1F2IG

Cocrystal structure of selected zinc finger dimer bound to dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
pubmed doi rcsb
molecule keywords 5'-D(*AP*TP*GP*GP*GP*CP*GP*CP*GP*CP*CP*CP*AP*T)-3'
source organism Mus musculus
molecule tags Transcription/dna
total genus 17
structure length 66
sequence length 66
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2000-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG01
2EM2A 5KL7A 1A1JA 1YSAC 1AAYA 2EOZA 1X3CA 1A1IA 4F6NA 4IJDA 4F6MA 3EPLA 2EN1A 3MHSC 1JK1A 1TF3A 2DLQA 2D9HA 2EM0A 1X6EA 2EPZA 2JPAA 2EPPA 4FK5C 4GZNC 4R2SA 2ENCA 2GLIA 2EORA 1X6FA 2YTDA 2LVHA 1B69A 2EPAA 2EM6A 4X9JA 3EPKA 2DGCA 5KL3A 2EMYA 1G2FC 2MKNA 2EJ4A 2EOIA 2EMIA 2LCEA 2EQ1A 2YSPA 1A1LA 2EMHA 2EE8A 2BB8A 2ELZA 2ENHA 4R2CA 2EPUA 2YSOA 2YTNA 1A1KA 2I13A 4R2RA 2GHFA 2HGHA 2YTQA 1KJKA 3UK3C 3VHTB 2ADRA 2EN6A 2EM8A 1A1FA 1F2IG 1ZAAC 2LV2A 2EOSA 2M9AA 3MHHC 3EPHA 2JP9A 2EMLA 2EOQA 2YTPA 1Z1BA 2A25A 2EOXA 5KL2A 2YTOA 2YTGA 1ZU1A 2YTFA 2DLKA 2DMIA 2EMCA 2J7JA 4R2QA 4R2PA 2MKDA 1UN6B 1X6HA 2YTIA 4F2JC 2EPRA 2YU8A 2MDGA 1YUJA 2EMKA 1DGCA 2EMFA 2EOFA 2EOHA 2NABA 2EPXA 2YRKA 1UBDC 2EM4A 4IS1C 1X5WA 2EMBA 2EOJA 2EMWA 2DRPA 2WBSA 1G2DC 5KL5A 2ENAA 5KL6A 1MEYC 2EMAA 2EM3A 2RPCA 4M9VC 2EOOA 2EN4A 4R2AA 4R2EA 2EP3A 2WBUA 2WCC3 2WBTA 2YRMA 2R1FA 2LO3A 2VRDA 5KL4A 2YTEA 1A1GA 2ELYA 2EL6A 1P47A 2EL4A 1TF6A 2EOMA 1BBOA 2E72A 1NCSA 2EOEA 1TN9A 2EMXA 1YUIA 2EN3A 2EM9A 3EPJA 1JK2A 2CT1A 2EM7A 2YRHA 2EM5A 2EQ3A 2CSHA 2EPCA 2LT7A 2EN2A 2YTJA 4WSGA 2EN8A 1LLMC 1ZR9A 2EN7A 3M99B 2CTDA 1A1HA 1BB8A 2EOYA 1RMDA 2EQ0A 2EMZA 1WJPA 2EL5A 4R2DA 2EMGA 2PRTA 2RSIA 2YU5A
chains in the Genus database with same CATH superfamily
