1F2IG

Cocrystal structure of selected zinc finger dimer bound to dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*GP*GP*GP*CP*GP*CP*GP*CP*CP*CP*AP*T)-3'
total genus 17
structure length 66
sequence length 66
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2000-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG01
1A1LA 2A25A 2DMIA 2EQ1A 2EOOA 2DGCA 2EN1A 2J7JA 2BB8A 2EOYA 4IJDA 2DRPA 2EOEA 2EMXA 2EOSA 1G2FC 2WBSA 1X6HA 5KL7A 2EMKA 2EM0A 1TF6A 1X6EA 2EP3A 1A1KA 2NABA 2GLIA 2RPCA 2YU8A 1BBOA 2EMWA 2D9HA 1YUIA 1ZU1A 2YTIA 2EN4A 1WJPA 2EM9A 2GHFA 2EMBA 2EOXA 4R2CA 4FK5C 2EJ4A 3UK3C 2EL5A 2EPAA 2EPZA 2RSIA 5KL6A 1LLMC 2I13A 3EPJA 2EOJA 2JPAA 1A1HA 4X9JA 1ZR9A 4R2DA 2WBTA 2YSPA 2YRKA 2WBUA 2YTEA 4GZNC 1X5WA 2EL4A 4R2PA 2YRMA 3M99B 4R2RA 2EM8A 3EPLA 2M9AA 2EPPA 1A1FA 1AAYA 1B69A 3MHSC 2EOZA 1YSAC 1X3CA 1DGCA 2EPXA 2EM5A 2LVHA 2LT7A 1A1GA 2EOMA 2EQ0A 2MDGA 2CTDA 2EMGA 4IS1C 1X6FA 3EPKA 1TN9A 1NCSA 2ELZA 2EORA 1UN6B 2EN8A 1KJKA 2PRTA 2JP9A 2E72A 4WSGA 1UBDC 2YTNA 5KL3A 1MEYC 2YTOA 2CSHA 4M9VC 2HGHA 2EM7A 2EN3A 2EMYA 2EMHA 2VRDA 2MKDA 1JK2A 1A1IA 2EMFA 2EMIA 1BB8A 2YTFA 2CT1A 4F2JC 2YTPA 1G2DC 2YTQA 2EM3A 5KL5A 2ELYA 2EMCA 2EOFA 2YTDA 1TF3A 2LO3A 2LV2A 2ENHA 2EN2A 2YSOA 1RMDA 2EMZA 2EE8A 2YTJA 2WCC3 1A1JA 4R2EA 1ZAAC 2YRHA 4R2QA 2EMAA 2ENAA 2EPRA 2EL6A 3EPHA 2EM2A 4R2AA 1YUJA 2DLQA 2YTGA 2EN6A 4R2SA 2EOQA 4F6MA 5KL4A 2MKNA 2EOHA 2ADRA 2DLKA 1JK1A 2R1FA 2EPCA 2EPUA 2EM4A 2EM6A 2EN7A 2YU5A 2EMLA 3VHTB 2LCEA 5KL2A 2EQ3A 3MHHC 4F6NA 1P47A 1F2IG 2EOIA 2ENCA 1Z1BA
chains in the Genus database with same CATH superfamily
2EQ1A 2L8TA 3C4TA 2E1MA 3MSWA 3VYXA 2EN1A 2B7TA 4DR3E 4DV7E 1SR9A 4DR4E 2R76A 5DNYA 2EOSA 4BCAA 3QG5C 4X64E 2LJUA 5AE1A 1IQSA 3IWCA 1IBLE 4GKJE 4P7DA 2L92A 1A1KA 2RTXA 3ADLA 4O4KA 1FKAE 2RPCA 4F9AB 3ADGA 1BBOA 4ZYHA 2VF1A 1YUIA 4WYQB 1WJPA 4TUIA 4NZVA 2UUBE 2EMBA 1X49A 4KHPE 1SFEA 2EL5A 1GQEA 1LLMC 3HPZA 2N8XA 1GZ6A 4LF5E 1N33E 4B3RE 2B7VA 4LFBE 