1F2IG

Cocrystal structure of selected zinc finger dimer bound to dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*GP*GP*GP*CP*GP*CP*GP*CP*CP*CP*AP*T)-3'
total genus 17
structure length 66
sequence length 66
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2000-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG01
2EM0A 2R1FA 2EORA 1YSAC 5KL6A 2YTDA 2EN8A 2EOXA 2D9HA 2LT7A 2M9AA 1YUIA 4R2DA 3EPHA 2EM6A 2EN2A 2YTQA 2NABA 2ENAA 2EM7A 2EN1A 3EPKA 4GZNC 1JK2A 2YTNA 1UN6B 2EMAA 2EM8A 1RMDA 2EJ4A 2JP9A 2ELZA 5KL7A 1A1JA 4IS1C 2EMKA 2EOEA 1JK1A 2EL5A 5KL4A 2WCC3 1X5WA 2EMZA 2EN4A 2EOJA 2DMIA 3EPLA 1AAYA 2JPAA 5KL3A 2A25A 2EMYA 2EPAA 1LLMC 2EPCA 3VHTB 2YSPA 2EMXA 4F6MA 2J7JA 2EMLA 1A1IA 2EOSA 2EOYA 2MKNA 2WBTA 2LVHA 2EPXA 2CSHA 2HGHA 1BBOA 2YTOA 2YRKA 2YRHA 2EOFA 3EPJA 2EQ1A 2PRTA 2MDGA 1G2DC 2I13A 4F6NA 2ENHA 2EQ3A 2RPCA 2YTPA 1A1FA 1NCSA 1X6EA 2LV2A 2EMFA 2EL6A 2EOHA 4WSGA 2EM4A 1TN9A 2YTGA 3UK3C 1TF6A 3M99B 2EOOA 2GHFA 2YU5A 1A1GA 2YSOA 1MEYC 1DGCA 2CT1A 2EMGA 2YRMA 2EPZA 4R2RA 1WJPA 2DLKA 2GLIA 1X6HA 4R2PA 2EL4A 2EOMA 3MHSC 1KJKA 1X3CA 1ZAAC 4X9JA 2EMIA 2EMWA 2VRDA 3MHHC 2YU8A 2EOQA 2MKDA 1UBDC 2EOZA 2YTIA 1Z1BA 2EE8A 2EM9A 4M9VC 2EPUA 1BB8A 4F2JC 2WBSA 1ZR9A 2LO3A 1X6FA 2EN6A 5KL2A 2EPRA 2EPPA 2YTJA 2YTEA 2EQ0A 2E72A 1P47A 1A1LA 2EP3A 1YUJA 2EMCA 4R2SA 4FK5C 2EN7A 2DRPA 2EMBA 2BB8A 2EM3A 2RSIA 2DGCA 2EM2A 1G2FC 1TF3A 2ELYA 2EN3A 2WBUA 5KL5A 1B69A 2ADRA 1A1HA 4IJDA 1ZU1A 2ENCA 4R2CA 2EMHA 4R2EA 2EM5A 1F2IG 2EOIA 1A1KA 2LCEA 4R2AA 2CTDA 2YTFA 2DLQA 4R2QA
chains in the Genus database with same CATH superfamily
2EWLA 1YFHA 2EM0A 2EN8A 2F8BA 4X65E 4LF9E 2FV4B 2LT7A 4YHHE 4BMJA 2L33A 2ENAA 2LTSA 2LBSB 1NEIA 1UN6B 4BCAA 2MC6A 2EJ4A 1BBGA 2YWQA 5ADZA 5KL7A 2LRSA 2LMZA 4R03A 4DV4E 4GKJE 2EMZA 2EPKX 3EPLA 1AAYA 1KYQA 5KL3A 4R8OA 2YSPA 2EMXA 1A1IA 2EOSA 5AASA 2JOBA 2EOYA 2WBTA 2B7VA 2EPXA 5IXMB 2HGHA 2V83A 2YTOA 2YRHA 3THNA 1G2DC 2I13A 4MLVA 4ZYGA 2RS7A 1A1FA 