1F2IG

Cocrystal structure of selected zinc finger dimer bound to dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*GP*GP*GP*CP*GP*CP*GP*CP*CP*CP*AP*T)-3'
total genus 17
structure length 66
sequence length 66
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2000-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG01
2EM7A 4R2QA 2WBTA 3MHSC 1YUJA 2MKDA 2EM2A 2D9HA 2EM8A 2YU8A 2EPCA 4R2EA 2YTEA 2YTNA 2WBUA 5KL2A 4F6MA 1G2FC 2EPAA 1ZU1A 1A1IA 1MEYC 4M9VC 1ZR9A 2WBSA 2EOEA 1Z1BA 2LVHA 4R2DA 2EMZA 2YRMA 1X5WA 1X6EA 2ENHA 2EM5A 2EOMA 2EQ3A 2YTFA 1AAYA 1WJPA 2EQ1A 1UBDC 2R1FA 2VRDA 2YRKA 2EMLA 2M9AA 2MDGA 2E72A 2LCEA 1BBOA 2EE8A 1BB8A 2EMWA 2JP9A 4X9JA 2PRTA 2EM4A 1UN6B 2EJ4A 2EMGA 1A1HA 2EN8A 1X6FA 2EMAA 2EM0A 2EOOA 2YTJA 2ELZA 2EPXA 2GHFA 4WSGA 4R2AA 3EPKA 5KL7A 1A1GA 2EPRA 2EMIA 1JK2A 1TN9A 2EN2A 3EPJA 2EMXA 2J7JA 2EOYA 2EOSA 2NABA 1ZAAC 4R2SA 2WCC3 2EMYA 1A1JA 2JPAA 1KJKA 2CSHA 4F6NA 1LLMC 2RSIA 2ADRA 2EPPA 2EM3A 2I13A 2DLQA 1RMDA 3MHHC 2EMBA 2YTIA 2EOZA 2EN1A 1NCSA 4IJDA 2DMIA 4R2CA 2CT1A 2LT7A 2EOXA 2EMKA 2EOQA 1P47A 2YTPA 2RPCA 2EOHA 1F2IG 1JK1A 1X6HA 1YSAC 3UK3C 2EN3A 1B69A 2EMCA 2LO3A 2EOJA 2YTGA 2EL6A 2EM6A 2YTQA 5KL3A 2DGCA 1YUIA 2DLKA 2EPUA 2YSOA 2BB8A 2EORA 2EN6A 2MKNA 1DGCA 1X3CA 1TF3A 2YTDA 2ELYA 4F2JC 2EL4A 2EOFA 1G2DC 2EPZA 2GLIA 2EP3A 2EMFA 4FK5C 3VHTB 2DRPA 2CTDA 2ENAA 3EPHA 2EOIA 1A1FA 2YSPA 5KL6A 4R2PA 2LV2A 2EMHA 2EM9A 3EPLA 1A1KA 2EN7A 2A25A 2HGHA 5KL5A 1A1LA 4R2RA 4IS1C 2EL5A 4GZNC 2YTOA 2YU5A 3M99B 1TF6A 2EQ0A 2EN4A 2ENCA 5KL4A 2YRHA
chains in the Genus database with same CATH superfamily
2RSMA 4LU9A 3OTOE 4F9AB 4DR5E 2EM8A 2YU8A 3C4BA 2HC5A 3KZYA 1G2FC 2EPAA 1ZU1A 1X49A 5BR8E 1ZR9A 1X5WA 2YTFA 3J7Yp 2V88A 1DI2A 5A6JA 3QG5C 2EPMX 2F8BA 4B3TE 1IQOA 1UN6B 1PDAA 2H36X 2PRTA 4DV1E 2JYAA 4LTYA 2V86A 2EMAA 1RC7A 2UUBE 2EPXA 3EPKA 3C6KA 4WSGA 1RQ0A 4DV3E 2L2KB 1YYOA 1A1GA 3EQ1A 2EPLX 2EMIA 1TN9A 4B3ME 2YZTA 2EN2A 3EPJA 3HXLA 4BHBA 2KHXA 