5AC4A 2WBUA 2YT4A 4X65E 2KONA 3C6KA 4X8WA 2G7HA 4OOGC 1DI2A 1X5WA 2YZTA 2EL4A 2JOBA 1T4OA 4N4RB 4K0KE 3M99B 1WHNA 4DUYE 2DRPA 4LTYA 1YFHA 2N3GA 1EKZA 2ZM6E 5A6AA 2EM5A 2LVHA 2IHR1 2EOMA 2EQ0A 2JYAA 4L8NA 3ADIA 1RQ0A 4WPYA 5A6JA 1NCSA 1WXRA 2EORA 4DMIA 4O43A 2E72A 3THNA 4WFTA 2CSHA 2EPOA 4M9VC 1IQOA 2WZOA 2HGHA 2EMHA 2VRDA 2YWQA 5A2QC 2EMFA 2EMIA 1MGTA 4LF6E 2YTPA 4DV6E 3LMLA 2EMCA 4BC9A 4LFCE 2ENHA 2NA2A 2YSOA 1J5EE 5A6KA 4AQYE 2VQFE 3LLHA 5IXMB 2ENAA 2EPRA 2EM2A 4R2AA 1YUJA 4JI1E 4X66E 5AE3A 4R8OA 2BBGA 2YU5A 3AV0A 2EMLA 2LCEA 5KL2A 4JI6E 1XNRE 2N3HA 1P47A 1F2IG 1A1IA 1X6EA 2JXPA 2EOOA 2RS6A 1IBKE 4IJDA 2UUCE 2UU9E 2EOEA 3BIDA 5KL7A 2EMKA 5F3WA 1TF6A 2V86A 3AUZA 2UXDE 4LFAE 2V85A 1BBGA 5BR8E 2D9HA 1YYKA 4FK5C 3VYYA 4M0VA 3H09A 3UK3C 2EPZA 4WX9A 3EPJA 3FIGA 3P1XA 1A1HA 3HPSA 4R2DA 4TUGA 2YRKA 5LL6R 4GZNC 4DR7E 2EPLX 2F8BA 1KYQA 3JTZA 2EOZA 1QNTA 1XMOE 1QU6A 2LTRA 5AC5A 2LMZA 4JI0E 4DUZE 1A1GA 4ZYGA 2UXBE 4DR6E 1UHZA 2MDGA 2F4VE 2EMGA 3C6MA 1X6FA 3F6GA 1TN9A 2K7IA 1UN6B 2EN8A 4WSGA 2YTNA 1HNWE 2EM7A 2EN3A 2L2KB 5A69A 3T1HE 2FGGA 1JK2A 5TSEA 4DV1E 2CT1A 1PJQA 2UUAE 2V83A 5KL5A 1X48A 2LO3A 1XNQE 2ODRD 2V8QB 2EMZA 2WCC3 3VK6A 2YRHA 2V89A 4B3SE 3KWRA 4KZSA 3EPHA 3RMPA 3BGHA 4F6MA 2MKNA 2EOQA 2EPNA 4DV0E 4M2ZA 2DLKA 4M30A 4O5GA 5AASA 1EH7A 1N34E 3EQ1A 4B3ME 3KZZA 2EM4A 2EM6A 2Q8UA 5LLQA 3MHHC 4F6NA 4DR1E 4DKKA 1Z1BA 2A25A 1HR0E 2FTXB 1ZBQA 2DGCA 2NUEA 3HQ1A 1T4NA 3JAMC 2JWOA 2EOYA 2DB2A 4LF4E 4LF8E 3DJWA 4O24A 2H36X 2JOXA 4GEQB 4BBYA 4WSPA 4YHHE 4LF9E 2EM0A 2DSYA 2ODRC 2DIXA 2GLIA 2YU8A 4OX9E 1ZU1A 3ADJA 2EM9A 2GHFA 4HEIA 2MDRA 4MLQA 2EJ4A 2LTSA 5KL6A 2EPAA 4BMJA 3TQMA 2I13A 3IWDA 4Q35B 4HTGA 4DV3E 1DQ3A 4JI8E 2JPAA 2WBTA 1EH8A 4NXNE 2YSPA 1HNXE 2VQEE 2B9DA 2MC6A 2RQLA 1N36E 3J81C 2JY9A 1PKPA 4P78A 4ZYEA 4MLVA 2UXCE 1YYOA 1WRJA 2KOUA 4DV2E 5IT9C 4R2RA 1UILA 3EPLA 1A1FA 4F9CB 1YSAC 2LBSB 4DV5E 2DMYA 2L33A 4NXME 2EPXA 3J7Yp 2VE7C 1PJSA 4F54A 4BHCA 2V88A 4DR5E 4IS1C 