2EMFA 3JTZA 4WSGA 4JI8E 1TN9A 1YYKA 3THOB 4BHBA 2LE2A 2JVAA 1DGCA 2CT1A 4M30A 1XNRE 2V85A 2LUQA 1EH6A 4DV1E 4YY3E 4R2RA 3ADJA 1X6HA 2H36X 2LUPB 3HQ1A 2B3TB 4O43A 4NXME 4NHRA 1X3CA 3T1YE 1ZAAC 4X9JA 2KONA 4GKKE 3IWCA 2VRDA 3MHHC 1FKAE 3C4BA 5F3WA 3TQMA 3FIGA 2YTIA 4GEQB 2UXDE 2N3HA 3DF6A 4OOGC 1WXRA 2EN6A 1PJSA 5AC5A 1O0WA 5KL2A 2EPRA 1HNXE 4L5NC 3VYXA 3RMPA 1N3GA 1P47A 5LMUE 4WXDA 2DSYA 2M4IA 2YZTA 2EN7A 5A6JA 2BB8A 2LTRA 2DGCA 5T6JA 2EM2A 1X48A 4Q28A 2WBUA 3OTOE 4N4RB 1ZU1A 2ENCA 2EMHA 2L2KB 5AE3A 1IBME 1HNWE 2DIXA 2YTFA 3C6KA 4RHBB 4B3SE 4X64E 2EORA 4F9BB 5KL6A 2YTDA 2EPOA 4P7DA 2YT4A 1WHNA 2D9HA 1YUIA 2M9AA 4JI0E 4X66E 1N32E 4RH8A 2EM7A 2EN1A 4GZNC 1HNZE 2JWOA 2YTNA 2EM8A 1RMDA 2ELZA 5AE1A 4LF8E 2EL5A 1X5WA 1SR9A 2EN4A 5IWAE 4LF5E 2RS6A 2K4VA 4BS9A 2L2NA 2ODRD 2EPCA 3J81C 3VHTB 2YPNA 4JI5E 4F6MA 4DR2E 4DR1E 1IMUA 4K0KE 3DJWA 1FJGE 3QG5C 1BBOA 2YRKA 1GTKA 4L8NA 1WHQA 1IBLE 2ENHA 4ZYEA 2MDRA 2KHXA 1NCSA 2NUFA 4B3ME 2EL6A 5LL6R 2EM4A 1RC7A 4KHPE 1TF6A 4LF4E 5A6AA 1N36E 1A1GA 4BC7A 2EMGA 2EPZA 3ECRA 4P78A 1WJPA 2DLKA 2GLIA 4NZVA 3C4TA 3L00A 4ZYDA 4X62E 4M2ZA 2UU9E 4DR5E 2MKDA 1UBDC 2EOZA 5A6KA 1Z1BA 4M9VC 1BB8A 4HEIA 2JOXA 2V88A 3JAMC 4JI7E 2BBGA 1J5EE 2HJJA 2EPPA 2YTEA 2EQ0A 3HPSA 1A1LA 4BC9A 4O5GA 4DV5E 4R2SA 4F9CB 4LTYA 1T4OA 4FK5C 1J26A 1EKZA 2DRPA 1T38A 5IT9C 2EM3A 3MSWA 2ADRA 4I8OA 4IJDA 1T4LB 1EH8A 4R2CA 2F4VE 2EM5A 1F2IG 2I9IA 1A1KA 5A69A 4LFBE 2CTDA 3HTXA 5LMNE 2V89A 2R1FA 2RTXA 3KZZA 2EPMX 1PJQA 4DMIA 3EPHA 2EM6A 2YTQA 2NABA 3EPKA 1JK2A 1X47A 2MC5A 4DV6E 2UUCE 2EMAA 2JP9A 1DQ3A 5AE2A 2EMKA 2V86A 1JK1A 5KL4A 1STUA 2EOJA 2HHHE 4OX9E 2GPIA 2EZ6A 4WXCA 1YYWA 2ODRC 1UHZA 2EMYA 2V8QB 4MLQA 4NXNE 3ZOQB 1LLMC 2UXBE 4JI2E 2DB2A 2J7JA 2EMLA 4WPYA 2IHR1 2MKNA 3BBGA 3KZYA 1IQOA 2LVHA 1HR0E 4WSPA 2EOFA 3EPJA 2EQ1A 5AC4A 2MDGA 5BR8E 4F6NA 4DV0E 4DR6E 2YTPA 1RQ0A 2EOHA 2YTGA 2EPNA 3UK3C 3M99B 1EH7A 3H09A 1PKPA 2RQLA 1L4SA 2ZM6E 2G7HA 2VQEE 4R2PA 2EOMA 2L6MA 3MHSC 