1T4LB 2N8XA 4DR7E 1UHZA 2EMYA 2KOUA 1T4NA 2V83A 2VQFE 3VK6A 1PJSA 4X62E 5CFFE 4WX9A 2RSIA 2EM3A 2L6MA 2ODRC 4O24A 5A69A 2RS6A 1YYKA 1FJGE 2EN1A 5TSEA 2F4VE 5LLQA 2DMIA 2E1MA 5F3WA 2UXCE 4R03A 3J7AG 3JU0A 2JOBA 2NUEA 4DV4E 2RPCA 2EOHA 2DMYA 1JK1A 3THOB 4LF5E 2EMCA 1GTKA 2LO3A 2DGCA 2EL6A 5KL3A 1YUIA 3KWRA 4TUIA 1DGCA 1TF3A 1IQSA 2EWLA 2EPZA 2GLIA 2EPNA 3HQ1A 3VHTB 3HPSA 1HNZE 2ODRD 3DF6A 5A6AA 1A1FA 2HGHA 2MDRA 4X65E 4IS1C 2LJUA 2YU5A 4LFAE 2L2NA 3K6QA 5KL4A 3H09A 3BBGA 2EM7A 2FV4B 1YUJA 4WPYA 2EM2A 2V85A 5AC5A 4BMJA 2YTEA 4O5GA 1J5EE 3JTZA 2LE2A 4M0VA 4ZYEA 5ADZA 4BCAA 1Z1BA 4KWYA 2EMZA 2YRMA 2WZOA 2EQ3A 2ENHA 5IT9C 1UBDC 2VRDA 2UU9E 4Q35B 1L4SA 2EMLA 2MDGA 1BBOA 1HNXE 1BB8A 2JP9A 4X9JA 1FKAE 3IWCA 2EJ4A 2VQEE 2FTXB 2NUFA 4F9CB 4NXNE 2EM0A 5FLXC 2EOOA 2YTJA 2ELZA 5AE2A 4R2AA 3IWDA 4KHPE 1JK2A 2M7QA 2DB2A 4DV2E 5IWAE 5A6KA 1XNQE 4GKKE 2EOYA 2EOSA 2NABA 4DMIA 2LTRA 1WHNA 1BBGA 4M30A 4N4RB 5AASA 4ZYDA 4X64E 1LLMC 3HTXA 2ADRA 4JI3E 5A6BD 2LBSB 1HNWE 4WXDA 3MHHC 2N3GA 2YWQA 5AE1A 2EPKX 1ZBQA 1YFHA 2UXDE 2DIXA 3C6MA 1F2IG 1O0WA 1X6HA 2M4IA 2EN3A 4JI6E 4YHHE 2EOJA 3C4TA 1IBME 2HHHE 2DLKA 2L3JA 2YSOA 4WFTA 2EL4A 4GEQB 3L00A 3ADGA 2I9IA 3ADLA 2DRPA 2CTDA 1N32E 2ENAA 2EOIA 4DUYE 2L8TA 4L8NA 2GPIA 2YSPA 2LUQA 2BBGA 2K7IA 4BC7A 2LRSA 4B3RE 2LTSA 3EPLA 3KZZA 5KL5A 4J8ZA 3AV0A 4GZNC 4DR2E 2ENCA 5AE3A 2YRHA 5LMNE 4R2QA 2WBTA 3ZOQB 4OX9E 2D9HA 3BIDA 1XMQE 4R2EA 2MC6A 1GZ6A 2YTNA 5IV8B 2WBUA 1X48A 4F6MA 4I8OA 4M9VC 1EH8A 1SFEA 4DV0E 2WBSA 2ZM6E 4LFBE 1XMOE 1EH6A 2EQ1A 4DR4E 1IMUA 4DV7E 2YRKA 2NUGA 2EE8A 3AUZA 3OMLA 4X66E 2UUCE 5AC4A 2EMWA 2FGGA 1QU6A 4JI0E 1IBLE 1X6FA 3T1HE 4LF4E 2JWOA 2EZ6A 5KL7A 4DUZE 2EPRA 2EMXA 3J81C 4NXME 2J7JA 1YYWA 1ZAAC 2KONA 4R2SA 4AQYE 4B3SE 3J80C 2JPAA 4JI4E 2CSHA 1UILA 1X47A 2I13A 2CPNA 2EOZA 1ZBTA 1WRJA 1NCSA 4IJDA 4NZVA 1YZ9A 4R2CA 1IBKE 2LT7A 3LMLA 2EOXA 4DR1E 5A2QC 2YTPA 3T1YE 2VF1A 2IHR1 1YSAC 2LUPB 3ADIA 3RMPA 4M2ZA 4DR6E 1B69A 2YTGA 2EM6A 