3T1YE 1STUA 3HXLA 2ELZA 2KHXA 4I8OA 4JV5E 2JP9A 3BBGA 1MEYC 2JVAA 1RC7A 2EMYA 2MKDA 4DR2E 2HJJA 1BB8A 5CFFE 1G2DC 2YTQA 3ECRA 2ELYA 4JI7E 1TF3A 2EPMX 2LV2A 2M1SA 1RMDA 4R2EA 1AH5A 2L3CA 2K4VA 2EWLA 2E5LE 5IV8B 2YTGA 2EN6A 4R2SA 2EOHA 4JI5E 2GPIA 4F9BB 2ADRA 2EPCA 4RH8A 3OMLA 2RSMA 3VHTB 1FJGE 4KWYA 4BS9A 1T39A 2EOIA 5T6JA 1A1LA 2DMIA 1HNZE 1YYWA 3HTXA 1X47A 1PDAA 2J7JA 2BB8A 1T4LB 3J7AG 3ZOQB 4Q28A 1XMQE 2RS7A 2EMXA 1T38A 1G2FC 1IMUA 1O0WA 2WBSA 1N32E 1X6HA 3THOB 2L6MA 2EP3A 2LUPB 1IBME 2NABA 2EPKX 4BHBA 2LJHA 2EMWA 2JR1A 4YY3E 2YTIA 2EN4A 4BC7A 5A6BA 3IWBA 4RHBB 2EOXA 5FLXC 4R2CA 4ZYDA 1ZBTA 4LF7E 1J26A 2RSIA 2L2MA 3L00A 4X62E 1YPNA 2EZ6A 2EOJA 2LRSA 4X9JA 1PJTA 1ZR9A 2I9IA 1N3GA 2YTEA 5LMNE 4R2PA 1NEIA 2YRMA 2L3JA 2MC5A 2M4IA 2EM8A 1AAYA 2M9AA 2EPPA 1B69A 3MHSC 1X3CA 4L5NC 1DGCA 4NHRA 4DV4E 4GKKE 2LT7A 3JU0A 2FV4B 2M7QA 1I94E 4B3TE 2NUGA 3K6QA 5AE2A 1EH6A 2CTDA 1GTKA 5LMUE 3EPKA 3KZYA 5ADZA 4R03A 2V87A 1KJKA 2PRTA 1UBDC 2LUQA 5KL3A 3DF6A 2YTOA 2YPNA 4JI4E 2B3TB 4LU9A 4JYAE 2L2NA 4JI2E 2NUFA 2LE2A 2YTFA 5IWAE 4F2JC 3OTOE 2EM3A 2EOFA 2YTDA 2HHHE 2EN2A 2YTJA 4WXCA 2EE8A 3BF2A 1A1JA 1ZAAC 3C4BA 1L4SA 4R2QA 2EMAA 4J8ZA 2EL6A 3F6HA 2DLQA 2CPNA 5KL4A 5A6BD 1YZ9A 4WXDA 1JK1A 2R1FA 2EPUA 2EN7A 3J80C 1WHQA 2EQ3A 4JI3E 2HC5A 2ENCA
chains in the Genus database with same CATH topology
1A1LA 2A25A 2DMIA 2EQ1A 2EOOA 2DGCA 2EN1A 2J7JA 2BB8A 2EOYA 4IJDA 2DRPA 2EOEA 2EMXA 2EOSA 1G2FC 2WBSA 1X6HA 5KL7A 2EMKA 2EM0A 1TF6A 1X6EA 2EP3A 1A1KA 2NABA 2GLIA 2RPCA 2YU8A 1BBOA 2EMWA 2D9HA 1YUIA 1ZU1A 2YTIA 2EN4A 1WJPA 2EM9A 2GHFA 2EMBA 2EOXA 4R2CA 4FK5C 2EJ4A 3UK3C 2EL5A 2EPAA 2EPZA 2RSIA 5KL6A 1LLMC 2I13A 3EPJA 2EOJA 2JPAA 1A1HA 4X9JA 1ZR9A 4R2DA 2WBTA 2YSPA 2YRKA 2WBUA 2YTEA 4GZNC 1X5WA 2EL4A 4R2PA 2YRMA 3M99B 4R2RA 2EM8A 3EPLA 2M9AA 2EPPA 1A1FA 1AAYA 1B69A 3MHSC 2EOZA 1YSAC 1X3CA 1DGCA 2EPXA 2EM5A 2LVHA 2LT7A 1A1GA 2EOMA 2EQ0A 2MDGA 2CTDA 2EMGA 4IS1C 1X6FA 3EPKA 1TN9A 1NCSA 2ELZA 2EORA 