3KWRA 3C6MA 3OMLA 4M0VA 1ZBQA 3AUZA 1QNTA 2YU8A 1GZ6A 2EOQA 2JY9A 3IWBA 2N8XA 4DR4E 2EE8A 2EM9A 2VE7C 4DV3E 3J80C 2KOUA 1N33E 2WBSA 1ZR9A 2FTXB 2LO3A 3HXLA 5DNYA 2L92A 2E5LE 1X6FA 4X8WA 3T1HE 2HC5A 2LJHA 2YTJA 3K6QA 5A2QC 4WYQB 1YPNA 2E72A 1PDAA 5FLXC 2EP3A 4JI6E 1I94E 3VK6A 3JU0A 2EPLX 2EMBA 2L2MA 1T4NA 1G2FC 2ELYA 2EN3A 2UXCE 2WZOA 2RSMA 2EOIA 4BBYA 2L3JA 2LCEA 2L8TA 1PJTA 2DLQA 4R2QA 2B7TA 4DUYE 4F9AB 1XMOE 1YZ9A 1YSAC 2CPNA 4JI4E 4DV7E 1DI2A 4B3RE 2EOXA 4R2DA 2EN2A 2JXPA 4LF7E 4WX9A 2VQFE 4B3TE 1IBKE 1MGTA 1A1JA 4JI3E 4DV2E 4IS1C 2NA2A 2EOEA 2WCC3 1WRJA 2UUBE 2DMIA 2NUGA 3BIDA 4DKKA 3VYYA 2JPAA 2A25A 2EPAA 4LFAE 4JV5E 3IWDA 4DR7E 4KZSA 3AV0A 5CFFE 5A6BD 4F54A 2JYAA 1UILA 2CSHA 2M1SA 2FGGA 4DR3E 4JYAE 2PRTA 3F6HA 3ADLA 2B9DA 2EQ3A 2RPCA 2K7IA 2E1MA 1XMQE 1X6EA 2NUEA 4HTGA 2LV2A 2R76A 4LU9A 1ZBTA 2EOOA 2GHFA 2YU5A 4TUIA 3F6GA 3J7AG 2YSOA 5LLQA 1MEYC 1AH5A 2YRMA 1YYOA 4Q35B 2VF1A 2L3CA 5TSEA 4JI1E 4KWYA 3BGHA 1XNQE 4LF6E 2EL4A 4J8ZA 4ZYHA 1KJKA 3LMLA 2V87A 2EMIA 3ADGA 1T39A 2EMWA 3J7Yp 1IQSA 4LFCE 1QU6A 1X49A 2N3GA 2UUAE 1N34E 2EPUA 4DUZE 4F2JC 3EQ1A 2M7QA 3ADIA 3LLHA 2DMYA 4O24A 4O4KA 2Q8UA 3BF2A 4BHCA 2JR1A 1YUJA 1GQEA 2EMCA 1SFEA 5A6BA 4WFTA 2RSIA 1TF3A 1A1HA 5KL5A 1B69A 4AQYE 5IV8B 3HPZA 3P1XA 4R2EA 4TUGA 2LJUA 4R2AA
chains in the Genus database with same CATH topology
2EM0A 2R1FA 2EORA 1YSAC 5KL6A 2YTDA 2EN8A 2EOXA 2D9HA 2LT7A 2M9AA 1YUIA 4R2DA 3EPHA 2EM6A 2EN2A 2YTQA 2NABA 2ENAA 2EM7A 2EN1A 3EPKA 4GZNC 1JK2A 2YTNA 1UN6B 2EMAA 2EM8A 1RMDA 2EJ4A 2JP9A 2ELZA 5KL7A 1A1JA 4IS1C 2EMKA 2EOEA 1JK1A 2EL5A 5KL4A 2WCC3 1X5WA 2EMZA 2EN4A 2EOJA 2DMIA 3EPLA 1AAYA 2JPAA 5KL3A 2A25A 2EMYA 2EPAA 1LLMC 2EPCA 3VHTB 2YSPA 2EMXA 4F6MA 2J7JA 2EMLA 1A1IA 2EOSA 2EOYA 2MKNA 2WBTA 2LVHA 2EPXA 2CSHA 2HGHA 1BBOA 2YTOA 2YRKA 2YRHA 2EOFA 3EPJA 2EQ1A 2PRTA 2MDGA 1G2DC 2I13A 4F6NA 2ENHA 2EQ3A 2RPCA 2YTPA 1A1FA 1NCSA 1X6EA 2LV2A 2EMFA 2EL6A 2EOHA 4WSGA 2EM4A 1TN9A 2YTGA 3UK3C 1TF6A 3M99B 