1F2JA

Crystal structure analysis of aldolase from t. brucei
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
357
structure length
357
Chain Sequence
SKRVEVLLTQLPAYNRLKTPYEAELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYRALMLECEGFEQYISGVILHDETVYQKAKTGETFPQYLRRRGVVPGIKTDCGLEPLVEGAKGEQMTAGLDGYIKRAKKYYAMGCRFCKWRNVYKIQNGTVSEAVVRFNAETLARYAILSQLCGLVPIVEPEVMIDGTHDIETCQRVSQHVWSEVVSALHRHGVVWEGCLLKPNMVVPGAESGLKGHAEQVAEYTVKTLARVIPPALPGVTFLSGGLSEVMASEYLNAMNNCPLPRPWKLTFSYARALQSSAIKRWGGKESGVEAGRRAFMHRAKMNSLAQLGKYNRADD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of type 2 peroxisomal targeting signals in two trypanosomatid aldolases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE, GLYCOSOMAL
total genus 145
structure length 357
sequence length 357
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2000-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f2jA00
2BXVA 4MPQA 4O1DA 4ZQMA 4D2JA 1A53A 4TO8A 5HULA 3STCA 2QUTA 3NZRA 3C4UA 1FWWA 3LXBA 4GUHA 4KWVA 4K8HA 3HPSA 4BI6A 3UWZA 2G97A 4UTTA 1G4EA 1NSJA 3TU9A 2E1DA 2OJPA 4WUIA 3M41A 1VLWA 1S3HA 3Q58A 3CEPA 2AGKA 3I6RA 5ABTA 4N9BA 3DKJA 3UZJA 3M43A 4IXXA 5AC6A 3TNOA 5T26A 5LHFA 3L67A 3C61A 4DO6A 1LP6A 5KSWA 5G2WA 3NL5A 3ANYA 2VEKA 1NF7A 4LU0A 4NQ1A 4R33A 3M5ZA 1TREA 2J9XA 4FNUA 3PAJA 3RF9A 4IUOA 5FI8A 3TSBA 4UCGA 2EGZA 3O07A 5K9XA 2Y63A 4K7VA 2Y7EA 5CPMA 3B04A 3O6DA 2J9ZA 3LTSA 5KITA 1AW1A 1P0NA 1I8JA 4UFLA 3BPWA 3TSDA 4N9DA 1KM2A 4NUWA 3DI0A 1D3GA 3W7IA 2W79A 2VFHA 5U7SA 3NM3A 3RLVA 1H51A 3NQEA 2A7RA 2QKFA 1YTKA 2QR6A 4HIBA 3ATYA 3GX9A 3NQDA 5DBTA 5EL1A 3G1FA 1EWEA 1BWLA 3NGJA 2C1HA 4NX5A 2D73A 4XBSA 4OHQA 3EX6A 1SPQA 3UWYA 1SZNA 1YADA 2FIQA 3W2UA 4BK9A 3UY8A 1TSIA 3NNTA 2WV8A 3HGRA 5C5YA 1KBIA 4KFPA 1OK4A 3PWAA 5HNRA 3W88A 3B05A 3CIXA 2G95A 2C15A 1LBFA 2GVLA 1OFOA 3L5MA 2A7NA 5AC7A 4XKYA 2RDUA 1KM5A 2ISVA 3LCFA 3N2MA 