1F2IG

Cocrystal structure of selected zinc finger dimer bound to dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
b'NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*TP*GP*GP*GP*CP*GP*CP*GP*CP*CP*CP*AP*T)-3'
publication title Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 17
structure length 66
sequence length 66
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2000-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG01
1P47A 1A1HA 1JK1A 2LO3A 2YTNA 4R2QA 2M9AA 1AAYA 1TF6A 2GLIA 2EM6A 3EPKA 2EN4A 2EN1A 1X6HA 4F6MA 2YSOA 2EP3A 2EMZA 2EOHA 2PRTA 4GZNC 2EORA 1ZU1A 1BB8A 2LV2A 2EJ4A 2EMIA 2EPRA 2EOYA 2YTJA 2E72A 2EOQA 2CSHA 4IJDA 1X3CA 2EPAA 2EN6A 2ENHA 2WBUA 2EMYA 4F6NA 1LLMC 2YU8A 1BBOA 2BB8A 2EM0A 1ZAAC 2WCC3 2ELZA 2JPAA 1X6EA 2J7JA 1WJPA 2EMWA 4R2RA 1MEYC 4R2EA 2DGCA 1YSAC 1DGCA 2YRMA 2EPPA 2D9HA 2EL4A 4WSGA 5KL4A 2EMGA 1X5WA 2YTFA 1A1KA 2EOEA 2GHFA 2YTOA 5KL5A 3EPJA 2EMXA 2EPZA 2CT1A 2RSIA 2YTGA 2EOMA 3VHTB 2EOJA 2I13A 2EQ0A 2HGHA 2VRDA 1Z1BA 2JP9A 2EPUA 2EN2A 2EOOA 2EN7A 3UK3C 4R2PA 1TF3A 2EN8A 2EPXA 2EM8A 2RPCA 4R2DA 4FK5C 2WBSA 2R1FA 4F2JC 2YSPA 4R2SA 2DMIA 2YU5A 2EM4A 2EL5A 2YRKA 2EMLA 2EOZA 2YTPA 2EPCA 2EOFA 2EE8A 2ENCA 2EM5A 2EMBA 1A1FA 2EQ3A 1A1JA 3EPLA 2NABA 3MHSC 5KL7A 2LT7A 2CTDA 2YTQA 2ELYA 2EOIA 1G2FC 1YUIA 2EMKA 2MKNA 2EOSA 5KL6A 1UBDC 2EM2A 2LVHA 3M99B 2WBTA 2EM9A 4R2AA 4X9JA 2YTIA 2MDGA 1JK2A 2EM3A 1B69A 1A1IA 1RMDA 2EL6A 2EOXA 1G2DC 4M9VC 1A1LA 1KJKA 3EPHA 2EMFA 2DLKA 1YUJA 2A25A 2LCEA 1A1GA 1ZR9A 2EN3A 1F2IG 5KL2A 1X6FA 2EMCA 2ENAA 2EM7A 3MHHC 4R2CA 2ADRA 1UN6B 2DRPA 2DLQA 2YRHA 2EMHA 1TN9A 2MKDA 2EQ1A 2YTEA 2EMAA 4IS1C 5KL3A 2YTDA 1NCSA
chains in the Genus database with same CATH superfamily
