1F2IG

Cocrystal structure of selected zinc finger dimer bound to dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
b'NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*TP*GP*GP*GP*CP*GP*CP*GP*CP*CP*CP*AP*T)-3'
publication title Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 17
structure length 66
sequence length 66
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2000-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1f2iG01
2BB8A 3VHTB 2A25A 3M99B 3UK3C 4R2QA 2EMXA 2EN4A 2EQ3A 2EL4A 5KL2A 2LO3A 2EE8A 2J7JA 1A1GA 2EOOA 2EMGA 2EL5A 2EN1A 2R1FA 2EOMA 1A1JA 4F6MA 2YSPA 5KL5A 2EMAA 4R2DA 1X3CA 2MKDA 2EOIA 2YTIA 2MDGA 2YTFA 2EM8A 2LCEA 1A1IA 2JPAA 2EN8A 2EM2A 2EM7A 2CTDA 1X6HA 2I13A 1LLMC 2EOJA 2ELYA 2EL6A 1DGCA 1A1KA 2EM9A 1NCSA 2EMKA 1MEYC 1JK2A 2EOFA 2YU8A 2EOSA 2EOXA 5KL7A 1TF3A 2YTJA 1A1HA 2JP9A 3EPHA 2RSIA 4GZNC 1ZU1A 2EMWA 2EORA 5KL6A 2YTNA 1YSAC 2EN3A 2ENCA 2EPPA 1TN9A 2WCC3 4IS1C 4R2PA 2EN7A 1TF6A 2LVHA 2WBSA 1G2DC 2LV2A 2GLIA 2EM5A 4R2RA 2EM4A 2EOYA 2EMFA 2EPUA 4WSGA 4F6NA 2M9AA 2EP3A 2EMYA 2RPCA 1F2IG 2EOEA 2EPZA 2EMHA 4R2EA 1ZR9A 1X6FA 2EJ4A 2YRKA 2CT1A 4F2JC 2NABA 2CSHA 2ENHA 2YRHA 4IJDA 2ADRA 3MHHC 1RMDA 5KL4A 2PRTA 4M9VC 2EM3A 1A1FA 2LT7A 1UN6B 2YTPA 4R2CA 3MHSC 2DLQA 2YTGA 2YTOA 2EMLA 5KL3A 1P47A 1YUJA 2MKNA 2WBTA 2DMIA 2DGCA 1KJKA 3EPKA 3EPLA 2EMBA 2ELZA 1BB8A 2D9HA 2EMCA 2EPRA 2YTEA 2YTQA 2YU5A 1UBDC 1BBOA 2EQ0A 2EN6A 2VRDA 1WJPA 2EMZA 4FK5C 2EMIA 1X6EA 2EPXA 2EPCA 1B69A 2YTDA 4R2AA 2EOHA 2GHFA 2DLKA 2EN2A 3EPJA 1JK1A 2DRPA 2WBUA 2EM0A 1Z1BA 4R2SA 2YSOA 2E72A 2EOZA 1AAYA 1G2FC 2EPAA 2ENAA 2HGHA 1ZAAC 1X5WA 4X9JA 1A1LA 1YUIA 2EM6A 2EQ1A 2EOQA 2YRMA
chains in the Genus database with same CATH superfamily