2CLHA 5K3VA 4JYEA 5L9FA 4OT7A 4MZYA 3OBKA 4C1LA 1Q6RA 2VENA 2YFOA 3O06A 3W7MA 2FQIA 4Y6GA 1JCLA 2NLIA 3W74A 2TYSA 2EAWA 4O8RA 3HMJG 5C6MA 5BMWA 5J5RA 2JGQA 4ZQRA 2RKXA 3B03A 1TV7A 5SWUA 1LORA 5FESA 3S8HA 4KWWA 2QJIA 3GDMA 4Y96A 2VC6A 3PBYA 1X6UA 1T96A 3C0JA 2E09A 4K8EA 1F5ZA 1MEIA 3CC1A 3TFXA 4ADSA 5AN7A 5K4ZA 4GFSA 3U6WA 2FB3A 3T78A 3I7RA 3NVTA 2FLIA 3W84A 2VFFA 2WOQA 4FXRA 4NJGA 3KOFA 4O0KA 2DZTA 3OVPA 1EPXA 3QQ0A 1T99A 3UWWA 2ZRYA 2PRMA 1KFEA 4AAJA 4DBDA 3H55A 3RMJA 3QZEA 2I9EA 1W3TA 1Q45A 2Y7GA 4RXGA 1K7FA 3A5FA 4JY9A 3HGOA 4JDBA 3STEA 2YR1A 2VFIA 1PV8A 4ZQOA 5HJLA 1JQVA 4NNBA 3P5ZA 3BO9A 1RR2A 3KRSA 1VYRA 1G67A 1VPXA 3W1RA 3LCWA 4DF0A 2YYTA 2R8WA 1OFAA 1C8VA 4ADUA 1W56A 1TPEA 5F1VA 5TBOA 3Q94A 1L6YA 4NNCA 1SW0A 4UTUA 5LNRA 2H6RA 1UUOA 4RX0A 4JX6A 3O8AA 4TX9A 3M44A 1ME8A 4CNPA 3PB0A 1ZENA 5IBXC 1VJIA 2C13A 1YYAA 3VFLA 1FCBA 2ZA1A 3NQ6A 1KBJA 4MOZA 3UWVA 1EP2A 4QNEA 4AWTA 3KVLA 3L0KA 2CW6A 3O16A 2ZZ4A 4PH6A 1TRDA 1W54A 1H1YA 3BLIA 3N9RA 4A22A 3W1XA 4Z1BA 1WDWA 3EX1A 1W5QA 5I3GA 3CB8A 3W85A 3L68A 5K9DA 2X1RA 1OFRA 3IVUA 1JR1A 1TPVA 4PL2A 4UFKA 1LLWA 3NPUA 1VH7A 1TIMA 4FF7A 2QAPA 2ZTKA 3C6CA 3Q37A 3C2OA 3G0XA 1DQXA 3W07A 3HB9A 4N6EA 2NUXA 3LOTA 3LCIA 2QDHA 1W1ZA 2CLMA 2E68A 1H7XA 4UR8A 5EA9A 1DHPA 4JXCA 1XL9A 3S1WA 4LVBA 1FCUA 1PHWA 3S1UA 4KFNA 2QCLA 3NZ1A 3ABRA 3L65A 2NXHA 4JN6A 3LLDA 3UY7A 1JCYA 4ADTA 3W6YA 1G6CA 3TXVA 1RV8A 4N02A 4R53A 3PULA 3USBA 4HPJA 4R7JA 5FF3A 2GPTA 3LGEA 3DU0A 4CNOA 4O14A 1OVDA 1XBXA 1LOSA 3BG3A 2A5HA 5LGXA 4WZHA 3N34A 3GDKA 3WK2A 3IGSA 3UPWA 2XFWA 2EPHA 3FS2A 3H54A 3M16A 3DENA 1H7NA 1ZCOA 3GDTA 4JNMA 3MI3A 2OCZA 4GBUA 3DHFA 1EIXA 1OYCA 4O19A 4E38A 4ZZ9A 1MZHA 4OBTA 1S5VA 3F4NA 1F2JA 1ICQA 4LRSA 1XC4A 1YPIA 3MYPA 3WK3A 4LC8A 3ZFHA 8TIMA 3M5XA 3W23A 4PTNA 2C16A 2VFEA 2X30A 3M0ZA 3W22A 1IXOA 1O94A 1W5MA 1FBAA 4JTSA 4LS0A 5LNUA 2Z1BA 5F4XA 1P1XA 3TDFA 5IBXA 