2EOOA 2GHFA 2YU5A 1A1GA 2YSOA 1MEYC 1DGCA 2CT1A 2EMGA 2YRMA 2EPZA 4R2RA 1WJPA 2DLKA 2GLIA 1X6HA 4R2PA 2EL4A 2EOMA 3MHSC 1KJKA 1X3CA 1ZAAC 4X9JA 2EMIA 2EMWA 2VRDA 3MHHC 2YU8A 2EOQA 2MKDA 1UBDC 2EOZA 2YTIA 1Z1BA 2EE8A 2EM9A 4M9VC 2EPUA 1BB8A 4F2JC 2WBSA 1ZR9A 2LO3A 1X6FA 2EN6A 5KL2A 2EPRA 2EPPA 2YTJA 2YTEA 2EQ0A 2E72A 1P47A 1A1LA 2EP3A 1YUJA 2EMCA 4R2SA 4FK5C 2EN7A 2DRPA 2EMBA 2BB8A 2EM3A 2RSIA 2DGCA 2EM2A 1G2FC 1TF3A 2ELYA 2EN3A 2WBUA 5KL5A 1B69A 2ADRA 1A1HA 4IJDA 1ZU1A 2ENCA 4R2CA 2EMHA 4R2EA 2EM5A 1F2IG 2EOIA 1A1KA 2LCEA 4R2AA 2CTDA 2YTFA 2DLQA 4R2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM0 A;  2R1F A;  2EOR A;  1YSA C;  5KL6 A;  2YTD A;  2EN8 A;  2EOX A;  2D9H A;  2LT7 A;  2M9A A;  1YUI A;  4R2D A;  3EPH A;  2EM6 A;  2EN2 A;  2YTQ A;  2NAB A;  2ENA A;  2EM7 A;  2EN1 A;  3EPK A;  4GZN C;  1JK2 A;  2YTN A;  1UN6 B;  2EMA A;  2EM8 A;  1RMD A;  2EJ4 A;  2JP9 A;  2ELZ A;  5KL7 A;  1A1J A;  4IS1 C;  2EMK A;  2EOE A;  1JK1 A;  2EL5 A;  5KL4 A;  2WCC 3;  1X5W A;  2EMZ A;  2EN4 A;  2EOJ A;  2DMI A;  3EPL A;  1AAY A;  2JPA A;  5KL3 A;  2A25 A;  2EMY A;  2EPA A;  1LLM C;  2EPC A;  3VHT B;  2YSP A;  2EMX A;  4F6M A;  2J7J A;  2EML A;  1A1I A;  2EOS A;  2EOY A;  2MKN A;  2WBT A;  2LVH A;  2EPX A;  2CSH A;  2HGH A;  1BBO A;  2YTO A;  2YRK A;  2YRH A;  2EOF A;  3EPJ A;  2EQ1 A;  2PRT A;  2MDG A;  1G2D C;  2I13 A;  4F6N A;  2ENH A;  2EQ3 A;  2RPC A;  2YTP A;  1A1F A;  1NCS A;  1X6E A;  2LV2 A;  2EMF A;  2EL6 A;  2EOH A;  4WSG A;  2EM4 A;  1TN9 A;  2YTG A;  3UK3 C;  1TF6 A;  3M99 B;  2EOO A;  2GHF A;  2YU5 A;  1A1G A;  2YSO A;  1MEY C;  1DGC A;  2CT1 A;  2EMG A;  2YRM A;  2EPZ A;  4R2R A;  1WJP A;  2DLK A;  2GLI A;  1X6H A;  4R2P A;  2EL4 A;  2EOM A;  3MHS C;  1KJK A;  1X3C A;  1ZAA C;  4X9J A;  2EMI A;  2EMW A;  2VRD A;  3MHH C;  2YU8 A;  2EOQ A;  2MKD A;  1UBD C;  2EOZ A;  2YTI A;  1Z1B A;  2EE8 A;  2EM9 A;  4M9V C;  2EPU A;  1BB8 A;  4F2J C;  2WBS A;  1ZR9 A;  