1N3GA 2BB8A 2EN6A 2EORA 2MKNA 1N33E 2NA2A 3F6GA 4LFCE 4F54A 2YPNA 2EOFA 2Q8UA 1G2DC 2EP3A 2EMFA 4ZYGA 4FK5C 2RS7A 5T6JA 3TQMA 5DNYA 3EPHA 4YY3E 2JXPA 2LMZA 5KL6A 2LV2A 4LF9E 4DKKA 5A6BA 2EM9A 1A1KA 1PKPA 4R2RA 2EL5A 2YT4A 4MLVA 2YTOA 1AH5A 3M99B 2EQ0A 2EN4A 1EH7A 4LF8E 4WSPA 3BGHA 2RQLA 4O43A 3MHSC 4WXCA 2MKDA 4OOGC 4DR3E 4JI7E 4JV5E 4K0KE 2EPCA 2B7TA 3MSWA 4RH8A 2G7HA 5KL2A 2RTXA 4KZSA 3LLHA 1A1IA 1MEYC 3ADJA 4DV6E 2EOEA 3THNA 2V89A 2LVHA 4R2DA 3JAMC 2L2MA 1X6EA 3IWBA 2EM5A 1YPNA 2EOMA 4BHCA 1AAYA 1WJPA 2R1FA 2JOXA 1PJQA 2K4VA 2M9AA 1T38A 3DJWA 2E72A 2LCEA 2VE7C 3HPZA 4TUGA 2L92A 4LF7E 1WXRA 2EM4A 2EMGA 2HJJA 4JI2E 1A1HA 2EN8A 3P1XA 2M1SA 4JYAE 3BF2A 1XNRE 3FIGA 2B7VA 4HTGA 2JY9A 2GHFA 4BBYA 3VYXA 4JI5E 4RHBB 1PJTA 2MC5A 5LL6R 4Q28A 2R76A 2E5LE 2WCC3 2L3CA 4JI8E 4LF6E 4JI1E 3F6HA 1KJKA 4F6NA 1SR9A 4F9BB 3ECRA 2EPPA 2DLQA 1RMDA 4BS9A 1T39A 1HR0E 2EMBA 4WYQB 2YTIA 4HEIA 4GKJE 2DSYA 1STUA 2N3HA 4DV5E 1GQEA 2UUAE 2V87A 2CT1A 2EOQA 2EMKA 1P47A 2B9DA 3VYYA 3UK3C 1J26A 2B3TB 2YTQA 5LMUE 1KYQA 2EPUA 2V8QB 1T4OA 1N34E 1DQ3A 1NEIA 4BC9A 1X3CA 1QNTA 2ELYA 2JR1A 2YTDA 4F2JC 4L5NC 4X8WA 2EPOA 1MGTA 2JVAA 4P7DA 4ZYHA 1I94E 2UXBE 4R8OA 2L33A 4P78A 4O4KA 4MLQA 1WHQA 4NHRA 4R2PA 2EMHA 1N36E 2EN7A 2A25A 5IXMB 1A1LA 2LJHA 1EKZA 1TF6A 1A1JA
chains in the Genus database with same CATH topology
2EM7A 4R2QA 2WBTA 3MHSC 1YUJA 2MKDA 2EM2A 2D9HA 2EM8A 2YU8A 2EPCA 4R2EA 2YTEA 2YTNA 2WBUA 5KL2A 4F6MA 1G2FC 2EPAA 1ZU1A 1A1IA 1MEYC 4M9VC 1ZR9A 2WBSA 2EOEA 1Z1BA 2LVHA 4R2DA 2EMZA 2YRMA 1X5WA 1X6EA 2ENHA 2EM5A 2EOMA 2EQ3A 2YTFA 1AAYA 1WJPA 2EQ1A 1UBDC 2R1FA 2VRDA 2YRKA 2EMLA 2M9AA 2MDGA 2E72A 2LCEA 1BBOA 2EE8A 1BB8A 2EMWA 2JP9A 4X9JA 2PRTA 2EM4A 1UN6B 2EJ4A 2EMGA 1A1HA 2EN8A 1X6FA 2EMAA 2EM0A 2EOOA 2YTJA 2ELZA 2EPXA 2GHFA 4WSGA 4R2AA 3EPKA 5KL7A 1A1GA 2EPRA 2EMIA 1JK2A 1TN9A 2EN2A 3EPJA 2EMXA 2J7JA 2EOYA 2EOSA 2NABA 1ZAAC 4R2SA 2WCC3 2EMYA 1A1JA 2JPAA 1KJKA 2CSHA 4F6NA 1LLMC 2RSIA 2ADRA 2EPPA 