4M7SA 2A4AA 3O6CA 4G1KA 5F2MA 3NQ7A 1L9WA 4MJMA 3SJ3A 1FCVA 4LNYA 1KM3A 3ABSA 1FDJA 1U5JA 1GEQA 4HSNA 2WKJA 4JY8A 1PIIA 1VCFA 2RH9A 1OX5A 5CKSA 4Z1DA 3W2NA 5DLCA 3GZ3A 4DF2A 2UV8G 3SFKA 1KLZA 2WNZA 4PL1A 2IQTA 5FF0A 2ZZ5A 4WXYA 1KLYA 3LXAA 3W83A 3VI2A 1EUAA 3M5YA 3LLFA 3UYCA 3SECA 2ZRWA 4N9EA 3C8FA 2G96A 1WYIA 3NDOA 4HNNA 1SU5A 2H90A 3LHTA 5FEXA 3QF0A 3RU6A 1VCVA 3R5EA 5KINA 3QEZA 1G7UA 3LBCA 3GR7A 2QCCA 2E6FA 5DY3A 3DFQA 1ML1A 3GXPA 4GUGA 5CZSA 4B5NA 4YCPA 5D09A 5D37A 2HS6A 5E0KA 2ZZ7A 3N3MA 3C2FA 4POCA 2ZA2A 4W9TA 4A21A 2WO5A 2DJXA 1I45A 4Y8FA 5K9CA 1V5XA 1SFLA 3DFTA 4P61A 1FWSA 5K4XA 2ZFAA 4O15A 2F84A 1XUUA 3TMLA 2Y70A 4Q4KA 1QPNA 1SFJA 3SSJA 5FF7A 1I4NA 3SIZA 1MEWA 2J27A 4UTKA 4AXKA 5HWMA 2GUUA 3T4CA 4JR5A 2GQ9A 3EX2A 1DJQA 3LX9A 2CZFA 3O6YX 2J9YA 3L5LA 4UXDA 2Z0IA 3UD6A 3TAOA 1RPXA 2FDSA 1T8XA 2J24A 3M7WA 1J5TA 1PE1A 1FDZA 2CFFA 1R47A 2OZ0A 3L21A 1TJPA 1O5XA 5AYYA 1Q6LA 1SSDA 2P10A 3PBWA 5D05A 3RFAA 5HMSA 1SZFA 3G0UA 4Y90A 1TYGA 1S5TA 4FHAA 4O4VA 3TQ0A 4R34A 1ICPA 1XBZA 4CLMA 3ABQA 5L6UA 1FWNA 4LUJA 1I2OA 4UTIA 4A2SA 3IIZA 4Q33A 2ZRZA 1TPC1 4BI5A 1LRNA 3MMTA 2YSWA 4NZJA 1ME9A 2CLEA 4AH7A 4CCEA 1GVFA 4ICNA 3MJYA 3W1LA 2V2CA 3TK7A 2QAFA 3G1SA 5HQEA 3LDVA 3B0VC 3NPVA 4GNJA 2Q3RA 3AO0A 2H8ZA 4FIQA 2C3ZA 1KTCA 2NXGA 4UMCA 4LVGA 2FTPA 1ZAIA 5EKYA 3W87A 3K30A 4FNRA 5AFDA 4UTTC 1TV5A 1JCJA 2E6DA 3GAYA 3QW3A 4OWGA 2ZZ6A 3CT7A 1VZWA 2XN2A 3G3MA 4GE8A 4UTMA 4A3UA 1OJXA 1TTIA 3W1PA 4O17A 3W2MA 1CX9A 1OYBA 3IVSA 4AMAA 3BW4A 4J9JA 2FJKA 3OIXA 5CPLA 4JD4A 1FY6A 1W3IA 2C19A 1H7OA 4OGZA 3G1HA 3EKZA 3LCGA 2C14A 1QPQA 2GJNA 3PB2A 1K8ZA 1V7YA 1KM4A 3DKLA 4MLRA 4QJ1A 3PBUA 2DZWA 1KFLA 3LHVA 1LDCA 1SUXA 3CQ0A 5DBUA 3WK0A 2BSLA 3W2JA 5LNWA 4IJBA 1QR7A 4JTIA 4ALDA 3GK0A 4AHPA 3BG9A 3KVJA 1HG3A 1W5OA 1H61A 4S2CA 5CPNA 3QW4B 3PC0A 1TPFA 4TMCA 4HNUA 4LTSA 1X1ZA 2ZTJA 1R30A 1OYAA 3IIXA 1LOLA 5F4SA 4WXZA 