2BB8A 4MLQA 4ZYHA 3M99B 3THOB 1I94E 2EMXA 4WXCA 3BBGA 2FTXB 4AQYE 4M30A 3KWRA 3C6KA 4WPYA 2IHR1 2B9DA 3ZOQB 2J7JA 2UU9E 1SR9A 1HNXE 1XNQE 2EOMA 5LLQA 3HPSA 3JTZA 4F6MA 2YSPA 4P7DA 5KL5A 1HR0E 4M2ZA 1X3CA 2MKDA 1YYWA 2MDGA 2YTFA 2JPAA 2EM2A 2EPOA 2CTDA 2I13A 4DV4E 2K4VA 1WRJA 2ELYA 2EL6A 4X8WA 4KHPE 1MEYC 3HTXA 2E5LE 2EOXA 4LF7E 2JP9A 4TUGA 2N8XA 2EMWA 5KL6A 4DUYE 1YSAC 5IXMB 2ENCA 2LUPB 1KYQA 4WXDA 1HNZE 2JOXA 4R2PA 1G2DC 2EM5A 2EM4A 2EMFA 2YWQA 2V8QB 1X49A 4N4RB 1T4LB 4WSGA 2UUBE 4F6NA 2EZ6A 3K6QA 2L92A 4RH8A 5LL6R 2UUAE 1ZR9A 2HJJA 4JI0E 2L8TA 3VK6A 4WYQB 1YYKA 3ADLA 5KL4A 2VQEE 2UXBE 3C4TA 3THNA 3MHSC 4DV7E 2YTOA 4BCAA 4JI2E 2WBTA 2DMIA 3EPKA 2MDRA 3J81C 3C6MA 5T6JA 1XNRE 4LTYA 5TSEA 1T38A 4DR4E 2YU5A 2I9IA 3RMPA 1UBDC 4FK5C 1X6EA 3BIDA 2KHXA 2L2MA 2V86A 2DRPA 2FGGA 4B3TE 5CFFE 2DB2A 2UUCE 2M7QA 2JYAA 4X9JA 5AE3A 4DR2E 2EM6A 4BBYA 4BC9A 1O0WA 5A6JA 1STUA 2V88A 1IBLE 1XMOE 4OOGC 2LJUA 2V85A 4I8OA 2LJHA 4F9AB 5DNYA 4HEIA 2L3CA 1YZ9A 4BHBA 5KL2A 1A1GA 5LMNE 2R1FA 1A1JA 4DUZE 5A6AA 1ZBTA 3C4BA 3J7AG 4DV6E 4LF9E 2M1SA 3ADJA 4JI4E 2EM8A 3IWDA 4GEQB 2EN8A 2B7TA 4NXNE 4R8OA 1LLMC 3T1YE 1YPNA 2ZM6E 5AE2A 1JK2A 2YU8A 4X66E 3QG5C 3JAMC 2JXPA 4Q35B 1DQ3A 2N3GA 2ODRD 4JI7E 3HPZA 1UILA 2WCC3 1TF6A 2EN7A 2WBSA 2LTRA 2EPNA 1X47A 4JV5E 2R76A 2RTXA 5BR8E 4RHBB 2RPCA 4B3RE 1F2IG 2EOEA 4M0VA 2B3TB 4KWYA 2EJ4A 4F2JC 2CSHA 2YRHA 4IJDA 2PRTA 2EM3A 2HC5A 1N32E 1A1FA 2VQFE 2LT7A 4R2CA 5AE1A 2CPNA 4JI3E 2LUQA 4OX9E 2EMLA 5KL3A 1GZ6A 4WFTA 1HNWE 3BF2A 4WX9A 4DV3E 1T4OA 3EPLA 2ELZA 1EH7A 1J26A 2YTQA 3AV0A 3LMLA 4YHHE 2UXCE 1WJPA 3H09A 1ZBQA 2EMZA 2EMIA 2EPCA 1FKAE 2L3JA 4R2AA 2RS7A 2BBGA 2JR1A 1Z1BA 4R2SA 2YSOA 2V83A 2ENAA 3ADIA 2HGHA 1PJTA 2N3HA 4YY3E 4GKJE 1WHQA 1A1LA 2EWLA 2EOQA 4R2QA 4ZYGA 3VHTB 2KOUA 3OTOE 1EH6A 4JI6E 2LBSB 2NUEA 4O43A 2EQ3A 1T39A 1N33E 2LO3A 1AH5A 4MLVA 2EOOA 3P1XA 1N3GA 4DR3E 1N34E 3F6GA 2VE7C 1J5EE 4R2DA 1IBME 4LF8E 2YTIA 5LMUE 4LFCE 4JI1E 1NEIA 2EM7A 4DV1E 2EOJA 4DR7E 3VYXA 1DGCA 1A1KA 2EM9A 1NCSA 3KZZA 4DKKA 1N36E 1QU6A 2EOSA 2YPNA 3DF6A 4R03A 2YTJA 3EPHA 4GZNC 4O4KA 2L2NA 2DIXA 2YTNA 4LF4E 2RSMA 3JU0A 2H36X 4IS1C 4F9BB 2LVHA 5A2QC 4DV5E 4R2RA 2LRSA 2K7IA 2DMYA 2EOYA 5A6BA 4F54A 5IWAE 1GQEA 4NXME 5IV8B 2V89A 