1F2JA

Crystal structure analysis of aldolase from t. brucei
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
357
structure length
357
Chain Sequence
SKRVEVLLTQLPAYNRLKTPYEAELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYRALMLECEGFEQYISGVILHDETVYQKAKTGETFPQYLRRRGVVPGIKTDCGLEPLVEGAKGEQMTAGLDGYIKRAKKYYAMGCRFCKWRNVYKIQNGTVSEAVVRFNAETLARYAILSQLCGLVPIVEPEVMIDGTHDIETCQRVSQHVWSEVVSALHRHGVVWEGCLLKPNMVVPGAESGLKGHAEQVAEYTVKTLARVIPPALPGVTFLSGGLSEVMASEYLNAMNNCPLPRPWKLTFSYARALQSSAIKRWGGKESGVEAGRRAFMHRAKMNSLAQLGKYNRADD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of type 2 peroxisomal targeting signals in two trypanosomatid aldolases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE, GLYCOSOMAL
total genus 145
structure length 357
sequence length 357
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2000-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f2jA00
1P5BA 3MHGA 3RMJA 3LI1A 3HG3A 3W7RA 1AL7A 4NJIA 2FB3A 3GKFA 2A7PA 2EKCA 3DH7A 5TIMA 1PV8A 1FCVA 3PM6A 3KRUA 3BVJA 4YCOA 1FCQA 2ISVA 2NXGA 1UCWA 2Y88A 3O63A 3NL2A 3BGGA 2YW3A 2JGQA 1H61A 1YPIA 3UYCA 1SW7A 3NQFA 3VI2A 3NQCA 5HMSA 3FFSA 4ICNA 1O4UA 1KM5A 1RQBA 3CIXA 4AVFA 3O8AA 3GR8A 3YPIA 2ZZ3A 2QDGA 2DZSA 5AN7A 1Q6RA 4LT9A 2B4GA 2EGZA 3LI0A 5DXYA 1MEWA 3HGSA 2YFNA 4EWND 3S0CA 4NJJA 2I9EA 1JQXA 1D3HA 4ALDA 3G1YA 3W76A 4O0ZA 4HN4A 1OFDA 4RXFA 3B0PA 1K7EA 2WSQA 3GX9A 4JTUA 1QPOA 1VYSX 5BOOA 1G67A 1NFBA 4QISA 1TPUA 3CQ0A 1ML1A 3P80A 3SW6A 2ZFAA 5D33A 3LOTA 4MZ1A 3HG4A 4AHQA 2Q8LA 2QUUA 3QYQA 4PODA 3HF3A 2X1TA 4BI7A 1A5SA 3IGSA 3UNDA 1NVMA 1OF8A 3QMTA 3W7DA 3UWVA 2H8XA 1OFBA 1W31A 1R2RA 2CLIA 2CLFA 3QRHA 2J9ZA 3HGRA 4QSHA 3RK8A 3W1UA 1O94A 3W87A 3W6YA 3P82A 2CLMA 2GOUA 4AHPA 3DHDA 1PVNA 4N2YA 1F76A 1R46A 1WQ5A 3KVKA 4JIQA 3SECA 3G22A 1F5ZA 5D02A 3NL6A 2C6QA 3BV4A 3WJYA 3C2VA 4MY9A 2J9YA 2Y63A 1ADOA 1ICQA 4DPQA 3DFQA 4UTLA 4UCGA 4FO4A 2V81A 1W5NA 3TKFA 3O06A 1JULA 3A24A 3CWNA 3B06A 3DAQA 1ZCOA 3N2MA 4WUIA 4AWTA 2A7RA 2I1OA 4FXSA 3W1QA 1JCMP 4JNMA 1X1ZA 4ADTA 3W2UA 5FEZA 1OABA 5LGXA 2FFCA 1VHCA 3DI0A 3NPVA 3W85A 3LLFA 4I7WA 3NYZA 4A2RA 4GXMA 4KFOA 4E0CA 5AFDA 1UUMA 3PAJA 3W1MA 3PF3A 1TV5A 3W73A 3BG9A 2E09A 3IIXA 4TO8A 5KSWA 1KLYA 2DZWA 1LDCA 4P2VA 5A5WA 3LXBA 2Q3RA 5C2XA 1KM0A 4X22A 3NQGA 4O18A 3PBWA 2G95A 1LBFA 3TNOA 3EB2A 1OK4A 3OVRA 3W9ZA 3MP4A 1H7XA 1LOLA 5F2GA 3CT7A 3MHUA 3ABOA 2NXHA 5H2ZA 1UB3A 4QQ3A 3FS2A 1LLZA 2YCEA 5A8GA 4HSOA 3G3DA 2CFFA 1QPNA 3M43A 4LC6A 1VJIA 3P62A 1H7NA 2ZZ7A 4OV9A 2V0TA 2GQAA 3TQ0A 2E68A 3L9CA 3LXCA 2B7QA 2A4AA 2HS6A 1AW1A 1QAPA 1OFRA 5EYWA 3NNTA 2Z0IA 3C2RA 4JDYA 4PCFA 2OX1A 3MP5A 4HKPA 2V82A 5AC6A 2GVLA 5SWUA 2H3DA 2ZA3A 3CHVA 4KFPA 4GJ1A 5K9DA 4O11A 1MEIA 5IBXA 2NX1A 3WK0A 1SO5A 3UWZA 1KBJA 3S8HA 3LCHA 4LV9A 5HULA 2ISSA 3W07A 2Z6JA 2QJHA 3S1UA 3KVJA 3LTPA 5L6UA 2PRMA 4JTHA 1T8XA 1GG1A 4WZHA 1TQJA 3QSRA 4CQAA 1FXQA 4NNBA 4JTTA 4BI5A 3BG3A 5TQLA 5LZLA 1VCFA 2UV8G 2GVJA 2QAFA 1YXDA 2EF9A 2YYTA 2WSYA 4DBDA 4NNCA 1KFBA 4O1BA 3VKJA 4AF0A 5D09A 3I7QA 2LLEA 3OVPA 1ZAJA 3PG8A 5HJLA 2BXVA 4IOTA 4WXYA 3MHFA 3R89A 4NQ1A 4Y6GA 4HNNA 2GUUA 2V9DA 6ALDA 5I3HA 1J4EA 4Z1CA 3TQKA 1GJPA 2ZRYA 2QCDB 3W7EA 1PHWA 5T26A 2DZXA 2RDWA 5IBXC 3PWAA 3TA6A 3EX1A 4N9EA 4NZJA 3N19B 3QEZA 5ABTA 3W2NA 1OG0A 1RQEA 3W1TA 1K02A 4FX8A 4IMEA 3BLIA 1XI3A 1MO0A 1SUXA 3DFOA 3LCWA 3W7PA 4OU1A 1M7PA 3W1XA 4N4PA 4AEOA 4UTMA 1OJXA 1SPQA 3CPRA 4GFSA 2C16A 1XCFA 5AHFA 5FEPA 4FXRA 4JDBA 4XUGA 3I65A 2WV8A 4N9BA 1EWEA 4M5PA 5AHMA 4QAIA 1G4TA 3W22A 4M6VA 5FF7A 3S1WA 4I7VA 1GWJA 2BZNA 3I7SA 1TV8A 1TPC1 1YTKA 1E51A 3PB0A 4A29A 2C19A 3LHWA 3KRZA 1PCKA 4FNTA 5FF0A 1XL9A 3LHYA 1FWRA 4BR1A 5AOUA 3H53A 3TH6A 4JYEA 3QJAA 3Q2DA 2EPHA 4DO6A 1ICSA 2W0UA 3I6RA 3HB9A 1ZNNA 3BO9A 2VEKA 4FNSA 4ML9A 3TIMA 3E9AA 1VHNA 4MY8A 3KHJA 3LM7A 1LM1A 3GDRA 4XWUA 2QUTA 1SZGA 3VCRA 1BTMA 4I9AA 1I8JA 3LB0A 3SSJA 3UWYA 2F7FA 3GDMA 2IQTA 2Y6ZA 4N9DA 1GOXA 4ZL1A 1GVRA 1I2PA 1FUYA 1AK5A 4IUOA 2VEPA 4LVGA 2F84A 5BMXA 3U8GA 1DOSA 3EWZA 4Q33A 4Z08A 3N2XA 4J9JA 4TMCA 5D04C 8TIMA 4RZ6A 4KKXA 3TSMA 3HOJA 2ZRZA 3C8FA 1ZJIA 3B0VC 3F4WA 1JRBA 5KTLA 4O28A 1LP6A 3VNDA 5E93A 1NF0A 1U83A 5FESA 2JGYA 3NA8A 1ALDA 4YL2A 2NZLA 5G5IA 1CI1A 2GQ9A 5K4ZA 2J6XA 1IIGA 5K7JA 5FI8A 3HPXA 5CG7A 3DU0A 4MZ8A 3KXQA 3E49A 2GJNA 1W54A 2WQPA 3PY2A 3HBLA 3PG9A 3NM1A 1GVQA 3IIPA 3NOEA 4Z0JA 1YYAA 1IXNA 4O15A 4R7JA 1RQHA 1ZENA 1G7UA 3W7MA 3W7IA 1VCVA 4CCEA 3ANYA 1CW2A 1B4EA 1LBLA 3L68A 1G69A 4Z1DA 5KITA 1OYBA 1AMKA 2YYUA 3N14A 2E1DA 2PCQA 1UASA 3G1XA 4LU0A 3NAVA 1SO4A 1T96A 4QM1A 3QF0A 3PUOA 1EIXA 3LXAA 3NPUA 2QKFA 3MI6A 2E5DA 1DL3A 3TW6A 4LUJA 4FX7A 2DZTA 5HINA 4ORIA 1Q45A 1RVGA 2C0AA 2DZUA 4WQ6A 1F6PA 1EEPA 1QFEA 3G8RA 2XFWA 2FPVA 4O13A 3MI3A 2E6DA 1N7KA 1ZAHA 1KW1A 1TJRA 1TTQA 3A21A 3C4UA 4WY0A 2CLHA 3PUEA 3ZR4A 4OE7A 4UMBA 2YR1A 3W71A 5BMWA 2ZTKA 3OBKA 2V30A 2E6YA 3FA5A 4MFDA 4R34A 3UWUA 3WK3A 1O60A 4LY8A 3K30A 3AO0A 4UC5A 1KBIA 4K39A 4R53A 1MXSA 1LBMA 2YDAA 3W2JA 3E0IA 4UFKA 4OQVA 1VLWA 5CPMA 3WJXA 4UTWC 2G5WA 4FX6M 4ZQOA 3GDKA 3NXFA 3TSBA 3Q58A 3W84A 1O5XA 1YXYA 4IMGA 1UJPA 1IF2A 3NQEA 2NV2A 