2LO3 A;  1X6F A;  2EN6 A;  5KL2 A;  2EPR A;  2EPP A;  2YTJ A;  2YTE A;  2EQ0 A;  2E72 A;  1P47 A;  1A1L A;  2EP3 A;  1YUJ A;  2EMC A;  4R2S A;  4FK5 C;  2EN7 A;  2DRP A;  2EMB A;  2BB8 A;  2EM3 A;  2RSI A;  2DGC A;  2EM2 A;  1G2F C;  1TF3 A;  2ELY A;  2EN3 A;  2WBU A;  5KL5 A;  1B69 A;  2ADR A;  1A1H A;  4IJD A;  1ZU1 A;  2ENC A;  4R2C A;  2EMH A;  4R2E A;  2EM5 A;  1F2I G;  2EOI A;  1A1K A;  2LCE A;  4R2A A;  2CTD A;  2YTF A;  2DLQ A;  4R2Q A; 
#chains in the Genus database with same CATH topology
 2EWL A;  1YFH A;  2EM0 A;  2EN8 A;  2F8B A;  4X65 E;  4LF9 E;  2FV4 B;  2LT7 A;  4YHH E;  4BMJ A;  2L33 A;  2ENA A;  2LTS A;  2LBS B;  1NEI A;  1UN6 B;  4BCA A;  2MC6 A;  2EJ4 A;  1BBG A;  2YWQ A;  5ADZ A;  5KL7 A;  2LRS A;  2LMZ A;  4R03 A;  4DV4 E;  4GKJ E;  2EMZ A;  2EPK X;  3EPL A;  1AAY A;  1KYQ A;  5KL3 A;  4R8O A;  2YSP A;  2EMX A;  1A1I A;  2EOS A;  5AAS A;  2JOB A;  2EOY A;  2WBT A;  2B7V A;  2EPX A;  5IXM B;  2HGH A;  2V83 A;  2YTO A;  2YRH A;  3THN A;  1G2D C;  2I13 A;  4MLV A;  4ZYG A;  2RS7 A;  1A1F A;  2EMF A;  3JTZ A;  4WSG A;  4JI8 E;  1TN9 A;  1YYK A;  3THO B;  4BHB A;  2LE2 A;  2JVA A;  1DGC A;  2CT1 A;  4M30 A;  1XNR E;  2V85 A;  2LUQ A;  1EH6 A;  4DV1 E;  4YY3 E;  4R2R A;  3ADJ A;  1X6H A;  2H36 X;  2LUP B;  3HQ1 A;  2B3T B;  4O43 A;  4NXM E;  4NHR A;  1X3C A;  3T1Y E;  1ZAA C;  4X9J A;  2KON A;  4GKK E;  3IWC A;  2VRD A;  3MHH C;  1FKA E;  3C4B A;  5F3W A;  3TQM A;  3FIG A;  2YTI A;  4GEQ B;  2UXD E;  2N3H A;  3DF6 A;  4OOG C;  1WXR A;  2EN6 A;  1PJS A;  5AC5 A;  1O0W A;  5KL2 A;  2EPR A;  1HNX E;  4L5N C;  3VYX A;  3RMP A;  1N3G A;  1P47 A;  5LMU E;  4WXD A;  2DSY A;  2M4I A;  2YZT A;  2EN7 A;  5A6J A;  2BB8 A;  2LTR A;  2DGC A;  5T6J A;  2EM2 A;  1X48 A;  4Q28 A;  2WBU A;  3OTO E;  4N4R B;  1ZU1 A;  2ENC A;  2EMH A;  2L2K B;  5AE3 A;  1IBM E;  1HNW E;  2DIX A;  2YTF A;  3C6K A;  4RHB B;  4B3S E;  4X64 E;  2EOR A;  4F9B B;  5KL6 A;  2YTD A;  