2DIXA 2EM2A 1YSAC 5F3WA 3JU0A 5AE1A 3KWRA 2D9HA 4JV5E 4B3SE 2EPPA 4R2SA 1IBLE 1FKAE 4X9JA 2LRSA 1X48A 4ZYEA 2YPNA 2MKNA 2EOIA 2EQ1A 2M7QA 2V86A 1UILA 2EE8A 2BB8A 2EPUA 2JVAA 3C6KA 2YSOA 2YTNA 4DKKA 2I13A 2LTRA 4DV4E 4BHBA 2B7VA 4JI8E 4DV5E 2EM8A 3KZZA 1T38A 4WSPA 2EOSA 4N4RB 1ZBTA 2DMYA 3BBGA 2YZTA 2MDRA 2JP9A 1Z1BA 3EQ1A 2A25A 2N3GA 5AE2A 2YTGA 1NEIA 2DMIA 4JI1E 5IWAE 5AE3A 3DJWA 4F9AB 3J7AG 4R2PA 2MKDA 4DUYE 2FGGA 2RQLA 1HNXE 2VQFE 5A6AA 3J80C 5AASA 4F9CB 2EMWA 2DRPA 5AC4A 4P7DA 1EH8A 1X47A 1G2DC 5KL5A 4Q35B 3JAMC 1XNQE 2F4VE 2EM3A 5IXMB 4RHBB 4R2EA 2VQEE 4LF6E 4RH8A 2EP3A 4LFBE 4JYAE 3MSWA 4X64E 2L8TA 1A1GA 4BC7A 1XMQE 4BCAA 1YYKA 3IWCA 2E72A 2VE7C 1TN9A 2JWOA 1YUIA 3EPJA 1JK2A 2EQ3A 3HPZA 4GKKE 2EN2A 2YTJA 4B3ME 4LFAE 4X66E 4LFCE 3J81C 2EN7A 3M99B 4WFTA 1A1HA 2EOYA 2KHXA 2Q8UA 5FLXC 2PRTA 4M30A 1RC7A 5KL7A 1A1JA 4TUIA 2NUFA 2EOZA 4P78A 1A1IA 4F54A 4F6MA 2EWLA 2EN1A 1JK1A 4R8OA 2DLQA 4HEIA 1KYQA 2L2KB 2V88A 4FK5C 4GZNC 3T1YE 1XNRE 4LF9E 1B69A 4NHRA 2EPAA 2EM6A 4J8ZA 3EPKA 5LMUE 2LE2A 4BS9A 4DV2E 1PJSA 5KL3A 1L4SA 1PDAA 2EMYA 2EJ4A 3LMLA 2JOXA 1A1LA 2FTXB 2ENHA 2JYAA 2LJUA 3ZOQB 4NXME 2ODRD 3F6GA 2LUPB 1A1KA 4M2ZA 2RTXA 2EZ6A 2FV4B 2ADRA 2V83A 2DB2A 1A1FA 1WHQA 5A69A 2EPKX 3EPHA 1SFEA 1SR9A 1FJGE 3RMPA 2YTPA 2EPOA 2UXCE 2YTOA 2DLKA 2EMCA 1GTKA 4R2QA 1QU6A 4L8NA 2YU8A 1N34E 1IMUA 2EMKA 3HXLA 4KZSA 1DGCA 2EOHA 2EPLX 1J26A 1QNTA 4NZVA 4JI3E 2EM4A 2H36X 2EOJA 3IWDA 1WHNA 2ENAA 4OX9E 2UUAE 2YT4A 3DF6A 1MEYC 1N32E 1O0WA 2EMAA 2RPCA 2LBSB 4M9VC 2EOOA 2V87A 4LTYA 2IHR1 2L3JA 3ADLA 4DR1E 4YHHE 2R1FA 2LO3A 2VRDA 1X49A 4I8OA 2EL6A 4B3RE 2K4VA 2NUGA 2GPIA 1MGTA 1WRJA 5A2QC 2RS6A 5IT9C 4M0VA 2EN3A 2L33A 3BIDA 2E5LE 4NXNE 3VK6A 1YZ9A 3F6HA 2M4IA 1BB8A 4ZYHA 4Q28A 4WPYA 2EMZA 4R2DA 4KWYA 2B9DA 2RSIA 1T4LB 2G7HA 4F6NA 2YWQA 2K7IA 4DR7E 3AV0A 1N3GA 2EM0A 1X6EA 2WZOA 2LMZA 2HJJA 3TQMA 2JR1A 2EPMX 2ENCA 2GLIA 2CPNA 2YTDA 2M1SA 2MC6A 2LVHA 3BF2A 2UU9E 4GEQB 1G2FC 4ZYGA 2YSPA 2EMIA 2LCEA 3H09A 2EMHA 4B3TE 4R2CA 3ECRA 3ADGA 1YPNA 2R76A 1YFHA 2HGHA 1KJKA 4DV7E 3VHTB 5ADZA 4O24A 1ZAAC 2LV2A 1GZ6A 3THOB 4K0KE 1PJQA 4JI5E 2EMLA 2EOQA 4MLQA 2LUQA 3HQ1A 4JI4E 4ZYDA 2BBGA 4AQYE 4GKJE 4F2JC 2L92A 1T4NA 1IQSA 2KONA 1YUJA 2EMFA 4DV3E 1I94E 4IS1C 1X5WA 