2BZNA 3FLUA 1LZOA 3W7QA 1H7WA 4FNPA 4UMAA 5G4EA 3TJXA 1ZY9A 3UXDA 4GUIA 1DQWA 2TSYA 3I7SA 3UZ5A 2YCEA 2ALDA 1Q3NA 1RD5A 4Z1AA 4ZQPA 5G2HA 3SGZA 1TTPA 4MY8A 1HTIA 3LHZA 3T40A 1EWDA 2V5BA 3W7LA 1KFCA 3FOKA 3TXZA 3LRMA 4IOTA 2VXNA 3CEUA 3CHVA 4JTUA 4YWIA 4EF9A 4O1AA 1YDVA 4JYDA 4A29A 3KFTA 4FXSA 1R2RA 4JIPA 2H8XA 4UR7A 2R94A 4IMCA 5TQLA 3W2KA 2FPVA 3SW6A 3IRDA 2QJHA 3UXAA 4PCFA 5F2GA 3C2VA 4YMZA 1K3UA 3W1UA 2NWRA 4UTWC 2DORA 3W3OA 4YXGA 1EP3A 3NQGA 3OEXA 3C3NA 4UC5A 4AHQA 2NX1A 1A5CA 2ZCGA 2B7OA 1PVNA 4CCDA 4XQ6A 4DELA 3B4UA 1TTQA 4XTDA 2WQPA 1VRDA 5CSSA 3PM6A 3TQKA 4OE7A 4L4MA 4K39A 3CTLA 4K7YA 3W72A 3LCHA 1QOPA 1FUYA 1LRTA 3HQ1A 4AWSA 3V1PA 3TV8A 2GJLA 4BI7A 3E49A 3PBVA 1SZEA 3QRHA 4JX5A 4UFIA 2CWNA 2E77A 1RQEA 3DGRA 4NJKA 3ZS4A 4AWUA 1H50A 1A5BA 2E6AA 3I7QA 1LYXA 4Q32A 3W76A 1H1ZA 3TC7A 4EWND 3W7DA 3BW3A 1AW2A 4UNKA 1TB3A 1SR9A 4TMBA 3VE9A 1PCWA 3FJLA 1K7XA 1NVMA 4BWLC 1ICSA 2C0AA 3PUEA 4P2VA 2QDGA 3HGJA 3G1YA 3FEMA 3MP5A 3QPZA 3QMRA 4MYXA 3TFCA 5FEPA 1W5NA 3O15A 5EY5A 4M7TA 3IV3A 3W7NA 3W86A 3VKJA 1P5BA 1G4TA 4CNNA 3FFSA 2QCEA 3LM7A 1JUEA 3NAVA 1XDLA 1O5KA 4GC4A 2CZ5A 5GVJA 4GUFA 3STGA 2QCDB 4GWEA 4NJIA 2JBMA 3W70A 1G69A 4RZ4A 5H91A 1EA0A 4JIQA 2NUWA 4WD0A 4ORIA 3EXSA 2TRSA 1LLZA 4GUJA 3N9SA 3INPA 4O52A 2QCHA 4UTWA 5D2WA 4JTHA 5AHEA 1W31A 1SZGA 3W73A 2PRLA 2HTMA 4RZ6A 3N19B 3I65A 3FYOA 6TIMA 3STFA 3P60A 3ATZA 3TIMA 3EXTA 1O95A 3NXFA 4Z0JA 2NX3A 2HMCA 2AAMA 4XWUA 1A50A 2TPSA 5G2IA 4QM1A 2F7FA 1ZALA 4M6QA 2J88A 2YGYA 4E2DA 4YL2A 2E5CA 3HG4A 2H3DA 5A8GA 3DH7A 1VYSX 1DV7A 3UNDA 1OF8A 5EBUA 5HWJA 1Q6OA 5HR7A 2Q8LA 3NPXA 1IIGA 5F4WA 3G1VA 3HPXA 4NZFA 1WX0A 4NVTA 4PC8A 3WJZA 1AW5A 5D32A 1SO3A 1VLIA 2BLEA 1FWRA 1VHNA 3G3DA 4LY8A 1VC4A 1SO4A 1SW3A 4JX4A 3NL6A 3P82A 4Z08A 3SR7A 3TR2A 4LVDA 4HNVA 2NZLA 3AJXA 3P5YA 2G5WA 4Z1CA 2JKAA 1ZAHA 1GVQA 1LROA 5G1TA 4WQ6A 3GVGA 1K8YA 1QO5A 1Y0EA 3KVKA 