2EP3A 2WZOA 4JI5E 3J7Yp 2GPIA 4R2EA 1WXRA 1XMQE 1QNTA 2CT1A 2NABA 1EKZA 1RMDA 1X48A 4M9VC 2G7HA 2HHHE 4LF5E 2NUGA 2YTPA 4X62E 2FV4B 4X65E 2NA2A 1P47A 1YUJA 2L2KB 4GKKE 2DGCA 2EPLX 3DJWA 2EPKX 4LU9A 1MGTA 4KZSA 1BBOA 4K0KE 2LTSA 2EN6A 2VRDA 1WHNA 3EQ1A 2Q8UA 4X64E 1UHZA 4O5GA 2YTDA 4NZVA 2EOHA 5AASA 1FJGE 2DLKA 2EN2A 1JK1A 4DMIA 2LE2A 1T4NA 4NHRA 3BGHA 2E72A 1AAYA 1RC7A 1GTKA 3ECRA 3HQ1A 3L00A 4WSPA 1X5WA 1YUIA 2UXDE 2A25A 1YYOA 1PDAA 3UK3C 2V87A 2EN4A 4JYAE 2EL4A 2LMZA 2M4IA 4ZYDA 1RQ0A 2EE8A 5IT9C 2EMGA 2EL5A 2EN1A 2L33A 5F3WA 2JY9A 1PKPA 2EMAA 4BHCA 1IBKE 1BBGA 3AUZA 4BS9A 5A6BD 4DR5E 2EOIA 3MSWA 1A1IA 2LCEA 2L6MA 2YT4A 4L8NA 1X6HA 2DSYA 1SFEA 4LF6E 1L4SA 2EMKA 5ADZA 1DI2A 2EOFA 2ODRC 5KL7A 1TF3A 1A1HA 2RSIA 1ZU1A 2EORA 4BC7A 4LFBE 2EN3A 1TN9A 2EPPA 1IQOA 5A6KA 2JVAA 2RQLA 2JOBA 2F8BA 2LV2A 2YZTA 3ADGA 4F9CB 4Q28A 4JI8E 2GLIA 1EH8A 4DV2E 4J8ZA 2EPUA 2M9AA 3IWBA 2EMYA 2B7VA 3LLHA 2NUFA 2RS6A 4DR1E 2JWOA 1PJSA 2EPZA 2EMHA 1X6FA 3HXLA 2YRKA 4TUIA 3J80C 2ENHA 2E1MA 2ADRA 3MHHC 4ZYEA 4P78A 3T1HE 3FIGA 1UN6B 4DV0E 2DLQA 4B3SE 2YTGA 5FLXC 3TQMA 1YFHA 2MKNA 2MC5A 4O24A 1KJKA 2EMBA 1IMUA 1BB8A 2D9HA 2EMCA 4L5NC 2EPRA 2YTEA 2MC6A 4B3ME 5A69A 2EQ0A 4HTGA 2EPXA 2VF1A 2EPMX 4DR6E 3OMLA 1B69A 3VYYA 4LFAE 4BMJA 2GHFA 3EPJA 5AC4A 2KONA 2WBUA 1IQSA 2EM0A 2EOZA 2F4VE 1G2FC 2EPAA 3IWCA 1PJQA 1ZAAC 5AC5A 3F6HA 2EQ1A 2YRMA 3KZYA
chains in the Genus database with same CATH topology
2BB8A 3VHTB 2A25A 3M99B 3UK3C 4R2QA 2EMXA 2EN4A 2EQ3A 2EL4A 5KL2A 2LO3A 2EE8A 2J7JA 1A1GA 2EOOA 2EMGA 2EL5A 2EN1A 2R1FA 2EOMA 1A1JA 4F6MA 2YSPA 5KL5A 2EMAA 4R2DA 1X3CA 2MKDA 2EOIA 2YTIA 2MDGA 2YTFA 2EM8A 2LCEA 1A1IA 2JPAA 2EN8A 2EM2A 2EM7A 2CTDA 1X6HA 2I13A 1LLMC 2EOJA 2ELYA 2EL6A 1DGCA 1A1KA 2EM9A 1NCSA 2EMKA 1MEYC 1JK2A 2EOFA 2YU8A 2EOSA 2EOXA 5KL7A 1TF3A 2YTJA 1A1HA 2JP9A 3EPHA 2RSIA 4GZNC 1ZU1A 2EMWA 2EORA 5KL6A 2YTNA 1YSAC 2EN3A 2ENCA 2EPPA 1TN9A 2WCC3 4IS1C 4R2PA 2EN7A 1TF6A 2LVHA 2WBSA 1G2DC 2LV2A 2GLIA 2EM5A 