2EPO A;  4P7D A;  2YT4 A;  1WHN A;  2D9H A;  1YUI A;  2M9A A;  4JI0 E;  4X66 E;  1N32 E;  4RH8 A;  2EM7 A;  2EN1 A;  4GZN C;  1HNZ E;  2JWO A;  2YTN A;  2EM8 A;  1RMD A;  2ELZ A;  5AE1 A;  4LF8 E;  2EL5 A;  1X5W A;  1SR9 A;  2EN4 A;  5IWA E;  4LF5 E;  2RS6 A;  2K4V A;  4BS9 A;  2L2N A;  2ODR D;  2EPC A;  3J81 C;  3VHT B;  2YPN A;  4JI5 E;  4F6M A;  4DR2 E;  4DR1 E;  1IMU A;  4K0K E;  3DJW A;  1FJG E;  3QG5 C;  1BBO A;  2YRK A;  1GTK A;  4L8N A;  1WHQ A;  1IBL E;  2ENH A;  4ZYE A;  2MDR A;  2KHX A;  1NCS A;  2NUF A;  4B3M E;  2EL6 A;  5LL6 R;  2EM4 A;  1RC7 A;  4KHP E;  1TF6 A;  4LF4 E;  5A6A A;  1N36 E;  1A1G A;  4BC7 A;  2EMG A;  2EPZ A;  3ECR A;  4P78 A;  1WJP A;  2DLK A;  2GLI A;  4NZV A;  3C4T A;  3L00 A;  4ZYD A;  4X62 E;  4M2Z A;  2UU9 E;  4DR5 E;  2MKD A;  1UBD C;  2EOZ A;  5A6K A;  1Z1B A;  4M9V C;  1BB8 A;  4HEI A;  2JOX A;  2V88 A;  3JAM C;  4JI7 E;  2BBG A;  1J5E E;  2HJJ A;  2EPP A;  2YTE A;  2EQ0 A;  3HPS A;  1A1L A;  4BC9 A;  4O5G A;  4DV5 E;  4R2S A;  4F9C B;  4LTY A;  1T4O A;  4FK5 C;  1J26 A;  1EKZ A;  2DRP A;  1T38 A;  5IT9 C;  2EM3 A;  3MSW A;  2ADR A;  4I8O A;  4IJD A;  1T4L B;  1EH8 A;  4R2C A;  2F4V E;  2EM5 A;  1F2I G;  2I9I A;  1A1K A;  5A69 A;  4LFB E;  2CTD A;  3HTX A;  5LMN E;  2V89 A;  2R1F A;  2RTX A;  3KZZ A;  2EPM X;  1PJQ A;  4DMI A;  3EPH A;  2EM6 A;  2YTQ A;  2NAB A;  3EPK A;  1JK2 A;  1X47 A;  2MC5 A;  4DV6 E;  2UUC E;  2EMA A;  2JP9 A;  1DQ3 A;  5AE2 A;  2EMK A;  2V86 A;  1JK1 A;  5KL4 A;  1STU A;  2EOJ A;  2HHH E;  4OX9 E;  2GPI A;  2EZ6 A;  4WXC A;  1YYW A;  2ODR C;  1UHZ A;  2EMY A;  2V8Q B;  4MLQ A;  4NXN E;  3ZOQ B;  1LLM C;  2UXB E;  4JI2 E;  2DB2 A;  2J7J A;  2EML A;  4WPY A;  2IHR 1;  2MKN A;  3BBG A;  3KZY A;  1IQO A;  2LVH A;  1HR0 E;  4WSP A;  2EOF A;  3EPJ A;  2EQ1 A;  5AC4 A;  2MDG A;  5BR8 E;  4F6N A;  4DV0 E;  4DR6 E;  2YTP A;  1RQ0 A;  2EOH A;  2YTG A;  2EPN A;  3UK3 C;  3M99 B;  1EH7 A;  3H09 A;  1PKP A;  