2V86A 1J26A 3L00A 5IT9C 4LTYA 4ZYGA 2LO3A 4NHRA 2YTNA 4R2QA 2GLIA 2N8XA 2EN4A 2UUAE 1X49A 1EH6A 3J7AG 4Q28A 4DR2E 2EMZA 2VE7C 2L33A 5A2QC 4LF6E 4IJDA 1J5EE 4B3SE 1O0WA 4MLQA 3KZZA 1FKAE 5TSEA 2FV4B 2EMYA 4F6NA 3DF6A 2V89A 3BIDA 4DUYE 1QNTA 2EM0A 5A6BA 2ELZA 1X6EA 2F8BA 2J7JA 2EPMX 1MEYC 4LF8E 4WSGA 1RC7A 5KL4A 1X5WA 1YYOA 2EOEA 3C4TA 3EPJA 4LFAE 2EPZA 4JI8E 4JI7E 2I13A 2EN7A 3UK3C 2V83A 2LUQA 2BBGA 2VF1A 4L5NC 4B3ME 4R2DA 1YFHA 4GKKE 2DMIA 1EH8A 4P7DA 2YU5A 4KZSA 2YRKA 2EMLA 1RQ0A 5CFFE 4X8WA 5IV8B 3ADIA 2I9IA 2JR1A 2B9DA 1NEIA 5A6AA 1A1JA 2LT7A 3DJWA 2CTDA 2YPNA 2YTQA 5KL6A 2EM2A 3M99B 2LTSA 2Q8UA 1RMDA 4X66E 1A1LA 4DR3E 3HPZA 2EMFA 1IBME 3IWCA 2A25A 4B3TE 4F9CB 2EN3A 5KL2A 4Q35B 2YWQA 4R2CA 1UN6B 2EZ6A 3J81C 2DRPA 1YZ9A 3HPSA 4F6MA 2UUBE 2YTIA 4P78A 5LMNE 2E5LE 3LLHA 2LRSA 1N3GA 1DI2A 1HNWE 3EPKA 2EN1A 1PKPA 3F6HA 4OX9E 3ADLA 4LFBE 2NUEA 2EOHA 3KWRA 2PRTA 3C6KA 5AC4A 2N3HA 1N34E 1N32E 1MGTA 1HNZE 3ADGA 3C6MA 2EJ4A 4DV3E 2EPRA 2LUPB 3JAMC 5F3WA 1SR9A 1UHZA 4LF5E 3P1XA 2LBSB 5IWAE 2EPAA 2ENHA 2WBUA 3LMLA 4O5GA 1PJTA 2YU8A 3AUZA 2BB8A 2WCC3 2YZTA 3T1HE 2L2MA 1STUA 1WJPA 3BF2A 2DSYA 4R2EA 1XMQE 1YSAC 2YRMA 2EPPA 4DV1E 2DB2A 2NA2A 2LJUA 2V87A 2YTOA 5KL5A 1DQ3A 2RQLA 4JI1E 2EMXA 1WHNA 2CT1A 4DMIA 2YTGA 2EOMA 2EOJA 1BBGA 2L92A 2EPUA 2EN2A 2EN8A 2EM8A 1HNXE 2WBSA 4FK5C 2R1FA 2UXCE 4JI2E 1GQEA 2EOZA 4ZYDA 2EPKX 2V85A 2EPCA 4F9AB 2M7QA 4M30A 4WX9A 4NXNE 2JY9A 1A1FA 2M4IA 3RMPA 2L2NA 4DV4E 2RTXA 3EPLA 4NXME 4DR4E 3MHSC 4GKJE 1AH5A 1ZBTA 3BGHA 2ELYA 1G2FC 2NUFA 2EOSA 2E1MA 2YT4A 2WBTA 3IWDA 4R2AA 4LU9A 1PJSA 2MDGA 3FIGA 2EM3A 2EOXA 2DLKA 3H09A 1EKZA 1PJQA 2LCEA 3C4BA 1ZR9A 3BBGA 1X6FA 1WHQA 2ZM6E 4DV7E 3MSWA 3MHHC 2VQFE 3VK6A 1T4OA 4X62E 3HXLA 4WSPA 5AASA 4BHBA 1EH7A 1X47A 1TN9A 2UXBE 2MKDA 2M1SA 1N33E 4X65E 2YTEA 4I8OA 1QU6A 3T1YE 2EMAA 4IS1C 2HC5A 5KL3A 1P47A 4ZYEA 1ZBQA 1PDAA 2H36X 2MC5A 1IQOA 3OTOE 4DUZE 4DV0E 2UXDE 1TF6A 3AV0A 4DR6E 1X6HA 2RS7A 2YSOA 3HQ1A 2EP3A 4KWYA 4BCAA 1T4NA 4B3RE 4DR1E 4BMJA 2EMIA 2EOYA 5ADZA 2E72A 2LE2A 2RSMA 1YPNA 1X3CA 4JI5E 1GZ6A 4JI6E 4YY3E 4KHPE 2JVAA 4R03A 1BBOA 2JXPA 2JOBA 5AE1A 4K0KE 1T4LB 1IMUA 2RS6A 2EPOA 5BR8E 1GTKA 4WPYA 4R2RA 4DV5E 1XMOE 4R8OA 4RH8A 2D9HA 4GEQB 2MC6A 2JWOA 3THNA 4NZVA 