4R2RA 2EM4A 2EOYA 2EMFA 2EPUA 4WSGA 4F6NA 2M9AA 2EP3A 2EMYA 2RPCA 1F2IG 2EOEA 2EPZA 2EMHA 4R2EA 1ZR9A 1X6FA 2EJ4A 2YRKA 2CT1A 4F2JC 2NABA 2CSHA 2ENHA 2YRHA 4IJDA 2ADRA 3MHHC 1RMDA 5KL4A 2PRTA 4M9VC 2EM3A 1A1FA 2LT7A 1UN6B 2YTPA 4R2CA 3MHSC 2DLQA 2YTGA 2YTOA 2EMLA 5KL3A 1P47A 1YUJA 2MKNA 2WBTA 2DMIA 2DGCA 1KJKA 3EPKA 3EPLA 2EMBA 2ELZA 1BB8A 2D9HA 2EMCA 2EPRA 2YTEA 2YTQA 2YU5A 1UBDC 1BBOA 2EQ0A 2EN6A 2VRDA 1WJPA 2EMZA 4FK5C 2EMIA 1X6EA 2EPXA 2EPCA 1B69A 2YTDA 4R2AA 2EOHA 2GHFA 2DLKA 2EN2A 3EPJA 1JK1A 2DRPA 2WBUA 2EM0A 1Z1BA 4R2SA 2YSOA 2E72A 2EOZA 1AAYA 1G2FC 2EPAA 2ENAA 2HGHA 1ZAAC 1X5WA 4X9JA 1A1LA 1YUIA 2EM6A 2EQ1A 2EOQA 2YRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BB8 A;  3VHT B;  2A25 A;  3M99 B;  3UK3 C;  4R2Q A;  2EMX A;  2EN4 A;  2EQ3 A;  2EL4 A;  5KL2 A;  2LO3 A;  2EE8 A;  2J7J A;  1A1G A;  2EOO A;  2EMG A;  2EL5 A;  2EN1 A;  2R1F A;  2EOM A;  1A1J A;  4F6M A;  2YSP A;  5KL5 A;  2EMA A;  4R2D A;  1X3C A;  2MKD A;  2EOI A;  2YTI A;  2MDG A;  2YTF A;  2EM8 A;  2LCE A;  1A1I A;  2JPA A;  2EN8 A;  2EM2 A;  2EM7 A;  2CTD A;  1X6H A;  2I13 A;  1LLM C;  2EOJ A;  2ELY A;  2EL6 A;  1DGC A;  1A1K A;  2EM9 A;  1NCS A;  2EMK A;  1MEY C;  1JK2 A;  2EOF A;  2YU8 A;  2EOS A;  2EOX A;  5KL7 A;  1TF3 A;  2YTJ A;  1A1H A;  2JP9 A;  3EPH A;  2RSI A;  4GZN C;  1ZU1 A;  2EMW A;  2EOR A;  5KL6 A;  2YTN A;  1YSA C;  2EN3 A;  2ENC A;  2EPP A;  1TN9 A;  2WCC 3;  4IS1 C;  4R2P A;  2EN7 A;  1TF6 A;  2LVH A;  2WBS A;  1G2D C;  2LV2 A;  2GLI A;  2EM5 A;  4R2R A;  2EM4 A;  2EOY A;  2EMF A;  2EPU A;  4WSG A;  4F6N A;  2M9A A;  2EP3 A;  2EMY A;  2RPC A;  1F2I G;  2EOE A;  2EPZ A;  2EMH A;  4R2E A;  1ZR9 A;  1X6F A;  2EJ4 A;  2YRK A;  2CT1 A;  4F2J C;  2NAB A;  2CSH A;  2ENH A;  2YRH A;  4IJD A;  2ADR A;  3MHH C;  1RMD A;  5KL4 A;  2PRT A;  4M9V C;  2EM3 A;  1A1F A;  2LT7 A;  1UN6 B;  2YTP A;  4R2C A;  3MHS C;  2DLQ A;  2YTG A;  2YTO A;  2EML A;  5KL3 A;  1P47 A;  1YUJ A;  2MKN A;  2WBT A;  