1KTNA 6TIMA 1K7XA 1RR2A 3R13A 1TPDA 1J2WA 2C18A 1QDSA 2J27A 3EX2A 1G6CA 2NX9A 3QPZA 1LRTA 3FEMA 5LGZA 3W7QA 1LOQA 4WOQA 3IVTA 2QCHA 3DZ1A 1ME7A 1V5XA 3T7VA 5F1UA 5G1TA 4JD4A 2RDTA 3T40A 3MYOA 3DGRA 1W3IA 3O05A 2VFEA 5DBTA 3TV8A 4FNRA 1OYCA 3KOFA 4MJZA 4LS0A 2OT0A 3LBCA 3ABSA 5AC8A 4UFLA 1L9WA 5FEWA 3THAA 2G96A 2QCMA 1IGSA 1Q6QA 1RZMA 3G8EA 1TPB1 1P1XA 2DP3A 4LRSA 4M7SA 3FLUA 3GR7A 3PBYA 1HUVA 3M1ZA 4LS1A 4K8EA 3EWBX 3W1RA 3O6DA 1VC4A 3LDVA 3G3MA 2NLIA 2ZRVA 4QIUA 3STEA 3TXZA 1KFEA 3ATZA 3G18A 3MWAA 1TYGA 3NM3A 1V7YA 2VKZG 3BARA 2BWGA 4TMBA 4PL1A 1F6KA 1HO4A 3QM3A 1C8VA 2J88A 3CM4A 2X1UA 1TTIA 3NPXA 1VRDA 4P61A 1DQWA 3M5VA 3IIZA 2GJLA 3NQAA 2V5BA 4K38A 3T4CA 1H1ZA 1RD5A 2QCEA 1FWSA 1EUNA 3GB6A 2RDUA 1WXJA 3OG3A 1YTEA 2Y85A 1ICPA 5FF3A 4ZZ9A 1PCWA 4Z1AA 3VFLA 1DKWA 2QCCA 1O5KA 5TBOA 3TJLA 3CU2A 3NR0A 1FBAA 3TDFA 2A21A 3QQ0A 3QMSA 1M7OA 5F2LA 2Y7DA 3EX3A 4YWIA 2PE4A 4MY1A 4W9TA 4MYAA 3H55A 1OYAA 1I2OA 1JQVA 1P0KA 1IXOA 3S5ZA 3DFTA 5FF2A 4O53A 2Q3OA 1TSIA 3LCGA 4JR5A 1F73A 3LHTA 3M0ZA 4GUFA 2ALDA 4IMCA 4NVTA 1EP1A 2O7SA 3HJZA 3GVGA 1KFKA 2JKPA 1WBHA 5K3VA 5E1QA 3P67A 4OGZA 3DENA 1MZHA 3BW3A 5AC7A 3M5YA 3NL5A 4OT7A 3P74A 3NZRA 5FF4A 5EMUA 5CZTA 1KM6A 1GVSA 3W1NA 1JCJA 5I3GA 3S5OA 1YDVA 1I2NA 5C6MA 2BSLA 4X3ZA 3WK2A 4HPXA 3UY7A 1F2JA 3CC1A 4XKYA 2HMCA 4K37A 3TXVA 1OHLA 3FIGA 4UTIA 4WY0F 3TJXA 4AHOA 1I2RA 4H4IA 1SO3A 2DU2A 2QCNA 2QDHA 3IV3A 4PFMA 1LOSA 2FPTA 1HFBA 2G97A 1KM4A 1KM1A 3O6CA 1ZHAA 1TPFA 3Q94A 1B3OA 3PVFA 2QCGA 1XBYA 3M16A 4DF1A 3LX9A 2CLKA 3C3NA 1W5PA 1RV8A 1A50A 1W8SA 4A22A 1KV5A 2A5HA 3LHZA 3EWWA 1FQ0A 1GG0A 1VYPX 2A85A 1VZWA 3W7JA 5LSMA 4DXVA 4O1DA 4CLMA 3L2IA 1KFLA 2X16A 3W7OA 4HHPA 4XTDA 4RCXA 1DJNA 2Z6IA 1GVFA 3L5AA 2ZDRA 5CZSA 4H6KA 1KTBA 3G1DA 4JTEA 5CPOA 3S1XA 4BWLA 3W2LA 3IIOA 4MLJA 3I68A 2ZRWA 2JKAA 1DJQA 3MO7A 1WOAA 1W5QA 5K9XA 1FWTA 2DZPA 1VPXA 1FDYA 2P10A 3DFSA 3HG5A 3W70A 3JR2A 1XFBA 4WY0B 1W3TA 3BW2A 5KZEA 1H7WA 4JY8A 4FHAA 4LVBA 1K3UA 3IGUA 1D9EA 4FB7A 4UTHA 1WBJA 4O4WA 5L9FA 3GIYA 5G4EA 3TC6A 3SIZA 4DELA 4YLWA 3UD6A 1F05A 3GAYA 1OX5A 3B8DA 2X1RA 1H50A 1PS9A 3RLUA 1W0MA 1K7FA 1H5YA 5AHLA 2Z1BA 3U6WA 5GVJA 1W1ZA 2JBMA 3GDLA 4FF7A 5D05A 4O54A 3JS3A 3QSTA 3SI9A 3MYPA 2J9XA 3THQA 2D73A 3F03K 3W7CA 2ABBA 3L5LA 1SR9A 4DF2A 1KFJA 5LNRA 1GZGA 3P84A 1ZFJA 4UTWA 2OT1A 4UMAA 5LHFA 3N9RA 3QW4B 4GRSA 5DCDA 3BGJA 2WOQA 1ME9A 2V2CA 4IPIA 4ADUA 4LTSA 4Y8FA 3M41A 5AYXA 3SZ8A 1BWLA 1ME8A 4BI6A 5IM51 1W5OA 2CLOA 1TPH1 3DFPA 3RFAA 1H7RA 1KM3A 2RHGA 4HT3A 5D30A 1QWGA 3ZWSA 1K03A 2CWNA 1P0NA 3PSWA 3HG2A 3KFTA 4N9CA 3M5ZA 3Q37A 3L0NA 3HPZA 1LORA 4UFMA 3STGA 4WXZA 3NO5A 4IXXA 3TX9A 3HQ1A 2NUYA 3DI1A 2Y89A 1S5WA 4Z0SA 2A1YA 2J24A 3R12A 1R30A 5E0KA 2R94A 1LYXA 4LVDA 4HPJA 2Y62A 1Q6LA 2B7OA 3MBDA 4RJEA 3T78A 3W1AA 1XM3A 3G0SA 4NX5A 3MMTA 3NG3A 1A5CA 2ZQ0A 2H8ZA 3MBFA 1NEYA 5I3FA 1GEQA 1N8FA 3LRKA 5BW6A 1FY6A 3G24A 4JTGA 1MEHA 1O95A 1K8ZA 3NDOA 2YPIA 1I4NA 1VR6A 3CB8A 3GDTA 4IX0A 3O15A 3PUDA 5J5RA 2CLEA 2X2GA 3TR2A 1TO3A 4GBUA 3IVUA 3A5FA 5FEXA 1OVDA 2B7PA 4LNYA 3S5YA 3UWWA 3KAOA 1GT8A 5HNRA 2P1FA 4MIMA 3W2KA 3TW7A 1W37A 3P8JA 3PBVA 7TIMA 1XXXA 4U28A 1R47A 2X1SA 2A2IA 1W5MA 3NQ2A 1XBXA 2CW6A 5G2WA 3STCA 3NQ7A 3ZS4A 4HNUA 4TIMA 5CPNA 4AWUA 2QCLA 1GVOA 4WOZA 1OFEA 3QW3A 3W23A 2HS8A 1QOPA 4M6QA 2C1HA 3GAKA 3U2OA 5J5DA 4QNWA 3UPWA 1A5BA 3L65A 4A2SA 1AW2A 1LRQA 1TQXA 4RX0A 2CZEA 3W7GA 2I14A 3M5XA 1DV7A 3BG5A 1S5TA 3GYEA 1SSDA 3DFNA 2V2DA 2VFHA 4LVAA 4LS2A 1H62A 2QEZA 3CWOX 4NXKA 4L4LA 3WJSA 2GVGA 5DELA 1K8YA 3BK0A 4BFAA 2ZBTA 3C61A 3ZWTA 2YSWA 3NVTA 2E77A 5F2IA 3P60A 5D2YA 4JXCA 3TC7A 3L66A 4DPPA 2V5LA 3MI2A 3UPBA 4GNJA 3W7LA 5U7SA 1DORA 1YLVA 4S2BA 3N34A 4UNLA 3E96A 2BTMA 2QJGA 4O14A 3DXIA 3TFCA 1VCGA 1SO6A 5CZJA 1I2QA 2WSRA 2TMDA 1R2TA 3JRKA 4ZMGA 4K6AA 4S2CA 2JK2A 2ABAA 4AMAA 4NJHA 3S9YA 1JJKA 1Z48A 3ABQA 3IGXA 5U4NA 3PSVA 3G1AA 2GQ8A 4ZQNA 3RLVA 5D2WA 2Z2UA 4K7YA 3TFXA 4FNQA 3G1VA 5K4XA 1VYRA 4NJKA 4GWEA 2KZHA 4O4VA 3EKZA 3SR7A 3G0UA 1H7PA 4UNKA 5D38A 1LTDA 3A22A 3VE7A 4DF0A 3BLFA 1ONRA 3LCXA 3G1SA 3S5NA 3INPA 4LC8A 3G0XA 1M5WA 5HQEA 1Q3NA 1VLIA 5G4WA 1YDOA 4MKNA 3KVMA 3WK1A 3RF9A 3N9SA 3B05A 4Y90A 2VELA 3M6YA 2H3BA 3L67A 4DBEA 4RXGA 3W2MA 1WYIA 3IVSA 3TE9A 5D37A 5CZ0A 4O57A 2QCDA 3FJLA 3LHUA 1VQTA 3TU9A 4AH7A 4M6PA 5C55A 2ISWA 5LHEA 2NUWA 4U4MA 2HSAA 1QPRA 3LV5A 1JR1A 3CTLA 2ZCGA 1LRNA 1SU5A 3E12A 1H1YA 4IQLA 1W3NA 3CLMA 4AF0B 3CEUA 1T99A 3HO8A 3GXPA 3W1PA 4FIRA 3N3MA 5F1VA 3RU6A 5BNKA 3PR2A 5BRBA 4FIQA 3V1PA 3GXNA 1EUAA 4ZQCA 1X1OA 4FEZA 5LNWA 1MSSA 4IJBA 4Q4KA 4HIBA 1AG1O 1IXPA 3EXTA 3ZFHA 1AL8A 4JGDA 4XBKA 1VS1A 4MVAA 3FOKA 1GYLA 1XBZA 1M6JA 4EIVA 1EPXA 5HUPA 1Q6OA 4PA8A 1VH7A 3O16A 4NX0A 4E38A 1OK6A 4NZFA 4CQ8A 3C56A 3P8IA 4BF9A 1WV2A 4JTIA 1XDLA 3L0KA 2E6FA 2Q8ZA 1PHQA 3HMJG 2TYSA 1L2UA 3SFKA 3E02A 3LTSA 4HNVA 3TROA 3W83A 1A5AA 3NGJA 1Z41A 2QAPA 3BLEA 3BPWA 2WPBA 4I7UA 3QPYA 2NUXA 3CEPA 4OHQA 3UY8A 3M9YA 3O07A 4HSNA 3SGZA 2FB2A 2YXGA 3LBMA 2ZZ5A 3IRDA 1JCYA 2PRHA 1TRDA 2AGKA 1Y0EA 4RR4A 3W7KA 5C5YA 5EPDA 4OV4A 4LVFA 2PURA 2YZRA 2VFFA 5G1YA 1JUBA 4JYDA 3BW4A 1H7OA 4DO5A 