1UN6B 2EN8A 1KJKA 2PRTA 2JP9A 2E72A 4WSGA 1UBDC 2YTNA 5KL3A 1MEYC 2YTOA 2CSHA 4M9VC 2HGHA 2EM7A 2EN3A 2EMYA 2EMHA 2VRDA 2MKDA 1JK2A 1A1IA 2EMFA 2EMIA 1BB8A 2YTFA 2CT1A 4F2JC 2YTPA 1G2DC 2YTQA 2EM3A 5KL5A 2ELYA 2EMCA 2EOFA 2YTDA 1TF3A 2LO3A 2LV2A 2ENHA 2EN2A 2YSOA 1RMDA 2EMZA 2EE8A 2YTJA 2WCC3 1A1JA 4R2EA 1ZAAC 2YRHA 4R2QA 2EMAA 2ENAA 2EPRA 2EL6A 3EPHA 2EM2A 4R2AA 1YUJA 2DLQA 2YTGA 2EN6A 4R2SA 2EOQA 4F6MA 5KL4A 2MKNA 2EOHA 2ADRA 2DLKA 1JK1A 2R1FA 2EPCA 2EPUA 2EM4A 2EM6A 2EN7A 2YU5A 2EMLA 3VHTB 2LCEA 5KL2A 2EQ3A 3MHHC 4F6NA 1P47A 1F2IG 2EOIA 2ENCA 1Z1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1L A;  2A25 A;  2DMI A;  2EQ1 A;  2EOO A;  2DGC A;  2EN1 A;  2J7J A;  2BB8 A;  2EOY A;  4IJD A;  2DRP A;  2EOE A;  2EMX A;  2EOS A;  1G2F C;  2WBS A;  1X6H A;  5KL7 A;  2EMK A;  2EM0 A;  1TF6 A;  1X6E A;  2EP3 A;  1A1K A;  2NAB A;  2GLI A;  2RPC A;  2YU8 A;  1BBO A;  2EMW A;  2D9H A;  1YUI A;  1ZU1 A;  2YTI A;  2EN4 A;  1WJP A;  2EM9 A;  2GHF A;  2EMB A;  2EOX A;  4R2C A;  4FK5 C;  2EJ4 A;  3UK3 C;  2EL5 A;  2EPA A;  2EPZ A;  2RSI A;  5KL6 A;  1LLM C;  2I13 A;  3EPJ A;  2EOJ A;  2JPA A;  1A1H A;  4X9J A;  1ZR9 A;  4R2D A;  2WBT A;  2YSP A;  2YRK A;  2WBU A;  2YTE A;  4GZN C;  1X5W A;  2EL4 A;  4R2P A;  2YRM A;  3M99 B;  4R2R A;  2EM8 A;  3EPL A;  2M9A A;  2EPP A;  1A1F A;  1AAY A;  1B69 A;  3MHS C;  2EOZ A;  1YSA C;  1X3C A;  1DGC A;  2EPX A;  2EM5 A;  2LVH A;  2LT7 A;  1A1G A;  2EOM A;  2EQ0 A;  2MDG A;  2CTD A;  2EMG A;  4IS1 C;  1X6F A;  3EPK A;  1TN9 A;  1NCS A;  2ELZ A;  2EOR A;  1UN6 B;  2EN8 A;  1KJK A;  2PRT A;  2JP9 A;  2E72 A;  4WSG A;  1UBD C;  2YTN A;  5KL3 A;  1MEY C;  2YTO A;  2CSH A;  4M9V C;  2HGH A;  2EM7 A;  2EN3 A;  2EMY A;  2EMH A;  2VRD A;  2MKD A;  1JK2 A;  1A1I A;  2EMF A;  2EMI A;  1BB8 A;  2YTF A;  2CT1 A;  4F2J C;  2YTP A;  1G2D C;  2YTQ A;  2EM3 A;  5KL5 A;  2ELY A;  2EMC A;  2EOF A;  2YTD A;  1TF3 A;  2LO3 A;  2LV2 A;  2ENH A;  2EN2 A;  