4O24A 5A69A 3VHTB 3KZYA 4DV6E 3JU0A 3HTXA 1Z1BA 1TF3A 2B7VA 2KONA 3OMLA 2EPXA 2KOUA 4R2SA 5T6JA 2F4VE 5LL6R 2CPNA 2YTPA 2EOFA 5LMUE 2ENCA 4O4KA 5AC5A 2EM5A 4JV5E 2N3GA 2EQ3A 2KHXA 2GPIA 1IBLE 4M2ZA 2DMYA 2ODRC 1YUIA 1YYKA 2EM9A 4X9JA 1L4SA 4JI0E 2WZOA 4LFCE 4TUIA 2L3CA 2ODRD 1KJKA 3EPHA 4BBYA 1YUJA 2HHHE 3J80C 4O43A 4F9BB 2UU9E 2EMCA 5DNYA 2VQEE 2MDRA 1FJGE 2V8QB 2ADRA 3K6QA 1IBKE 2DLQA 1XNRE 4F54A 1YYWA 1SFEA 2EMHA 2K7IA 4TUGA 4WFTA 1A1HA 5A6JA 3J7Yp 1WXRA 1JK1A 3F6GA 2M9AA 1AAYA 2EM6A 4JYAE 2IHR1 3EQ1A 1N36E 4LF7E 4L8NA 2EPLX 2L8TA 2FTXB 4GZNC 2EORA 1ZU1A 5A6BD 1BB8A 2LV2A 4HEIA 4WXCA 4OOGC 3TQMA 3IWBA 2YTJA 3VYXA 1T38A 2EOQA 2CSHA 4MLVA 2B3TB 4BC9A 2G7HA 4DKKA 2EN6A 3JTZA 1LLMC 4M0VA 1ZAAC 5AE2A 2JPAA 2EPNA 4ZYHA 4DV2E 2LMZA 2EMWA 2V88A 4DR7E 2DGCA 1DGCA 5IXMB 2EL4A 2FGGA 2EMGA 1A1KA 2YTFA 4N4RB 2GHFA 3ZOQB 2B7TA 4WXDA 2RSIA 4RHBB 4WYQB 5A6KA 2EQ0A 4YHHE 2HGHA 2VRDA 2JP9A 2L6MA 2EOOA 2HJJA 4R2PA 2RPCA 1KYQA 4F2JC 2YSPA 3THOB 2EM4A 2LTRA 2EL5A 2DIXA 4BHCA 2JOXA 2EE8A 1UILA 1WRJA 2UUCE 2EMBA 3VYYA 2LJHA 3QG5C 1HR0E 1T39A 4JI4E 1XNQE 2NABA 5LLQA 5KL7A 2EOIA 1I94E 4X64E 4DR5E 2EMKA 2MKNA 1UBDC 2LVHA 4J8ZA 3ADJA 4LF4E 4BC7A 5AE3A 1JK2A 2R76A 1B69A 1A1IA 2JYAA 2EL6A 1G2DC 4M9VC 3ECRA 2K4VA 1X48A 1A1GA 1F2IG 4BS9A 2ENAA 4HTGA 2EM7A 2EWLA 1IQSA 2YRHA 5FLXC 2NUGA 2L2KB 4LF9E 4JI3E 2EQ1A 2L3JA 4AQYE 2YTDA 1NCSA
chains in the Genus database with same CATH topology
1P47A 1A1HA 1JK1A 2LO3A 2YTNA 4R2QA 2M9AA 1AAYA 1TF6A 2GLIA 2EM6A 3EPKA 2EN4A 2EN1A 1X6HA 4F6MA 2YSOA 2EP3A 2EMZA 2EOHA 2PRTA 4GZNC 2EORA 1ZU1A 1BB8A 2LV2A 2EJ4A 2EMIA 2EPRA 2EOYA 2YTJA 2E72A 2EOQA 2CSHA 4IJDA 1X3CA 2EPAA 2EN6A 2ENHA 2WBUA 2EMYA 4F6NA 1LLMC 2YU8A 1BBOA 2BB8A 2EM0A 1ZAAC 2WCC3 2ELZA 2JPAA 1X6EA 2J7JA 1WJPA 2EMWA 4R2RA 1MEYC 4R2EA 2DGCA 1YSAC 1DGCA 2YRMA 2EPPA 2D9HA 2EL4A 4WSGA 5KL4A 2EMGA 1X5WA 2YTFA 1A1KA 2EOEA 2GHFA 2YTOA 5KL5A 3EPJA 2EMXA 2EPZA 2CT1A 2RSIA 2YTGA 2EOMA 3VHTB 2EOJA 2I13A 2EQ0A 2HGHA 2VRDA 