1F2IG

Cocrystal structure of selected zinc finger dimer bound to dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*TP*GP*GP*GP*CP*GP*CP*GP*CP*CP*CP*AP*T)-3'
publication title Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 17
structure length 66
sequence length 66
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2000-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG01
2CTDA 4IS1C 1X5WA 2LVHA 2EOEA 2YRKA 2EE8A 3EPKA 2EJ4A 2ADRA 2R1FA 2WCC3 4R2PA 4R2SA 2EM5A 1DGCA 4WSGA 2A25A 2YSPA 3EPLA 1MEYC 2GHFA 2CSHA 2EM7A 2WBSA 4R2EA 2EM8A 2EMXA 2MDGA 1KJKA 1A1HA 1B69A 2EM2A 2EM6A 2EN3A 2EMCA 1ZU1A 2ENCA 2EOZA 2EPUA 2EMBA 2YTIA 4F6NA 1TF6A 2YTNA 2HGHA 2EQ1A 1X6EA 2D9HA 2EMIA 2EOQA 2E72A 1A1KA 1A1LA 2NABA 5KL3A 1JK2A 2RPCA 2EMFA 2EPPA 1TN9A 2RSIA 2EOJA 2EN1A 1A1FA 4R2CA 5KL5A 2EPZA 1YUJA 2VRDA 2EN8A 2EM3A 5KL6A 5KL7A 4X9JA 2DGCA 4GZNC 2YU5A 2YTGA 2EPRA 2LO3A 1ZR9A 2MKDA 2YTQA 1NCSA 2EPXA 2CT1A 2EN6A 2EPAA 2EL5A 2YTDA 2ELYA 1YUIA 2EL6A 3EPHA 2ENHA 2EOHA 4F6MA 2YTEA 2BB8A 2YTOA 3MHSC 2YRHA 2GLIA 1WJPA 4M9VC 2I13A 1UN6B 2EOIA 2DLQA 2EMYA 2EN7A 3MHHC 1BB8A 2EM4A 2EORA 2LCEA 2EMKA 2YTPA 4R2DA 5KL4A 2YTFA 2EMZA 2EOXA 1RMDA 2EP3A 1X6HA 2EL4A 2EM9A 2EOFA 2WBUA 1X6FA 2EMLA 3EPJA 4F2JC 1A1IA 2MKNA 2YU8A 2JP9A 2LT7A 2YSOA 4R2RA 4R2AA 1JK1A 2ENAA 2EOMA 2DRPA 2EMHA 2EQ0A 1UBDC 3M99B 3VHTB 1ZAAC 2EOOA 4IJDA 4R2QA 2EN4A 5KL2A 1A1JA 2EM0A 2EN2A 1TF3A 2PRTA 1X3CA 1A1GA 2J7JA 1F2IG 2EOSA 2YRMA 2EMGA 2EMWA 1YSAC 2DLKA 1P47A 2ELZA 1BBOA 1G2FC 1G2DC 2EMAA 2LV2A 3UK3C 2EQ3A 2JPAA 4FK5C 2YTJA 1Z1BA 2M9AA 1LLMC 1AAYA 2EPCA 2WBTA 2EOYA 2DMIA
chains in the Genus database with same CATH superfamily
1N36E 2CTDA 1IBKE 2UU9E 2YRKA 4JI2E 2JYAA 5A6AA 1DGCA 2MC5A 4R03A 2GHFA 4BHBA 1ZBQA 2EM7A 2N3HA 1J5EE 3BBGA 1B69A 2EM2A 4BHCA 2V89A 2EOZA 1T4OA 1O0WA 2FGGA 1TF6A 4M30A 5IXMB 3T1HE 5LLQA 4BMJA 2RTXA 2I9IA 2JVAA 4WXDA 2E72A 3HQ1A 2NABA 4DKKA 5KL3A 3IWCA 2EPPA 2EOJA 4DMIA 2EPZA 1YUJA 4OOGC 2KONA 