2EMBA 2L6MA 2WBSA 1XMOE 3QG5C 4LF4E 4DR5E 3JTZA 2N8XA 4L5NC 2N3HA 1HNZE 3C4TA 2VF1A 2WCC3 2WBTA 2YRMA 3KZYA 2YTEA 1HNWE 1DQ3A 2EL4A 1TF6A 4LF8E 4X62E 1BBOA 2L3CA 1IBME 2EOEA 1WXRA 2EMXA 4X8WA 1PJTA 5CFFE 2CT1A 3K6QA 1RQ0A 4DV1E 2EM5A 4LU9A 2EPCA 1AH5A 2LT7A 1N33E 1T39A 2LTSA 2EN8A 2L2MA 4WYQB 1RMDA 4HTGA 2EQ0A 4X65E 1WJPA 5DNYA 2EL5A 3T1HE 3L00A 2EMGA 5LMNE 3C4BA 3ADJA 1N36E 2YU5A 2V8QB 1ZBQA 1AAYA 4BBYA 1X3CA 4MLVA 4IJDA 3EPLA 3MHSC 2JOBA 4WXDA 2EPZA 1TF3A 1EKZA 2JPAA 4DR3E 4JI7E 4R03A 2HC5A 2NA2A 2EORA 1X6FA 2MC5A 4JI6E 3OMLA 5T6JA 2DGCA 4DMIA 5A6JA 4O4KA 4LF5E 3AUZA 4DR2E 4LF7E 4BC9A 2UXBE 3BGHA 4O43A 5IV8B 2RSMA 2ELZA 2F8BA 1HR0E 2UXDE 2NUEA 4DUZE 5A6BD 4JI0E 4R2RA 2GHFA 2B3TB 2YTQA 3UK3C 1EH7A 1BBGA 3VYXA 2L2NA 2EN6A 1YYWA 1F2IG 4DV6E 1GQEA 5AC5A 4DV0E 2M9AA 4O5GA 3MHHC 3P1XA 2ZM6E 3HPSA 2EOXA 5KL2A 2KOUA 2HHHE 2UUBE 1ZU1A 4BMJA 2YTFA 2J7JA 1UN6B 1X6HA 2YTIA 5TSEA 2EPRA 1UHZA 2MDGA 3LLHA 2EOFA 2NABA 2EPXA 2YRKA 4KHPE 3VYYA 4DR6E 2I9IA 2UUCE 2DSYA 5BR8E 1STUA 2E1MA 5A6BA 5KL6A 4F9BB 2B7TA 1DI2A 1YYOA 2EN4A 4R2AA 2JY9A 4DR4E 4TUGA 2ODRC 4WXCA 2V85A 2WBUA 2RS7A 4JI2E 3HTXA 1EH6A 1PKPA 5KL4A 2ELYA 1P47A 2EOMA 1IBKE 4OOGC 1NCSA 4BHCA 3ADIA 4WX9A 2EM9A 2EM7A 2YRHA 5LLQA 5A6KA 3OTOE 2CSHA 5LL6R 4YY3E 1T4OA 4WSGA 3J7Yp 1IQOA 1LLMC 1ZR9A 2LJHA 2CTDA 2EPNA 3IWBA 3C6MA 3THNA 2V89A 2JXPA 1UBDC 1J5EE 3FIGA
chains in the Genus database with same CATH topology
2EM2A 5KL7A 1A1JA 1YSAC 1AAYA 2EOZA 1X3CA 1A1IA 4F6NA 4IJDA 4F6MA 3EPLA 2EN1A 3MHSC 1JK1A 1TF3A 2DLQA 2D9HA 2EM0A 1X6EA 2EPZA 2JPAA 2EPPA 4FK5C 4GZNC 4R2SA 2ENCA 2GLIA 2EORA 1X6FA 2YTDA 2LVHA 1B69A 2EPAA 2EM6A 4X9JA 3EPKA 2DGCA 5KL3A 2EMYA 1G2FC 2MKNA 2EJ4A 2EOIA 2EMIA 2LCEA 2EQ1A 2YSPA 1A1LA 2EMHA 2EE8A 2BB8A 2ELZA 2ENHA 4R2CA 2EPUA 2YSOA 2YTNA 1A1KA 2I13A 4R2RA 2GHFA 2HGHA 2YTQA 1KJKA 3UK3C 3VHTB 2ADRA 2EN6A 2EM8A 1A1FA 1F2IG 1ZAAC 2LV2A 2EOSA 2M9AA 3MHHC 3EPHA 2JP9A 2EMLA 2EOQA 2YTPA 1Z1BA 2A25A 2EOXA 5KL2A 2YTOA 2YTGA 1ZU1A 