2EM3A 2I13A 2DLQA 1RMDA 3MHHC 2EMBA 2YTIA 2EOZA 2EN1A 1NCSA 4IJDA 2DMIA 4R2CA 2CT1A 2LT7A 2EOXA 2EMKA 2EOQA 1P47A 2YTPA 2RPCA 2EOHA 1F2IG 1JK1A 1X6HA 1YSAC 3UK3C 2EN3A 1B69A 2EMCA 2LO3A 2EOJA 2YTGA 2EL6A 2EM6A 2YTQA 5KL3A 2DGCA 1YUIA 2DLKA 2EPUA 2YSOA 2BB8A 2EORA 2EN6A 2MKNA 1DGCA 1X3CA 1TF3A 2YTDA 2ELYA 4F2JC 2EL4A 2EOFA 1G2DC 2EPZA 2GLIA 2EP3A 2EMFA 4FK5C 3VHTB 2DRPA 2CTDA 2ENAA 3EPHA 2EOIA 1A1FA 2YSPA 5KL6A 4R2PA 2LV2A 2EMHA 2EM9A 3EPLA 1A1KA 2EN7A 2A25A 2HGHA 5KL5A 1A1LA 4R2RA 4IS1C 2EL5A 4GZNC 2YTOA 2YU5A 3M99B 1TF6A 2EQ0A 2EN4A 2ENCA 5KL4A 2YRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM7 A;  4R2Q A;  2WBT A;  3MHS C;  1YUJ A;  2MKD A;  2EM2 A;  2D9H A;  2EM8 A;  2YU8 A;  2EPC A;  4R2E A;  2YTE A;  2YTN A;  2WBU A;  5KL2 A;  4F6M A;  1G2F C;  2EPA A;  1ZU1 A;  1A1I A;  1MEY C;  4M9V C;  1ZR9 A;  2WBS A;  2EOE A;  1Z1B A;  2LVH A;  4R2D A;  2EMZ A;  2YRM A;  1X5W A;  1X6E A;  2ENH A;  2EM5 A;  2EOM A;  2EQ3 A;  2YTF A;  1AAY A;  1WJP A;  2EQ1 A;  1UBD C;  2R1F A;  2VRD A;  2YRK A;  2EML A;  2M9A A;  2MDG A;  2E72 A;  2LCE A;  1BBO A;  2EE8 A;  1BB8 A;  2EMW A;  2JP9 A;  4X9J A;  2PRT A;  2EM4 A;  1UN6 B;  2EJ4 A;  2EMG A;  1A1H A;  2EN8 A;  1X6F A;  2EMA A;  2EM0 A;  2EOO A;  2YTJ A;  2ELZ A;  2EPX A;  2GHF A;  4WSG A;  4R2A A;  3EPK A;  5KL7 A;  1A1G A;  2EPR A;  2EMI A;  1JK2 A;  1TN9 A;  2EN2 A;  3EPJ A;  2EMX A;  2J7J A;  2EOY A;  2EOS A;  2NAB A;  1ZAA C;  4R2S A;  2WCC 3;  2EMY A;  1A1J A;  2JPA A;  1KJK A;  2CSH A;  4F6N A;  1LLM C;  2RSI A;  2ADR A;  2EPP A;  2EM3 A;  2I13 A;  2DLQ A;  1RMD A;  3MHH C;  2EMB A;  2YTI A;  2EOZ A;  2EN1 A;  1NCS A;  4IJD A;  2DMI A;  4R2C A;  2CT1 A;  2LT7 A;  2EOX A;  2EMK A;  2EOQ A;  1P47 A;  2YTP A;  2RPC A;  2EOH A;  1F2I G;  1JK1 A;  1X6H A;  1YSA C;  3UK3 C;  2EN3 A;  1B69 A;  2EMC A;  2LO3 A;  2EOJ A;  2YTG A;  2EL6 A;  2EM6 A;  2YTQ A;  5KL3 A;  2DGC A;  1YUI A;  2DLK A;  2EPU A;  2YSO A;  2BB8 A;  