5KL6A 4NXME 4LF5E 2L3CA 2YTGA 5A6BD 2K4VA 2YTQA 4L8NA 2UUBE 2JOXA 2V88A 1YUIA 2VQEE 3BIDA 4DV6E 4RH8A 2YTEA 3IWBA 2YRHA 2L2MA 2VQFE 2I13A 1YYKA 1UN6B 2EOIA 2EMYA 2B7TA 1WXRA 3C6MA 1YYWA 3HPZA 4DR5E 2EMZA 3HTXA 2WBUA 2EMLA 3EQ1A 3H09A 2MKNA 1NEIA 1J26A 4X64E 2IHR1 4X8WA 4L5NC 4LU9A 2LT7A 1EH7A 2EMHA 1UBDC 4F54A 5ADZA 2NUEA 1PJQA 3KWRA 2EWLA 2EOOA 4J8ZA 4R2QA 4K0KE 5IV8B 2EN4A 1WHQA 2EM0A 1XNQE 1A1GA 4Q28A 4DR3E 4OX9E 2EMAA 2LV2A 2EZ6A 4DV2E 3UK3C 1YFHA 3ECRA 4O24A 4DV0E 4GEQB 2ODRC 4KWYA 2YTJA 1Z1BA 4DV5E 2DIXA 3OTOE 4M2ZA 3VYYA 3C4TA 4YY3E 2L3JA 2LVHA 2EOEA 3EPKA 1IBLE 1QNTA 2ADRA 2R1FA 4R2PA 2WCC3 4R2SA 1T4NA 2EM5A 4WSGA 1STUA 2LBSB 2A25A 1MEYC 2V87A 2EPNA 2MDGA 2EPLX 2V83A 3AV0A 4DUYE 4AQYE 1A1HA 4LFAE 2EPMX 2EN3A 1GQEA 4B3RE 2EPKX 2ENCA 2L33A 2LTRA 2JR1A 3JAMC 4F6NA 2GPIA 2N3GA 3THNA 1X6EA 2M1SA 2EMIA 3J7AG 4DV1E 4JI6E 1JK2A 2MDRA 4KZSA 2RSIA 3P1XA 1A1FA 2WZOA 2UUCE 3TQMA 2VRDA 2EN8A 2RSMA 2EM3A 5LMNE 5KL7A 4GZNC 2YU5A 4O5GA 4GKKE 2MC6A 2UXBE 4B3SE 4N4RB 2EL5A 1T39A 2UXCE 4JI1E 3EPHA 2EOHA 1IMUA 3HXLA 4DV7E 4M9VC 3MHHC 2KOUA 1DQ3A 2R76A 2ODRD 2EMKA 3MSWA 1GZ6A 2YTFA 2EP3A 2EL4A 2EM9A 2EOFA 2B7VA 2BBGA 4O4KA 4P78A 5A2QC 2FV4B 4WX9A 1SR9A 2YSOA 4R2RA 4R2AA 1JK1A 2LTSA 2EOMA 1ZAAC 4MLQA 3ADGA 5KL2A 1A1JA 1L4SA 3J7Yp 1TF3A 1X3CA 4DV4E 1SFEA 2V8QB 4DUZE 1FJGE 3QG5C 1YSAC 3HPSA 1T38A 2N8XA 3F6GA 2L6MA 4BS9A 1AH5A 1T4LB 4BBYA 1HNWE 1GTKA 5LMUE 1XNRE 4O43A 3ADIA 2M9AA 1UILA 4F9BB 1AAYA 4LF4E 4F9AB 4F6MA 2LRSA 4X66E 5A6KA 3K6QA 4JI8E 1WHNA 3RMPA 4GKJE 3C4BA 1HR0E 2LJHA 4R8OA 2CSHA 2WBSA 4R2EA 2EM8A 1N34E 4LF9E 4TUGA 4HTGA 3THOB 4JI7E 2LJUA 3ADJA 2F8BA 2EPUA 2YTIA 2HHHE 4NXNE 2HGHA 2EQ1A 1HNXE 2D9HA 2YPNA 2HJJA 3LMLA 5A6JA 2L2NA 1FKAE 4P7DA 2UXDE 1A1KA 1A1LA 4X62E 2EMFA 2DMYA 5A69A 2EN1A 2L92A 4NHRA 1X47A 5TSEA 4WYQB 3DJWA 2KHXA 2JXPA 3LLHA 3J80C 1PKPA 2H36X 4TUIA 2LO3A 1ZR9A 2UUAE 4JI0E 2MKDA 2YWQA 1NCSA 4WSPA 2CT1A 2EPAA 3KZZA 2ELYA 2L8TA 3BF2A 1RC7A 1ZBTA 5LL6R 2YTOA 3MHSC 