3MO7A 6ALDA 2ZRUA 1B9BA 1AMKA 2FPTA 3S6DA 1Z44A 1O4UA 1C9DA 3N14A 3G24A 3R8RA 4N4QA 5AYXA 3T44A 4OV4A 1D9EA 3DFSA 4I7WA 1QO2A 2V2DA 2DZXA 1JRBA 3F03K 4CQ9A 4UNLA 1NAL1 3S5OA 3LCXA 2NV2A 4OU1A 1ZFJA 4IMEA 4IMDA 1KM0A 3TJLA 1OFDA 1OFQA 2WSQA 1G4SA 2FFCA 1GYLA 5U4NA 3KRZA 4E0CA 4FO4A 3D0CA 3H53A 1ZJIA 1GT8A 1KFBA 3G22A 2V8ZA 3HJZA 4UIOA 1KFKA 4H3DA 2JK2A 4JDYA 5DN1A 2XN0A 3LI1A 4IX0A 4LT9A 1AL7A 3EX4A 4N4PA 4FB7A 4MKNA 1VHCA 3FYPA 1OFBA 1JJKA 3MBDA 7TIMA 3EXRA 1Z48A 4HT3A 3IIOA 1OFPA 1E51A 1XM3A 1WBHA 5DXXA 3JRKA 5D02A 5AHMA 1N7KA 1DORA 1K03A 4RLIA 3NL3A 4FEZA 3DBPA 4M5PA 5AYZA 3LB0A 3THAA 2ZA3A 4OV9A 5I3IA 1FX6A 3TSMA 1NEYA 2Y6ZA 3W7RA 3CWOX 3OVRA 3G1DA 1GQNA 1VR6A 3M47A 4CQAA 5CSRA 2O7SA 4JEQA 4NXKA 2VKZG 1EUNA 1G7VA 1H60A 2WNQA 4M6PA 5D33A 4I9AA 3MHFA 5DELA 4AB4A 3W1TA 2V81A 1IXQA 3G18A 4AEOA 2NUYA 3OA3A 4PFMA 3TAKA 3W7JA 4S2BA 1HUVA 3FKKA 1WBJA 2Y7FA 1UB3A 3W9ZA 5HWNA 4IWWA 4LUIA 1YPFA 3B06A 1F05A 5D03A 1GZGA 1YXDA 4DPQA 3NL2A 1MEHA 4YLWA 4MFEA 1SO6A 4LW7A 2Q8ZA 1MO0A 2ZRVA 4XKYB 3IVTA 4DO4A 4QQ3A 1FCQA 4ONVA 4PODA 4XZ9A 3TW7A 1YTDA 1XBYA 5MHBA 3WJYA 3EWWA 2GVGA 3O1NA 2I14A 3FKRA 1GTEA 3WJSA 1JVNA 3QPYA 4QISA 3KX6A 2GVJA 4UUIA 3KRUA 3HGSA 1GVRA 3LTYA 4JTKA 3C2RA 1JRCA 3EWXA 3MUXA 4QAIA 1RQBA 3LHWA 4HKPA 4X3ZA 5BNKA 2OT1A 4LS1A 1H63A 2V2HA 1KFJA 1TO3A 3DFOA 3G0SA 3PG8A 4FX7A 5FEWA 3RNDA 3EB2A 3DI1A 3NR0A 5I3JA 3GKAA 5KZDA 3E0IA 1JCXA 2Z6IA 1VS1A 2YW4A 2JKEA 1H7RA 1J4EA 3M1ZA 3DAQA 4WJEA 2DU2A 3TE9A 5FEZA 2A2IA 5HINA 4JTJA 3L0NA 4IPIA 3QH2A 1WOAA 3IIPA 3QMSA 1Z41A 2YX0A 1HO1A 5DY2A 4NJJA 4RKAA 2W6RA 2YXGA 4O0ZA 4IX2A 1KTBA 3S5NA 4IPJA 2CLLA 1SO5A 3NQCA 3DXIA 5D2VA 1YTEA 1IF2A 3JS3A 1GYNA 1T0OA 5K2ZA 4RV8A 3GR8A 3NEVA 3W7CA 4O10A 3LHUA 4U28A 3MP3A 3DFNA 4K38A 3B0PA 1IIHA 3GB6A 2YYUA 1NF0A 1BKSA 3NQAA 4A2RA 1F6KA 2BX7A 1X8FA 3LTPA 5CZ0A 1NFBA 5TIMA 1TJRA 5BW6A 5E93A 1QAPA 4MY9A 2RDTA 