 2OK7A 3UV6A 3WLQA 2JCSA 2CDNA 1X0VA 4IDCA 4D81A 1MC5A 1DIAA 2BFEB 3IAS1 1XG5A 2ERYA 3GCWA 1P45A 2Q0SA 1C8BA 1G6KA 2P30A 1PVVA 4GXNA 1NUPA 4C78A 3EGOA 1NY6A 4KGZA 4RO0A 1WS6A 1BDBA 2GZRA 4ERNA 4M1KA 1SC4A 1P29A 2RI0A 1OXMA 2O0LA 1FU8A 2QT1A 1YD7A 1ZGAA 3C7TA 4M87A 4PZ9A 5DMHA 2QP4A 4F3NA 3HI4A 3DO8A 5KJFA 4OXQA 3KOXA 1JBKA 5FHRA 4QPZA 1DFHA 1G8FA 1PG0A 2I6FA 3OCVA 1E2UA 5EJGA 3OUTA 3AESA 3DEAA 4LNUA 1OAKA 1CIJA 1ND6A 4DKXA 2WTMA 2OGTA 4G0XA 4GZ3A 3ND5A 2P75A 1UJ4A 4F93B 3L8YA 5JW6A 1DE0A 1RC1A 3EGXA 5C1BA 4UXJA 3WYAA 3O94A 1ZIYA 1CY0A 1QHHA 1VLVA 4XNFA 2A86A 2BM9A 1Y5IA 2EGGA 3EZFA 3GJ0A 4ENVA 3KCQA 5LZ2A 3SX2A 1I8DA 5CB4F 2PJDA 4IZIA 4O0LA 4DR2B 3M1YA 5FLEX 2XXAB 1VQLB 4PQEA 1AQYA 3OIWA 1C3VA 1EE1A 1RBQA 1V8ZA 3R6WA 2G0AA 1KY5A 1NV9A 3F7NA 4ALMA 5CD9A 2MSLA 3SZ3A 1Y5MA 2IOFK 1OU4A 2WV9A 3G2LA 1NVBA 1ECBA 3W9YA 4CKCB 2DULA 4Q48A 2HJ9A 4GT1A 4QUZA 1LDEA 2J6IA 1TUGA 3AU8A 4G37A 1E58A 4AJ1A 4RJLA 2OV8A 3UMRA 2ROQA 4B3BA 1DC3A 4XQFA 2IPOA 4NECA 4DNFA 4FE3A 2ZB4A 2FMKA 5CM9C 3CCUB 5JE8A 5EJAA 2VJMB 4JJ6A 2J9FB 2QW8A 4EG6A 4PNEA 2YC4C 3RJZA 4I36A 5TS3A 5BSGA 1RCFA 1TJPB 1C4XA 2LCFA 4ALLA 2EKPA 3ZWMA 2Z6AA 4QELA 3KLMX 1HEYA 2O3SA 3VJKA 4CEIA 2DQZA 1CUBA 1GPWB 2HPVA 3F7TA 2XWSA 1YCFA 3LUGA 4JB3A 3WLAA 2O20A 3GUHA 4CKBA 4DG8A 1EFHA 2E6UX 4JZKA 3VR5H 3EVZA 3FR8A 4EPYA 1FUIA 4RYLA 3DVQX 3NBQA 5JROA 5ESDA 1LDYA 1M2OB 5CDFE 2HEIA 3DLAA 1C0IA 1GCOA 3C5VA 3IXQA 2NGRA 2E18A 4U63A 4WX2B 4FYHA 5KTYA 1N0IA 4FPXA 2YW2A 3G7NA 4WE3A 5BN4B 3HPQA 2PBRA 3ZDBA 3N75A 4TMTA 5G4LA 5CFPA 1A5BB 3MHPA 1G8HA 4LWQA 2VZ9A 1ZCZA 4DLXA 1ELOA 3CPXA 2WSBA 4IIJF 1QXSA 2GOYA 2I3DA 2A1UA 2GHQA 2OXRA 3NRJA 1O0SA 4KRXA 4ENTA 3BXPA 4BTLA 2DY0A 2AD1A 2W2QA 1PX2A 3DO6A 3V6LA 2AN4A 4GE3A 4MEBA 5F3RA 1WF3A 4R2XA 4G1FA 4UUMA 1QAQA 2XI4A 1I2BA 