4JX5A 1TPVA 3GXTA 1LLWA 5G2HA 4LWWA 3S1VA 3MJYA 3O6YX 5DLCA 3PBUA 2Y7EA 4C1KA 2ZRUA 1FCBA 1PIIA 3R8RA 3WJZA 3LLDA 4CCDA 4CNOA 5C54A 1OFQA 2EHHA 2R14A 2RFGA 5CPLA 2C14A 3PB2A 5LKYA 5MHBA 1Z44A 1XKYA 3TUUA 1OX4B 3M44A 3IEBA 3OA3A 4LRTA 3UXAA 2ZZ2A 3NPWA 4ADSA 5HWMA 1B9BA 1C9DA 1F74A 5DXXA 3G1HA 3UZ5A 1IIHA 1DHPA 3HPSA 3QZEA 3P81A 4RZ5A 1TPWA 2FQIA 4RV8A 3TAKA 4UR7A 2ZZ6A 4KWVA 1X8FA 1LZOA 4YMZA 5LNUA 1X7FA 2ZTJA 2VEIA 3TAOA 1S3HA 4POCA 3LV6A 4JTSA 2H6RA 3WJWA 4MPQA 2XN1A 4RKAA 3UQNA 1KTCA 3TK7A 1OFAA 1OFPA 1HL2A 4E2DA 5K9CA 3F4NA 1WA3A 3H54A 2VXNA 1QPQA 4K8HA 2WNNA 3QC3A 2OZ0A 1YDNA 1FXPA 1SZNA 3M7WA 1FX6A 1HO1A 2Y61A 1ZAIA 1EP3A 3A5VA 4PTNA 1OF6A 3GK0A 5CKSA 4E2BA 4QITA 5LNSA 3PS7A 1TTJA 5AB3A 1FDZA 4A3UA 4GUHA 3QFEA 1L6WA 2CU0A 3QMRA 4K7VA 3EEGA 1H51A 3UZJA 2YX0A 1FDJA 4RZ4A 4CNNA 1T0OA 4XBSA 2W79A 3C0JA 1TV7A 4WJEA 1XUZA 2C3ZA 3B4UA 4X9SA 3LTYA 5AHNA 1TCDA 3SJ3A 4MYXA 5LNVA 2E5BA 4AWSA 5CSSA 4WD0A 2CZFA 3LERA 4B5NA 5AHIA 1OX4A 4JTJA 4XKYB 1GTEA 1PE1A 1DVJA 2XN2A 3FJ6A 3HGJA 3NZ1A 3OHIA 3DKJA 4JTKA 4JEQA 1SFJA 5DY2A 1NAL1 2YFOA 2E6AA 4A21A 3P7YA 4EF9A 5CGQA 2NWSA 1THFD 4YXGA 2B0MA 1HG3A 3OEXA 4ONVA 4NU7A 4O52A 5DCEA 1HTIA 1C29A 1S5VA 1QMLA 2VC6A 1J5TA 4UTJA 2NXIA 5DN1A 4EOUA 5AYYA 1JUEA 4CCCA 2QF7A 2E5CA 2FIQA 3W3OA 3MUXA 4NT0A 3FYOA 3GNDA 4M19A 4QJ1A 4Y9AA 1XDMA 2OJPA 5EBUA 2TPSA 1SZEA 3FKKA 4GC4A 3NQ6A 4M7TA 3OVQA 4XZ9A 5AHEA 2CZDA 3EWXA 4CQ9A 3W1LA 2YGYA 1G4EA 1W56A 3A9IA 4UIOA 4Y96A 4GUJA 4IMFA 4GUGA 3NQDA 1X6UA 2DORA 4UFHA 1JUKA 3LCLA 3KRSA 5D2TA 1TRIA 2PRLA 3TCEA 4GE8A 1B4KA 4MJMA 1WAUA 4KWWA 2WNQA 1QO2A 2Y7FA 4IMDA 3A23A 4PH6A 3W72A 3O1NA 2NWRA 2R91A 1EA0A 3RNDA 2B7NA 3L0GA 1N55A 2CZ5A 1FWNA 3C2EA 4JICA 4IX2A 4NXSA 1I45A 3GKAA 5D2VA 3R5EA 1GTHA 2FPYA 5F4SA 2A0NA 1BKSA 4UTTC 1TMHA 4HNTA 4Z1BA 4PEKA 1XBVA 3P5ZA 2FLIA 2QJIA 1FWWA 3FYPA 1JCLA 2QCFA 1SQ7A 4O12A 1KV8A 3EKLA 1SW3A 5EL1A 2BLEA 3N73A 1G7VA 1K8XA 2RKXA 3MW7A 1LROA 4LUIA 3ABRA 4EVZA 3OIXA 3STFA 5KMYA 3EWYA 1EX5A 1KM2A 2EAWA 3GZ3A 3EXRA 3T55A 4IXHA 1CX9A 1GPWA 2WO5A 4N6EA 4UTKA 3KX6A 4OWGA 3NQ8A 2CLLA 2FDSA 5EA9A 3GNNA 1YXCA 2NV1A 3C6CA 4UFIA 4XTIA 2VOMA 1U5JA 4L4MA 4N6FA 1XC4A 3SY5A 1WDWA 5I3JA 5HWNA 1OFOA 4RK8A 4ZVJA 1GYNA 4N02A 2VENA 4R33A 4LV4A 5DY3A 4LW7A 2V2HA 3S42A 4MZYA 2C15A 4UTTA 2QR6A 4FNPA 2HTMA 3LRLA 4JY9A 1TTPA 1TPEA 3W7HA 1AW5A 2DZVA 1P4CA 5D03A 3W7NA 3LHVA 3R2GA 3NQVA 1QCWA 2ZRXA 3B03A 2TSYA 1G4PA 2YW4A 4JIPA 3VE9A 1TIMA 2VEMA 5G2IA 4IWWA 1NF7A 1SFLA 2GPTA 5D32A 1FCUA 1QNVA 4K36A 3NL3A 3NQMA 4O50A 4DQWA 1QOQA 1ZY9A 2AQWA 3UXDA 1Z42A 2ZA1A 4BK9A 1WOBA 4EF8A 2WKJA 5HR6A 2AAMA 2NX3A 2Y7GA 2OMAA 1EP2A 3MP3A 5EKYA 4YCPA 4O0KA 1F7BA 3ATYA 3GLCA 1UUOA 5HWJA 4G1KA 4TR9A 3L21A 1BWKA 4O16A 1G4SA 2P0OA 4ZQRA 5HR7A 3QQ1A 2X30A 4N4QA 1H63A 2VFGA 4O17A 3DBPA 4WX2A 1GQNA 1YTDA 2VFDA 2A6LA 3W75A 4O10A 5AYZA 5KINA 4O19A 4MUZA 4S1FA 3USBA 3LRMA 1OX6A 4AAJA 4Q32A 4JX6A 2ZZ4A 2FTPA 3D0CA 4NNAA 1ZALA 1UBSA 1DBTA 1YPFA 3DKLA 4O8RA 5DBUA 3TQVA 4DEFA 3IIVA 4JTLA 2O7QA 4FNUA 3TSDA 3PULA 4UXDA 3TMLA 1L6SA 1JRCA 3FKRA 2ZYFA 3T44A 4MLRA 4MFEA 4MOZA 2V8ZA 4C1LA 4JS3A 3L5MA 1L6YA 2VFIA 2C13A 4AXKA 2R8WA 4JN6A 2OCZA 3LCFA 2BX7A 3HIJA 3W86A 1EWDA 4OBTA 5F4WA 5KZMA 4QNEA 2Y70A 1VGAA 1KLZA 2A7NA 4LOCA 5I3IA 4H3DA 1QR7A 1BEUA 3B04A 3CIWA 5KZDA 5CSRA 3ELFA 3W88A 4RLIA 1TB3A 1JVNA 1JCXA 2ZZ1A 5H91A 4XQ6A 2DJXA 4ORMA 3HGOA 4X2RA 4BWLC 4KFNA 2ZA2A 3LCIA 3EWUA 3EX6A 5F2MA 2PC4A 1XUUA 3P61A 4TU1A 4O1CA 2WJZA 3PC0A 4JTFA 3P5YA 4NUWA 4ZQMA 1KA9F 2QUVA 4UUIA 1LCOA 3W74A 4IPJA 1TREA 4O1AA 5I3KA 4CNPA 3EX4A 4ZQPA 3F1QA 4GUIA 2DJLA 4TX9A 3B0UX 3AJXA 2RH9A 2WNZA 2TRSA 4PC8A 4UR8A 3QH2A 3EXSA 1EB3A 4UFJA 2W6RA 1QO5A 2ATMA 5HUOA 3M47A 3KVLA 1A53A 4UTUA 3SGUA 3V75A 4AB4A 1PL9A 1IXQA 2FJKA 3C2OA 4NJGA 2XN0A 1NSJA 3S6DA 3C2FA 1B57A 4UMCA 5K2ZA 3NEVA 2A6NA 2H90A 3DHFA 1D3GA 4JX4A 5DCBA 1SW0A 1RPXA 5EY5A 4DO4A 1TJPA 4JYFA 1H60A 1KFCA 4PL2A 1WX0A 2ATSA 2JKEA 3G1FA 4IGHA 4D2JA 1SSGA 3LGEA 3I7RA 1JCNA 1R2SA 1YADA 5F4XA 3WFAA 3C52A 1DQXA 3TMQA 5D2XA 1SZFA 3UWQA
chains in the Genus database with same CATH superfamily
3QV9A 4QEHA 3RMJA 3LI1A 4AC1X 2FVKA 3P6LA 2EKCA 2VQTA 5TIMA 3CMJA 4G7FA 4YCOA 3KCJA 3KRBA 1L6GA 3OZPA 1FCQA 2R82A 2NXGA 1UCWA 3BGGA 1EHAA 1H61A 3JVAA 2BG5A 2EPMX 3E0FA 1HT6A 1SW7A 3NQFA 4UB9A 2AQVA 3LD5A 4AZIA 3FFSA 4LYQA 5C7VA 3O8AA 1QW9A 3LA4A 3M0VA 4EWND 2X42A 1K8CA 3CAQA 1A3XA 4JPGA 1Q8AA 1HKMA 1G9HA 2G50A 3AHTA 1DQUA 4AY8A 3B0PA 3GBDA 4CNSA 1NFBA 9RUBA 1TPUA 3CQ0A 1MW2A 1ML1A 3DYPA 4KRUA 2ZFAA 5D33A 3HG4A 4AHQA 3HF3A 2X1TA 4GQBA 2PA6A 3UNDA 4D6FA 3NSMA 1OFBA 1W31A 1R2RA 4QSHA 3RK8A 2PDGA 1K9FA 4HJFA 1OQFA 1PVNA 2CXEA 3DOPA 1F76A 1R46A 1UYQA 1JF6A 2J7HA 1JZ2A 2CXGA 1F5ZA 5D02A 3WNOA 2YDSA 3VIFA 3WJYA 2J9YA 4B2DD 4DPQA 3DFQA 4RDVA 1TKKA 2GL5A 1V6YA 3RMEA 1R3SA 2W62A 3N2MA 1JYXA 2YCIX 3POHA 2BOEX 2I1OA 2PDCA 4FXSA 4H9XA 4JNMA 4PBEA 4YHEA 4ADTA 4D6CA 5FEZA 1OABA 2Y0FA 4DRSA 3GTFA 2DSZA 3DI0A 1PAMA 1WKEA 4GXMA 4KFOA 1DWJM 3PF3A 1YMYA 4H6QA 1TV5A 3W73A 3RR1A 2VR2A 1XJBA 3GZAA 3LENA 3U4AA 2ADAA 3VPLA 2XFFA 4X9YA 2PBOA 5B7ZA 1O68A 5A94A 1LDCA 5CC5A 