2EOR A;  2EN6 A;  2MKN A;  1DGC A;  1X3C A;  1TF3 A;  2YTD A;  2ELY A;  4F2J C;  2EL4 A;  2EOF A;  1G2D C;  2EPZ A;  2GLI A;  2EP3 A;  2EMF A;  4FK5 C;  3VHT B;  2DRP A;  2CTD A;  2ENA A;  3EPH A;  2EOI A;  1A1F A;  2YSP A;  5KL6 A;  4R2P A;  2LV2 A;  2EMH A;  2EM9 A;  3EPL A;  1A1K A;  2EN7 A;  2A25 A;  2HGH A;  5KL5 A;  1A1L A;  4R2R A;  4IS1 C;  2EL5 A;  4GZN C;  2YTO A;  2YU5 A;  3M99 B;  1TF6 A;  2EQ0 A;  2EN4 A;  2ENC A;  5KL4 A;  2YRH A; 
#chains in the Genus database with same CATH topology
 2RSM A;  4LU9 A;  3OTO E;  4F9A B;  4DR5 E;  2EM8 A;  2YU8 A;  3C4B A;  2HC5 A;  3KZY A;  1G2F C;  2EPA A;  1ZU1 A;  1X49 A;  5BR8 E;  1ZR9 A;  1X5W A;  2YTF A;  3J7Y p;  2V88 A;  1DI2 A;  5A6J A;  3QG5 C;  2EPM X;  2F8B A;  4B3T E;  1IQO A;  1UN6 B;  1PDA A;  2H36 X;  2PRT A;  4DV1 E;  2JYA A;  4LTY A;  2V86 A;  2EMA A;  1RC7 A;  2UUB E;  2EPX A;  3EPK A;  3C6K A;  4WSG A;  1RQ0 A;  4DV3 E;  2L2K B;  1YYO A;  1A1G A;  3EQ1 A;  2EPL X;  2EMI A;  1TN9 A;  4B3M E;  2YZT A;  2EN2 A;  3EPJ A;  3HXL A;  4BHB A;  2KHX A;  1T4L B;  2N8X A;  4DR7 E;  1UHZ A;  2EMY A;  2KOU A;  1T4N A;  2V83 A;  2VQF E;  3VK6 A;  1PJS A;  4X62 E;  5CFF E;  4WX9 A;  2RSI A;  2EM3 A;  2L6M A;  2ODR C;  4O24 A;  5A69 A;  2RS6 A;  1YYK A;  1FJG E;  2EN1 A;  5TSE A;  2F4V E;  5LLQ A;  2DMI A;  2E1M A;  5F3W A;  2UXC E;  4R03 A;  3J7A G;  3JU0 A;  2JOB A;  2NUE A;  4DV4 E;  2RPC A;  2EOH A;  2DMY A;  1JK1 A;  3THO B;  4LF5 E;  2EMC A;  1GTK A;  2LO3 A;  2DGC A;  2EL6 A;  5KL3 A;  1YUI A;  3KWR A;  4TUI A;  1DGC A;  1TF3 A;  1IQS A;  2EWL A;  2EPZ A;  2GLI A;  2EPN A;  3HQ1 A;  3VHT B;  3HPS A;  1HNZ E;  2ODR D;  3DF6 A;  5A6A A;  1A1F A;  2HGH A;  2MDR A;  4X65 E;  4IS1 C;  2LJU A;  2YU5 A;  4LFA E;  2L2N A;  3K6Q A;  5KL4 A;  3H09 A;  3BBG A;  2EM7 A;  2FV4 B;  1YUJ A;  4WPY A;  2EM2 A;  2V85 A;  5AC5 A;  4BMJ A;  2YTE A;  4O5G A;  1J5E E;  3JTZ A;  2LE2 A;  4M0V A;  4ZYE A;  5ADZ A;  4BCA A;  