2RQL A;  1L4S A;  2ZM6 E;  2G7H A;  2VQE E;  4R2P A;  2EOM A;  2L6M A;  3MHS C;  3KWR A;  3C6M A;  3OML A;  4M0V A;  1ZBQ A;  3AUZ A;  1QNT A;  2YU8 A;  1GZ6 A;  2EOQ A;  2JY9 A;  3IWB A;  2N8X A;  4DR4 E;  2EE8 A;  2EM9 A;  2VE7 C;  4DV3 E;  3J80 C;  2KOU A;  1N33 E;  2WBS A;  1ZR9 A;  2FTX B;  2LO3 A;  3HXL A;  5DNY A;  2L92 A;  2E5L E;  1X6F A;  4X8W A;  3T1H E;  2HC5 A;  2LJH A;  2YTJ A;  3K6Q A;  5A2Q C;  4WYQ B;  1YPN A;  2E72 A;  1PDA A;  5FLX C;  2EP3 A;  4JI6 E;  1I94 E;  3VK6 A;  3JU0 A;  2EPL X;  2EMB A;  2L2M A;  1T4N A;  1G2F C;  2ELY A;  2EN3 A;  2UXC E;  2WZO A;  2RSM A;  2EOI A;  4BBY A;  2L3J A;  2LCE A;  2L8T A;  1PJT A;  2DLQ A;  4R2Q A;  2B7T A;  4DUY E;  4F9A B;  1XMO E;  1YZ9 A;  1YSA C;  2CPN A;  4JI4 E;  4DV7 E;  1DI2 A;  4B3R E;  2EOX A;  4R2D A;  2EN2 A;  2JXP A;  4LF7 E;  4WX9 A;  2VQF E;  4B3T E;  1IBK E;  1MGT A;  1A1J A;  4JI3 E;  4DV2 E;  4IS1 C;  2NA2 A;  2EOE A;  2WCC 3;  1WRJ A;  2UUB E;  2DMI A;  2NUG A;  3BID A;  4DKK A;  3VYY A;  2JPA A;  2A25 A;  2EPA A;  4LFA E;  4JV5 E;  3IWD A;  4DR7 E;  4KZS A;  3AV0 A;  5CFF E;  5A6B D;  4F54 A;  2JYA A;  1UIL A;  2CSH A;  2M1S A;  2FGG A;  4DR3 E;  4JYA E;  2PRT A;  3F6H A;  3ADL A;  2B9D A;  2EQ3 A;  2RPC A;  2K7I A;  2E1M A;  1XMQ E;  1X6E A;  2NUE A;  4HTG A;  2LV2 A;  2R76 A;  4LU9 A;  1ZBT A;  2EOO A;  2GHF A;  2YU5 A;  4TUI A;  3F6G A;  3J7A G;  2YSO A;  5LLQ A;  1MEY C;  1AH5 A;  2YRM A;  1YYO A;  4Q35 B;  2VF1 A;  2L3C A;  5TSE A;  4JI1 E;  4KWY A;  3BGH A;  1XNQ E;  4LF6 E;  2EL4 A;  4J8Z A;  4ZYH A;  1KJK A;  3LML A;  2V87 A;  2EMI A;  3ADG A;  1T39 A;  2EMW A;  3J7Y p;  1IQS A;  4LFC E;  1QU6 A;  1X49 A;  2N3G A;  2UUA E;  1N34 E;  2EPU A;  4DUZ E;  4F2J C;  3EQ1 A;  2M7Q A;  3ADI A;  3LLH A;  2DMY A;  4O24 A;  4O4K A;  2Q8U A;  3BF2 A;  4BHC A;  2JR1 A;  1YUJ A;  1GQE A;  2EMC A;  1SFE A;  5A6B A;  4WFT A;  2RSI A;  1TF3 A;  1A1H A;  5KL5 A;  1B69 A;  4AQY E;  5IV8 B;  3HPZ A;  3P1X A;  4R2E A;  4TUG A;  2LJU A;  4R2A A; 