2YSO A;  1RMD A;  2EMZ A;  2EE8 A;  2YTJ A;  2WCC 3;  1A1J A;  4R2E A;  1ZAA C;  2YRH A;  4R2Q A;  2EMA A;  2ENA A;  2EPR A;  2EL6 A;  3EPH A;  2EM2 A;  4R2A A;  1YUJ A;  2DLQ A;  2YTG A;  2EN6 A;  4R2S A;  2EOQ A;  4F6M A;  5KL4 A;  2MKN A;  2EOH A;  2ADR A;  2DLK A;  1JK1 A;  2R1F A;  2EPC A;  2EPU A;  2EM4 A;  2EM6 A;  2EN7 A;  2YU5 A;  2EML A;  3VHT B;  2LCE A;  5KL2 A;  2EQ3 A;  3MHH C;  4F6N A;  1P47 A;  1F2I G;  2EOI A;  2ENC A;  1Z1B A; 
#chains in the Genus database with same CATH topology
 2EQ1 A;  2L8T A;  3C4T A;  2E1M A;  3MSW A;  3VYX A;  2EN1 A;  2B7T A;  4DR3 E;  4DV7 E;  1SR9 A;  4DR4 E;  2R76 A;  5DNY A;  2EOS A;  4BCA A;  3QG5 C;  4X64 E;  2LJU A;  5AE1 A;  1IQS A;  3IWC A;  1IBL E;  4GKJ E;  4P7D A;  2L92 A;  1A1K A;  2RTX A;  3ADL A;  4O4K A;  1FKA E;  2RPC A;  4F9A B;  3ADG A;  1BBO A;  4ZYH A;  2VF1 A;  1YUI A;  4WYQ B;  1WJP A;  4TUI A;  4NZV A;  2UUB E;  2EMB A;  1X49 A;  4KHP E;  1SFE A;  2EL5 A;  1GQE A;  1LLM C;  3HPZ A;  2N8X A;  1GZ6 A;  4LF5 E;  1N33 E;  4B3R E;  2B7V A;  4LFB E;  5AC4 A;  2WBU A;  2YT4 A;  4X65 E;  2KON A;  3C6K A;  4X8W A;  2G7H A;  4OOG C;  1DI2 A;  1X5W A;  2YZT A;  2EL4 A;  2JOB A;  1T4O A;  4N4R B;  4K0K E;  3M99 B;  1WHN A;  4DUY E;  2DRP A;  4LTY A;  1YFH A;  2N3G A;  1EKZ A;  2ZM6 E;  5A6A A;  2EM5 A;  2LVH A;  2IHR 1;  2EOM A;  2EQ0 A;  2JYA A;  4L8N A;  3ADI A;  1RQ0 A;  4WPY A;  5A6J A;  1NCS A;  1WXR A;  2EOR A;  4DMI A;  4O43 A;  2E72 A;  3THN A;  4WFT A;  2CSH A;  2EPO A;  4M9V C;  1IQO A;  2WZO A;  2HGH A;  2EMH A;  2VRD A;  2YWQ A;  5A2Q C;  2EMF A;  2EMI A;  1MGT A;  4LF6 E;  2YTP A;  4DV6 E;  3LML A;  2EMC A;  4BC9 A;  4LFC E;  2ENH A;  2NA2 A;  2YSO A;  1J5E E;  5A6K A;  4AQY E;  2VQF E;  3LLH A;  5IXM B;  2ENA A;  2EPR A;  2EM2 A;  4R2A A;  1YUJ A;  4JI1 E;  4X66 E;  5AE3 A;  4R8O A;  2BBG A;  2YU5 A;  3AV0 A;  2EML A;  2LCE A;  5KL2 A;  4JI6 E;  1XNR E;  2N3H A;  1P47 A;  1F2I G;  1A1I A;  