1Z1B A;  4KWY A;  2EMZ A;  2YRM A;  2WZO A;  2EQ3 A;  2ENH A;  5IT9 C;  1UBD C;  2VRD A;  2UU9 E;  4Q35 B;  1L4S A;  2EML A;  2MDG A;  1BBO A;  1HNX E;  1BB8 A;  2JP9 A;  4X9J A;  1FKA E;  3IWC A;  2EJ4 A;  2VQE E;  2FTX B;  2NUF A;  4F9C B;  4NXN E;  2EM0 A;  5FLX C;  2EOO A;  2YTJ A;  2ELZ A;  5AE2 A;  4R2A A;  3IWD A;  4KHP E;  1JK2 A;  2M7Q A;  2DB2 A;  4DV2 E;  5IWA E;  5A6K A;  1XNQ E;  4GKK E;  2EOY A;  2EOS A;  2NAB A;  4DMI A;  2LTR A;  1WHN A;  1BBG A;  4M30 A;  4N4R B;  5AAS A;  4ZYD A;  4X64 E;  1LLM C;  3HTX A;  2ADR A;  4JI3 E;  5A6B D;  2LBS B;  1HNW E;  4WXD A;  3MHH C;  2N3G A;  2YWQ A;  5AE1 A;  2EPK X;  1ZBQ A;  1YFH A;  2UXD E;  2DIX A;  3C6M A;  1F2I G;  1O0W A;  1X6H A;  2M4I A;  2EN3 A;  4JI6 E;  4YHH E;  2EOJ A;  3C4T A;  1IBM E;  2HHH E;  2DLK A;  2L3J A;  2YSO A;  4WFT A;  2EL4 A;  4GEQ B;  3L00 A;  3ADG A;  2I9I A;  3ADL A;  2DRP A;  2CTD A;  1N32 E;  2ENA A;  2EOI A;  4DUY E;  2L8T A;  4L8N A;  2GPI A;  2YSP A;  2LUQ A;  2BBG A;  2K7I A;  4BC7 A;  2LRS A;  4B3R E;  2LTS A;  3EPL A;  3KZZ A;  5KL5 A;  4J8Z A;  3AV0 A;  4GZN C;  4DR2 E;  2ENC A;  5AE3 A;  2YRH A;  5LMN E;  4R2Q A;  2WBT A;  3ZOQ B;  4OX9 E;  2D9H A;  3BID A;  1XMQ E;  4R2E A;  2MC6 A;  1GZ6 A;  2YTN A;  5IV8 B;  2WBU A;  1X48 A;  4F6M A;  4I8O A;  4M9V C;  1EH8 A;  1SFE A;  4DV0 E;  2WBS A;  2ZM6 E;  4LFB E;  1XMO E;  1EH6 A;  2EQ1 A;  4DR4 E;  1IMU A;  4DV7 E;  2YRK A;  2NUG A;  2EE8 A;  3AUZ A;  3OML A;  4X66 E;  2UUC E;  5AC4 A;  2EMW A;  2FGG A;  1QU6 A;  4JI0 E;  1IBL E;  1X6F A;  3T1H E;  4LF4 E;  2JWO A;  2EZ6 A;  5KL7 A;  4DUZ E;  2EPR A;  2EMX A;  3J81 C;  4NXM E;  2J7J A;  1YYW A;  1ZAA C;  2KON A;  4R2S A;  4AQY E;  4B3S E;  3J80 C;  2JPA A;  4JI4 E;  2CSH A;  1UIL A;  1X47 A;  2I13 A;  2CPN A;  2EOZ A;  1ZBT A;  1WRJ A;  1NCS A;  4IJD A;  4NZV A;  1YZ9 A;  4R2C A;  1IBK E;  2LT7 A;  3LML A;  2EOX A;  4DR1 E;  5A2Q C;  2YTP A;  3T1Y E;  2VF1 A;  2IHR 1;  