2DMI A;  2DGC A;  1KJK A;  3EPK A;  3EPL A;  2EMB A;  2ELZ A;  1BB8 A;  2D9H A;  2EMC A;  2EPR A;  2YTE A;  2YTQ A;  2YU5 A;  1UBD C;  1BBO A;  2EQ0 A;  2EN6 A;  2VRD A;  1WJP A;  2EMZ A;  4FK5 C;  2EMI A;  1X6E A;  2EPX A;  2EPC A;  1B69 A;  2YTD A;  4R2A A;  2EOH A;  2GHF A;  2DLK A;  2EN2 A;  3EPJ A;  1JK1 A;  2DRP A;  2WBU A;  2EM0 A;  1Z1B A;  4R2S A;  2YSO A;  2E72 A;  2EOZ A;  1AAY A;  1G2F C;  2EPA A;  2ENA A;  2HGH A;  1ZAA C;  1X5W A;  4X9J A;  1A1L A;  1YUI A;  2EM6 A;  2EQ1 A;  2EOQ A;  2YRM A; 
#chains in the Genus database with same CATH topology
 2BB8 A;  4MLQ A;  4ZYH A;  3M99 B;  3THO B;  1I94 E;  2EMX A;  4WXC A;  3BBG A;  2FTX B;  4AQY E;  4M30 A;  3KWR A;  3C6K A;  4WPY A;  2IHR 1;  2B9D A;  3ZOQ B;  2J7J A;  2UU9 E;  1SR9 A;  1HNX E;  1XNQ E;  2EOM A;  5LLQ A;  3HPS A;  3JTZ A;  4F6M A;  2YSP A;  4P7D A;  5KL5 A;  1HR0 E;  4M2Z A;  1X3C A;  2MKD A;  1YYW A;  2MDG A;  2YTF A;  2JPA A;  2EM2 A;  2EPO A;  2CTD A;  2I13 A;  4DV4 E;  2K4V A;  1WRJ A;  2ELY A;  2EL6 A;  4X8W A;  4KHP E;  1MEY C;  3HTX A;  2E5L E;  2EOX A;  4LF7 E;  2JP9 A;  4TUG A;  2N8X A;  2EMW A;  5KL6 A;  4DUY E;  1YSA C;  5IXM B;  2ENC A;  2LUP B;  1KYQ A;  4WXD A;  1HNZ E;  2JOX A;  4R2P A;  1G2D C;  2EM5 A;  2EM4 A;  2EMF A;  2YWQ A;  2V8Q B;  1X49 A;  4N4R B;  1T4L B;  4WSG A;  2UUB E;  4F6N A;  2EZ6 A;  3K6Q A;  2L92 A;  4RH8 A;  5LL6 R;  2UUA E;  1ZR9 A;  2HJJ A;  4JI0 E;  2L8T A;  3VK6 A;  4WYQ B;  1YYK A;  3ADL A;  5KL4 A;  2VQE E;  2UXB E;  3C4T A;  3THN A;  3MHS C;  4DV7 E;  2YTO A;  4BCA A;  4JI2 E;  2WBT A;  2DMI A;  3EPK A;  2MDR A;  3J81 C;  3C6M A;  5T6J A;  1XNR E;  4LTY A;  5TSE A;  1T38 A;  4DR4 E;  2YU5 A;  2I9I A;  3RMP A;  1UBD C;  4FK5 C;  1X6E A;  3BID A;  2KHX A;  2L2M A;  2V86 A;  2DRP A;  2FGG A;  4B3T E;  5CFF E;  2DB2 A;  2UUC E;  2M7Q A;  2JYA A;  4X9J A;  5AE3 A;  4DR2 E;  2EM6 A;  4BBY A;  4BC9 A;  1O0W A;  5A6J A;  1STU A;  2V88 A;  1IBL E;  1XMO E;  4OOG C;  