3ARQA 1KXTA 2Q3RA 5C2XA 4XO7A 1KM0A 4X22A 1RHCA 3PBWA 1MNSA 3HM7A 3MP4A 2X0SA 2RUSA 1LOLA 3CT7A 3BAWA 3ABOA 4J1OA 5AYBA 1LLZA 1X97A 4XUYA 1UMYA 2YCEA 3FXGA 4ERIA 2I17A 2CFFA 1QPNA 3BMVA 3M43A 1H7NA 3OA5A 2E68A 2VZVA 2NVAA 1UMLA 3LXCA 1S3TC 2HS6A 1AW1A 4C6LA 1OFRA 2VWSA 3S2MA 1XQLA 7REQB 3VNJA 1DHKA 1Y8BA 2GK1B 2V82A 1F4AA 4A8IA 4W88A 3TYZA 3UJEA 2H3DA 5G4HC 1TVNA 2PGFA 5K9DA 2OWWA 1X6LA 1PWLA 3WK0A 3UWZA 3S8HA 4Q8UA 1JYWA 1XLHA 1Q13A 4NI8A 2QJHA 4WDWA 3LTPA 5L6UA 2PRMA 4JTHA 1T8XA 3UR2A 5I23A 4M51A 2D1ZA 4NNBA 2NSOA 4BI5A 3BG3A 1VCFA 3C2YA 3BH4A 2HEJA 2WKGA 3AMLA 4G6CA 4IZGA 3H2EA 3W4RA 3ZJ6A 2BGQA 2LLEA 4GO9A 1JAKA 1E6SM 1ZAJA 4IOTA 1DEDA 4AVNA 4ERAA 4YTSA 4C6MA 2GUUA 6ALDA 5FJJA 3TJ4A 5I3HA 2D3NA 2OZ3A 3TQKA 4A8RA 4FI4A 3PPCA 2Z4GA 4DYJA 3QEZA 3CHEA 4KCUA 1RQEA 3OG2A 3V0SA 2QVNA 1X6NA 4Y7EA 1R5YA 1XLFA 2C16A 4PUJA 5AHFA 5FEPA 2WVSA 1UZ4A 1X96A 1EWEA 2GYIA 2WMIB 3B40A 3W22A 4AD3A 4PTMA 4YU1A 3VVGA 3I7SA 8A3HA 1EA9C 3PB0A 4INFA 1TWZA 1PCKA 4FNTA 4DNHA 3H53A 2GQ3A 1FKWA 3GDBA 3LLXA 3BO9A 1XPYA 3S2JA 5FL0A 3S2LA 3E9AA 1VHNA 4MY8A 2XVLA 2FZDA 1LM1A 3V5FA 3A64A 3GDRA 3GU2A 3SUTA 4L4OA 1ZP3A 3CMGA 2VEGA 3LB0A 3SSJA 4LGXA 2HDJA 4M24A 2F7FA 3GDMA 1OBAA 3MDUA 2HBVA 1ZBVA 4MJ4A 1GVRA 1I2PA 2Q09A 3RG6A 5BMXA 1DOSA 3EWZA 4PGLA 1O5QA 4G1NA 4DI8A 5D04C 1PO9A 3GUWA 2KX9A 2OKOA 1ZJIA 1HJQA 3F4WA 4Q8WA 4ML4A 3G5EA 4IIDA 1FHUA 4F48A 1FWCC 3VNDA 5E93A 1NF0A 2WVVA 1S2WA 5FESA 3NA8A 5C9WA 5A6KA 4QGCA 1WDPA 1IIGA 5CG7A 1GOKA 4NASA 3ZVIA 3KXQA 2GJNA 5DT7A 3NM1A 4GY0A 3NOEA 2J7FA 1ZENA 1G7UA 4EXAA 2WZTA 4Y8EA 1XIDA 2PP0A 5H8PA 1KO0A 4GY1A 1E1CA 4JHZA 3N14A 1UASA 2QT3A 2GK1A 4F79A 2WQDA 3G1XA 3UWEA 3NAVA 4QM1A 3QF0A 4V28A 3LXAA 1IR1A 3NPUA 2G8ZA 4GVIA 4V15A 1P7TA 4K2SA 4MNKA 3TW6A 4FX7A 1XP3A 3VD3A 1Q45A 1MDLA 1RVGA 2YKKA 3CQIA 2C0AA 2DZUA 2DSVA 4ZA0A 2B81A 4A3HA 2CESA 4RDZA 1JZ6A 1MZRA 3C4UA 3R0KA 4KH2A 1KBKA 2YLLA 2OO0A 1NARA 2PF8A 4GG9A 2WANA 3OBKA 2V30A 1E73M 2OODA 3DUGA 3NO3A 3UWUA 3TYDA 3NJ3A 3DG7A 2Y4SA 3AO0A 4JQ2A 3CHDA 1KBIA 4K39A 4AX6A 3WH8A 1MXSA 3LU2A 2DW6A 4X0NA 2EPKX 4UFKA 1OD0A 4UOQA 4HOZA 3WJXA 4UTWC 3ITVA 1R38A 3TSBA 1S5NA 2WWCA 2PU0A 3QV8A 2ZX6A 1E0XA 3KW3A 1KTNA 1RR2A 1RALA 1OT1A 2ON3A 1QDSA 2HV5A 3GTXA 2QPXA 2J78A 2PCEA 1LRTA 3DZ1A 4ZBCA 2GWNA 2PTDA 3T7VA 3V5OA 5G1TA 4JD4A 4CD5A 2PFHA 2PDXA 3DGRA 5DBTA 2VFEA 3UJFA 3H22A 1SJBA 2O9RA 3BDKA 1Z9AA 2XSAA 1E6RA 3ABSA 5AC8A 3AROA 3VKBA 3G8EA 5EU9A 4M7SA 3FLUA 4BKNA 4LS1A 4GH1A 3CZJA 4ZODA 3WBYA 3O6DA 3OZYA 1AQFA 1NP0A 3ES8A 3QN3A 3U2ZA 1LT7A 4MADA 3UW6A 1E6QM 1TYGA 3NM3A 3GR4A 2VRKA 4TMBA 4PL1A 3RLGA 1V77A 3QM3A 3CPUA 1JPHA 3M0LA 3NPXA 1IGWA 1VRDA 1GHSA 4OOUA 3MO4A 4E4PA 3ALFA 3CJPA 2QMJA 1UC4A 3KBJA 5D9PA 1EC9A 4CVWA 3COTA 1PCWA 4ACZA 4XZIA 4Z1AA 1L8PA 1Q6DA 2PDMA 2PB1A 4L64A 1HF6A 3AUOA 4H6RA 4PCPA 1DKWA 2QCCA 2R9RA 3LPGA 3CU2A 1M65A 2ESCA 1ELSA 4L61A 4EAMA 4UQDA 3NWRA 3M0IA 3QMSA 2PE4A 4MY1A 1RK5A 3WF0A 3WDQA 2XJ7A 2XDFA 1I2OA 3DFHA 1P6BA 3S5ZA 2PWDA 1XLIA 4HZ7A 4CCZA 3THDA 5ABHA 3CUGA 2HVMA 3LHTA 1ITCA 1NWRA 3FYYA 3L7RA 3A13A 3VU2A 4IMCA 4W8AA 1MW3A 1EP1A 2ZUUA 3VZYA 1KFKA 5HQMA 3GH7A 3VGHA 2JKPA 5K3VA 2F9RA 4J2PA 2WHMA 3AIWA 3CQJA 3P0WA 4PRWA 3NZRA 5FF4A 4C6NA 5EMUA 2V5KA 4XX6A 4DJFA 1YDVA 5C6MA 4X3ZA 2PDWA 3CC1A 3VD5A 1RPKA 1SFTA 4QE1A 4DJEC 2EPLX 4BQ3A 3K8MA 4HYWA 3UZXA 2QDHA 2FPTA 5KEZA 4PTXA 5CQ1A 3CUHA 4LUSA 3VGBA 1D3CA 2XM1A 3S83A 4F4RA 1W5PA 1RV8A 4A22A 1MQQA 1ZGDA 3W7JA 3APTA 5BXSA 4CLMA 2EBNA 1KFLA 4BQ2A 5FJIA 7TAAA 2O4MA 4NG3A 1GVFA 3WENA 3L5AA 1AJ0A 3L23A 3PNZA 5CZSA 3Q4DA 2NW0A 1XSIA 4DBSA 3IIOA 2E40A 3QQWA 2ZRWA 2JKAA 4ZB2A 1A4LA 1W5QA 1FWTA 4KESA 3SBFA 3TYCA 3HG5A 3KBVA 3UXIA 3W70A 1XFBA 4JY8A 1C91A 2PLCA 5BXTA 3IGUA 2W91A 1HJVA 1TV2A 3H21A 5G4EA 3LMYA 3TC6A 3SIZA 4DELA 4YLWA 3UD6A 3GAYA 4AZCB 5M5DA 3B8DA 3QR1A 1QNRA 2V5CA 4PSRA 1RBOB 3B97A 1ZBCA 4CQBA 4FF7A 4O54A 4B9ZA 3JS3A 4X61A 3AFBA 1PIGA 4FA3A 2HVNA 3W7CA 1OIFA 2FMNA 5HAOA 4EE9A 1KKRA 1SR9A 4YHGA 3ZLGA 1KFJA 3BCFA 3FHQA 1ZFJA 3KUMA 5LHFA 3N9RA 3CAKA 4GRSA 2GFTA 5DCDA 2PD9A 2X40A 3U9IA 4Y8FA 3M41A 4IGSA 1D2KA 3KBSA 3V35A 5IM51 1W5OA 4RE0A 4QHRA 4ZXOA 3DFPA 2WMHA 3WH5A 1HKKA 4F9DA 9XIMA 3HG2A 3WNPA 5E9XA 3CIVA 1WZKA 3LZ3A 2XIOA 4AXNA 1A80A 3HPZA 4MJ2A 5HJYA 3SY8A 4IXXA 2HWGA 1IR2A 4LAKA 1JZ3A 1S5WA 4W84A 2J24A 3R12A 4HVXA 2PD5A 1GVYA 1LYXA 4B90A 2QJJA 4RJEA 3S47A 4L9YA 3VTRA 1OCJA 4NAEA 2H8ZA 2Q8XA 3FGCA 3RO8A 3MU7A 3CL7A 5FAJA 4H41A 2J4GA 3G24A 1EBGA 1K8ZA 1WP6A 2YPIA 3GDTA 4Z2KA 4IX0A 3U57A 3MCOA 4QRNA 5J5RA 3TR2A 2X2GA 3FAWA 4U10A 1EQCA 3A5FA 8XIAA 1W9PA 1GT8A 4JFSA 1M41A 2P1FA 2O92A 3OQ8A 4A8NA 4I5XA 2DUAA 1OSEA 7CGTA 5C2CA 1H4PA 4FSAA 4A4AA 3H7VA 1R47A 2DIKA 2X1SA 2A2IA 1LQ2A 1UKSA 1XBXA 1RVKA 4ZFCA 1ZU8A 2PDBA 4AWUA 4WOZA 4D6GA 3W23A 2HS8A 1QOPA 5DFAA 4DI9A 3U2OA 3IS4A 1TQXA 4RX0A 2I14A 3HPAA 3LPOA 4YIWA 3M5XA 1DV7A 3BG5A 5JUVA 1PBGA 2QEZA 3V5CA 3WJSA 3P0XA 2WB5A 3B8IA 1CGUA 1K8YA 4B3KA 2YSWA 3NVTA 4HMDA 5F2IA 1ESWA 1R8LA 4GNJA 2WNWA 1XW8A 1W91A 3N34A 3E96A 2QJGA 4O14A 5ABGA 3TFCA 1SO6A 4JHOA 3L2MA 4K6AA 5FCZA 3SCSA 1XH0A 1PDZA 2W4XA 4GYFA 4KT2A 3USZA 4IG2B 