1YSA C;  2LUP B;  3ADI A;  3RMP A;  4M2Z A;  4DR6 E;  1B69 A;  2YTG A;  2EM6 A;  1N3G A;  2BB8 A;  2EN6 A;  2EOR A;  2MKN A;  1N33 E;  2NA2 A;  3F6G A;  4LFC E;  4F54 A;  2YPN A;  2EOF A;  2Q8U A;  1G2D C;  2EP3 A;  2EMF A;  4ZYG A;  4FK5 C;  2RS7 A;  5T6J A;  3TQM A;  5DNY A;  3EPH A;  4YY3 E;  2JXP A;  2LMZ A;  5KL6 A;  2LV2 A;  4LF9 E;  4DKK A;  5A6B A;  2EM9 A;  1A1K A;  1PKP A;  4R2R A;  2EL5 A;  2YT4 A;  4MLV A;  2YTO A;  1AH5 A;  3M99 B;  2EQ0 A;  2EN4 A;  1EH7 A;  4LF8 E;  4WSP A;  3BGH A;  2RQL A;  4O43 A;  3MHS C;  4WXC A;  2MKD A;  4OOG C;  4DR3 E;  4JI7 E;  4JV5 E;  4K0K E;  2EPC A;  2B7T A;  3MSW A;  4RH8 A;  2G7H A;  5KL2 A;  2RTX A;  4KZS A;  3LLH A;  1A1I A;  1MEY C;  3ADJ A;  4DV6 E;  2EOE A;  3THN A;  2V89 A;  2LVH A;  4R2D A;  3JAM C;  2L2M A;  1X6E A;  3IWB A;  2EM5 A;  1YPN A;  2EOM A;  4BHC A;  1AAY A;  1WJP A;  2R1F A;  2JOX A;  1PJQ A;  2K4V A;  2M9A A;  1T38 A;  3DJW A;  2E72 A;  2LCE A;  2VE7 C;  3HPZ A;  4TUG A;  2L92 A;  4LF7 E;  1WXR A;  2EM4 A;  2EMG A;  2HJJ A;  4JI2 E;  1A1H A;  2EN8 A;  3P1X A;  2M1S A;  4JYA E;  3BF2 A;  1XNR E;  3FIG A;  2B7V A;  4HTG A;  2JY9 A;  2GHF A;  4BBY A;  3VYX A;  4JI5 E;  4RHB B;  1PJT A;  2MC5 A;  5LL6 R;  4Q28 A;  2R76 A;  2E5L E;  2WCC 3;  2L3C A;  4JI8 E;  4LF6 E;  4JI1 E;  3F6H A;  1KJK A;  4F6N A;  1SR9 A;  4F9B B;  3ECR A;  2EPP A;  2DLQ A;  1RMD A;  4BS9 A;  1T39 A;  1HR0 E;  2EMB A;  4WYQ B;  2YTI A;  4HEI A;  4GKJ E;  2DSY A;  1STU A;  2N3H A;  4DV5 E;  1GQE A;  2UUA E;  2V87 A;  2CT1 A;  2EOQ A;  2EMK A;  1P47 A;  2B9D A;  3VYY A;  3UK3 C;  1J26 A;  2B3T B;  2YTQ A;  5LMU E;  1KYQ A;  2EPU A;  2V8Q B;  1T4O A;  1N34 E;  1DQ3 A;  1NEI A;  4BC9 A;  1X3C A;  1QNT A;  2ELY A;  2JR1 A;  2YTD A;  4F2J C;  4L5N C;  4X8W A;  2EPO A;  1MGT A;  2JVA A;  4P7D A;  4ZYH A;  1I94 E;  2UXB E;  4R8O A;  2L33 A;  4P78 A;  4O4K A;  4MLQ A;  1WHQ A;  4NHR A;  4R2P A;  2EMH A;  1N36 E;  2EN7 A;  2A25 A;  5IXM B;  1A1L A;  2LJH A;  1EKZ A;  1TF6 A;  1A1J A; 