1Z1BA 2JP9A 2EPUA 2EN2A 2EOOA 2EN7A 3UK3C 4R2PA 1TF3A 2EN8A 2EPXA 2EM8A 2RPCA 4R2DA 4FK5C 2WBSA 2R1FA 4F2JC 2YSPA 4R2SA 2DMIA 2YU5A 2EM4A 2EL5A 2YRKA 2EMLA 2EOZA 2YTPA 2EPCA 2EOFA 2EE8A 2ENCA 2EM5A 2EMBA 1A1FA 2EQ3A 1A1JA 3EPLA 2NABA 3MHSC 5KL7A 2LT7A 2CTDA 2YTQA 2ELYA 2EOIA 1G2FC 1YUIA 2EMKA 2MKNA 2EOSA 5KL6A 1UBDC 2EM2A 2LVHA 3M99B 2WBTA 2EM9A 4R2AA 4X9JA 2YTIA 2MDGA 1JK2A 2EM3A 1B69A 1A1IA 1RMDA 2EL6A 2EOXA 1G2DC 4M9VC 1A1LA 1KJKA 3EPHA 2EMFA 2DLKA 1YUJA 2A25A 2LCEA 1A1GA 1ZR9A 2EN3A 1F2IG 5KL2A 1X6FA 2EMCA 2ENAA 2EM7A 3MHHC 4R2CA 2ADRA 1UN6B 2DRPA 2DLQA 2YRHA 2EMHA 1TN9A 2MKDA 2EQ1A 2YTEA 2EMAA 4IS1C 5KL3A 2YTDA 1NCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P47 A;  1A1H A;  1JK1 A;  2LO3 A;  2YTN A;  4R2Q A;  2M9A A;  1AAY A;  1TF6 A;  2GLI A;  2EM6 A;  3EPK A;  2EN4 A;  2EN1 A;  1X6H A;  4F6M A;  2YSO A;  2EP3 A;  2EMZ A;  2EOH A;  2PRT A;  4GZN C;  2EOR A;  1ZU1 A;  1BB8 A;  2LV2 A;  2EJ4 A;  2EMI A;  2EPR A;  2EOY A;  2YTJ A;  2E72 A;  2EOQ A;  2CSH A;  4IJD A;  1X3C A;  2EPA A;  2EN6 A;  2ENH A;  2WBU A;  2EMY A;  4F6N A;  1LLM C;  2YU8 A;  1BBO A;  2BB8 A;  2EM0 A;  1ZAA C;  2WCC 3;  2ELZ A;  2JPA A;  1X6E A;  2J7J A;  1WJP A;  2EMW A;  4R2R A;  1MEY C;  4R2E A;  2DGC A;  1YSA C;  1DGC A;  2YRM A;  2EPP A;  2D9H A;  2EL4 A;  4WSG A;  5KL4 A;  2EMG A;  1X5W A;  2YTF A;  1A1K A;  2EOE A;  2GHF A;  2YTO A;  5KL5 A;  3EPJ A;  2EMX A;  2EPZ A;  2CT1 A;  2RSI A;  2YTG A;  2EOM A;  3VHT B;  2EOJ A;  2I13 A;  2EQ0 A;  2HGH A;  2VRD A;  1Z1B A;  2JP9 A;  2EPU A;  2EN2 A;  2EOO A;  2EN7 A;  3UK3 C;  4R2P A;  1TF3 A;  2EN8 A;  2EPX A;  2EM8 A;  2RPC A;  4R2D A;  4FK5 C;  2WBS A;  2R1F A;  4F2J C;  2YSP A;  4R2S A;  2DMI A;  2YU5 A;  2EM4 A;  2EL5 A;  2YRK A;  2EML A;  2EOZ A;  2YTP A;  2EPC A;  2EOF A;  2EE8 A;  2ENC A;  2EM5 A;  2EMB A;  1A1F A;  2EQ3 A;  1A1J A;  3EPL A;  2NAB A;  3MHS C;  5KL7 A;  2LT7 A;  2CTD A;  2YTQ A;  2ELY A;  2EOI A;  1G2F C;  1YUI A;  