1X6E A;  2JXP A;  2EOO A;  2RS6 A;  1IBK E;  4IJD A;  2UUC E;  2UU9 E;  2EOE A;  3BID A;  5KL7 A;  2EMK A;  5F3W A;  1TF6 A;  2V86 A;  3AUZ A;  2UXD E;  4LFA E;  2V85 A;  1BBG A;  5BR8 E;  2D9H A;  1YYK A;  4FK5 C;  3VYY A;  4M0V A;  3H09 A;  3UK3 C;  2EPZ A;  4WX9 A;  3EPJ A;  3FIG A;  3P1X A;  1A1H A;  3HPS A;  4R2D A;  4TUG A;  2YRK A;  5LL6 R;  4GZN C;  4DR7 E;  2EPL X;  2F8B A;  1KYQ A;  3JTZ A;  2EOZ A;  1QNT A;  1XMO E;  1QU6 A;  2LTR A;  5AC5 A;  2LMZ A;  4JI0 E;  4DUZ E;  1A1G A;  4ZYG A;  2UXB E;  4DR6 E;  1UHZ A;  2MDG A;  2F4V E;  2EMG A;  3C6M A;  1X6F A;  3F6G A;  1TN9 A;  2K7I A;  1UN6 B;  2EN8 A;  4WSG A;  2YTN A;  1HNW E;  2EM7 A;  2EN3 A;  2L2K B;  5A69 A;  3T1H E;  2FGG A;  1JK2 A;  5TSE A;  4DV1 E;  2CT1 A;  1PJQ A;  2UUA E;  2V83 A;  5KL5 A;  1X48 A;  2LO3 A;  1XNQ E;  2ODR D;  2V8Q B;  2EMZ A;  2WCC 3;  3VK6 A;  2YRH A;  2V89 A;  4B3S E;  3KWR A;  4KZS A;  3EPH A;  3RMP A;  3BGH A;  4F6M A;  2MKN A;  2EOQ A;  2EPN A;  4DV0 E;  4M2Z A;  2DLK A;  4M30 A;  4O5G A;  5AAS A;  1EH7 A;  1N34 E;  3EQ1 A;  4B3M E;  3KZZ A;  2EM4 A;  2EM6 A;  2Q8U A;  5LLQ A;  3MHH C;  4F6N A;  4DR1 E;  4DKK A;  1Z1B A;  2A25 A;  1HR0 E;  2FTX B;  1ZBQ A;  2DGC A;  2NUE A;  3HQ1 A;  1T4N A;  3JAM C;  2JWO A;  2EOY A;  2DB2 A;  4LF4 E;  4LF8 E;  3DJW A;  4O24 A;  2H36 X;  2JOX A;  4GEQ B;  4BBY A;  4WSP A;  4YHH E;  4LF9 E;  2EM0 A;  2DSY A;  2ODR C;  2DIX A;  2GLI A;  2YU8 A;  4OX9 E;  1ZU1 A;  3ADJ A;  2EM9 A;  2GHF A;  4HEI A;  2MDR A;  4MLQ A;  2EJ4 A;  2LTS A;  5KL6 A;  2EPA A;  4BMJ A;  3TQM A;  2I13 A;  3IWD A;  4Q35 B;  4HTG A;  4DV3 E;  1DQ3 A;  4JI8 E;  2JPA A;  2WBT A;  1EH8 A;  4NXN E;  2YSP A;  1HNX E;  2VQE E;  2B9D A;  2MC6 A;  2RQL A;  1N36 E;  3J81 C;  2JY9 A;  1PKP A;  4P78 A;  4ZYE A;  4MLV A;  2UXC E;  1YYO A;  1WRJ A;  2KOU A;  4DV2 E;  5IT9 C;  4R2R A;  1UIL A;  3EPL A;  1A1F A;  4F9C B;  1YSA C;  2LBS B;  4DV5 E;  2DMY A;  2L33 A;  4NXM E;  