4AYSA 4PYSA 2W9MA 1CNVA 1O1ZA 2AAAA 4CN4A 3ABQA 3CUXA 3I4EA 3K2GA 4GIEA 3SQLA 3GC4A 1T41A 2P76A 4FNQA 3G1VA 1VYRA 4NJKA 4H83A 3VM5A 1A49A 2WJFA 4KQNA 2PDIA 3ARSA 1IT0A 3AIVA 3PJTA 3SR7A 2PWGA 4YJ5A 3UGVA 1J8VA 4RUBA 1FHDA 3UR5A 5E0CA 3S5NA 4NHVA 4AZBA 1C93A 5G4WA 1YDOA 3N04A 3KVMA 3WK1A 1KCLA 1JYVA 3RF9A 3DBNA 4JQ4A 2VELA 3WQEA 4RXGA 3AXHA 3TE9A 5LIWX 4O57A 3LHUA 4HZ6A 1WE5A 3K13A 4PEEA 2NUWA 1LQAA 2HSAA 3LV5A 4CD8A 3FSUA 3KBMA 4RZBA 3FAXA 4IQLA 2VP8A 4MF4A 4KS0A 3B4YA 4I5UA 4IT1A 5A8QA 5T9CE 3W1PA 4FIRA 1L0PA 3VNYA 1TJ2A 1T7LA 4HD5A 3JZUA 3V1PA 1NELA 3GXNA 1S2TA 3BAJA 5CJNA 4ZQCA 4GYPC 4S3CA 1ITUA 4HIBA 1AG1O 3EXTA 1E6NA 1EJUC 4XBKA 3AHZA 3A6OA 4BA0A 4FP1A 4EIVA 1EPXA 2HZGA 3O16A 3IAPA 3AUJA 3OLIA 4KEMA 3TW9A 2HVOA 5XIAA 4OVXA 3SCNA 1OK6A 2JE8A 4JIHA 5H8MA 4NZFA 3BE7A 2WK2A 2NT0A 3RU8X 2E6FA 1U5HA 4HU0A 2TYSA 3R1ZA 3GXDA 5HNNA 4WIWA 1L2UA 3SFKA 3LTSA 3TOYA 3W83A 1A5AA 1HNYA 3NGJA 4ATLA 4GHRA 1Z41A 4ZXLA 2IQ0A 3BLEA 3BPWA 1Q6CA 4EPKA 4GMEA 3RPMA 4OHQA 2OLSA 3ARUA 3M9YA 2ZXBA 1VEPA 3LBMA 3EA1A 1JCYA 1V7AA 2POTA 3PANA 1R87A 5C5YA 5EPDA 3AIEA 1UZDA 3VXGA 1OGSA 1IHIA 1SM9A 4ICCX 6XIMA 1W1IE 3N3TA 3GXTA 1N8IA 3KOZA 1L2QA 3S1VA 4I9JA 3MJYA 5ABFB 3TJIA 4C1KA 1FCBA 1PIIA 5EFFA 3N2OA 4CCDA 1OFQA 2RFGA 2WLZA 4L65A 1Z44A 1XKYA 1U22A 4GXWA 3TUUA 3M44A 2WAGA 3OA3A 2PZNA 4ADSA 4PMJA 4LBSA 1NQ6A 1F74A 3AALA 4E8CA 2PDYA 5I7GA 1I9CB 3B9DA 3VILA 4KETA 3HPSA 3QZEA 3WDRA 2QHAA 5I02A 2FQIA 4YTUA 4RV8A 3V0TA 4PTDA 1JYNA 1V51A 2WVTA 1HJSA 3QY8A 4XD6A 1HKVA 2VEIA 4POCA 1YRRA 3LV6A 4HMNA 4JTSA 2H6RA 3WJWA 5I3DA 2A3EA 2XN1A 2CERA 3TK7A 1UA7A 2VHLA 1HKIA 2ZUSA 3I3EA 2PSNA 4K8HA 2DUXA 2XGZA 1YDNA 2ZWYA 1FXPA 1XIMA 3M7WA 2Y61A 1ZAIA 3ITCA 1UC5A 2QDDA 3A5VA 3GK0A 1ZL1A 1EJSC 3PS7A 5AB3A 4A3UA 1WPCA 4U5KA 2YDRA 1V08A 3QMRA 3MWCA 1MMFA 4AISA 3P3BA 3UZJA 1FDJA 4RZ4A 2FGLA 3TC3A 4XBSA 3C0JA 5DMMA 1TV7A 3WDJA 4AZ6A 4Q8TA 3UZWA 2E25A 4MYXA 2E5BA 4AWSA 5I03A 3K4DA 3B8SA 4XKYB 1PE1A 1DVJA 3NZ1A 5M2FX 5I09A 1XG3A 3GO2A 2ICSA 4JEQA 1SFJA 3HV8A 3S2CA 2YFOA 2PTWA 2E6AA 3WQDA 3P7YA 1VBGA 2P53A 4G5DA 3OEXA 3PFMA 4ONVA 4O52A 1C29A 3GH5A 5LIUX 3T8QA 3ZVHA 4H9VA 3EDFA 1K1DA 1J01A 3O0FA 2R24A 1CENA 2NXIA 5DN1A 3C5QA 1ZPTA 3CO8A 3KLKA 3UG8A 4MWAC 4CCCA 1QXLA 4C6IA 2FIQA 3MUXA 4NRRA 1MQRA 4NT0A 2OSXA 3FYOA 5FOOA 2XVPA 2VGBA 1E0TA 4Y9AA 5EBUA 4Q6XA 2TPSA 3OBEA 3VFCA 4GI8A 4M7TA 2ZXAA 4XZ9A 1FWEC 3SCVA 4IMFA 4GUGA 2ZKMX 3V4BA 1X6UA 1SMAA 3KRSA 3EPNA 3HQNA 1B4KA 4KWWA 2WNQA 5A8NA 3A23A 5D9MA 5A1AA 2NWRA 3EDKA 5LIKX 5HA7A 3SQMA 3SCTA 3QGAC 5JBEA 4TVCA 3PPHA 3GKAA 3R5EA 4NRSA 1J12A 4UTTC 3GU9A 3GRIA 4HNTA 1XBVA 3P5ZA 5HBFA 1SQ7A 1W3JA 3ENLA 3KDNA 4LYRA 4MDOA 3WUEA 2QYGA 3MW7A 4LUIA 4DXKA 4EVZA 3STFA 3GZ3A 4JTRA 1CLXA 3WQ4A 4IXHA 1VBJA 1Z69A 1GPWA 4JTQA 2GOKA 1C7TA 5D4YA 2FDSA 4V2XA 3WLMA 1BYAA 4NZ5A 5EA9A 1YXCA 4MB1A 1VEMA 2VR4A 2V3EA 3C6CA 4UFIA 2VURA 5FD0A 3TONA 4N6FA 4S3JA 4GX9A 5HWNA 4IIGA 2O4QA 2CHRA 3VMOA 3ZMRA 4ZVJA 1GYNA 3I4KA 1XYAA 4B92A 1XDJA 1LUCB 4G7EA 2YCLA 5CBBA 3LYEA 3CUIA 3LNMA 2F6XA 5A6BD 1UWTA 3B03A 4C6DA 2TSYA 4AEFA 2VEMA 3B0XA 4LUTB 3WMSA 5D32A 1Y5XA 1QNVA 1GOQA 1GZ1A 4K36A 4GQRA 2X7WA 4HBKA 2AQWA 2BHYA 4GZJA 2ZA1A 1ADDA 1W1B1 4AUBA 4QG9A 1TV4A 2WKJA 2AAMA 2NX3A 3IJDA 4HMEA 3SEPA 2GGGA 3ID7A 3BCDA 3ATYA 4H2HA 1SJDA 3N12A 3RHGA 3KTXA 4DZAA 3MC5A 4L1GA 1XF0A 2Y5SA 2PC8A 4O17A 2HROA 2WCGA 1RH9A 3MVIA 3KZSA 4O10A 3U5YA 4MUZA 4PCSA 5I6SA 1CCWB 3GXIA 4NYYA 4AAJA 2OSYA 1LJYA 4HP5A 1P6WA 5DBUA 5DT5A 2A3BA 2OEKA 3TQVA 3H24A 4LAMA 1GCYA 3AMDA 3VM7A 1R3VA 2WC3A 1AA1B 2WHKA 3MB9A 4H04A 3SRHA 5EMMA 1CB7B 1JRCA 4XZBA 4MFEA 5HPCA 1YE4A 4AZCA 2JALA 1EEXA 4JS3A 3QC0A 1DXIA 3LN3A 2C13A 4XAGA 2HBXA 4HA0A 1J0IA 3TLLA 1UWSA 3STPA 3BLPX 1ZBKA 5A6TC 4AD0A 3FDGA 4C1NB 2A7NA 4LOCA 4V27A 2OLHA 5AECA 5I3IA 3UCCA 3AHYA 2VVSA 3TVAA 5B80A 3R8GA 3KOWA 1ISWA 3W88A 3CL6A 1EO5A 1OZMA 1A4MA 1GZJA 4Q8NA 3BAIA 3DFYA 4FMVA 4O1CA 4ATDA 2WJZA 3PC0A 4OECA 4JTFA 3AQUA 3SN1A 2G4JA 3OGRA 1KA9F 3GW3A 5DMLA 1D8WA 4O1AA 4IQEA 2VQUA 4PMZA 4QE5A 3URAA 1NY1A 3EOEA 1RSCA 4LUSB 2QJMA 1UPPA 2RH9A 3BQ5A 3OIHA 4PC8A 2VM8A 2DVXA 5IDZA 2W6RA 1ZSXA 3AYSA 4AZHA 2BVDA 3B3DA 3IUHA 2OX4A 2YCKX 1OG6A 3KVLA 2EG6A 1EOMA 1LWIA 4S3GA 3AOFA 1NSJA 3S6DA 2C71A 3EAUA 2YL9A 5K2ZA 3NEVA 2A6NA 1D8CA 1D3GA 3E2RA 5DCBA 1QI2A 1SW0A 1E72M 3RM8A 2JEQA 5EY5A 2XISA 3EOSA 1JZ8A 2ATSA 4D2JA 1SSGA 3LGEA 1JCNA 2YCJA 4IL2A 1DJGA 1Y65A 3GFXA 1E1CB 2HXTA 4RNFA 2X0YA 3HG3A 1NU5A 4LNCA 4PUEA 3B9NA 2A7PA 3DH7A 3VUSA 1PV8A 3VMNA 3WLOA 3KRUA 3VOFA 3BVJA 2YL5A 2QF8A 1KKOA 4HOWA 1XH2A 2ISVA 3RJXA 3OB8A 2BP1A 3NL2A 4QCEA 4HYRA 2EPNA 2EEXA 2OFJA 3ZLHA 1XCXA 1VFOA 1GW9A 3NQCA 1RP8A 1PUDA 3NURA 1UR0A 4AVFA 7REQA 2DZSA 4BF7A 3RLHA 4HU4A 3VOCA 1W9UA 5DXYA 4BZYA 2QNEA 2YFNA 3OJGA 2OYMA 2WZEA 1JQXA 3NVDA 4ALDA 2WZMA 2C7FA 3W76A 1Q7ZA 4ZENA 2VVNA 3AHXA 3AIQA 4WGHA 2J7DA 2WSQA 3IRSA 3IV8A 4JTUA 3S6TA 1BF6A 2X1IA 5FA5A 4HOXA 1DTUA 2YDQA 3FSTA 2Q8LA 2QUUA 1F3TA 4HNCA 3AYTA 2J47A 1OF8A 3QMTA 3W7DA 2H8XA 4JQAA 3SB0A 3QRHA 3AS3A 3HGRA 4QX4A 4FF5A 3DGBA 3W6YA 2BB0A 2CLMA 2GOUA 4AHPA 5AYIA 3DHDA 2GGJA 3BSMA 5FAGA 