2LJU A;  2V85 A;  4I8O A;  2LJH A;  4F9A B;  5DNY A;  4HEI A;  2L3C A;  1YZ9 A;  4BHB A;  5KL2 A;  1A1G A;  5LMN E;  2R1F A;  1A1J A;  4DUZ E;  5A6A A;  1ZBT A;  3C4B A;  3J7A G;  4DV6 E;  4LF9 E;  2M1S A;  3ADJ A;  4JI4 E;  2EM8 A;  3IWD A;  4GEQ B;  2EN8 A;  2B7T A;  4NXN E;  4R8O A;  1LLM C;  3T1Y E;  1YPN A;  2ZM6 E;  5AE2 A;  1JK2 A;  2YU8 A;  4X66 E;  3QG5 C;  3JAM C;  2JXP A;  4Q35 B;  1DQ3 A;  2N3G A;  2ODR D;  4JI7 E;  3HPZ A;  1UIL A;  2WCC 3;  1TF6 A;  2EN7 A;  2WBS A;  2LTR A;  2EPN A;  1X47 A;  4JV5 E;  2R76 A;  2RTX A;  5BR8 E;  4RHB B;  2RPC A;  4B3R E;  1F2I G;  2EOE A;  4M0V A;  2B3T B;  4KWY A;  2EJ4 A;  4F2J C;  2CSH A;  2YRH A;  4IJD A;  2PRT A;  2EM3 A;  2HC5 A;  1N32 E;  1A1F A;  2VQF E;  2LT7 A;  4R2C A;  5AE1 A;  2CPN A;  4JI3 E;  2LUQ A;  4OX9 E;  2EML A;  5KL3 A;  1GZ6 A;  4WFT A;  1HNW E;  3BF2 A;  4WX9 A;  4DV3 E;  1T4O A;  3EPL A;  2ELZ A;  1EH7 A;  1J26 A;  2YTQ A;  3AV0 A;  3LML A;  4YHH E;  2UXC E;  1WJP A;  3H09 A;  1ZBQ A;  2EMZ A;  2EMI A;  2EPC A;  1FKA E;  2L3J A;  4R2A A;  2RS7 A;  2BBG A;  2JR1 A;  1Z1B A;  4R2S A;  2YSO A;  2V83 A;  2ENA A;  3ADI A;  2HGH A;  1PJT A;  2N3H A;  4YY3 E;  4GKJ E;  1WHQ A;  1A1L A;  2EWL A;  2EOQ A;  4R2Q A;  4ZYG A;  3VHT B;  2KOU A;  3OTO E;  1EH6 A;  4JI6 E;  2LBS B;  2NUE A;  4O43 A;  2EQ3 A;  1T39 A;  1N33 E;  2LO3 A;  1AH5 A;  4MLV A;  2EOO A;  3P1X A;  1N3G A;  4DR3 E;  1N34 E;  3F6G A;  2VE7 C;  1J5E E;  4R2D A;  1IBM E;  4LF8 E;  2YTI A;  5LMU E;  4LFC E;  4JI1 E;  1NEI A;  2EM7 A;  4DV1 E;  2EOJ A;  4DR7 E;  3VYX A;  1DGC A;  1A1K A;  2EM9 A;  1NCS A;  3KZZ A;  4DKK A;  1N36 E;  1QU6 A;  2EOS A;  2YPN A;  3DF6 A;  4R03 A;  2YTJ A;  3EPH A;  4GZN C;  4O4K A;  2L2N A;  2DIX A;  2YTN A;  4LF4 E;  2RSM A;  3JU0 A;  2H36 X;  4IS1 C;  4F9B B;  2LVH A;  5A2Q C;  4DV5 E;  4R2R A;  2LRS A;  2K7I A;  2DMY A;  2EOY A;  5A6B A;  4F54 A;  5IWA E;  1GQE A;  4NXM E;  5IV8 B;  2V89 A;  2EP3 A;  2WZO A;  4JI5 