3F6HA 1MGTA 2DB2A 4ZYHA 2YZTA 4BCAA 5F3WA 2EN7A 2EORA 4DR6E 1UHZA 4R2DA 5KL4A 1XMOE 3ZOQB 1RMDA 5AE3A 1X6FA 1A1IA 5DNYA 4YHHE 2JP9A 4LFBE 1IQOA 4LF8E 4WPYA 5IWAE 2ZM6E 1N32E 2M4IA 4ZYEA 2DRPA 4JV5E 3VHTB 4IJDA 4DV3E 5FLXC 1XMQE 2EN2A 3OMLA 1PJTA 3IWDA 2PRTA 2NUGA 2JY9A 4HEIA 2RS6A 2EMGA 4F9CB 1HNZE 2JWOA 4JI4E 1P47A 1BBOA 1G2FC 1G2DC 1PJSA 4B3TE 2JPAA 5IT9C 4FK5C 4KHPE 2LUQA 2B3TB 2RS7A 3T1YE 1RQ0A 2EOYA 1KYQA 2DMIA 4IS1C 1X5WA 2EE8A 1X48A 2FTXB 4BC9A 2EJ4A 2CPNA 2YSPA 3EPLA 2EMXA 1YZ9A 2NUFA 2B9DA 1KJKA 1QU6A 4DR1E 4DR2E 3ADLA 2EM6A 2EMCA 1ZU1A 5T6JA 2YT4A 2EMBA 2YTNA 1EH8A 4ZYDA 2E5LE 2EOQA 4ZYGA 3J81C 3C6KA 2M7QA 5AC4A 2RPCA 2LE2A 1TN9A 4R2CA 5KL5A 4X65E 5A6BA 4JI3E 4I8OA 4Q35B 4X9JA 4MLVA 4LFCE 2DGCA 2DSYA 2HC5A 2EPRA 3FIGA 2L2KB 5AE1A 2EPXA 3JU0A 1YYOA 2EN6A 2YTDA 2NA2A 4BC7A 4LTYA 2EL6A 2ENHA 3KZYA 4DR7E 1IQSA 2BB8A 2GLIA 1WJPA 5CFFE 5AC5A 4JYAE 2DLQA 1BB8A 1BBGA 2YTPA 2EM4A 2JOBA 2LCEA 2VF1A 3DF6A 4B3ME 2LMZA 2EPOA 2EOXA 1X6HA 3L00A 3EPJA 2F4VE 1EKZA 4F2JC 1X49A 1DI2A 5AASA 2V85A 2RQLA 2YU8A 4WXCA 2G7HA 2VE7C 2ENAA 1PDAA 3VYXA 1IBME 2LUPB 3M99B 5BR8E 4JI5E 2Q8UA 1I94E 3AUZA 2J7JA 1F2IG 2EOSA 4LF7E 2YRMA 2K7IA 2EMWA 1YPNA 4NZVA 2E1MA 1WRJA 2DLKA 2ELZA 2EQ3A 4WFTA 3VK6A 4RHBB 1N33E 5AE2A 2V86A 4DR4E 1EH6A 3BGHA 1N3GA 3JTZA 1LLMC 2EPCA 4LF6E 4M0VA 2WBTA 2EQ0A
chains in the Genus database with same CATH topology
2CTDA 4IS1C 1X5WA 2LVHA 2EOEA 2YRKA 2EE8A 3EPKA 2EJ4A 2ADRA 2R1FA 2WCC3 4R2PA 4R2SA 2EM5A 1DGCA 4WSGA 2A25A 2YSPA 3EPLA 1MEYC 2GHFA 2CSHA 2EM7A 2WBSA 4R2EA 2EM8A 2EMXA 2MDGA 1KJKA 1A1HA 1B69A 2EM2A 2EM6A 2EN3A 2EMCA 1ZU1A 2ENCA 2EOZA 2EPUA 2EMBA 2YTIA 4F6NA 1TF6A 2YTNA 2HGHA 2EQ1A 1X6EA 2D9HA 2EMIA 2EOQA 2E72A 1A1KA 1A1LA 2NABA 5KL3A 1JK2A 2RPCA 2EMFA 2EPPA 1TN9A 2RSIA 2EOJA 2EN1A 1A1FA 4R2CA 5KL5A 2EPZA 1YUJA 2VRDA 2EN8A 2EM3A 5KL6A 5KL7A 4X9JA 2DGCA 4GZNC 2YU5A 2YTGA 2EPRA 2LO3A 1ZR9A 2MKDA 2YTQA 1NCSA 2EPXA 2CT1A 2EN6A 2EPAA 2EL5A 2YTDA 2ELYA 1YUIA 2EL6A 3EPHA 2ENHA 2EOHA 4F6MA 2YTEA 2BB8A 2YTOA 3MHSC 2YRHA 2GLIA 1WJPA 4M9VC 2I13A 1UN6B 2EOIA 2DLQA 2EMYA 2EN7A 3MHHC 1BB8A 2EM4A 2EORA 2LCEA 2EMKA 2YTPA 4R2DA 5KL4A 2YTFA 2EMZA 2EOXA 1RMDA 2EP3A 1X6HA 2EL4A 2EM9A 2EOFA 2WBUA 1X6FA 2EMLA 3EPJA 4F2JC 1A1IA 2MKNA 2YU8A 2JP9A 2LT7A 2YSOA 4R2RA 4R2AA 1JK1A 2ENAA 2EOMA 2DRPA 2EMHA 2EQ0A 1UBDC 3M99B 3VHTB 1ZAAC 2EOOA 4IJDA 4R2QA 2EN4A 5KL2A 1A1JA 2EM0A 2EN2A 1TF3A 2PRTA 1X3CA 1A1GA 2J7JA 1F2IG 2EOSA 2YRMA 2EMGA 2EMWA 1YSAC 2DLKA 1P47A 2ELZA 1BBOA 1G2FC 1G2DC 2EMAA 2LV2A 3UK3C 2EQ3A 2JPAA 4FK5C 2YTJA 1Z1BA 2M9AA 1LLMC 1AAYA 2EPCA 2WBTA 2EOYA 2DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTD A;  4IS1 C;  1X5W A;  2LVH A;  2EOE A;  2YRK A;  2EE8 A;  3EPK A;  2EJ4 A;  2ADR A;  2R1F A;  2WCC 3;  4R2P A;  4R2S A;  2EM5 A;  1DGC A;  4WSG A;  2A25 A;  2YSP A;  3EPL A;  1MEY C;  2GHF A;  2CSH A;  2EM7 A;  2WBS A;  4R2E A;  2EM8 A;  2EMX A;  2MDG A;  1KJK A;  1A1H A;  1B69 A;  2EM2 A;  2EM6 A;  2EN3 A;  2EMC A;  1ZU1 A;  2ENC A;  2EOZ A;  2EPU A;  2EMB A;  2YTI A;  4F6N A;  1TF6 A;  2YTN A;  2HGH A;  2EQ1 A;  1X6E A;  2D9H A;  2EMI A;  2EOQ A;  2E72 A;  1A1K A;  1A1L A;  2NAB A;  5KL3 A;  1JK2 A;  2RPC A;  2EMF A;  2EPP A;  1TN9 A;  2RSI A;  2EOJ A;  2EN1 A;  1A1F A;  4R2C A;  5KL5 A;  2EPZ A;  1YUJ A;  2VRD A;  2EN8 A;  2EM3 A;  5KL6 A;  5KL7 A;  4X9J A;  2DGC A;  4GZN C;  2YU5 A;  2YTG A;  2EPR A;  2LO3 A;  1ZR9 A;  2MKD A;  2YTQ A;  1NCS A;  2EPX A;  2CT1 A;  2EN6 A;  2EPA A;  2EL5 A;  2YTD A;  2ELY A;  1YUI A;  2EL6 A;  3EPH A;  2ENH A;  2EOH A;  4F6M A;  2YTE A;  2BB8 A;  2YTO A;  3MHS C;  2YRH A;  2GLI A;  1WJP A;  4M9V C;  2I13 A;  1UN6 B;  2EOI A;  2DLQ A;  2EMY A;  2EN7 A;  3MHH C;  1BB8 A;  2EM4 A;  2EOR A;  2LCE A;  2EMK A;  2YTP A;  4R2D A;  5KL4 A;  2YTF A;  2EMZ A;  2EOX A;  1RMD A;  2EP3 A;  1X6H A;  2EL4 A;  2EM9 A;  2EOF A;  2WBU A;  1X6F A;  2EML A;  3EPJ A;  4F2J C;  1A1I A;  2MKN A;  2YU8 A;  2JP9 A;  2LT7 