2YTFA 2DLKA 2DMIA 2EMCA 2J7JA 4R2QA 4R2PA 2MKDA 1UN6B 1X6HA 2YTIA 4F2JC 2EPRA 2YU8A 2MDGA 1YUJA 2EMKA 1DGCA 2EMFA 2EOFA 2EOHA 2NABA 2EPXA 2YRKA 1UBDC 2EM4A 4IS1C 1X5WA 2EMBA 2EOJA 2EMWA 2DRPA 2WBSA 1G2DC 5KL5A 2ENAA 5KL6A 1MEYC 2EMAA 2EM3A 2RPCA 4M9VC 2EOOA 2EN4A 4R2AA 4R2EA 2EP3A 2WBUA 2WCC3 2WBTA 2YRMA 2R1FA 2LO3A 2VRDA 5KL4A 2YTEA 1A1GA 2ELYA 2EL6A 1P47A 2EL4A 1TF6A 2EOMA 1BBOA 2E72A 1NCSA 2EOEA 1TN9A 2EMXA 1YUIA 2EN3A 2EM9A 3EPJA 1JK2A 2CT1A 2EM7A 2YRHA 2EM5A 2EQ3A 2CSHA 2EPCA 2LT7A 2EN2A 2YTJA 4WSGA 2EN8A 1LLMC 1ZR9A 2EN7A 3M99B 2CTDA 1A1HA 1BB8A 2EOYA 1RMDA 2EQ0A 2EMZA 1WJPA 2EL5A 4R2DA 2EMGA 2PRTA 2RSIA 2YU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM2 A;  5KL7 A;  1A1J A;  1YSA C;  1AAY A;  2EOZ A;  1X3C A;  1A1I A;  4F6N A;  4IJD A;  4F6M A;  3EPL A;  2EN1 A;  3MHS C;  1JK1 A;  1TF3 A;  2DLQ A;  2D9H A;  2EM0 A;  1X6E A;  2EPZ A;  2JPA A;  2EPP A;  4FK5 C;  4GZN C;  4R2S A;  2ENC A;  2GLI A;  2EOR A;  1X6F A;  2YTD A;  2LVH A;  1B69 A;  2EPA A;  2EM6 A;  4X9J A;  3EPK A;  2DGC A;  5KL3 A;  2EMY A;  1G2F C;  2MKN A;  2EJ4 A;  2EOI A;  2EMI A;  2LCE A;  2EQ1 A;  2YSP A;  1A1L A;  2EMH A;  2EE8 A;  2BB8 A;  2ELZ A;  2ENH A;  4R2C A;  2EPU A;  2YSO A;  2YTN A;  1A1K A;  2I13 A;  4R2R A;  2GHF A;  2HGH A;  2YTQ A;  1KJK A;  3UK3 C;  3VHT B;  2ADR A;  2EN6 A;  2EM8 A;  1A1F A;  1F2I G;  1ZAA C;  2LV2 A;  2EOS A;  2M9A A;  3MHH C;  3EPH A;  2JP9 A;  2EML A;  2EOQ A;  2YTP A;  1Z1B A;  2A25 A;  2EOX A;  5KL2 A;  2YTO A;  2YTG A;  1ZU1 A;  2YTF A;  2DLK A;  2DMI A;  2EMC A;  2J7J A;  4R2Q A;  4R2P A;  2MKD A;  1UN6 B;  1X6H A;  2YTI A;  4F2J C;  2EPR A;  2YU8 A;  2MDG A;  1YUJ A;  2EMK A;  1DGC A;  2EMF A;  2EOF A;  2EOH A;  2NAB A;  2EPX A;  2YRK A;  1UBD C;  2EM4 A;  4IS1 C;  1X5W A;  2EMB A;  2EOJ A;  2EMW A;  2DRP A;  2WBS A;  1G2D C;  5KL5 A;  2ENA A;  5KL6 A;  1MEY C;  2EMA A;  2EM3 A;  2RPC A;  4M9V C;  2EOO A;  2EN4 A;  4R2A A;  4R2E A;  2EP3 A;  2WBU A;  