E;  3J7Y p;  2GPI A;  4R2E A;  1WXR A;  1XMQ E;  1QNT A;  2CT1 A;  2NAB A;  1EKZ A;  1RMD A;  1X48 A;  4M9V C;  2G7H A;  2HHH E;  4LF5 E;  2NUG A;  2YTP A;  4X62 E;  2FV4 B;  4X65 E;  2NA2 A;  1P47 A;  1YUJ A;  2L2K B;  4GKK E;  2DGC A;  2EPL X;  3DJW A;  2EPK X;  4LU9 A;  1MGT A;  4KZS A;  1BBO A;  4K0K E;  2LTS A;  2EN6 A;  2VRD A;  1WHN A;  3EQ1 A;  2Q8U A;  4X64 E;  1UHZ A;  4O5G A;  2YTD A;  4NZV A;  2EOH A;  5AAS A;  1FJG E;  2DLK A;  2EN2 A;  1JK1 A;  4DMI A;  2LE2 A;  1T4N A;  4NHR A;  3BGH A;  2E72 A;  1AAY A;  1RC7 A;  1GTK A;  3ECR A;  3HQ1 A;  3L00 A;  4WSP A;  1X5W A;  1YUI A;  2UXD E;  2A25 A;  1YYO A;  1PDA A;  3UK3 C;  2V87 A;  2EN4 A;  4JYA E;  2EL4 A;  2LMZ A;  2M4I A;  4ZYD A;  1RQ0 A;  2EE8 A;  5IT9 C;  2EMG A;  2EL5 A;  2EN1 A;  2L33 A;  5F3W A;  2JY9 A;  1PKP A;  2EMA A;  4BHC A;  1IBK E;  1BBG A;  3AUZ A;  4BS9 A;  5A6B D;  4DR5 E;  2EOI A;  3MSW A;  1A1I A;  2LCE A;  2L6M A;  2YT4 A;  4L8N A;  1X6H A;  2DSY A;  1SFE A;  4LF6 E;  1L4S A;  2EMK A;  5ADZ A;  1DI2 A;  2EOF A;  2ODR C;  5KL7 A;  1TF3 A;  1A1H A;  2RSI A;  1ZU1 A;  2EOR A;  4BC7 A;  4LFB E;  2EN3 A;  1TN9 A;  2EPP A;  1IQO A;  5A6K A;  2JVA A;  2RQL A;  2JOB A;  2F8B A;  2LV2 A;  2YZT A;  3ADG A;  4F9C B;  4Q28 A;  4JI8 E;  2GLI A;  1EH8 A;  4DV2 E;  4J8Z A;  2EPU A;  2M9A A;  3IWB A;  2EMY A;  2B7V A;  3LLH A;  2NUF A;  2RS6 A;  4DR1 E;  2JWO A;  1PJS A;  2EPZ A;  2EMH A;  1X6F A;  3HXL A;  2YRK A;  4TUI A;  3J80 C;  2ENH A;  2E1M A;  2ADR A;  3MHH C;  4ZYE A;  4P78 A;  3T1H E;  3FIG A;  1UN6 B;  4DV0 E;  2DLQ A;  4B3S E;  2YTG A;  5FLX C;  3TQM A;  1YFH A;  2MKN A;  2MC5 A;  4O24 A;  1KJK A;  2EMB A;  1IMU A;  1BB8 A;  2D9H A;  2EMC A;  4L5N C;  2EPR A;  2YTE A;  2MC6 A;  4B3M E;  5A69 A;  2EQ0 A;  4HTG A;  2EPX A;  2VF1 A;  2EPM X;  4DR6 E;  3OML A;  1B69 A;  3VYY A;  4LFA E;  4BMJ A;  2GHF A;  3EPJ A;  5AC4 A;  2KON A;  2WBU A;  1IQS A;  2EM0 A;  2EOZ A;  2F4V E;  1G2F C;  2EPA A;  3IWC A;  1PJQ A;  1ZAA C;  5AC5 A;  3F6H A;  2EQ1 A;  2YRM A;  3KZY A; 