4JTLA 3MHGA 4IMFA 3U2OA 1UBSA 3NA8A 3L5AA 1OX4B 1TRIA 1A5AA 1FXPA 1LM1A 2DZPA 1GOXA 2B0MA 2OT0A 1W3NA 3M9YA 5BRBA 1R46A 1TPWA 3T55A 4NX0A 4O18A 1W8SA 2QJGA 1LOQA 2KZHA 1H5YA 2A7PA 3HIJA 3MBFA 1AK5A 1H7PA 4FNSA 4O13A 1KM1A 2ZYFA 5DCDA 2QF7A 1W5PA 2A6NA 2CU0A 2OX1A 1OX6A 1XXXA 2DJLA 5LSMA 1K02A 2DZVA 1WXJA 3A9IA 2X1SA 3ELFA 2QCGA 3S42A 3VCRA 1QWGA 4LV4A 2A1YA 3G8EA 4BR1A 4UFJA 4FX8A 5AOUA 4O28A 3R2GA 3C56A 1TQJA 3A23A 3NQFA 4NT0A 3IEBA 1XKYA 1SQ7A 5D2YA 2NV1A 4O57A 1GG1A 3W71A 2Z2UA 4H6KA 4WX2A 5AHNA 3KVMA 2LLEA 4ZL1A 2WNNA 5KTLA 3P81A 3W7OA 5LGZA 3BGGA 2EHHA 4IMGA 3ZWTA 4JYFA 1ZNNA 4X22A 1TCDA 2ATMA 3QYQA 4EVZA 3PR2A 3W7EA 4K6AA 4JTFA 4LVAA 2R91A 4GJ1A 4LVFA 1ONRA 2X1TA 3HG2A 2WSYA 2A21A 3GDRA 3WJWA 1LRQA 3W7KA 1OHLA 1N55A 3L66A 5CGQA 1Q6QA 2VOMA 4UFHA 3LRLA 3V75A 3MP4A 3E9AA 4ZQCA 1JQXA 4WY0B 3B0UX 4DO5A 1THFD 4TIMA 4ZMGA 5D04C 3OHIA 3A5VA 5I3HA 3KAOA 2TMDA 2WSRA 5FF2A 2CLKA 3S0CA 3A22A 4NJHA 1PL9A 5EYWA 1QFEA 2JKPA 2ZZ3A 3S1XA 3GNDA 1QPOA 3BARA 2GQAA 3E12A 4KKXA 3CWNA 3BW2A 3HF3A 1G4PA 2DZUA 3TA6A 1GWJA 5KMYA 3CIWA 3NQVA 3CM4A 2H3BA 1ZHAA 4FIRA 2P0OA 3E02A 4Y9AA 5IM51 3BGJA 3PVFA 3SGUA 2ZZ2A 1QCWA 2JGYA 2AQWA 1TPH1 4RXFA 1VGAA 3G1AA 5D2XA 2Y85A 4PEKA 1GJPA 4DEFA 3W1MA 3UQNA 3HPZA 4X2RA 1P0KA 3LV6A 1FQ0A 2QCDA 3FA5A 3LCLA 4O50A 4MY1A 5H2ZA 2X1UA 3KHJA 3LI0A 4RR4A 3W75A 3CU2A 1B4KA 3HOJA 4RCXA 1IXNA 1C29A 5BMXA 3EWBX 1EB3A 2ATSA 2QCNA 3MI6A 4RJEA 4ML9A 4M19A 3W7HA 1L6SA 3BLEA 5AHIA 2NXIA 3EWYA 2ZQ0A 3MWAA 4S1FA 3PUDA 2QEZA 2HS8A 4I7UA 1OG0A 1UASA 1QOQA 3G8RA 3SI9A 4FNTA 1KA9F 3HBLA 5D2TA 1ZAJA 3S1VA 3P62A 3LV5A 3IGUA 4QSHA 3W7GA 5KZMA 2CLIA 1DOSA 3TC6A 2W0UA 1D3HA 3F4WA 4UFMA 2ZDRA 3HO8A 3TX9A 1I2QA 2HSAA 3B8DA 4HPXA 1KTNA 4FX6M 3P8JA 5G5IA 3LERA 5CG7A 4IGHA 1QPRA 4N6FA 5HUOA 2RHGA 3VNDA 2RDWA 1QNVA 5LZLA 2E5DA 3IIVA 4EIVA 3PG9A 4O12A 3P61A 1UCWA 1RQHA 4AVFA 4WY0A 2ABBA 2A85A 4MUZA 