4IF2A 4N2YA 1E0UA 4EPDC 1WQ5A 3SECA 2XWDA 2ZVIA 4WHBA 4WKHA 4NAFB 2V3FA 3C2VA 3UJ2A 2Y63A 1GGOA 1ADOA 3BL3A 4FO4A 1OC6A 1EO7A 2V81A 3A24A 3PTMA 3B06A 5HMDA 4REQB 4Y9PA 1J9YA 1GEHA 4OOZA 2PPGA 3W1QA 1JCMP 1X1ZA 4IIEA 1J6OA 3LGGA 4HA4A 2FFCA 2A3HA 3GY1A 4QEEA 3W85A 4K1GA 2VZOA 3NYZA 2FZBA 4S3EA 1CGWA 4NAEB 3II1A 4RNIA 1UUMA 3PAJA 1XYBA 3F5JA 1XRFA 5JBDA 3BG9A 2E09A 3IIXA 1XLEA 2XZ7A 4MMWA 3IJ8A 5GJMA 3DG6A 1KGWA 3FDKA 1C8QA 3S9ZA 2F2KA 3EB2A 1OK4A 1H7XA 3DEQA 5F2GA 4Q7IA 1UB3A 2BY1A 3TWAA 1LWHA 5A8GA 1QNSA 4HSOA 3N29A 4TTUA 4MAZA 1VJIA 1B3VA 3KDOA 5BXRA 4WEVX 2B7QA 1Q2RA 2O56A 2OTDA 5LIXX 3KBWA 1AQHA 2Z0IA 1K70A 4JDYA 4PCFA 3ZO9A 2GVLA 1MUWA 1EF2A 2ZA3A 4H1ZA 3CHVA 2WSPA 4J3SA 5EBAA 1B5TA 2MNRA 2BBFA 1SO5A 1KBJA 3LCHA 1HN1A 4J3VA 3UJRA 3MSYA 2Z6JA 3WD0A 2HXUA 4P7OA 1BLIA 4FALA 5A6MA 5LIYX 3K4AA 1TQJA 3QSRA 2D0HA 5TQLA 5LZLA 2QAFA 2YYTA 2WSYA 1KFBA 1DWHM 4O1BA 1E40A 4AF0A 2RGMA 3EDJA 1JD9A 3OVPA 2XH7A 4YPJA 4H6EA 1TUXA 3PG8A 2OKTA 3R89A 1XIBA 4Y6GA 3GVVA 2V9DA 4X2PA 1KGUA 1TWDA 2IKHA 2FZMA 2QCDB 3W7EA 4MSSA 2ZC8A 3O6AA 3F4DA 5IBXC 1HGYA 1R86A 1IEXA 3TA6A 5G1MA 3EX1A 4N9EA 4A3RA 3EPMA 2Z1WA 1MWOA 1VFLA 2HNHA 4PR4A 3IANA 2RGLA 3ARWA 1K02A 3H23A 4IMEA 3BLIA 2AMXA 3LCWA 4OU1A 3MS8A 3AXIA 3W1XA 4N4PA 3TCSA 4UTMA 4TTGA 1EXPA 1XCFA 3WDIA 3UZYA 2WV8A 5I07A 4GNVA 4QAIA 3XISA 1G4TA 2V67A 2IKIA 3M64A 1ZS2A 5AZ0A 4Y2WA 4LH8A 4HZMA 4DWSB 2BZNA 3ANVA 1KD0A 3GXFA 3ARPA 4A29A 3HV9A 1CBGA 3ARYA 1JGIA 5FF0A 1ZB5A 1UA3A 1FWRA 3TH6A 5BU9A 3QJAA 4W4QA 2W0UA 3HB9A 1UP3A 4JHMA 4DZIA 1YKWA 1GQJA 3ZJKA 4DN1A 3KHJA 3LM7A 1A47A 3UETA 1CTNA 1S1PA 3ZVHB 1BTMA 5ECUA 3LQGA 2CETA 4TOQA 2ZIDA 2IQTA 2Y6ZA 1F07A 1FUYA 3RM4A 2O0TA 4IISA 2VEPA 2PBGA 4OBSA 3WQ5A 4NZ1A 2OQLA 4RW5A 3G2GA 2OWCA 7ODCA 1BYCA 4Z08A 3N2XA 2PP1A 4TMCA 4FLSA 3H7RA 4PCTA 3TSMA 2FZ8A 3K8LA 4LQ1A 3B0VC 2UY2A 1Q7QA 1JRBA 1KCKA 1MRAA 3UCQA 4O28A 5HPOA 1F9CA 6CGTA 1YX1A 2JGYA 2WM1A 4YL2A 1CI1A 1V3KA 2GQ9A 3CHFA 3QZAA 5I2UA 2YL8A 3W25A 4EPEC 3DU0A 4MZ8A 4B9YA 3OZOA 2XVKA 3QTPA 2WQPA 4QS6A 3WLKX 3IIPA 4GC3A 2DVTA 3VDCA 1BGAA 3VDAA 4O15A 1RQHA 5IHSA 2OVLA 4DUWA 1SFSA 2HRWA 3BOXA 7A3HA 2PF0A 5FACA 4Z1DA 5KITA 2FH8A 1IEQA 2YYUA 4G2DA 2QV5A 4I5RA 2E1DA 2PCQA 4UWMA 3BOFA 3MCMA 1HJWA 3CBWA 3DG3A 5CLWA 5CAKA 3MI6A 2E5DA 4PFHA 1DL3A 1XYLA 1J0YA 5HINA 3MPGA 4X63A 3G8RA 3WFLA 2XGIA 3MI3A 2E6DA 4W85A 1TJRA 3PZGA 4UMBA 2DH2A 4CU7A 3OTRA 3W71A 3AMGA 4ZSUA 4R27A 1XX1A 1O6IA 2E9BA 4I9TA 1QHOA 4LY8A 3K30A 4UC5A 4FLRA 1BWVA 5HNUA 4O8AA 4I6VA 1LBMA 2YDAA 2GSHA 3W2JA 1VBHA 2G5WA 4R5EA 3MCNA 3GDKA 3NXFA 1PXGA 3W84A 4LUYA 1UJPA 1JDEA 2NV2A 4F9JA 1LQ0A 1K7XA 1TPDA 2C18A 2J27A 1M53A 3EX2A 1G6CA 3MQTA 3G6MA 3QPZA 3FEMA 5LGZA 1EXBA 1LOQA 4WOQA 2G3JA 3IVTA 2QCHA 3W38A 5F1UA 3T40A 4C1NA 3TV8A 1BXBA 1AZ2A 4FNRA 4U5IA 4D6DA 3S46A 2OT0A 4HGXA 3QY6A 1PKMA 1RZMA 1TPB1 4PZVA 3GSMA 4QE4A 1P1XA 3W0KA 3R6IA 4L5ZA 3LK6A 1ZRQA 4K8EA 1XPGA 3LDVA 1EFZA 3QR0A 2PWUA 1BG9A 1ZQ5A 4B4HA 3PZVA 2E7FA 1CXFA 4GZIA 1KFEA 3ATZA 1V7YA 2XFRA 4M56A 3REQB 1QK2A 4DZHA 2BWGA 1OGBA 3N11A 1XH1A 3CM4A 2X1UA 4IG2A 5T9BG 4HPGA 1A0EA 3IIZA 3OZMA 4S3DA 3EBVA 2GJLA 2V5BA 1H1ZA 1JEZA 3EDDA 1RD5A 1N2VA 1FWSA 3MJMA 4HK5A 1EUNA 3GB6A 1UW9A 3T1GA 1JPIA 2CZVA 3OG3A 1YTEA 3L4XA 1ICPA 1M1BA 2QS8A 5FF3A 4ZZ9A 2PWFA 3TYAA 1FWDC 4KCWA 4FOJA 1KXQA 5TBOA 1O5KA 5CG0A 5I06A 3TJLA 4MG4A 1FBAA 1H0GA 4W86A 3QQ0A 5DMYA 3K1DA 1M7OA 2Y7DA 3L2LA 4W9TA 4EXBA 3QYSA 2ZUNA 2TAAA 3H55A 2A79A 1VFMA 3N6QA 1P0KA 1TCMA 1TE6A 1R3YA 2J7EA 3DFTA 3FVMA 4AD5A 4B5UA 1UROA 1YHTA 2P3EA 1UWRA 2FHFA 4JR5A 5DRIA 3ISIX 4NVTA 1E71M 1RLDA 2NVCA 3WX7A 3HJZA 3GVGA 1NIUA 2YJQA 4JZ5A 1GJWA 1BAGA 3P67A 3MANA 3NO1A 3BW3A 1WDRA 3M5YA 2ZX8A 4OT7A 2VX4A 5CZTA 1GVSA 3CAWA 3BAYA 3BJFA 3S5OA 1BF2A 3UVAA 2BSLA 3WK2A 3UY7A 1TX2A 4IMAA 3N4EA 2Z26A 3CTTA 2NQ5A 3TXVA 1OHLA 3FIGA 4NF7A 3TP4A 4WY0F 4PB3A 2G41A 2D22A 4YYFA 1SO3A 4IQDA 4MKVA 1OADA 4PFMA 3DYMA 3OGSA 3DHUA 4IUGA 1KM4A 3KOXA 2C1GA 1QK0A 1R7AA 3WELA 4FLOA 3Q94A 1Q2SA 4ZFMA 1B0IA 1B3OA 4GOAA 4Z42C 4YTRA 3M16A 4HSHA 1M03A 1KV5A 2A5HA 1VYPX 2JQXA 1VZWA 3OYXA 2Z27A 3L2IA 3C0QA 2X16A 4HHPA 1PZ3A 3FA4A 3THCA 3A12A 4GNKB 2BVWA 1FWGC 3GTIA 4D6IA 5M17A 3E74A 4H6KA 1KTBA 4JTEA 3W2LA 1XLLA 1XR2A 3QY7A 3I68A 3K1GA 2QW5A 3TOPA 3M0KA 3KLLA 3M0YA 5K9XA 4GIAA 1QT1A 2DZPA 2P10A 3WZ0E 1CZ1A 1I1XA 1FTXA 5KZEA 2GJXA 1K3UA 5TD4A 3VOIA 3CGTA 1BSIA 1Q63A 1D9EA 2KAUC 4FB7A 1X8CA 5L9FA 1S2AA 1F05A 1JIBA 3APYA 5E0FA 4KCVA 1EJWC 1H50A 2X2YA 1H5YA 5AHLA 1QBBA 5HMFA 5GVJA 2JBMA 3GDLA 1V93A 5D05A 1M7JA 3CUFA 2J75A 1HP4A 3GC5A 3MYPA 4XZMX 3XIMA 2QPSA 3THQA 3ZIZA 4KRZA 4GJJA 3ITXA 4KMQA 1M68A 2ZX5A 3PK7A 5LNRA 3FGCB 4JKMA 3DDMA 3BGJA 3T9PA 2WOQA 4IPIA 4ADUA 1BTCA 5AYXA 2ZXDA 1BPLB 1BWLA 1YDYA 1ME8A 3LQLA 3RYSA 3QKEA 2RHGA 4HT3A 4GH3A 1E4NA 1EZ2A 1QWGA 6A3HA 3KFTA 3M5ZA 2PI6A 1ECEA 7PTDA 1U1HA 1R3RA 3L0NA 3Q37A 1LORA 1R3WA 4WXZA 4US6A 5BYWA 5DRCA 2G3NA 3NYDA 3TX9A 5BOEA 3HQ1A 1U1UA 3DI1A 3N13A 2A1YA 3GYCA 5E0KA 4HPJA 3R79A 2ZE0A 2OXNA 1E5NA 3MMTA 2DH3A 3BAXA 1NJJA 3MBFA 1H3GA 4D72A 2GSEA 1EDTA 3GE7A 4E2OA 4PUMA 4QG8A 1OGGA 5BW6A 3BAKA 1FWBC 4XV0A 