2EMK A;  2MKN A;  2EOS A;  5KL6 A;  1UBD C;  2EM2 A;  2LVH A;  3M99 B;  2WBT A;  2EM9 A;  4R2A A;  4X9J A;  2YTI A;  2MDG A;  1JK2 A;  2EM3 A;  1B69 A;  1A1I A;  1RMD A;  2EL6 A;  2EOX A;  1G2D C;  4M9V C;  1A1L A;  1KJK A;  3EPH A;  2EMF A;  2DLK A;  1YUJ A;  2A25 A;  2LCE A;  1A1G A;  1ZR9 A;  2EN3 A;  1F2I G;  5KL2 A;  1X6F A;  2EMC A;  2ENA A;  2EM7 A;  3MHH C;  4R2C A;  2ADR A;  1UN6 B;  2DRP A;  2DLQ A;  2YRH A;  2EMH A;  1TN9 A;  2MKD A;  2EQ1 A;  2YTE A;  2EMA A;  4IS1 C;  5KL3 A;  2YTD A;  1NCS A; 
#chains in the Genus database with same CATH topology
 2V86 A;  1J26 A;  3L00 A;  5IT9 C;  4LTY A;  4ZYG A;  2LO3 A;  4NHR A;  2YTN A;  4R2Q A;  2GLI A;  2N8X A;  2EN4 A;  2UUA E;  1X49 A;  1EH6 A;  3J7A G;  4Q28 A;  4DR2 E;  2EMZ A;  2VE7 C;  2L33 A;  5A2Q C;  4LF6 E;  4IJD A;  1J5E E;  4B3S E;  1O0W A;  4MLQ A;  3KZZ A;  1FKA E;  5TSE A;  2FV4 B;  2EMY A;  4F6N A;  3DF6 A;  2V89 A;  3BID A;  4DUY E;  1QNT A;  2EM0 A;  5A6B A;  2ELZ A;  1X6E A;  2F8B A;  2J7J A;  2EPM X;  1MEY C;  4LF8 E;  4WSG A;  1RC7 A;  5KL4 A;  1X5W A;  1YYO A;  2EOE A;  3C4T A;  3EPJ A;  4LFA E;  2EPZ A;  4JI8 E;  4JI7 E;  2I13 A;  2EN7 A;  3UK3 C;  2V83 A;  2LUQ A;  2BBG A;  2VF1 A;  4L5N C;  4B3M E;  4R2D A;  1YFH A;  4GKK E;  2DMI A;  1EH8 A;  4P7D A;  2YU5 A;  4KZS A;  2YRK A;  2EML A;  1RQ0 A;  5CFF E;  4X8W A;  5IV8 B;  3ADI A;  2I9I A;  2JR1 A;  2B9D A;  1NEI A;  5A6A A;  1A1J A;  2LT7 A;  3DJW A;  2CTD A;  2YPN A;  2YTQ A;  5KL6 A;  2EM2 A;  3M99 B;  2LTS A;  2Q8U A;  1RMD A;  4X66 E;  1A1L A;  4DR3 E;  3HPZ A;  2EMF A;  1IBM E;  3IWC A;  2A25 A;  4B3T E;  4F9C B;  2EN3 A;  5KL2 A;  4Q35 B;  2YWQ A;  4R2C A;  1UN6 B;  2EZ6 A;  3J81 C;  2DRP A;  1YZ9 A;  3HPS A;  4F6M A;  2UUB E;  2YTI A;  4P78 A;  5LMN E;  2E5L E;  3LLH A;  2LRS A;  1N3G A;  1DI2 A;  1HNW E;  3EPK A;  2EN1 A;  1PKP A;  3F6H A;  4OX9 E;  3ADL A;  4LFB E;  2NUE A;  2EOH A;  3KWR A;  2PRT A;  3C6K A;  5AC4 A;  2N3H A;  1N34 E;  