#chains in the Genus database with same CATH homology
 2BB8 A;  3VHT B;  2A25 A;  3M99 B;  3UK3 C;  4R2Q A;  2EMX A;  2EN4 A;  2EQ3 A;  2EL4 A;  5KL2 A;  2LO3 A;  2EE8 A;  2J7J A;  1A1G A;  2EOO A;  2EMG A;  2EL5 A;  2EN1 A;  2R1F A;  2EOM A;  1A1J A;  4F6M A;  2YSP A;  5KL5 A;  2EMA A;  4R2D A;  1X3C A;  2MKD A;  2EOI A;  2YTI A;  2MDG A;  2YTF A;  2EM8 A;  2LCE A;  1A1I A;  2JPA A;  2EN8 A;  2EM2 A;  2EM7 A;  2CTD A;  1X6H A;  2I13 A;  1LLM C;  2EOJ A;  2ELY A;  2EL6 A;  1DGC A;  1A1K A;  2EM9 A;  1NCS A;  2EMK A;  1MEY C;  1JK2 A;  2EOF A;  2YU8 A;  2EOS A;  2EOX A;  5KL7 A;  1TF3 A;  2YTJ A;  1A1H A;  2JP9 A;  3EPH A;  2RSI A;  4GZN C;  1ZU1 A;  2EMW A;  2EOR A;  5KL6 A;  2YTN A;  1YSA C;  2EN3 A;  2ENC A;  2EPP A;  1TN9 A;  2WCC 3;  4IS1 C;  4R2P A;  2EN7 A;  1TF6 A;  2LVH A;  2WBS A;  1G2D C;  2LV2 A;  2GLI A;  2EM5 A;  4R2R A;  2EM4 A;  2EOY A;  2EMF A;  2EPU A;  4WSG A;  4F6N A;  2M9A A;  2EP3 A;  2EMY A;  2RPC A;  1F2I G;  2EOE A;  2EPZ A;  2EMH A;  4R2E A;  1ZR9 A;  1X6F A;  2EJ4 A;  2YRK A;  2CT1 A;  4F2J C;  2NAB A;  2CSH A;  2ENH A;  2YRH A;  4IJD A;  2ADR A;  3MHH C;  1RMD A;  5KL4 A;  2PRT A;  4M9V C;  2EM3 A;  1A1F A;  2LT7 A;  1UN6 B;  2YTP A;  4R2C A;  3MHS C;  2DLQ A;  2YTG A;  2YTO A;  2EML A;  5KL3 A;  1P47 A;  1YUJ A;  2MKN A;  2WBT A;  2DMI A;  2DGC A;  1KJK A;  3EPK A;  3EPL A;  2EMB A;  2ELZ A;  1BB8 A;  2D9H A;  2EMC A;  2EPR A;  2YTE A;  2YTQ A;  2YU5 A;  1UBD C;  1BBO A;  2EQ0 A;  2EN6 A;  2VRD A;  1WJP A;  2EMZ A;  4FK5 C;  2EMI A;  1X6E A;  2EPX A;  2EPC A;  1B69 A;  2YTD A;  4R2A A;  2EOH A;  2GHF A;  2DLK A;  2EN2 A;  3EPJ A;  1JK1 A;  2DRP A;  2WBU A;  2EM0 A;  1Z1B A;  4R2S A;  2YSO A;  2E72 A;  2EOZ A;  1AAY A;  1G2F C;  2EPA A;  2ENA A;  2HGH A;  1ZAA C;  1X5W A;  4X9J A;  1A1L A;  1YUI A;  2EM6 A;  2EQ1 A;  2EOQ A;  2YRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...