A;  2YSO A;  4R2R A;  4R2A A;  1JK1 A;  2ENA A;  2EOM A;  2DRP A;  2EMH A;  2EQ0 A;  1UBD C;  3M99 B;  3VHT B;  1ZAA C;  2EOO A;  4IJD A;  4R2Q A;  2EN4 A;  5KL2 A;  1A1J A;  2EM0 A;  2EN2 A;  1TF3 A;  2PRT A;  1X3C A;  1A1G A;  2J7J A;  1F2I G;  2EOS A;  2YRM A;  2EMG A;  2EMW A;  1YSA C;  2DLK A;  1P47 A;  2ELZ A;  1BBO A;  1G2F C;  1G2D C;  2EMA A;  2LV2 A;  3UK3 C;  2EQ3 A;  2JPA A;  4FK5 C;  2YTJ A;  1Z1B A;  2M9A A;  1LLM C;  1AAY A;  2EPC A;  2WBT A;  2EOY A;  2DMI A; 
#chains in the Genus database with same CATH topology
 1N36 E;  2CTD A;  1IBK E;  2UU9 E;  2YRK A;  4JI2 E;  2JYA A;  5A6A A;  1DGC A;  2MC5 A;  4R03 A;  2GHF A;  4BHB A;  1ZBQ A;  2EM7 A;  2N3H A;  1J5E E;  3BBG A;  1B69 A;  2EM2 A;  4BHC A;  2V89 A;  2EOZ A;  1T4O A;  1O0W A;  2FGG A;  1TF6 A;  4M30 A;  5IXM B;  3T1H E;  5LLQ A;  4BMJ A;  2RTX A;  2I9I A;  2JVA A;  4WXD A;  2E72 A;  3HQ1 A;  2NAB A;  4DKK A;  5KL3 A;  3IWC A;  2EPP A;  2EOJ A;  4DMI A;  2EPZ A;  1YUJ A;  4OOG C;  2KON A;  5KL6 A;  4NXM E;  4LF5 E;  2L3C A;  2YTG A;  5A6B D;  2K4V A;  2YTQ A;  4L8N A;  2UUB E;  2JOX A;  2V88 A;  1YUI A;  2VQE E;  3BID A;  4DV6 E;  4RH8 A;  2YTE A;  3IWB A;  2YRH A;  2L2M A;  2VQF E;  2I13 A;  1YYK A;  1UN6 B;  2EOI A;  2EMY A;  2B7T A;  1WXR A;  3C6M A;  1YYW A;  3HPZ A;  4DR5 E;  2EMZ A;  3HTX A;  2WBU A;  2EML A;  3EQ1 A;  3H09 A;  2MKN A;  1NEI A;  1J26 A;  4X64 E;  2IHR 1;  4X8W A;  4L5N C;  4LU9 A;  2LT7 A;  1EH7 A;  2EMH A;  1UBD C;  4F54 A;  5ADZ A;  2NUE A;  1PJQ A;  3KWR A;  2EWL A;  2EOO A;  4J8Z A;  4R2Q A;  4K0K E;  5IV8 B;  2EN4 A;  1WHQ A;  2EM0 A;  1XNQ E;  1A1G A;  4Q28 A;  4DR3 E;  4OX9 E;  2EMA A;  2LV2 A;  2EZ6 A;  4DV2 E;  3UK3 C;  1YFH A;  3ECR A;  4O24 A;  4DV0 E;  4GEQ B;  2ODR C;  4KWY A;  2YTJ A;  1Z1B A;  4DV5 E;  2DIX A;  3OTO E;  4M2Z A;  3VYY A;  3C4T A;  4YY3 E;  2L3J A;  2LVH A;  2EOE A;  3EPK A;  1IBL E;  1QNT A;  2ADR A;  2R1F A;  4R2P A;  2WCC 3;  4R2S A;  1T4N