1N32 E;  1MGT A;  1HNZ E;  3ADG A;  3C6M A;  2EJ4 A;  4DV3 E;  2EPR A;  2LUP B;  3JAM C;  5F3W A;  1SR9 A;  1UHZ A;  4LF5 E;  3P1X A;  2LBS B;  5IWA E;  2EPA A;  2ENH A;  2WBU A;  3LML A;  4O5G A;  1PJT A;  2YU8 A;  3AUZ A;  2BB8 A;  2WCC 3;  2YZT A;  3T1H E;  2L2M A;  1STU A;  1WJP A;  3BF2 A;  2DSY A;  4R2E A;  1XMQ E;  1YSA C;  2YRM A;  2EPP A;  4DV1 E;  2DB2 A;  2NA2 A;  2LJU A;  2V87 A;  2YTO A;  5KL5 A;  1DQ3 A;  2RQL A;  4JI1 E;  2EMX A;  1WHN A;  2CT1 A;  4DMI A;  2YTG A;  2EOM A;  2EOJ A;  1BBG A;  2L92 A;  2EPU A;  2EN2 A;  2EN8 A;  2EM8 A;  1HNX E;  2WBS A;  4FK5 C;  2R1F A;  2UXC E;  4JI2 E;  1GQE A;  2EOZ A;  4ZYD A;  2EPK X;  2V85 A;  2EPC A;  4F9A B;  2M7Q A;  4M30 A;  4WX9 A;  4NXN E;  2JY9 A;  1A1F A;  2M4I A;  3RMP A;  2L2N A;  4DV4 E;  2RTX A;  3EPL A;  4NXM E;  4DR4 E;  3MHS C;  4GKJ E;  1AH5 A;  1ZBT A;  3BGH A;  2ELY A;  1G2F C;  2NUF A;  2EOS A;  2E1M A;  2YT4 A;  2WBT A;  3IWD A;  4R2A A;  4LU9 A;  1PJS A;  2MDG A;  3FIG A;  2EM3 A;  2EOX A;  2DLK A;  3H09 A;  1EKZ A;  1PJQ A;  2LCE A;  3C4B A;  1ZR9 A;  3BBG A;  1X6F A;  1WHQ A;  2ZM6 E;  4DV7 E;  3MSW A;  3MHH C;  2VQF E;  3VK6 A;  1T4O A;  4X62 E;  3HXL A;  4WSP A;  5AAS A;  4BHB A;  1EH7 A;  1X47 A;  1TN9 A;  2UXB E;  2MKD A;  2M1S A;  1N33 E;  4X65 E;  2YTE A;  4I8O A;  1QU6 A;  3T1Y E;  2EMA A;  4IS1 C;  2HC5 A;  5KL3 A;  1P47 A;  4ZYE A;  1ZBQ A;  1PDA A;  2H36 X;  2MC5 A;  1IQO A;  3OTO E;  4DUZ E;  4DV0 E;  2UXD E;  1TF6 A;  3AV0 A;  4DR6 E;  1X6H A;  2RS7 A;  2YSO A;  3HQ1 A;  2EP3 A;  4KWY A;  4BCA A;  1T4N A;  4B3R E;  4DR1 E;  4BMJ A;  2EMI A;  2EOY A;  5ADZ A;  2E72 A;  2LE2 A;  2RSM A;  1YPN A;  1X3C A;  4JI5 E;  1GZ6 A;  4JI6 E;  4YY3 E;  4KHP E;  2JVA A;  4R03 A;  1BBO A;  2JXP A;  2JOB A;  5AE1 A;  4K0K E;  1T4L B;  1IMU A;  2RS6 A;  2EPO A;  5BR8 E;  1GTK A;  4WPY A;  4R2R A;  4DV5 E;  1XMO E;  4R8O A;  4RH8 A;  2D9H A;  4GEQ B;  2MC6 A;  2JWO A;  3THN A;  4NZV A;  4O24 A;  5A69 A;  