5EP3A 3KOUA 5KSOA 3S1SA 3HABA 2PD3A 1QE5A 2XGOA 3DV9A 3HP7A 3V8QA 4IRMA 3AFHA 3HBAA 1J25A 4J1QA 4UATA 1MO3A 1T8PA 4QT4A 5IYQA 3S1AB 3TD6A 3UMCA 3VSEA 1Z7EA 1SXJE 1VFPA 2RAPA 1DEOA 3JQCA 4ND8B 3VKWA 2C5AA 1PNTA 2NV2B 3W5JA 4YI5A 1Y5RA 5ADWA 2EG5A 2IODA 4DK1A 2DR3A 2JB9A 4OGKA 1ZI6A 5EIAA 1ARZA 2UKDA 3ZHXA 4FJ0A 2NZXA 4LMAA 5KQGA 2CUNA 2NQ8A 2C9OA 2CB0A 2H4YA 4IYRA 1VFNA 4KDEA 4MI1A 5IMBA 2NU6B 4G85A 3ZNPA 5HRUA 1GQOA 1WX1A 1JDUA 1H5NA 3GLFB 2SKEA 1SXJD 3IUBA 1X1QA 1J8QA 1RLUA 1YTLA 3FAZA 4DLKA 1GNTA 2GLXA 2XBLA 2IFTA 2VDLB 1P44A 4KH1A 1CUCA 4XIYA 1QGDA 3OQ6A 2Z3VA 4Y2TA 5EC8A 3QVUA 4BO6A 4CDGA 5IKEA 1PRYA 1N5LA 2VH5R 4Y1RA 3QW2A 3HDTA 3VZDA 1X1BA 1TMYA 3DZBA 1DU4A 1NYTA 3H5LA 2QLTA 4WZAB 1JYEA 2XLCA 2GM3A 1H65A 1YHYA 3GAMA 5TVKA 4CR6A 2IHVA 2L19A 3A7EA 3V2UA 1P0FA 3VPCA 4DLNA 2K5UA 3FWNA 1DAGA 4BWVA 3TECE 3PHJA 2FPXA 3ORSA 1MG5A 3ZHSA 4M1YA 1ZUNA 2F3SA 3ZDCA 3VKVA 4M1SA 1TYCA 5I9MA 2H0QA 1RACA 2FWAA 2GFIA 3FPFA 1RWVA 1T91A 1W4AA 3AF2A 3GH1A 4J29A 3SZOA 3TFWA 1E1QD 2I66A 2IGTA 5H83A 1CY8A 2B1JA 2ZB2A 5CG2A 4QDJA 2GPBA 1XDZA 4XZ3A 3VKFA 1SOVA 4BGVA 3E0QA 5TLSA 4I50F 4ILEA 5JWHA 2IKQA 3R75A 1XVLA 4EMTA 5DN6A 1EQUA 3PUVA 1VSTA 4PNPA 3NZEA 1KFCB 1PYOA 1HDZA 2WIGA 2DFTA 3AP2A 2JLAA 4MP6A 5DW0A 4BP3A 1G7SA 2HPAA 3WC4A 1N6HA 1Z7YA 4BO5A 4NL4H 4TMWA 2Q0HA 1NBHA 4Y18A 4M9CA 4MICA 1DPGA 3A9VA 2HZBA 4EX6A 3TM4A 4V2UA 3ZE7A 2R6JA 3NEJA 4Q4JB 2REQA 3VMFA 1A27A 3FB1A 1VP3A 1Y34E 3WOHA 1P7PA 1XD2A 5GADl 1WOSA 2EP5A 4H3HB 4D5GA 4RELA 1JG1A 1VSQA 3PC8C 4I3GA 5J4HA 1SD1A 3FPAA 3IBGA 1JSXA 3MQFA 1T9KA 4MUGA 3G5UA 5JAMA 4YAEA 4BP1A 2QORA 1U0HC 3HBLA 1QMGA 4EQZA 5JPCA 5ABPA 2EL9A 1PQ4A 2Q2WA 4MX8A 1EUDA 2VNKA 2DPGA 4A1FA 3BT7A 4ROSA 2QX4A 2C7GA 3SDZA 1Z62A 3CCJB 3TLXA 1PLKA 4KQGA 4LJYA 4RPLA 2BHRA 3FKQA 3LTEA 3N8DA 