2WCC 3;  2WBT A;  2YRM A;  2R1F A;  2LO3 A;  2VRD A;  5KL4 A;  2YTE A;  1A1G A;  2ELY A;  2EL6 A;  1P47 A;  2EL4 A;  1TF6 A;  2EOM A;  1BBO A;  2E72 A;  1NCS A;  2EOE A;  1TN9 A;  2EMX A;  1YUI A;  2EN3 A;  2EM9 A;  3EPJ A;  1JK2 A;  2CT1 A;  2EM7 A;  2YRH A;  2EM5 A;  2EQ3 A;  2CSH A;  2EPC A;  2LT7 A;  2EN2 A;  2YTJ A;  4WSG A;  2EN8 A;  1LLM C;  1ZR9 A;  2EN7 A;  3M99 B;  2CTD A;  1A1H A;  1BB8 A;  2EOY A;  1RMD A;  2EQ0 A;  2EMZ A;  1WJP A;  2EL5 A;  4R2D A;  2EMG A;  2PRT A;  2RSI A;  2YU5 A; 
#chains in the Genus database with same CATH topology
 2DIX A;  2EM2 A;  1YSA C;  5F3W A;  3JU0 A;  5AE1 A;  3KWR A;  2D9H A;  4JV5 E;  4B3S E;  2EPP A;  4R2S A;  1IBL E;  1FKA E;  4X9J A;  2LRS A;  1X48 A;  4ZYE A;  2YPN A;  2MKN A;  2EOI A;  2EQ1 A;  2M7Q A;  2V86 A;  1UIL A;  2EE8 A;  2BB8 A;  2EPU A;  2JVA A;  3C6K A;  2YSO A;  2YTN A;  4DKK A;  2I13 A;  2LTR A;  4DV4 E;  4BHB A;  2B7V A;  4JI8 E;  4DV5 E;  2EM8 A;  3KZZ A;  1T38 A;  4WSP A;  2EOS A;  4N4R B;  1ZBT A;  2DMY A;  3BBG A;  2YZT A;  2MDR A;  2JP9 A;  1Z1B A;  3EQ1 A;  2A25 A;  2N3G A;  5AE2 A;  2YTG A;  1NEI A;  2DMI A;  4JI1 E;  5IWA E;  5AE3 A;  3DJW A;  4F9A B;  3J7A G;  4R2P A;  2MKD A;  4DUY E;  2FGG A;  2RQL A;  1HNX E;  2VQF E;  5A6A A;  3J80 C;  5AAS A;  4F9C B;  2EMW A;  2DRP A;  5AC4 A;  4P7D A;  1EH8 A;  1X47 A;  1G2D C;  5KL5 A;  4Q35 B;  3JAM C;  1XNQ E;  2F4V E;  2EM3 A;  5IXM B;  4RHB B;  4R2E A;  2VQE E;  4LF6 E;  4RH8 A;  2EP3 A;  4LFB E;  4JYA E;  3MSW A;  4X64 E;  2L8T A;  1A1G A;  4BC7 A;  1XMQ E;  4BCA A;  1YYK A;  3IWC A;  2E72 A;  2VE7 C;  1TN9 A;  2JWO A;  1YUI A;  3EPJ A;  1JK2 A;  2EQ3 A;  3HPZ A;  4GKK E;  2EN2 A;  2YTJ A;  4B3M E;  4LFA E;  4X66 E;  4LFC E;  3J81 C;  2EN7 A;  3M99 B;  4WFT A;  1A1H A;  2EOY A;  2KHX A;  2Q8U A;  5FLX C;  2PRT A;  4M30 A;  1RC7 A;  5KL7 A;  1A1J A;  4TUI A;  2NUF A;  2EOZ A;  4P78 A;  1A1I A;  4F54 A;  4F6M A;  2EWL A;  2EN1 A;  1JK1 A;  4R8O A;  2DLQ A;  4HEI A;  1KYQ A;  2L2K B;  2V88 A;  4FK5 C;  4GZN C;  3T1Y E;  1XNR E;  4LF9 E;  1B69 A;  4NHR A;  2EPA A;  2EM6 A;  4J8Z A;  3EPK A;  5LMU E;  2LE2 A;  4BS9 A;  4DV2 E;  1PJS A;  5KL3 A;  1L4S A;  1PDA A;  2EMY A;  2EJ4 A;  3LML A;  2JOX A;  1A1L A;  2FTX B;  2ENH A;  2JYA A;  2LJU A;  3ZOQ B;  4NXM E;  2ODR D;  3F6G A;  2LUP B;  1A1K A;  4M2Z A;  2RTX A;  2EZ6 A;  2FV4 B;  2ADR A;  2V83 A;  2DB2 A;  1A1F A;  1WHQ A;  5A69 A;  2EPK X;  3EPH A;  1SFE A;  1SR9 A;  1FJG E;  3RMP A;  2YTP A;  2EPO A;  2UXC E;  2YTO A;  2DLK A;  2EMC A;  1GTK A;  4R2Q A;  1QU6 A;  4L8N A;  2YU8 A;  1N34 E;  1IMU A;  2EMK A;  3HXL A;  4KZS A;  1DGC A;  2EOH A;  2EPL X;  1J26 A;  1QNT A;  4NZV A;  4JI3 E;  2EM4 A;  2H36 X;  2EOJ A;  3IWD A;  1WHN A;  2ENA A;  4OX9 E;  2UUA E;  2YT4 A;  3DF6 A;  1MEY C;  1N32 E;  1O0W A;  2EMA A;  2RPC A;  2LBS B;  4M9V C;  2EOO A;  2V87 A;  4LTY A;  2IHR 1;  2L3J A;  3ADL A;  4DR1 E;  4YHH E;  2R1F A;  2LO3 A;  2VRD A;  1X49 A;  4I8O A;  2EL6 A;  4B3R E;  2K4V A;  2NUG A;  2GPI A;  1MGT A;  1WRJ A;  5A2Q C;  2RS6 A;  5IT9 C;  4M0V A;  2EN3 A;  2L33 A;  3BID A;  2E5L E;  4NXN E;  3VK6 A;  1YZ9 A;  3F6H A;  2M4I A;  1BB8 A;  4ZYH A;  4Q28 A;  4WPY A;  2EMZ A;  4R2D A;  4KWY A;  2B9D A;  2RSI A;  1T4L B;  2G7H A;  4F6N A;  2YWQ A;  2K7I A;  4DR7 E;  3AV0 A;  1N3G A;  2EM0 A;  1X6E A;  2WZO A;  2LMZ A;  2HJJ A;  3TQM A;  2JR1 A;  2EPM X;  2ENC A;  2GLI A;  2CPN A;  2YTD A;  2M1S A;  2MC6 A;  2LVH A;  3BF2 A;  2UU9 E;  4GEQ B;  1G2F C;  4ZYG A;  2YSP A;  2EMI A;  2LCE A;  3H09 A;  2EMH A;  4B3T E;  4R2C A;  3ECR A;  3ADG A;  1YPN A;  2R76 A;  1YFH A;  2HGH A;  1KJK A;  4DV7 E;  3VHT B;  5ADZ A;  4O24 A;  1ZAA C;  2LV2 A;  1GZ6 A;  3THO B;  4K0K E;  1PJQ A;  4JI5 E;  2EML A;  2EOQ A;  4MLQ A;  2LUQ A;  3HQ1 A;  4JI4 E;  4ZYD A;  2BBG A;  4AQY E;  4GKJ E;  4F2J C;  2L92 A;  1T4N A;  1IQS A;  2KON A;  1YUJ A;  2EMF A;  4DV3 E;  1I94 E;  4IS1 C;  1X5W A;  2EMB A;  