A;  2EM5 A;  4WSG A;  1STU A;  2LBS B;  2A25 A;  1MEY C;  2V87 A;  2EPN A;  2MDG A;  2EPL X;  2V83 A;  3AV0 A;  4DUY E;  4AQY E;  1A1H A;  4LFA E;  2EPM X;  2EN3 A;  1GQE A;  4B3R E;  2EPK X;  2ENC A;  2L33 A;  2LTR A;  2JR1 A;  3JAM C;  4F6N A;  2GPI A;  2N3G A;  3THN A;  1X6E A;  2M1S A;  2EMI A;  3J7A G;  4DV1 E;  4JI6 E;  1JK2 A;  2MDR A;  4KZS A;  2RSI A;  3P1X A;  1A1F A;  2WZO A;  2UUC E;  3TQM A;  2VRD A;  2EN8 A;  2RSM A;  2EM3 A;  5LMN E;  5KL7 A;  4GZN C;  2YU5 A;  4O5G A;  4GKK E;  2MC6 A;  2UXB E;  4B3S E;  4N4R B;  2EL5 A;  1T39 A;  2UXC E;  4JI1 E;  3EPH A;  2EOH A;  1IMU A;  3HXL A;  4DV7 E;  4M9V C;  3MHH C;  2KOU A;  1DQ3 A;  2R76 A;  2ODR D;  2EMK A;  3MSW A;  1GZ6 A;  2YTF A;  2EP3 A;  2EL4 A;  2EM9 A;  2EOF A;  2B7V A;  2BBG A;  4O4K A;  4P78 A;  5A2Q C;  2FV4 B;  4WX9 A;  1SR9 A;  2YSO A;  4R2R A;  4R2A A;  1JK1 A;  2LTS A;  2EOM A;  1ZAA C;  4MLQ A;  3ADG A;  5KL2 A;  1A1J A;  1L4S A;  3J7Y p;  1TF3 A;  1X3C A;  4DV4 E;  1SFE A;  2V8Q B;  4DUZ E;  1FJG E;  3QG5 C;  1YSA C;  3HPS A;  1T38 A;  2N8X A;  3F6G A;  2L6M A;  4BS9 A;  1AH5 A;  1T4L B;  4BBY A;  1HNW E;  1GTK A;  5LMU E;  1XNR E;  4O43 A;  3ADI A;  2M9A A;  1UIL A;  4F9B B;  1AAY A;  4LF4 E;  4F9A B;  4F6M A;  2LRS A;  4X66 E;  5A6K A;  3K6Q A;  4JI8 E;  1WHN A;  3RMP A;  4GKJ E;  3C4B A;  1HR0 E;  2LJH A;  4R8O A;  2CSH A;  2WBS A;  4R2E A;  2EM8 A;  1N34 E;  4LF9 E;  4TUG A;  4HTG A;  3THO B;  4JI7 E;  2LJU A;  3ADJ A;  2F8B A;  2EPU A;  2YTI A;  2HHH E;  4NXN E;  2HGH A;  2EQ1 A;  1HNX E;  2D9H A;  2YPN A;  2HJJ A;  3LML A;  5A6J A;  2L2N A;  1FKA E;  4P7D A;  2UXD E;  1A1K A;  1A1L A;  4X62 E;  2EMF A;  2DMY A;  5A69 A;  2EN1 A;  2L92 A;  4NHR A;  1X47 A;  5TSE A;  4WYQ B;  3DJW A;  2KHX A;  2JXP A;  3LLH A;  3J80 C;  1PKP A;  2H36 X;  4TUI A;  2LO3 A;  1ZR9 A;  2UUA E;  4JI0 E;  2MKD A;  2YWQ A;  1NCS A;  4WSP A;  2CT1 A;  2EPA A;  3KZZ A;  2ELY A;  2L8T A;  3BF2 A;  1RC7 A;  1ZBT