1H62A 2GOUA 4MZ1A 2PRHA 2PURA 3M6YA 4JGDA 2O7QA 1IGSA 3MW7A 3L9CA 4XUGA 4LRTA 1YXYA 4EOUA 4HHPA 1A5SA 5AC8A 3EX3A 4QIUA 1DJNA 3LHYA 4HN4A 3DHDA 4JS3A 4GXMA 1R2TA 3LRKA 4XBKA 3CPRA 4O11A 1KW1A 2B7PA 3P74A 1EEPA 4WY0F 4JICA 5G4WA 1I2PA 1BTMA 3TCEA 1BEUA 1F73A 1R2SA 1TPB1 2VEMA 4BFAA 1CW2A 2OMAA 3NM1A 3TW6A 2VFGA 1OABA 1GG0A 1I2RA 1J2WA 3TH6A 5LNSA 4MYAA 2V5LA 4N2YA 1S5WA 2BWGA 2WPBA 4UTLA 4DQWA 1YLVA 3EWUA 2CZDA 3N2XA 4IXHA 4O16A 2QUUA 2PC4A 3PS7A 1W37A 1OX4A 4JTGA 3W1AA 3S5YA 4ORMA 3R89A 1F74A 2WJZA 1L6WA 3NQMA 3IGXA 2Y89A 3NQ8A 1JUKA 3NQ2A 3BV4A 2X16A 4Z0SA 4MZ8A 3FIGA 3S5ZA 4PA8A 1LBLA 2RFGA 1UUMA 1JCNA 1IXPA 4LC6A 3PUOA 5EMUA 1XCFA 1GPWA 4UMBA 4AF0B 3QSRA 3UPBA 1FXQA 4RZ5A 5D38A 1N8FA 4DBEA 1VQTA 3U8GA 1GVOA 3W1QA 1RVGA 1EX5A 4LWWA 4NNAA 3QM3A 4IQLA 1SW7A 1L2UA 3G1XA 2Q3OA 1X7FA 2DP3A 3E96A 4UTJA 4TR9A 3DFPA 3OVQA 2XN1A 2NWSA 3ZWSA 3P7YA 1TPDA 1K8XA 2E6YA 4QITA 1U83A 4N9CA 4MVAA 1OFEA 1PCKA 5AHLA 1BWKA 5C2XA 2V0TA 1EP1A 3EEGA 3TMQA 3QSTA 3F1QA 4JTTA 2ZRXA 3PSWA 3YPIA 1JUBA 2J6XA 3TROA 1XUZA 3EKLA 3MYOA 2QCFA 2QUVA 4MJZA 1X1OA 5E1QA 4LV9A 4L4LA 1FWTA 1F76A 1PHQA 1YDOA 4XTIA 4DF1A 5AB3A 1F7BA 1F6PA 1XFBA 2V30A 3ABOA 4K36A 4M6VA 3O63A 3W7PA 3HG5A 3MHUA 3M5VA 3TKFA 3JR2A 4NU7A 1HFBA 1TTJA 4AHOA 1KV5A 2VELA 3ZR4A 3I68A 5D30A 3QMTA 2ISWA 4BWLA 3R12A 5CZJA 5DXYA 3NG3A 4K37A 2YW3A 2CZEA 2A6LA 2YPIA 2X2GA 4JTEA 1VYPX 4DXVA 2NX9A 1WAUA 1GTHA 2DZSA 3GKFA 1RZMA 3A24A 3QFEA 3QQ1A 4BF9A 4HSOA 3RLUA 2YFNA 5C55A 1GVSA 5F2LA 3OG3A 1TMHA 2R14A 4I7VA 3LXCA 1LBMA 4UTHA 5G1YA 4MIMA 3QJAA 2GQ8A 1ADOA 5LNVA 1B3OA 3PF3A 4HNTA 4MLJA 2PCQA 5LHEA 1QDSA 4ZVJA 3BLFA 3SZ8A 4WOZA 3UWUA 3WFAA 3P8IA 1QMLA 4O1CA 2BTMA 1HL2A 4QNWA 1AL8A 3NYZA 3GAKA 5HR6A 3P67A 1DVJA 3FJ6A 2V82A 2B4GA 5CPOA 5BOOA 1LCOA 2VFDA 5EPDA 1WV2A 1PS9A 2QCMA 1MSSA 4H4IA 2FPYA 3P80A 1I2NA 3WK1A 1M7OA 4TU1A 1K7EA 3WJXA 3KXQA 4LS2A 3DZ1A 1VCGA 3QC3A 