2L6M A;  2WBS A;  1XMO E;  3QG5 C;  4LF4 E;  4DR5 E;  3JTZ A;  2N8X A;  4L5N C;  2N3H A;  1HNZ E;  3C4T A;  2VF1 A;  2WCC 3;  2WBT A;  2YRM A;  3KZY A;  2YTE A;  1HNW E;  1DQ3 A;  2EL4 A;  1TF6 A;  4LF8 E;  4X62 E;  1BBO A;  2L3C A;  1IBM E;  2EOE A;  1WXR A;  2EMX A;  4X8W A;  1PJT A;  5CFF E;  2CT1 A;  3K6Q A;  1RQ0 A;  4DV1 E;  2EM5 A;  4LU9 A;  2EPC A;  1AH5 A;  2LT7 A;  1N33 E;  1T39 A;  2LTS A;  2EN8 A;  2L2M A;  4WYQ B;  1RMD A;  4HTG A;  2EQ0 A;  4X65 E;  1WJP A;  5DNY A;  2EL5 A;  3T1H E;  3L00 A;  2EMG A;  5LMN E;  3C4B A;  3ADJ A;  1N36 E;  2YU5 A;  2V8Q B;  1ZBQ A;  1AAY A;  4BBY A;  1X3C A;  4MLV A;  4IJD A;  3EPL A;  3MHS C;  2JOB A;  4WXD A;  2EPZ A;  1TF3 A;  1EKZ A;  2JPA A;  4DR3 E;  4JI7 E;  4R03 A;  2HC5 A;  2NA2 A;  2EOR A;  1X6F A;  2MC5 A;  4JI6 E;  3OML A;  5T6J A;  2DGC A;  4DMI A;  5A6J A;  4O4K A;  4LF5 E;  3AUZ A;  4DR2 E;  4LF7 E;  4BC9 A;  2UXB E;  3BGH A;  4O43 A;  5IV8 B;  2RSM A;  2ELZ A;  2F8B A;  1HR0 E;  2UXD E;  2NUE A;  4DUZ E;  5A6B D;  4JI0 E;  4R2R A;  2GHF A;  2B3T B;  2YTQ A;  3UK3 C;  1EH7 A;  1BBG A;  3VYX A;  2L2N A;  2EN6 A;  1YYW A;  1F2I G;  4DV6 E;  1GQE A;  5AC5 A;  4DV0 E;  2M9A A;  4O5G A;  3MHH C;  3P1X A;  2ZM6 E;  3HPS A;  2EOX A;  5KL2 A;  2KOU A;  2HHH E;  2UUB E;  1ZU1 A;  4BMJ A;  2YTF A;  2J7J A;  1UN6 B;  1X6H A;  2YTI A;  5TSE A;  2EPR A;  1UHZ A;  2MDG A;  3LLH A;  2EOF A;  2NAB A;  2EPX A;  2YRK A;  4KHP E;  3VYY A;  4DR6 E;  2I9I A;  2UUC E;  2DSY A;  5BR8 E;  1STU A;  2E1M A;  5A6B A;  5KL6 A;  4F9B B;  2B7T A;  1DI2 A;  1YYO A;  2EN4 A;  4R2A A;  2JY9 A;  4DR4 E;  4TUG A;  2ODR C;  4WXC A;  2V85 A;  2WBU A;  2RS7 A;  4JI2 E;  3HTX A;  1EH6 A;  1PKP A;  5KL4 A;  2ELY A;  1P47 A;  2EOM A;  1IBK E;  4OOG C;  1NCS A;  4BHC A;  3ADI A;  4WX9 A;  2EM9 A;  2EM7 A;  2YRH A;  5LLQ A;  5A6K A;  3OTO E;  2CSH A;  5LL6 R;  4YY3 E;  1T4O A;  4WSG A;  3J7Y p;  1IQO A;  1LLM C;  1ZR9 A;  2LJH A;  2CTD A;  2EPN A;  3IWB A;  3C6M A;  3THN A;  2V89 A;  2JXP A;  1UBD C;  1J5E E;  3FIG A; 