A;  5LL6 R;  2YTO A;  3MHS C;  3F6H A;  1MGT A;  2DB2 A;  4ZYH A;  2YZT A;  4BCA A;  5F3W A;  2EN7 A;  2EOR A;  4DR6 E;  1UHZ A;  4R2D A;  5KL4 A;  1XMO E;  3ZOQ B;  1RMD A;  5AE3 A;  1X6F A;  1A1I A;  5DNY A;  4YHH E;  2JP9 A;  4LFB E;  1IQO A;  4LF8 E;  4WPY A;  5IWA E;  2ZM6 E;  1N32 E;  2M4I A;  4ZYE A;  2DRP A;  4JV5 E;  3VHT B;  4IJD A;  4DV3 E;  5FLX C;  1XMQ E;  2EN2 A;  3OML A;  1PJT A;  3IWD A;  2PRT A;  2NUG A;  2JY9 A;  4HEI A;  2RS6 A;  2EMG A;  4F9C B;  1HNZ E;  2JWO A;  4JI4 E;  1P47 A;  1BBO A;  1G2F C;  1G2D C;  1PJS A;  4B3T E;  2JPA A;  5IT9 C;  4FK5 C;  4KHP E;  2LUQ A;  2B3T B;  2RS7 A;  3T1Y E;  1RQ0 A;  2EOY A;  1KYQ A;  2DMI A;  4IS1 C;  1X5W A;  2EE8 A;  1X48 A;  2FTX B;  4BC9 A;  2EJ4 A;  2CPN A;  2YSP A;  3EPL A;  2EMX A;  1YZ9 A;  2NUF A;  2B9D A;  1KJK A;  1QU6 A;  4DR1 E;  4DR2 E;  3ADL A;  2EM6 A;  2EMC A;  1ZU1 A;  5T6J A;  2YT4 A;  2EMB A;  2YTN A;  1EH8 A;  4ZYD A;  2E5L E;  2EOQ A;  4ZYG A;  3J81 C;  3C6K A;  2M7Q A;  5AC4 A;  2RPC A;  2LE2 A;  1TN9 A;  4R2C A;  5KL5 A;  4X65 E;  5A6B A;  4JI3 E;  4I8O A;  4Q35 B;  4X9J A;  4MLV A;  4LFC E;  2DGC A;  2DSY A;  2HC5 A;  2EPR A;  3FIG A;  2L2K B;  5AE1 A;  2EPX A;  3JU0 A;  1YYO A;  2EN6 A;  2YTD A;  2NA2 A;  4BC7 A;  4LTY A;  2EL6 A;  2ENH A;  3KZY A;  4DR7 E;  1IQS A;  2BB8 A;  2GLI A;  1WJP A;  5CFF E;  5AC5 A;  4JYA E;  2DLQ A;  1BB8 A;  1BBG A;  2YTP A;  2EM4 A;  2JOB A;  2LCE A;  2VF1 A;  3DF6 A;  4B3M E;  2LMZ A;  2EPO A;  2EOX A;  1X6H A;  3L00 A;  3EPJ A;  2F4V E;  1EKZ A;  4F2J C;  1X49 A;  1DI2 A;  5AAS A;  2V85 A;  2RQL A;  2YU8 A;  4WXC A;  2G7H A;  2VE7 C;  2ENA A;  1PDA A;  3VYX A;  1IBM E;  2LUP B;  3M99 B;  5BR8 E;  4JI5 E;  2Q8U A;  1I94 E;  3AUZ A;  2J7J A;  1F2I G;  2EOS A;  4LF7 E;  2YRM A;  2K7I A;  2EMW A;  1YPN A;  4NZV A;  2E1M A;  1WRJ A;  2DLK A;  2ELZ A;  2EQ3 A;  4WFT A;  3VK6 A;  4RHB B;  1N33 E;  5AE2 A;  2V86 A;  4DR4 E;  1EH6 A;  3BGH A;  1N3G A;  3JTZ A;  1LLM C;  2EPC A;  4LF6 E;  4M0V A;  2WBT A;  2EQ0 A; 