2FFHA 3NYRA 1ZSNA 3LQ2A 1UBOS 3TW4A 3VV2A 5KYKA 1R9GA 4N01A 5ICEA 3Q5DA 3ZU5A 3U6BA 3CRRA 1SQGA 5I7FA 2XF2A 1KOGA 1LFDB 4NMXB 3EUWA 4RGBA 5EXEA 5AM3A 1VRWA 3NHSA 2FLWA 4UVEA 3SYLA 2EZ4A 2IPXA 3D5EA 3OJOA 1M9NA 5TQ2A 4F4CA 5CURA 3GCXA 3LUJA 1JB9A 3ZVMA 1BCRB 4WESB 3GRYA 2FRDC 1OCEA 1WPXA 3E0XA 4Y9RA 4ABTA 4KN5A 3W5VA 2JH9A 5C80A 1NJ8A 1E2KA 1FBTA 1NW6A 4UXHA 3G2KA 1KS2A 4BFVA 1L7QA 1OTYA 3ESDA 3MYRA 3LIIA 1W4BA 3QJGA 3GRKA 3DL7A 4OCZA 4EKEA 2F55A 3NLLA 4AQYB 4WZBA 2Z08A 4C4YA 4D43A 4D4KA 1E3LA 4ED9A 2A1IA 1DIRA 3VZPA 3LT0A 4OM7A 4ECAA 4TVSA 2W9XA 4TSFA 1C30A 3AI1A 3BVPA 4FOLA 4IHAA 5DHFA 3DMFA 4OQQA 3D4PA 3JYOA 4FFWA 3R6KA 4MINA 3DD5A 4ZAXA 3FOEC 4HWPA 2I7TA 4PQGA 4LOIA 1NMXA 2X86A 4E70A 3WWYA 4PEVA 1LK0A 1XLVA 1FQWA 3AI2A 3R5SA 5B58T 5JNWA 4DLYA 3MJHA 3R24A 1PDOA 4KSYA 1T0BA 4P3NA 5F4ZA 4ZI7A 4M1OA 4MEJA 3H94A 1RRFA 2CXTA 2ZBFA 3MCTA 5DB4A 3D64A 4UUNA 2BP7A 5L95A 1LPAB 4KMSA 4MQEB 3HXMA 4M38A 4JA2A 3ILSA 5IZ4A 1F17A 1P9OA 1YZTA 4ZTZB 4MW5A 2ZTMA 5CVJA 3G5TA 3GV0A 3I4LA 3TSWA 2R0QC 4IINA 2VQSA 1PSDA 3V1NA 1UDBA 2X2EA 4UFNA 4XLZA 3EAQA 4RFSB 4G41A 2BV3A 3QU5A 1QH0A 4HDMA 4KWIA 3G9ZA 1GT6A 5ER6A 4CKWB 4DIFA 2JLCA 1HKHA 1QAMA 2QPTA 2OKCA 3PUHA 4RZQA 1IN8A 5JMOA 1TRKA 4DV0B 1HG0A 2GARA 3AM4A 4NDZA 2RGYA 3HJHA 4FBGA 4BKQA 1GVNB 1MA0A 2FGKA 2HF7A 2X0NA 1Q84A 4IVRA 2CSXA 1VHQA 1WW3A 3AESB 3CZMA 4PHCA 1G8GA 2W4MA 3PRJA 3TBHA 3VPHA 1G0OA 1NW7A 1ZEJA 5G1OA 1OF1A 2BY4A 4RE6A 2C0PA 3E22B 4UARA 2IX3A 3F9CA 4UU8A 2IBSA 5FD8A 1OI7A 3D6NB 4TOIA 4ZO7A 2C9MA 5I9NA 4PCLA 4H17A 5JCJD 3C2QA 3VR4A 3RFXA 4C5BA 1T24A 3R4CA 1GILA 2MU1A 4NK5A 4PO8A 4YHHB 4EFKA 1T8RA 2ID4A 1A5TA 1JFLA 2I67A 3D59A 3H5OA 3V4LA 5M7EA 1C5KA 1DZ3A 1X80B 1XAIA 4LYFA 3W04A 4LRXA 3OZTA 3DDYA 1M2HA 3PA6A 2G4LA 1NULA 3DLIA 1NXPA 4NATA 4WZBE 5C1OA 