#chains in the Genus database with same CATH homology
 2EM2 A;  5KL7 A;  1A1J A;  1YSA C;  1AAY A;  2EOZ A;  1X3C A;  1A1I A;  4F6N A;  4IJD A;  4F6M A;  3EPL A;  2EN1 A;  3MHS C;  1JK1 A;  1TF3 A;  2DLQ A;  2D9H A;  2EM0 A;  1X6E A;  2EPZ A;  2JPA A;  2EPP A;  4FK5 C;  4GZN C;  4R2S A;  2ENC A;  2GLI A;  2EOR A;  1X6F A;  2YTD A;  2LVH A;  1B69 A;  2EPA A;  2EM6 A;  4X9J A;  3EPK A;  2DGC A;  5KL3 A;  2EMY A;  1G2F C;  2MKN A;  2EJ4 A;  2EOI A;  2EMI A;  2LCE A;  2EQ1 A;  2YSP A;  1A1L A;  2EMH A;  2EE8 A;  2BB8 A;  2ELZ A;  2ENH A;  4R2C A;  2EPU A;  2YSO A;  2YTN A;  1A1K A;  2I13 A;  4R2R A;  2GHF A;  2HGH A;  2YTQ A;  1KJK A;  3UK3 C;  3VHT B;  2ADR A;  2EN6 A;  2EM8 A;  1A1F A;  1F2I G;  1ZAA C;  2LV2 A;  2EOS A;  2M9A A;  3MHH C;  3EPH A;  2JP9 A;  2EML A;  2EOQ A;  2YTP A;  1Z1B A;  2A25 A;  2EOX A;  5KL2 A;  2YTO A;  2YTG A;  1ZU1 A;  2YTF A;  2DLK A;  2DMI A;  2EMC A;  2J7J A;  4R2Q A;  4R2P A;  2MKD A;  1UN6 B;  1X6H A;  2YTI A;  4F2J C;  2EPR A;  2YU8 A;  2MDG A;  1YUJ A;  2EMK A;  1DGC A;  2EMF A;  2EOF A;  2EOH A;  2NAB A;  2EPX A;  2YRK A;  1UBD C;  2EM4 A;  4IS1 C;  1X5W A;  2EMB A;  2EOJ A;  2EMW A;  2DRP A;  2WBS A;  1G2D C;  5KL5 A;  2ENA A;  5KL6 A;  1MEY C;  2EMA A;  2EM3 A;  2RPC A;  4M9V C;  2EOO A;  2EN4 A;  4R2A A;  4R2E A;  2EP3 A;  2WBU A;  2WCC 3;  2WBT A;  2YRM A;  2R1F A;  2LO3 A;  2VRD A;  5KL4 A;  2YTE A;  1A1G A;  2ELY A;  2EL6 A;  1P47 A;  2EL4 A;  1TF6 A;  2EOM A;  1BBO A;  2E72 A;  1NCS A;  2EOE A;  1TN9 A;  2EMX A;  1YUI A;  2EN3 A;  2EM9 A;  3EPJ A;  1JK2 A;  2CT1 A;  2EM7 A;  2YRH A;  2EM5 A;  2EQ3 A;  2CSH A;  2EPC A;  2LT7 A;  2EN2 A;  2YTJ A;  4WSG A;  2EN8 A;  1LLM C;  1ZR9 A;  2EN7 A;  3M99 B;  2CTD A;  1A1H A;  1BB8 A;  2EOY A;  1RMD A;  2EQ0 A;  2EMZ A;  1WJP A;  2EL5 A;  4R2D A;  2EMG A;  2PRT A;  2RSI A;  2YU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...