2EPX A;  3J7Y p;  2VE7 C;  1PJS A;  4F54 A;  4BHC A;  2V88 A;  4DR5 E;  4IS1 C;  3T1Y E;  1STU A;  3HXL A;  2ELZ A;  2KHX A;  4I8O A;  4JV5 E;  2JP9 A;  3BBG A;  1MEY C;  2JVA A;  1RC7 A;  2EMY A;  2MKD A;  4DR2 E;  2HJJ A;  1BB8 A;  5CFF E;  1G2D C;  2YTQ A;  3ECR A;  2ELY A;  4JI7 E;  1TF3 A;  2EPM X;  2LV2 A;  2M1S A;  1RMD A;  4R2E A;  1AH5 A;  2L3C A;  2K4V A;  2EWL A;  2E5L E;  5IV8 B;  2YTG A;  2EN6 A;  4R2S A;  2EOH A;  4JI5 E;  2GPI A;  4F9B B;  2ADR A;  2EPC A;  4RH8 A;  3OML A;  2RSM A;  3VHT B;  1FJG E;  4KWY A;  4BS9 A;  1T39 A;  2EOI A;  5T6J A;  1A1L A;  2DMI A;  1HNZ E;  1YYW A;  3HTX A;  1X47 A;  1PDA A;  2J7J A;  2BB8 A;  1T4L B;  3J7A G;  3ZOQ B;  4Q28 A;  1XMQ E;  2RS7 A;  2EMX A;  1T38 A;  1G2F C;  1IMU A;  1O0W A;  2WBS A;  1N32 E;  1X6H A;  3THO B;  2L6M A;  2EP3 A;  2LUP B;  1IBM E;  2NAB A;  2EPK X;  4BHB A;  2LJH A;  2EMW A;  2JR1 A;  4YY3 E;  2YTI A;  2EN4 A;  4BC7 A;  5A6B A;  3IWB A;  4RHB B;  2EOX A;  5FLX C;  4R2C A;  4ZYD A;  1ZBT A;  4LF7 E;  1J26 A;  2RSI A;  2L2M A;  3L00 A;  4X62 E;  1YPN A;  2EZ6 A;  2EOJ A;  2LRS A;  4X9J A;  1PJT A;  1ZR9 A;  2I9I A;  1N3G A;  2YTE A;  5LMN E;  4R2P A;  1NEI A;  2YRM A;  2L3J A;  2MC5 A;  2M4I A;  2EM8 A;  1AAY A;  2M9A A;  2EPP A;  1B69 A;  3MHS C;  1X3C A;  4L5N C;  1DGC A;  4NHR A;  4DV4 E;  4GKK E;  2LT7 A;  3JU0 A;  2FV4 B;  2M7Q A;  1I94 E;  4B3T E;  2NUG A;  3K6Q A;  5AE2 A;  1EH6 A;  2CTD A;  1GTK A;  5LMU E;  3EPK A;  3KZY A;  5ADZ A;  4R03 A;  2V87 A;  1KJK A;  2PRT A;  1UBD C;  2LUQ A;  5KL3 A;  3DF6 A;  2YTO A;  2YPN A;  4JI4 E;  2B3T B;  4LU9 A;  4JYA E;  2L2N A;  4JI2 E;  2NUF A;  2LE2 A;  2YTF A;  5IWA E;  4F2J C;  3OTO E;  2EM3 A;  2EOF A;  2YTD A;  2HHH E;  2EN2 A;  2YTJ A;  4WXC A;  2EE8 A;  3BF2 A;  1A1J A;  1ZAA C;  3C4B A;  1L4S A;  4R2Q A;  2EMA A;  4J8Z A;  2EL6 A;  3F6H A;  2DLQ A;  2CPN A;  5KL4 A;  5A6B D;  1YZ9 A;  4WXD A;  1JK1 A;  2R1F A;  2EPU A;  2EN7 A;  3J80 C;  1WHQ A;  2EQ3 A;  4JI3 E;  2HC5 A;  2ENC A; 