5DHPA 3AR8A 3QVGA 2GGSA 2QRVA 5JVDB 4E14A 4JBNA 3W3AD 4EHDA 3HJFA 3CRVA 3E9NA 2ZRLA 2J9ZB 1LPNA 4H7EA 3LA8A 3GROA 4C4OA 1X7WB 4YRPA 3QKSA 1Q6YA 1G7RA 4I1OA 3EEOA 4XAQA 4MQEA 2ZPAA 2JGDB 3T9DA 5AQ1A 1E6UA 2PO5A 2C9DA 4RA9A 2X6TA 1GAWA 2ZR7A 4Y6PA 5CCEA 3B1KA 1GL3A 1QH9A 3GMSA 1NQTA 3LLUA 1B26A 1A9RA 1H2YA 4PX9A 1V26A 1MAHA 5D6OA 3ZOZA 1O94D 4AG5A 2GPTA 3BILA 1JHUA 3UQZA 4TXLA 1YKSA 1YONA 2W98A 3PXXA 4XE5A 2X4GA 4CNBA 4F4FA 5IZCC 4TGLA 1JWLA 2B1IA 3CLTC 3AVQA 4W8GA 3RV3A 1G2IA 1QF6A 4OLJA 4AB1A 1K3FA 1PT6A 1RXIA 2A3NA 5ANRB 4UNPA 1YTUA 1WBJB 3A25A 4MS3B 1WXXA 5ES3A 5A7HA 1VF7A 4C6HA 1SHZA 4I81A 2J3HA 3A1VA 1Q0HA 3WMXA 5M29A 3K1JA 3MXOA 5J4KA 1AK9A 2Z4TA 1WULS 3JV7A 4HZUA 4DCVA 2VSQA 4TSFD 1JEQB 4Q18A 5LL6P 3CF2A 1NVEA 2WVAA 1XLTC 3LRTA 1R0KA 2IIPA 1NHWA 4PFSA 3VU1A 5FTLA 2EQ5A 3BYZA 1CUUA 2VP0A 1LVHA 4X97A 3VPBA 4EMSA 1Y1SA 2B0JA 3CX8A 3DXXA 4MV6A 4NCXA 1K5DA 5E6TA 3PR1A 3UHOA 5K5EA 4KE8A 4BNZA 1A9OA 1CNMA 1QS0A 3KWJA 2ZUEA 4MMYB 1L8XA 4JY7A 4QWWA 4ABYA 3C4VA 1W94A 1V5VA 1AXEA 1D07A 3AT1A 2D2EA 2G9NA 5JCPA 4KITB 5A88A 3A1FA 3DT6A 3P9QA 1F0PA 5LLTA 4Z4GA 4L22A 1P1FA 4Y9UA 1MFZA 2FLKA 1KQNA 1LD3A 1HTTA 2BFFA 4X54A 3T9BA 3OEHA 2WTAA 1Q7CA 3EEBA 2PAAA 1WZUA 3HCAA 1NJ6A 3M1IA 3KT0A 1G6Q1 3QWFA 1RWOA 4NKRA 4AZSA 3OIGA 4L5JA 4LYHA 1QGUA 3LUCA 4Z4FA 2CVOA 2GMWA 3GJ7A 4RV4A 2CV0A 2FPMA 1IQRA 4AO7A 1L4LA 3A58B 1HDGO 3ZE2B 1PAUA 3KT8A 1UMDB 2ZRNA 3UJ3X 2CVHA 2BEKA 2OSBA 1V47A 1W87A 1T36A 4O1IA 5BVHB 2X9QA 3U40A 1CFZA 1YNSA 1LTKA 2IEDA 1EFUA 3NBZC 2ECFA 4O4IB 3U7EB 4N5MA 2W43A 3UK1A 1W6UA 1NMYA 2DWOA 3PC2A 4NBUA 2QAGB 1RW4A 4M76B 4Q3EA 3KZXA 1I2MA 3B9PA 3IQZA 4N6OA 3WO1A 2RGBA 3B7WA 4JENA 5DM60 2WOJA 3AH8A 3BMCA 4BBZA 2QL6A 1FVHA 2G5GX 3ID6C 3BBLA 4D4JA 1YASA 4NAUA 1RQRA 4Q3NA 3EQ7A 1K27A 1M2FA 1MPTA 4NEHB 