#chains in the Genus database with same CATH homology
 2EM7 A;  4R2Q A;  2WBT A;  3MHS C;  1YUJ A;  2MKD A;  2EM2 A;  2D9H A;  2EM8 A;  2YU8 A;  2EPC A;  4R2E A;  2YTE A;  2YTN A;  2WBU A;  5KL2 A;  4F6M A;  1G2F C;  2EPA A;  1ZU1 A;  1A1I A;  1MEY C;  4M9V C;  1ZR9 A;  2WBS A;  2EOE A;  1Z1B A;  2LVH A;  4R2D A;  2EMZ A;  2YRM A;  1X5W A;  1X6E A;  2ENH A;  2EM5 A;  2EOM A;  2EQ3 A;  2YTF A;  1AAY A;  1WJP A;  2EQ1 A;  1UBD C;  2R1F A;  2VRD A;  2YRK A;  2EML A;  2M9A A;  2MDG A;  2E72 A;  2LCE A;  1BBO A;  2EE8 A;  1BB8 A;  2EMW A;  2JP9 A;  4X9J A;  2PRT A;  2EM4 A;  1UN6 B;  2EJ4 A;  2EMG A;  1A1H A;  2EN8 A;  1X6F A;  2EMA A;  2EM0 A;  2EOO A;  2YTJ A;  2ELZ A;  2EPX A;  2GHF A;  4WSG A;  4R2A A;  3EPK A;  5KL7 A;  1A1G A;  2EPR A;  2EMI A;  1JK2 A;  1TN9 A;  2EN2 A;  3EPJ A;  2EMX A;  2J7J A;  2EOY A;  2EOS A;  2NAB A;  1ZAA C;  4R2S A;  2WCC 3;  2EMY A;  1A1J A;  2JPA A;  1KJK A;  2CSH A;  4F6N A;  1LLM C;  2RSI A;  2ADR A;  2EPP A;  2EM3 A;  2I13 A;  2DLQ A;  1RMD A;  3MHH C;  2EMB A;  2YTI A;  2EOZ A;  2EN1 A;  1NCS A;  4IJD A;  2DMI A;  4R2C A;  2CT1 A;  2LT7 A;  2EOX A;  2EMK A;  2EOQ A;  1P47 A;  2YTP A;  2RPC A;  2EOH A;  1F2I G;  1JK1 A;  1X6H A;  1YSA C;  3UK3 C;  2EN3 A;  1B69 A;  2EMC A;  2LO3 A;  2EOJ A;  2YTG A;  2EL6 A;  2EM6 A;  2YTQ A;  5KL3 A;  2DGC A;  1YUI A;  2DLK A;  2EPU A;  2YSO A;  2BB8 A;  2EOR A;  2EN6 A;  2MKN A;  1DGC A;  1X3C A;  1TF3 A;  2YTD A;  2ELY A;  4F2J C;  2EL4 A;  2EOF A;  1G2D C;  2EPZ A;  2GLI A;  2EP3 A;  2EMF A;  4FK5 C;  3VHT B;  2DRP A;  2CTD A;  2ENA A;  3EPH A;  2EOI A;  1A1F A;  2YSP A;  5KL6 A;  4R2P A;  2LV2 A;  2EMH A;  2EM9 A;  3EPL A;  1A1K A;  2EN7 A;  2A25 A;  2HGH A;  5KL5 A;  1A1L A;  4R2R A;  4IS1 C;  2EL5 A;  4GZN C;  2YTO A;  2YU5 A;  3M99 B;  1TF6 A;  2EQ0 A;  2EN4 A;  2ENC A;  5KL4 A;  2YRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...