#chains in the Genus database with same CATH homology
 1A1L A;  2A25 A;  2DMI A;  2EQ1 A;  2EOO A;  2DGC A;  2EN1 A;  2J7J A;  2BB8 A;  2EOY A;  4IJD A;  2DRP A;  2EOE A;  2EMX A;  2EOS A;  1G2F C;  2WBS A;  1X6H A;  5KL7 A;  2EMK A;  2EM0 A;  1TF6 A;  1X6E A;  2EP3 A;  1A1K A;  2NAB A;  2GLI A;  2RPC A;  2YU8 A;  1BBO A;  2EMW A;  2D9H A;  1YUI A;  1ZU1 A;  2YTI A;  2EN4 A;  1WJP A;  2EM9 A;  2GHF A;  2EMB A;  2EOX A;  4R2C A;  4FK5 C;  2EJ4 A;  3UK3 C;  2EL5 A;  2EPA A;  2EPZ A;  2RSI A;  5KL6 A;  1LLM C;  2I13 A;  3EPJ A;  2EOJ A;  2JPA A;  1A1H A;  4X9J A;  1ZR9 A;  4R2D A;  2WBT A;  2YSP A;  2YRK A;  2WBU A;  2YTE A;  4GZN C;  1X5W A;  2EL4 A;  4R2P A;  2YRM A;  3M99 B;  4R2R A;  2EM8 A;  3EPL A;  2M9A A;  2EPP A;  1A1F A;  1AAY A;  1B69 A;  3MHS C;  2EOZ A;  1YSA C;  1X3C A;  1DGC A;  2EPX A;  2EM5 A;  2LVH A;  2LT7 A;  1A1G A;  2EOM A;  2EQ0 A;  2MDG A;  2CTD A;  2EMG A;  4IS1 C;  1X6F A;  3EPK A;  1TN9 A;  1NCS A;  2ELZ A;  2EOR A;  1UN6 B;  2EN8 A;  1KJK A;  2PRT A;  2JP9 A;  2E72 A;  4WSG A;  1UBD C;  2YTN A;  5KL3 A;  1MEY C;  2YTO A;  2CSH A;  4M9V C;  2HGH A;  2EM7 A;  2EN3 A;  2EMY A;  2EMH A;  2VRD A;  2MKD A;  1JK2 A;  1A1I A;  2EMF A;  2EMI A;  1BB8 A;  2YTF A;  2CT1 A;  4F2J C;  2YTP A;  1G2D C;  2YTQ A;  2EM3 A;  5KL5 A;  2ELY A;  2EMC A;  2EOF A;  2YTD A;  1TF3 A;  2LO3 A;  2LV2 A;  2ENH A;  2EN2 A;  2YSO A;  1RMD A;  2EMZ A;  2EE8 A;  2YTJ A;  2WCC 3;  1A1J A;  4R2E A;  1ZAA C;  2YRH A;  4R2Q A;  2EMA A;  2ENA A;  2EPR A;  2EL6 A;  3EPH A;  2EM2 A;  4R2A A;  1YUJ A;  2DLQ A;  2YTG A;  2EN6 A;  4R2S A;  2EOQ A;  4F6M A;  5KL4 A;  2MKN A;  2EOH A;  2ADR A;  2DLK A;  1JK1 A;  2R1F A;  2EPC A;  2EPU A;  2EM4 A;  2EM6 A;  2EN7 A;  2YU5 A;  2EML A;  3VHT B;  2LCE A;  5KL2 A;  2EQ3 A;  3MHH C;  4F6N A;  1P47 A;  1F2I G;  2EOI A;  2ENC A;  1Z1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...