3VHT B;  3KZY A;  4DV6 E;  3JU0 A;  3HTX A;  1Z1B A;  1TF3 A;  2B7V A;  2KON A;  3OML A;  2EPX A;  2KOU A;  4R2S A;  5T6J A;  2F4V E;  5LL6 R;  2CPN A;  2YTP A;  2EOF A;  5LMU E;  2ENC A;  4O4K A;  5AC5 A;  2EM5 A;  4JV5 E;  2N3G A;  2EQ3 A;  2KHX A;  2GPI A;  1IBL E;  4M2Z A;  2DMY A;  2ODR C;  1YUI A;  1YYK A;  2EM9 A;  4X9J A;  1L4S A;  4JI0 E;  2WZO A;  4LFC E;  4TUI A;  2L3C A;  2ODR D;  1KJK A;  3EPH A;  4BBY A;  1YUJ A;  2HHH E;  3J80 C;  4O43 A;  4F9B B;  2UU9 E;  2EMC A;  5DNY A;  2VQE E;  2MDR A;  1FJG E;  2V8Q B;  2ADR A;  3K6Q A;  1IBK E;  2DLQ A;  1XNR E;  4F54 A;  1YYW A;  1SFE A;  2EMH A;  2K7I A;  4TUG A;  4WFT A;  1A1H A;  5A6J A;  3J7Y p;  1WXR A;  1JK1 A;  3F6G A;  2M9A A;  1AAY A;  2EM6 A;  4JYA E;  2IHR 1;  3EQ1 A;  1N36 E;  4LF7 E;  4L8N A;  2EPL X;  2L8T A;  2FTX B;  4GZN C;  2EOR A;  1ZU1 A;  5A6B D;  1BB8 A;  2LV2 A;  4HEI A;  4WXC A;  4OOG C;  3TQM A;  3IWB A;  2YTJ A;  3VYX A;  1T38 A;  2EOQ A;  2CSH A;  4MLV A;  2B3T B;  4BC9 A;  2G7H A;  4DKK A;  2EN6 A;  3JTZ A;  1LLM C;  4M0V A;  1ZAA C;  5AE2 A;  2JPA A;  2EPN A;  4ZYH A;  4DV2 E;  2LMZ A;  2EMW A;  2V88 A;  4DR7 E;  2DGC A;  1DGC A;  5IXM B;  2EL4 A;  2FGG A;  2EMG A;  1A1K A;  2YTF A;  4N4R B;  2GHF A;  3ZOQ B;  2B7T A;  4WXD A;  2RSI A;  4RHB B;  4WYQ B;  5A6K A;  2EQ0 A;  4YHH E;  2HGH A;  2VRD A;  2JP9 A;  2L6M A;  2EOO A;  2HJJ A;  4R2P A;  2RPC A;  1KYQ A;  4F2J C;  2YSP A;  3THO B;  2EM4 A;  2LTR A;  2EL5 A;  2DIX A;  4BHC A;  2JOX A;  2EE8 A;  1UIL A;  1WRJ A;  2UUC E;  2EMB A;  3VYY A;  2LJH A;  3QG5 C;  1HR0 E;  1T39 A;  4JI4 E;  1XNQ E;  2NAB A;  5LLQ A;  5KL7 A;  2EOI A;  1I94 E;  4X64 E;  4DR5 E;  2EMK A;  2MKN A;  1UBD C;  2LVH A;  4J8Z A;  3ADJ A;  4LF4 E;  4BC7 A;  5AE3 A;  1JK2 A;  2R76 A;  1B69 A;  1A1I A;  2JYA A;  2EL6 A;  1G2D C;  4M9V C;  3ECR A;  2K4V A;  1X48 A;  1A1G A;  1F2I G;  4BS9 A;  2ENA A;  4HTG A;  2EM7 A;  2EWL A;  1IQS A;  2YRH A;  5FLX C;  2NUG A;  2L2K B;  4LF9 E;  4JI3 E;  2EQ1 A;  2L3J A;  4AQY E;  2YTD A;  1NCS A; 