#chains in the Genus database with same CATH homology
 2EM0 A;  2R1F A;  2EOR A;  1YSA C;  5KL6 A;  2YTD A;  2EN8 A;  2EOX A;  2D9H A;  2LT7 A;  2M9A A;  1YUI A;  4R2D A;  3EPH A;  2EM6 A;  2EN2 A;  2YTQ A;  2NAB A;  2ENA A;  2EM7 A;  2EN1 A;  3EPK A;  4GZN C;  1JK2 A;  2YTN A;  1UN6 B;  2EMA A;  2EM8 A;  1RMD A;  2EJ4 A;  2JP9 A;  2ELZ A;  5KL7 A;  1A1J A;  4IS1 C;  2EMK A;  2EOE A;  1JK1 A;  2EL5 A;  5KL4 A;  2WCC 3;  1X5W A;  2EMZ A;  2EN4 A;  2EOJ A;  2DMI A;  3EPL A;  1AAY A;  2JPA A;  5KL3 A;  2A25 A;  2EMY A;  2EPA A;  1LLM C;  2EPC A;  3VHT B;  2YSP A;  2EMX A;  4F6M A;  2J7J A;  2EML A;  1A1I A;  2EOS A;  2EOY A;  2MKN A;  2WBT A;  2LVH A;  2EPX A;  2CSH A;  2HGH A;  1BBO A;  2YTO A;  2YRK A;  2YRH A;  2EOF A;  3EPJ A;  2EQ1 A;  2PRT A;  2MDG A;  1G2D C;  2I13 A;  4F6N A;  2ENH A;  2EQ3 A;  2RPC A;  2YTP A;  1A1F A;  1NCS A;  1X6E A;  2LV2 A;  2EMF A;  2EL6 A;  2EOH A;  4WSG A;  2EM4 A;  1TN9 A;  2YTG A;  3UK3 C;  1TF6 A;  3M99 B;  2EOO A;  2GHF A;  2YU5 A;  1A1G A;  2YSO A;  1MEY C;  1DGC A;  2CT1 A;  2EMG A;  2YRM A;  2EPZ A;  4R2R A;  1WJP A;  2DLK A;  2GLI A;  1X6H A;  4R2P A;  2EL4 A;  2EOM A;  3MHS C;  1KJK A;  1X3C A;  1ZAA C;  4X9J A;  2EMI A;  2EMW A;  2VRD A;  3MHH C;  2YU8 A;  2EOQ A;  2MKD A;  1UBD C;  2EOZ A;  2YTI A;  1Z1B A;  2EE8 A;  2EM9 A;  4M9V C;  2EPU A;  1BB8 A;  4F2J C;  2WBS A;  1ZR9 A;  2LO3 A;  1X6F A;  2EN6 A;  5KL2 A;  2EPR A;  2EPP A;  2YTJ A;  2YTE A;  2EQ0 A;  2E72 A;  1P47 A;  1A1L A;  2EP3 A;  1YUJ A;  2EMC A;  4R2S A;  4FK5 C;  2EN7 A;  2DRP A;  2EMB A;  2BB8 A;  2EM3 A;  2RSI A;  2DGC A;  2EM2 A;  1G2F C;  1TF3 A;  2ELY A;  2EN3 A;  2WBU A;  5KL5 A;  1B69 A;  2ADR A;  1A1H A;  4IJD A;  1ZU1 A;  2ENC A;  4R2C A;  2EMH A;  4R2E A;  2EM5 A;  1F2I G;  2EOI A;  1A1K A;  2LCE A;  4R2A A;  2CTD A;  2YTF A;  2DLQ A;  4R2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...