3KLOA 4N82A 2QGZA 5DBFA 5EIWA 4HE6A 1U2EA 3H5RA 1AMOA 3SD7A 3KV1A 3U4IA 4KVGA 5DSTA 4ZDWA 5KDDA 4NYJR 1W48A 3L4BA 2OZEA 1LLCA 3AEUB 3WYEA 5ITSA 3RAJA 2NU8B 1OGIA 2WR8A 1RLMA 1RZ3A 1EG2A 1KI8A 2I7XA 2RHMA 3NP9A 5ESXA 3V80A 3DQQA 4ND3A 3OKXA 3SOPA 3DVLA 2ZUUA 4XR4A 4YRFA 3ZDFA 1R8QA 2XTAA 3BXGA 5CCBA 3EYWA 1Z2OX 3EIHA 3CHYA 3HGQA 1VCMA 3L6DA 1V7CA 3G2QA 1HV8A 1TLFA 3ONDA 1RZRD 1OAOA 4BMVA 1U2QA 1GXSA 5J23A 2DY1A 1GUYA 2YIVX 1C9JA 1TGYA 1Q7EA 1J33A 1L5WA 3CLTD 3DWIA 3HDJA 4FKBA 3SJAA 5M34A 1OSNA 1QQ6A 3SQNA 1AQJA 5IABA 2PAFA 1C7RA 3EPPA 3BMNA 2OBLA 4OHMA 4P82A 1P2DA 3H11B 3OIDA 4HVTA 4JB8A 2NM0A 5I48A 4L9RA 3D4NA 1NZJA 1Y8RB 5I01A 5JMTA 3PRHA 2NVUA 2Q8QA 3ITNA 3QEJA 1TMOA 4BNDA 1A9PA 3OEEA 1LLDA 3DCNA 4JD5A 3QKTA 1M1KD 2BEJA 2BMWA 3COYA 4RZHA 1MNQA 4I55F 4LZOA 1GN8A 1H6AA 1EGMB 3NALA 2XUDA 4KO2S 3R0IA 4X93A 2LW7A 5DP1A 4AKIA 1KI7A 1D2RA 1VG0B 3JTEA 5COBA 4ZOLA 3WV5A 2IE8A 3FTEA 3RSCA 4GYJA 1F1BA 1DDOA 1Z4PX 2O52A 4X91A 5DNAA 3IIEA 4PFQA 2QAIA 3ZS8A 2GFHA 3SF0A 4WI1A 5J3JA 2WTNA 5ETJA 3W8EA 3ZU2A 4TWBA 4ROTA 1FIUA 1OXSC 3KQOA 5HM6A 1X1SA 2QUZA 3PUKA 1TU3A 1R27A 4Z3KA 2DJIA 3PNVA 3ZHBA 1XPOA 1R1DA 1EUZA 5EI5A 3ZWXA 4GDMA 2X4IA 4O1HA 2WG1A 4XB2A 1TF2A 4JJFA 2ZBDA 1YZHA 1KQOA 3A05A 3GEDA 1F6BA 2J46A 5IAGA 3GQBB 1RWMA 1ESZA 3LQEA 4DQLA 2CHFA 1JIXA 1H94A 3LQ6A 2FN3A 4UU1A 3ZQ4A 2IY9A 5HKAA 1NZDA 1P39A 4RWZA 2IHBA 4UVDA 2ONCA 4I55B 2BFOA 2JF0A 3DD1A 3SXPA 4DILA 3K70C 4CTKA 1RPZA 3QU4A 3RG8A 4FFLA 1PQWA 3CBQA 5AJWA 4B1FA 4QUHA 1ADGA 2RJOA 1W59A 4JAVC 4WACA 1D3AA 4I55A 3D0OA 1V8FA 3VO2A 2D3WA 3DZHA 3O8OA 1HH4A 1XMJA 1YZ3A 2RHJA 2VF7A 3L8GA 2FR8C 4GWKA 1ZU5A 5EXXA 2HCBA 4FCVA 2JJ2A 4NF2A 1H1DA 5EEGA 1AH2A 1JQLB 1USKA 3AR7A 4J7CA 5HPYB 2JLZA 3B7PA 1CP3A 4DRYA 1MW8X 2VYFA 3KVNA 4XWGA 1QHYA 2O54A 4ZQBA 4PRKA 