#chains in the Genus database with same CATH homology
 2CTD A;  4IS1 C;  1X5W A;  2LVH A;  2EOE A;  2YRK A;  2EE8 A;  3EPK A;  2EJ4 A;  2ADR A;  2R1F A;  2WCC 3;  4R2P A;  4R2S A;  2EM5 A;  1DGC A;  4WSG A;  2A25 A;  2YSP A;  3EPL A;  1MEY C;  2GHF A;  2CSH A;  2EM7 A;  2WBS A;  4R2E A;  2EM8 A;  2EMX A;  2MDG A;  1KJK A;  1A1H A;  1B69 A;  2EM2 A;  2EM6 A;  2EN3 A;  2EMC A;  1ZU1 A;  2ENC A;  2EOZ A;  2EPU A;  2EMB A;  2YTI A;  4F6N A;  1TF6 A;  2YTN A;  2HGH A;  2EQ1 A;  1X6E A;  2D9H A;  2EMI A;  2EOQ A;  2E72 A;  1A1K A;  1A1L A;  2NAB A;  5KL3 A;  1JK2 A;  2RPC A;  2EMF A;  2EPP A;  1TN9 A;  2RSI A;  2EOJ A;  2EN1 A;  1A1F A;  4R2C A;  5KL5 A;  2EPZ A;  1YUJ A;  2VRD A;  2EN8 A;  2EM3 A;  5KL6 A;  5KL7 A;  4X9J A;  2DGC A;  4GZN C;  2YU5 A;  2YTG A;  2EPR A;  2LO3 A;  1ZR9 A;  2MKD A;  2YTQ A;  1NCS A;  2EPX A;  2CT1 A;  2EN6 A;  2EPA A;  2EL5 A;  2YTD A;  2ELY A;  1YUI A;  2EL6 A;  3EPH A;  2ENH A;  2EOH A;  4F6M A;  2YTE A;  2BB8 A;  2YTO A;  3MHS C;  2YRH A;  2GLI A;  1WJP A;  4M9V C;  2I13 A;  1UN6 B;  2EOI A;  2DLQ A;  2EMY A;  2EN7 A;  3MHH C;  1BB8 A;  2EM4 A;  2EOR A;  2LCE A;  2EMK A;  2YTP A;  4R2D A;  5KL4 A;  2YTF A;  2EMZ A;  2EOX A;  1RMD A;  2EP3 A;  1X6H A;  2EL4 A;  2EM9 A;  2EOF A;  2WBU A;  1X6F A;  2EML A;  3EPJ A;  4F2J C;  1A1I A;  2MKN A;  2YU8 A;  2JP9 A;  2LT7 A;  2YSO A;  4R2R A;  4R2A A;  1JK1 A;  2ENA A;  2EOM A;  2DRP A;  2EMH A;  2EQ0 A;  1UBD C;  3M99 B;  3VHT B;  1ZAA C;  2EOO A;  4IJD A;  4R2Q A;  2EN4 A;  5KL2 A;  1A1J A;  2EM0 A;  2EN2 A;  1TF3 A;  2PRT A;  1X3C A;  1A1G A;  2J7J A;  1F2I G;  2EOS A;  2YRM A;  2EMG A;  2EMW A;  1YSA C;  2DLK A;  1P47 A;  2ELZ A;  1BBO A;  1G2F C;  1G2D C;  2EMA A;  2LV2 A;  3UK3 C;  2EQ3 A;  2JPA A;  4FK5 C;  2YTJ A;  1Z1B A;  2M9A A;  1LLM C;  1AAY A;  2EPC A;  2WBT A;  2EOY A;  2DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...