#chains in the Genus database with same CATH homology
 1P47 A;  1A1H A;  1JK1 A;  2LO3 A;  2YTN A;  4R2Q A;  2M9A A;  1AAY A;  1TF6 A;  2GLI A;  2EM6 A;  3EPK A;  2EN4 A;  2EN1 A;  1X6H A;  4F6M A;  2YSO A;  2EP3 A;  2EMZ A;  2EOH A;  2PRT A;  4GZN C;  2EOR A;  1ZU1 A;  1BB8 A;  2LV2 A;  2EJ4 A;  2EMI A;  2EPR A;  2EOY A;  2YTJ A;  2E72 A;  2EOQ A;  2CSH A;  4IJD A;  1X3C A;  2EPA A;  2EN6 A;  2ENH A;  2WBU A;  2EMY A;  4F6N A;  1LLM C;  2YU8 A;  1BBO A;  2BB8 A;  2EM0 A;  1ZAA C;  2WCC 3;  2ELZ A;  2JPA A;  1X6E A;  2J7J A;  1WJP A;  2EMW A;  4R2R A;  1MEY C;  4R2E A;  2DGC A;  1YSA C;  1DGC A;  2YRM A;  2EPP A;  2D9H A;  2EL4 A;  4WSG A;  5KL4 A;  2EMG A;  1X5W A;  2YTF A;  1A1K A;  2EOE A;  2GHF A;  2YTO A;  5KL5 A;  3EPJ A;  2EMX A;  2EPZ A;  2CT1 A;  2RSI A;  2YTG A;  2EOM A;  3VHT B;  2EOJ A;  2I13 A;  2EQ0 A;  2HGH A;  2VRD A;  1Z1B A;  2JP9 A;  2EPU A;  2EN2 A;  2EOO A;  2EN7 A;  3UK3 C;  4R2P A;  1TF3 A;  2EN8 A;  2EPX A;  2EM8 A;  2RPC A;  4R2D A;  4FK5 C;  2WBS A;  2R1F A;  4F2J C;  2YSP A;  4R2S A;  2DMI A;  2YU5 A;  2EM4 A;  2EL5 A;  2YRK A;  2EML A;  2EOZ A;  2YTP A;  2EPC A;  2EOF A;  2EE8 A;  2ENC A;  2EM5 A;  2EMB A;  1A1F A;  2EQ3 A;  1A1J A;  3EPL A;  2NAB A;  3MHS C;  5KL7 A;  2LT7 A;  2CTD A;  2YTQ A;  2ELY A;  2EOI A;  1G2F C;  1YUI A;  2EMK A;  2MKN A;  2EOS A;  5KL6 A;  1UBD C;  2EM2 A;  2LVH A;  3M99 B;  2WBT A;  2EM9 A;  4R2A A;  4X9J A;  2YTI A;  2MDG A;  1JK2 A;  2EM3 A;  1B69 A;  1A1I A;  1RMD A;  2EL6 A;  2EOX A;  1G2D C;  4M9V C;  1A1L A;  1KJK A;  3EPH A;  2EMF A;  2DLK A;  1YUJ A;  2A25 A;  2LCE A;  1A1G A;  1ZR9 A;  2EN3 A;  1F2I G;  5KL2 A;  1X6F A;  2EMC A;  2ENA A;  2EM7 A;  3MHH C;  4R2C A;  2ADR A;  1UN6 B;  2DRP A;  2DLQ A;  2YRH A;  2EMH A;  1TN9 A;  2MKD A;  2EQ1 A;  2YTE A;  2EMA A;  4IS1 C;  5KL3 A;  2YTD A;  1NCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...