3VJMA 1N5JA 4RSMA 1O96B 2PNFA 3EW9A 4LWOA 5BOVA 3RBAA 4Z2AA 5JV5A 3F46A 5K0SA 2QTCA 4XH9B 2JGNA 1RADA 4DLAA 2BC9A 2LRHA 1C14A 3D3JA 3P5SA 1EFAA 2Z30A 4D9HA 3UBTA 1FRNA 3EG9B 2VPQA 1BS1A 1KDTA 1OYOA 5LQDA 4YJ3A 1G7TA 4M1EA 1MCZA 1R0RE 4QO8A 5K20A 1P17A 4Y1GA 4EABA 3G05A 3ILYA 5D84A 1OLSA 3L46A 1MZPA 3BDVA 1XE3A 3U4HA 1TZMA 4R01A 4GLJA 3X1YA 2REXB 5IJZA 1K63A 3OT1B 3WKDA 4ZYWA 4PC1A 4B3JA 1OFGA 4C6TA 3LF1A 3KLPX 5J35A 1ZQ1A 2CNBA 2PSSA 4F4DA 4EY7A 2OCLA 3NMUF 2R1UA 1QVAA 2VP3A 3FRIA 4JB0A 4ZOAA 3STHA 2Z8YM 3GVPA 3ENQA 1H3EA 3LNTA 2HT1A 4OAQA 4Y6QA 2YRWA 1EP1B 2E6KA 4JQZA 721PA 4HGYA 3FFWA 3OF5A 3TX6A 3H9GA 1IEVA 1K8YB 1XTTA 1RYYA 4KU4A 5AI5A 4M7PA 3KR2A 1Z29A 4M49A 4GQIA 4X9XA 4D0GA 4DVGA 2ZJ0A 3TRJA 2OY0A 4HAIA 3KVRA 5HILA 2XCOA 5CJJA 3BMQA 1Y5LA 2OLJA 1B0UA 2I4IA 2JHPA 4K40A 4EGQA 4UTOA 3D8SA 4MDYA 3C39A 4FCTA 1R8JA 2O5RA 2RH5A 3OFKA 4MGIR 2WKPA 4WKNA 5JQWA 1OGJA 1VB3A 1XTQA 2IYXA 1Y63A 2NTNA 2OV4A 3WGZA 3UTDA 4FB5A 1SKUA 1KFJB 3QOXA 4KGXA 4B4UA 1M75A 3I8SA 3RUEA 1CQIA 3HXQA 2VDWB 1RWWA 2Q3LA 5H1YA 3JATA 1D9ZA 5TMEA 1JR2A 2AJCA 1Z33A 5DVZA 3A9TA 3BXEA 3ZWDA 4BGIA 5CHYA 3PWSA 3M89A 4FOOA 4Z99A 4HDRB 4D0LB 4W8OA 1H1LB 3VTKA 1RXCA 2QW0X 2PR7A 4A2WA 4KZPA 5AVVA 4QTTB 2SCUA 5CNIA 4ZOQI 4D9CA 4EQ6B 3JW8A 2C3PA 4IDEA 1R6XA 4Q7MB 1JL3A 2A9KA 3KUDA 2D0PB 2XMDA 3RODA 4QNMA 3C48A 2NTJA 4MUHA 2FEKA 2PU5A 3TD9A 3U9SA 1IBMB 1T6BY 5LYJF 3CLHA 4TRRA 1KAQA 1XEXB 5J5VA 3LPCA 4S1NA 1WY5A 1B2LA 4DJFC 4I99A 5GGYA 2EJVA 1M1ZA 2C2HA 2PL5A 3CUKA 1GG2A 3QKWA 4LCJA 3UICA 2GUWA 1P9LA 4UPDA 1BQEA 4RORA 1QFYA 1O6GA 4MYDA 1DOAA 1SBCA 2ZWOA 4A0HA 5CA0F 3GAFA 1SUIA 2JGLA 3LKVA 4NPCA 1HG1A 2FFJA 2W22A 3BGWA 1NP7A 2OM6A 5JJ5A 3NOXA 2QRKA 4FT2A 1FX0B 2ZR8A 1TK2A 3USCS 3G2NA 4CIVA 3TGWA 1PHRA 2BRUA 1WZNA 4FGSA 2W6JA 2O3RA 3IV7A 