4ICMA 3NSNA 1I4NA 5CSYA 1TZ9A 3E5BA 2WKLA 1TO3A 1QI0A 3IVUA 1OVDA 2B7PA 3KAOA 1TVPA 2DSKA 1XRSA 3HU7A 5MKGA 1RJRA 4PE8A 3CL8A 1DIDA 7TIMA 4V33A 1WO2A 2IUZA 2PZ0A 5CJMA 4ZE4A 5G2WA 4S39A 4B5XA 4PRRA 3NQ7A 1K6AA 4TIMA 3WQPA 2IW0A 2WMKA 5BXPA 1OFEA 3QW3A 3WQ8A 4AZ5A 1QW7A 4ZOBA 1RAKA 3VGDA 3GNRA 5J5DA 4I8YA 4JEJA 1DXFA 4Z17A 3UPWA 3SIMA 4RE2A 1A5BA 3L65A 4A2SA 1AW2A 1LRQA 1OCQA 3QLLA 1DTNA 4F0SA 1S5TA 1W3HA 3OP2A 1FA2A 3W82A 1SSDA 2PDQA 1JPMA 3DFNA 4L4LA 2GVGA 5DELA 3BK0A 3MTWA 1QJWA 4R7OA 4WKAA 4N0RA 5E9AA 1DP0A 1V6VA 3TC7A 2DIEA 2V5LA 3MI2A 3K8KA 2AL2B 3WYZA 3VABA 1GW1A 4S2BA 1TA3B 4K1WA 4UNLA 2BTMA 1XRVA 5MKGB 3DXIA 1VCGA 4P8XA 2WSRA 1J18A 3ZR6A 1R2TA 3JRKA 4Z2LA 3AHVA 4GXPA 1KBBA 2VRJA 3W6LA 4AMAA 3ONCA 4OZOA 3E3HA 5HK4A 1ZTVA 4R88A 1JJKA 4GYKA 2ODOA 4ZQNA 2UY4A 3RLVA 2XPKA 2Z2UA 2F38A 4K7YA 3PZTA 4JN7A 4S23A 3C8NA 2Z28A 3HJEA 3GHRA 2KZHA 3TN3A 4O4VA 1M3UA 1GVIA 3QGKC 2ZC1A 1LTDA 4DF0A 3CYJA 3LCXA 4GABA 4J3ZA 4JCMA 4LC8A 4BEQA 4JFWA 4GVGA 3WLTA 4PBGA 2I57A 2PGWA 3M6YA 2H3BA 3L67A 3UG3A 3VD7A 3W2MA 3C0LA 3T6CA 3AAMA 3RGTA 4GACA 5D37A 5C9ZA 1TG7A 5CEWA 2VWTA 3TU9A 3N2TA 2TODA 5C55A 3GHSA 2ISWA 4U4MA 2CC0A 2VDGA 4AFYA 3CTLA 4QAWA 4CEXC 1LRNA 3E12A 1H1YA 4GZEA 4ZCWA 1EC7A 3CLMA 4E3VA 4AF0B 3HO8A 3GXPA 3GTNA 4FIQA 1WAWA 4D8AA 4LBUA 1EUAA 2PDFA 3E2SA 1X1OA 4DYKA 4FEZA 4IJBA 1JG9A 4Q4KA 3T0AA 4MWAB 3GWQA 2WLYA 5I5RA 4JGDA 2PS2A 1VS1A 4DJED 5IOBA 1W32A 1M6JA 1UD5A 1CT5A 3QVQA 2CCRA 4XZLX 4Q8QA 3VIIA 4NX0A 3ITOA 1EOKA 3C56A 3P8IA 4BF9A 2F6KA 4JTIA 2Q8ZA 3HMJG 2YCLB 4C6PA 4UQ9A 1KRBC 3UY8A 3O07A 3SGZA 1KWKA 2FB2A 2YXGA 3IRDA 2D24A 3U0HA 3IJ7A 4I3GA 2PRHA 1Y0EA 4HZ8A 2PURA 4JNYA 2P5NA 1VD6A 3V36A 1H7OA 2ONEA 1F8MA 1TPVA 3RIKA 5BWAA 4LWWA 1US3A 1FVPA 2WXDM 2XSXA 4H7CA 3PBUA 5BZAA 1TJ1A 2ZRUA 3OOQA 5JIWA 1REQB 3WJZA 4GI6A 5C54A 2C14A 3WLQA 1M9HA 3IEBA 3S6OA 3OO2A 4E2VA 4LRTA 3NPWA 1B9BA 4LCQA 1C9DA 3WLJA 4ZOAA 3BSHA 1XKJA 3ONBA 2WZHA 1IIHA 4RZ5A 5CAHA 1NDVA 3TAKA 4AX7A 4HPNA 4UR7A 1XLJA 2ZZ6A 4XD5A 2VNCA 4YMZA 1J0ZA 5LNUA 5IDIA 2GVEA 4XVDA 2ZTJA 1W1VA 3IGHX 1S3HA 4DM1A 1RY8A 5T8GA 4RKAA 5AZ1A 3ZT7A 2R1MA 3PPGA 4E2DA 4W7UA 4JTCA 3F4NA 4IJRA 1CXHA 1G0CA 1WA3A 3NGFA 3H54A 4ZTXA 3QC3A 2ZX7A 3ES7A 3GG8A 1FX6A 3ZT6A 1U33A 3HQPA 3SRFA 2QIWA 1EP3A 4XSMA 2P8BA 4PTNA 1OF6A 2EJAA 4CKQA 5CKSA 2PDNA 4R9XA 4QITA 3TYUA 1UWQA 5FSEC 5LNSA 2C91A 1FDZA 1BYBA 3MUIA 4GUHA 5XINA 1L6WA 1S2VA 1JDCA 2CU0A 2OLAA 3EEGA 3SURA 1H51A 6XIAA 3I10A 4XK2A 3LGDA 2PDLA 4KWSA 5AHNA 1P0EA 2PGRA 1TCDA 4DJDA 1EGMA 4IFKB 5CSSA 4QROA 3VD4A 5GNXA 1OX4A 3FJ6A 2XN2A 1JI1A 3HGJA 1BQGA 1OM0A 3H2OA 1PEZA 3GHUA 3ZSTA 5DY2A 1VIZA 2OU4A 5CGQA 5DF0A 1EH9A 1O7AA 3PWGA 4YXGA 4DUOA 3S4TA 2DSWA 3URBA 4UTJA 1ZJBA 2YL6A 4EOUA 1TJ0A 5AYYA 4E6MA 2GJRA 5JIPA 2J74A 4QJ1A 1XDMA 4GVFA 4A05A 2WVVB 3GUGA 3OVQA 5AHEA 2CZDA 1CB2A 2G0WA 3O0KA 3U3HA 1W56A 1PSCA 4GUJA 1MI3A 4B5TA 2HK1A 3EA2A 5D2TA 1TRIA 3TCEA 4MJMA 1QO2A 3R8HA 3O1NA 2W63A 2DT3A 3RNDA 2B7NA 2IMRA 6PTDA 4NXSA 3KM8A 4S38A 5D2VA 3MKCA 1BKSA 3U2EA 2NLYA 3MKKA 5A6BA 3ZLFA 4R9OA 3VGEA 2QJIA 1FWWA 3FYPA 3T8LA 3VCNA 2ZXQA 5HANA 1SW3A 5EL1A 2BLEA 3N15A 3H26A 1KRMA 1C7SA 4XG1A 1KR0A 1ECQA 3WUBA 5KMYA 1WDDA 2ASHA 2EAWA 3EXRA 4GK8A 3KS6A 3LEPA 5H1WA 3F7JA 5JMUA 2WZIA 4QFUA 3K5XA 1A5MC 2NV1A 3CAVA 1U5JA 4L4MA 3CUZA 4RK8A 4F3HA 3WQVA 2VENA 4IPNB 4IJCA 4C5YA 1JNEA 4FNPA 1GVEA 2HTMA 1K9TA 1TTPA 2OO6A 3NQBA 1WCGA 3W7HA 2DZVA 2Z2BA 1UD2A 3W7NA 5JU6A 3LHVA 3NQVA 4JQ1A 1V6WA 2UZ9A 2YW4A 4JIPA 1RBLA 4JN8A 1TIMA 1CGTA 3A4WA 3GVRA 1ZBWA 1NF7A 3NL3A 2WWDA 1CLKA 1ZY9A 1W3KA 1POKA 4DZ5A 2F61A 1QNOA 2ZE3A 5HR6A 1LWJA 4RV3A 1EP2A 2X41A 4YCPA 1TZZA 3IJQA 2QVHA 1F7BA 4L9XA 3SAZA 3PZNA 2Y8KA 4G1KA 4DUXA 1J6PA 2XU2A 1TWWA 2WC4A 1CIUA 1G4SA 5HR7A 4M6UA 2P8CA 3PHAA 2VFDA 1UH2A 2I7GA 5KINA 4XVEA 1BXCA 4U2YA 2BV9A 4WDTA 4Q32A 4NNAA 4F0RA 1RBAA 1XQKA 1DBTA 3KZPA 3TA9A 4BEUA 3IIVA 4JTLA 3R11A 2O7QA 3VOHA 1U30A 3G6LA 4PUUA 2J8GA 3TSDA 3UBPC 4YNGA 4UXDA 3TMLA 1UPMB 2ZYFA 3O2LA 2V8ZA 1RA0A 3S1GA 1YPXA 1DWAM 1L6YA 4KGLA 2UBPC 4J3TA 3CZGA 3S3GA 1XRTA 4AXKA 4K68A 2OCZA 2BX7A 1EWDA 3OLGA 2HJPA 5LA2A 4P8UA 3RCYA 1FWIC 1CLVA 3RAOA 3PWIA 4B91A 5CGMA 3CIWA 5KZDA 1J93A 4TV5A 5CSRA 1IT8A 4RLIA 5ENLA 4TXEA 2XVNA 1QI3A 1J0HA 1PIFA 1A0DA 1UWUA 1GHRA 1C92A 1OB0A 1W9XA 2E28A 4F0MA 2G3MA 4BWLC 4DAIA 4KFNA 2ZA2A 3LCIA 3EWUA 3EX6A 5F2MA 2HNEA 1XUUA 3SO7A 1CEOA 4DBWA 5H6HA 4AEEA 4W87A 3MDWA 3BZJA 5AVNA 1ODUA 4ZQMA 2QUVA 3WIJA 5I00A 3WF3A 3N9KA 1TREA 4IPJA 1MDRA 1SJCA 3EX4A 4ZQPA 1XYFA 2DJLA 4TX9A 1R9XA 4TVDA 2GGHA 3QH2A 2UWFA 4YVVA 1QO5A 1KFWA 1MUMA 2QIIA 2ATMA 1XIJA 1UH3A 2VCBA 2XHYA 4LYKA 4UTUA 1E5JA 3V75A 3WBXA 4AB4A 3FHAA 4NI3A 4F0LA 1KCXA 2O9OA 4YTTA 4OBRA 3LZ5A 4UMCA 4PUWA 1EDGA 1Z32X 1RPXA 4FXJA 1CGXA 4DO4A 3RDKA 1HXJA 1EJTC 1R2SA 2VR5A 4MUPA 2ANUA 3MHGA 3WH7A 4AQLA 3W7RA 5CC3A 4UBPC 3VOJA 1VF8A 1IYXA 4NJIA 2FYMA 3GW0A 1FCVA 3PM6A 2WCSA 4KWUA 1QUMA 4C6KA 2XH0A 8CGTA 3OHMB 3LMZA 2PEVA 1CXIA 4C6BA 3O63A 2YW3A 2JGQA 1WDQA 3GM8A 4H9UA 3WNMA 3HFYA 3KP1A 5HMSA 1SVDA 1O4UA 2QGHA 1KM5A 1W6TA 2I5QA 3EMQA 4M80A 3T42A 1A5OC 3GR8A 2OOGA 3H2AA 2FGBA 2NQZA 