4OQ4A 5GZ1A 5JBQA 5KU1A 1OH7A 1EM6A 4AO6A 5JAOA 5KS2A 2W8BA 2GSWA 5A5GA 4DA9A 1GV0A 1HX7A 2HSWA 3KZCA 4XQEA 4ARZB 1G63A 1YACA 1JJBA 4HIZA 2GEFA 2GN1A 2Q3FA 1V95A 2HJVA 1PR3A 2AN9A 2JEYA 3Q12A 4IDBA 4AIRA 3CZ4A 5LOVF 2Q5IA 3GFVA 1G2QA 2P9YA 1VMKA 4N7MA 3STYA 2N3ZA 4DDVA 1KMNA 3E2IA 3RC7A 3T3NA 1FYWA 4WXMA 1IUKA 1D2HA 3HSSA 1F20A 3H9BA 4L9WA 4ZVUA 4M9SA 3TVYA 1QQTA 2K6GA 1E77A 2WAXA 2H2DA 2YV4A 5IX8A 5ED0A 4CL8A 5MN6A 5EE3A 4QGAA 2OVFA 4YROA 2NU9A 2R48A 2BZGA 2C2YA 1W2BB 2EKLA 2FP3A 2WRZA 4DBLE 2YVAA 4KMRA 1HDEA 3FUTA 3VJLA 1FXUA 1FJGB 4GSYA 2PN1A 1ISPA 1G21E 1G8SA 2FR8A 3MJVA 2A9FA 2ZE5A 2Q99A 3L3BA 1W88A 1Z74A 3VHQA 3N53A 3FIUA 5CCXA 2BKVA 2NSDA 3A1NA 3PVCA 2OWEA 2ZJBA 3EIWA 5A8AA 4P5PA 4TVOA 3LX4A 3USES 4EHNA 2E4WA 2JVJA 1E2EA 1FPQA 2RH4A 2F3RA 2PGDA 3X2FA 3JWGA 4ND1A 1SCDA 4H08A 1XTSA 3UXYA 3SFTA 2D2VA 3Q2KA 5EMHA 1PJTA 2B61A 2RJ3A 5SZKB 2QKYA 3Q3EA 4AC9A 4GIBA 2JLUA 4J0FA 2YJTD 4DZRA 4JMQA 1XTIA 1AUPA 1P7WA 2NYUA 1ZD3A 2WJWA 3BWEA 3LO5A 4HFMA 4YAUA 4QU8A 4ZPJA 1TUBB 2L0XA 1HEUA 4HJXA 1R0SA 1JMYA 1OE0A 4NBWA 3GPCA 1WZEA 3PC3A 5BNTA 1QZZA 3LC2O 5JQGA 2ONJA 1D5WA 3QEOA 3E70C 4PAMA 2OFFA 5IG2A 2BFCA 2LUOA 3KWMA 4NOJA 2C5EA 4TLMB 3KZOA 1NQXA 2Z98A 4OQZA 2R62A 2HLDA 5T7BA 4JYPA 4MJ7A 4DEXA 4BB0A 4OH7A 4I0WB 5CCDA 3GJYA 1JG4A 5CX1B 5T64A 1QRRA 4A2CA 4OA5A 2AH5A 2WHYA 4WOCA 5HKLA 3AY7A 2BJVA 1Q0QA 2ZJ8A 3GJXC 3IVXA 3IR5A 1YFZA 4H9GA 3I9OA 3IVRA 3CIFA 1KFBB 1T43A 5FBRB 2X8WA 4Z3DA 4G24A 1CJBA 3S6JA 2BFBB 2BSXA 3V00A 1EK0A 2W4IA 3D6TB 2HUPA 3VISA 4U2DA 3RVPA 4LV5B 1NI4B 2J08A 2PUTA 1RD4A 2C4KA 1GTJ1 3HHPA 3U3MA 2O8DA 4GUAA 3OETA 1F6WA 1JHZA 3ZCXA 2OPBA 2WQZA 1T8TA 4RETA 5FR2A 4OYHA 4Q4AA 5E7IA 4A6DA 3CC2B 1QIGA 2NXEA 1T5SA 4QAJA 2I7CA 4S35A 3WBFA 3DTYA 5BSEA 5P8WA 5IN5A 3DZFA 3K92A 5JY1A 2CYBA 5A0VA 3NRCA 5E9WA 1OAOC 3KR1A 1JLSA 3BB1A 3GZNB 4DR4B 1RR6A 3M6VA 4KE6A 3K8OE 1SKQA 2MCFA 1RYMA 2FDCA 5HZAA 1K75A 1P19A 4QJBA 3TOCA 2GNOA 4TUYF 2QTMA 3TIGA 4LYEA 2NXCA 3NVMB 4XRGA 1IN4A 5TF4A 2C8KA 3RT7A 5IN4A 5SYMA 1GGFA 2PA3A 1UXGA 2Q46A 2RGNA 3A1SA 3PXCX 4PAWA 4XYGA 3DKKA 2ZJOA 1GRRA 5EP4A 2QAJA 1Q14A 2PX8A 5KNDD 2B2CA 3LYHA 2P9EA 4RH0A 2MYTA 2HF2A 4XUGB 4BN4A 4Q9LA 4R2KA 4R5MA 3ZNOA 3BD8A 4MEAA 2P5UA 4DCCA 3X1WA 4PLGA 3OE4A 3O4GA 1MDBA 3PV0A 4G8DA 1N2CA 2WIDA 3OZGA 1KRWA 3CCCA 4QUGA 4P3OA 1UAYA 2O1EA 3QQ5A 4YMSA 1NC1A 4BO9A 5HFAA 5HS4A 2C7PA 3AERB 2R8OA 3RJ9A 2FSVA 3OFJA 4K86A 3TMKA 3W4IA 4EENA 4TVBA 3IH5A 2E37A 4BX3A 5A5DA 2RH9B 1CF9A 4JXZA 2PKQP 3A6KA 4K9DA 4I1VA 1ONPA 4BEVA 3W2HA 1L7AA 1QB8A 4FOSA 1EINA 2ZZFA 1ZRNA 3C85A 4YEJA 2CHVA 2QSJA 4U00A 2B1QA 2EBFX 5K6TA 3NHWA 3GEMA 4RY0A 5J1TB 1HKUA 1ND5A 2NMVA 3N8GA 4HNUA 4MUBA 2E5WA 3FMGA 1N75A 2I2AA 4G26A 1GPNA 2CT8A 1UQTA 1P5JA 1TZ2A 1G6HA 2AI1A 3NASA 4HXEB 1N7GA 4H77A 3AXTA 4LZAA 1Q19A 5D85A 2LIVA 1T0PA 2YBEA 4AZ0A 1QIKA 3EC1A 4D41A 1FTGA 3PQ6A 5DEIA 4PZDA 3QE4A 4XLFA 4KH0A 1JQJC 2J3DA 3DMHA 5G40A 5T4FA 1X86B 3L1HA 1V2GA 4XGIA 3UG7A 3GDOA 1G98A 4FXUA 3MERA 1QOZA 2R8XA 3NR2A 4DSUA 3IDQA 2IZ7A 2VDRB 4BLSA 1KQGA 1U7WA 3JXEA 1OLUB 5AP9A 5ADVA 1Q7RA 3W5BA 5ITZB 4MKHA 2A88A 1OXBB 1X74A 2H07A 1JZSA 2AN3A 1PJ4A 2G40A 3OY7A 5AKXA 3KYCA 1SOMA 3OBIA 4TTTS 2XHEA 3FPJA 4N8SA 1RQ2A 4Q02A 3L7JA 2HK9A 3L7NA 4F7DA 3BH4A 2H92A 4G2TA 1U1FA 4GWLA 4GXTA 2R84A 2IYAA 2EYUA 1U3FA 3ZGZA 2JDIA 2QD3A 5FRDA 1MIOB 1O6FA 3FF4A 2PANA 2G9ZA 1OFHA 2YRXA 1XF9A 2PZLA 5EINA 3TRKA 3G9UA 3TCXB 5CVEA 3WZMA 2L17A 3NBXX 3H5TA 1G8JA 1I4WA 3JQ9A 4INJA 4XA8A 5J3OA 1RWKA 2PGAA 3OM8A 2B36A 4XQGA 1KOJA 4BXOB 1VBNA 3S5UA 2XF8A 1JSZA 5EXDA 3L1JA 4I9GA 4AJEA 2YZKA 2AX4A 2ZIXA 3AV0B 5FUYA 1NSFA