3BWWA 5AN7A 1Q6RA 3SM0A 3VC5A 3BLOA 4CD4A 4LT9A 2B4GA 4HNOA 2V69A 1VFHA 3S0CA 3WBEA 3SDOA 1BYDA 4P7LA 4O0ZA 3ZOAA 3U7BA 4DVOA 1OFDA 2WMJA 5F7UA 4RXFA 1K7EA 3JUGA 4Z2JA 1JDDA 2J7BA 3GX9A 3GVQA 1VYSX 4ZSTA 4QISA 1UWAA 3P80A 1KRAC 1KRCC 1ADSA 4CQCA 4GIRA 1EHNA 2WMFA 3N2CA 3QYQA 1KBLA 4DIAA 1UR2A 1NVMA 2JIEA 3H2FA 3UWVA 2CLIA 2J9ZA 1LUCA 4G7EB 4QLLA 3WLHA 1O94A 3W87A 1XV8A 3MMUA 3P82A 2VC7A 1WKFA 2YOCA 3SCRA 3RILA 4JIQA 1J0JA 3G22A 4S3KA 1BRLB 1UKPA 4FR6A 1ICQA 3R58A 4UTLA 4UCGA 3WQGA 3W26A 3TKFA 1A5KC 3O06A 1JULA 3CWNA 3DHPA 3D3AA 1ZCOA 1FOBA 3QZ6A 4ROPA 4WUIA 4AWTA 2XG9A 5I0DA 2INZA 1FWHC 1S39A 2HISA 5LGXA 5GPRA 1VHCA 3BQ6A 3NPVA 4LY4A 3LLFA 4Q4MA 3BLLA 4A2RA 4E0CA 5AFDA 5E6YA 2WBGA 4PMVA 4PMXA 4GIYA 3W1MA 2ACQA 2VZTA 4TO8A 4AIOA 5KSWA 4CEUC 3L4UA 1H1NA 3F5KA 1KLYA 4FZIA 1V79A 1LG2A 1LG1A 1ODZA 4TX6A 4U33A 3F4CA 1LBFA 2PWVA 3H8AA 3TNOA 3ICJA 3OVRA 1N82A 3W9ZA 1MFVA 4R85A 2GGIA 4EXQA 5H2ZA 3KOYA 4QQ3A 3U4FA 3FS2A 1VP5A 4MWAA 2XVGA 3G3DA 3VKKA 4LC6A 3VCCA 2ZZ7A 3NOYA 3TQ0A 4OUIA 3L9CA 4HK6A 2A4AA 1QAPA 4ECLA 2NT1A 1UOKA 4W89A 3WEMA 1XWYA 1E55A 1FFQA 3C2RA 1M04A 1EGZA 3MP5A 3W02A 3XINA 3BLKA 3L4YA 5AC6A 1NWSA 5KETA 2CBVA 3L4TA 2ZX9A 4NP7A 1Z8AA 4EWJA 4QLJA 5EMYA 3PUGA 4S3FA 5CXPA 2SFPA 1HP5A 4JKKA 5HULA 2ISSA 5FJOA 3W07A 1ONWA 2BY0A 3TN6A 3KVJA 4D6JA 4XD3A 4WZHA 4JTTA 2UV8G 4X0VA 1YXDA 3FX4A 4UQAA 1JI2A 3VINA 1E3ZA 2IPFA 1WKDA 4EK7A 2VMFA 5BRQA 5LA1A 3U5UA 3MVTA 4D8ZA 4Z1CA 4GO8A 2QQ6A 2ZRYA 3SUUA 2DZXA 1QI5A 3H2CA 3LNPA 2DPEA 1VJSA 5C71A 4GGHA 4NZJA 2P0IA 4K8GA 3N19B 5ABTA 2J7CA 1W3LA 3AMKA 3J7HA 2G3FA 4UZUA 3W1TA 1TVLA 4U31A 5C70A 1MO0A 3DFOA 1OD8A 1GUVA 4B3LA 3B8TA 1OJXA 1NWTA 4DJFC 3N25A 2MANA 4US5D 3JU2A 5DQPA 4XUGA 3I65A 3BUVA 4M5PA 3GC2A 1FHVA 1BGGA 3S1WA 1GWJA 1TV8A 1TPC1 1YTKA 3EYPA 2C19A 1IZJA 3LHWA 2GUYA 1MXDA 4BR1A 3R43A 4NYUA 4JYEA 3Q2DA 3T81A 3D46A 2OEJA 4DO6A 4EANA 4LB3A 3I6RA 4FNSA 1PTGA 2QJNA 1Y7VA 5CPSA 1PX8A 1S46A 2BOFX 3ZJ7A 3BANA 2BY3A 3M0MA 1J10A 4XIMA 1SZGA 2IKJA 3RM9A 3QLDA 4I9AA 1I8JA 3BOLA 3VA8A 3KBNA 3UWYA 1GOXA 2PDUA 4NSBA 4IUOA 2F84A 3U8GA 5A2CA 1UZHA 4Q33A 4J9JA 4LAOA 3KEHA 4LJ3A 1A5LC 8TIMA 1R9YA 2POZA 4KKXA 2ZRZA 1YQ2A 3BZGA 5KTLA 4U3CA 4GQQA 3VX0A 2XM2A 5KZ6A 5K4ZA 4RPPA 1JFHA 3MSDA 1OCBA 3SUSA 1UD8A 3RRXA 1YYAA 4R7JA 4ZO9A 4H8UA 3W7MA 4C7FA 1VCVA 1LBLA 1O66A 4DWSC 1G69A 1W1PA 1OYBA 4AWEA 1RK6A 1AMKA 3GG7A 5ECVA 3PBGA 3B9OA 2D3LA 4LU0A 1T96A 2YA2A 1NOUA 1ISYA 1EIXA 2QKFA 1P1MA 3AU2A 3PNUA 4C6JA 5ABEA 3NEHA 1F6PA 1EEPA 1QFEA 4HN8A 1SGJA 2XFWA 2FPVA 3D5HA 1E1FA 1KW1A 3ZQ9A 1V3MA 4WY0A 4OTKA 2CLHA 3PUEA 3ZR4A 4OE7A 3VD9A 4NZ4A 3QFWA 4LCRA 4C65A 1ONXA 2WPGA 3M7SA 1QHPA 1UKOA 4CU6A 4LAUA 3WK3A 4KPLA 3CH0A 2V3DA 3IARA 4JFVA 4WGXA 2W92A 1GOWA 4H9TA 3TYBA 1BG4A 5H8UA 4OQVA 5CSUA 1GQKA 1VLWA 2OOFA 5D8WA 2QV4A 4FX6M 1BHGA 3R4IA 4CD7A 3MKVA 1O5XA 3WNNA 4IMGA 1IF2A 2W66A 1T8QA 3NQEA 6TIMA 3CYVA 1IWBA 1FP8A 3DYOA 4KIEA 1J2WA 4ZE5A 2NX9A 1EIBA 5TNVA 4D8LA 1DIEA 3W7QA 5JBFA 4Q4RA 1V5XA 2WSKA 3TN5A 2QXWA 3MYOA 1W3IA 3O05A 2BGNE 3KOFA 3DESA 3UA3A 4QLKA 4ZO8A 2XSBA 4UQCA 3THAA 1V03A 2R6OA 3T2PA 2G96A 2QCMA 1IGSA 1ZCCA 3KCLA 3WDPP 2WW5A 2OYLA 2DP3A 4LRSA 3TZNA 3WEZA 4IQJA 4J3XA 1HUVA 3M1ZA 2AOSA 4AY7A 2PTZA 2Z1SA 3AS1A 1VC4A 5FJUA 3ECQA 2GJXB 3AXXA 2XUCA 2ZRVA 3STEA 1VENA 3JW7A 1YIXA 4K3ZA 3G18A 9XIAA 3MWAA 1CDGA 3AZSA 4Q3MA 2Z1KA 4AYGA 2CBJA 5C9UA 1F6KA 1HO4A 2J88A 1DE6A 1DQWA 3WDHA 2QMKA 2JF7A 3A4JA 3MZ2A 3NQAA 3UXLA 4LB4A 4RNHA 4JIRA 1DIOA 1WXJA 3T0BA 2Y85A 5AC5A 1V6XA 3PZMA 2X7VA 2Z1XA 4ZEPA 3GG0A 4GI9A 2OGYA 4GY7A 3ABXA 2RDXA 4AIEA 3PPFA 3KHDA 1V0LA 3NR0A 4URIA 1KQZA 2A21A 1C3FA 4JNZA 4ZB5A 2Y5JA 3E1F1 3CK5A 3EX3A 4YWIA 4R3UA 3BLDA 4Q7NA 2VZUA 1UG6A 3VZZA 1W1YA 4O0QA 3VK5A 4A6GA 1AUSL 5JQ9A 1JQVA 4M29A 1XLBA 3ITLA 4C5ZA 1ITQA 5FJPA 3VAVA 5FF2A 1TSIA 2D2OA 2E3ZA 3CMFA 3SQSA 3LCGA 1F73A 3ABZA 2PTYA 1NFPA 4GUFA 1JZ5A 5A3HA 3ZM8A 2O7SA 8XIMA 5PTDA 3SGGA 1WBHA 5E1QA 3DENA 2GDQA 5AC7A 3NL5A 3P74A 5HDRA 1GYMA 1NOWA 3KP0A 4HPXA 1AJ2A 4XKYA 3VIHA 2HMCA 4K37A 1S2UA 3NDYA 3GNOA 4H2CA 4UTIA 2WMIA 3TJXA 1NDZA 1I2RA 2DU2A 3IV3A 1LOSA 5A6AA 1AQ0A 1ZHAA 1TPFA 2O9TA 3VX1A 2ZDSA 4ATWA 3PTKA 4DLMA 1XBYA 4IP4A 3F5LA 2CLKA 3C3NA 3AI0A 1A50A 4H8VA 3EWWA 3SUWA 1Q85A 1FQ0A 1GG0A 2A85A 3WMLA 4J3UA 4AG0A 4DXVA 4O1DA 3FNDA 3W7OA 2DEPA 4XTDA 4RCXA 1PYFA 2Z6IA 1AD4A 3GS6A 1E56A 4Q4SA 4MLJA 5CBJA 1DJQA 2PLMA 3MO7A 3UYIA 1RY0A 3HURA 1JCTA 4NKCA 1FH7A 5GNYA 1PZ0A 3AWNA 3WG6A 3DFSA 4YVPA 1XLAA 3JR2A 1W3TA 4J3WA 4Q7BA 4LVBA 1R3QA 3PBMA 1QWKA 3AZRA 1J79A 4UTHA 6REQB 2VL4A 1E6XM 1WUEA 4LSBA 1WZMA 4P8WA 3H4GA 1PS9A 3RLUA 1W0MA 1K7FA 2CKSA 1ONEA 3UZZA 1BVZA 4ZOEA 3PJUA 1W1ZA 4GFIA 4PUNA 4Q8MA 2GZXA 3SI9A 1UIPA 2J9XA 2D73A 5DMNA 3UG4A 3F03K 3OODA 4XAFA 4GPNA 4B5WA 1TMQA 2ABBA 3DIPA 3L5LA 4DF2A 1RUSA 1GZGA 2AKMA 3BICA 4UMAA 4AIBA 3QW4B 3LUTA 3WY1A 1CWYA 1QNQA 1V3LA 3VNZA 5JXQA 3VYLA 1ME9A 3UCDA 1B3WA 2V2CA 3CV2A 3SZ8A 3H6OA 1Y5VA 4C6EA 2CLOA 3WH6A 3RFAA 1D7KA 4PULA 1V6UA 5D30A 3ZWSA 1K03A 1UD4A 2CWNA 4N9CA 3IAQA 5A95A 1H09A 3ME3A 1Z7AA 1T6MA 1GKRA 4XZHA 4ERGA 2ZICA 4CN6A 3W81A 2NUYA 4F2UA 1P6CA 4Z0SA