5DCEA 1DL3A 1KV8A 3UWQA 1TV8A 5HUPA 3SY5A 4NXSA 3BVJA 5A5WA 4OQVA 3GIYA 4GRSA 1UJPA 2Y61A 1TPUA 3BK0A 3TQVA 2VEIA 3C2EA 1P4CA 3LBMA 3P84A 1SSGA 5K7JA 4CQ8A 4MFDA 5I3FA 3A21A 1TQXA 1MXSA 1FDYA 3CLMA 3GXTA 4E2BA 2Z6JA 1OK6A 3Q2DA 1ALDA 5F1UA 1WQ5A 4X9SA 3C52A 5KZEA 4LOCA 3S9YA 1JULA 3PSVA 1WOBA 3RK8A 1AG1O 4WOQA 2YDAA 3NO5A 4FNQA 1ME7A 4O1BA 1XI3A 3TUUA 1O60A 3BG5A 3MI2A 4YCOA 3O05A 2ZBTA 1B57A 2Y88A 1DKWA 4KFOA 3W2LA 3PY2A 2FB2A 4RK8A 3EWZA 5FF4A 5DCBA 1JCMP 4ZQNA 1B4EA 2ABAA 3W1NA 3L2IA 4DPPA 2PE4A 1YDNA 1KM6A 4C1KA 1M6JA 5CZTA 2CLOA 4O4WA 5LKYA 1OF6A 1YXCA 2B7QA 1HO4A 3NPWA 5C54A 2ZZ1A 3NOEA 2V9DA 2EKCA 1WA3A 3N73A 2Y62A 1Z42A 2C18A 3T7VA 4CCCA 2C6QA 3GLCA 4O54A 2YZRA 2VEPA 1DBTA 2Y7DA 1XBVA 5F2IA 2EF9A 4EF8A 3GDLA 1M7PA 5I3KA 3L0GA 4U4MA 2A0NA 2ISSA 2P1FA 5J5DA 3VE7A 3GXNA 2CLFA 2E5BA 3THQA 3GYEA 1LTDA 2B7NA 4O53A 2I1OA 5AHFA 3GNNA 1CI1A 4AF0A 3R13A 3HG3A 1M5WA 1W0MA 1XDMA
chains in the Genus database with same CATH superfamily
1OIFA 5JIPA 2V69A 3II1A 2C7FA 1A53A 2VD8A 3HURA 4TO8A 2XWEA 5HULA 2J7FA 2G97A 3WLPA 4WUIA 3AXHA 4U2ZA 1VLWA 3CEPA 4N9BA 2A3BA 4XZNX 1E71M 2VOTA 3O0KA 5T26A 3MSRA 4DO6A 5G2WA 3UG4A 5H8PA 2CYGA 2IXVA 4IIHA 4GMEA 1F61A 3EDFA 4R33A 3EZ4A 3CH9A 1W1PA 4GABA 7A3HA 3PAJA 3EOEA 4L6HA 2EGZA 3VOHA 4GNVA 4K7VA 4NZ1A 3WH6A 2DPEA 3O6DA 4C6OA 1VIWA 3N3TA 4C90A 3TSDA 1GORA 2XDFA 3E2VA 1D3GA 2VFHA 1M9HA 3RLVA 2QKFA 2Y0FA 4L6DA 2BB0A 3W0KA 2G50A 4BQ3A 1MW0A 2C1HA 4NX5A 2D73A 4XBSA 5BWFA 1XD1A 1NOWA 2YIHA 5DX7A 3UWYA 4BK9A 1WO2A 2WB5A 5FA5A 1GPFA 1XLFA 1MQRA 3PWAA 2HNEA 3THUA 2X41A 4ZE5A 2C15A 2VC7A 2GVLA 1RK5A 3DC8A 1JYNA 1WZMA 3CB3A 4WKAA 4K3ZA 4XKYA 1H11A 3LCFA 2CLHA 4OT7A 4MZYA 4C1LA 3S2NA 2VENA 1IR1A 1JCLA 1ADSA 2TYSA 2EAWA 4JIHA 2VL4A 1Z8AA 5C6MA 5LIYX 4GZ7A 1RJPA 3MCOA 4QLKA 1QNSA 2VHLA 4WJXA 2X42A 3B03A 3DX5A 3RLGA 3S8HA 4PTDA 3GDMA 1R3TA 4D6FA 2VC6A 3WQOA 1X6UA 4UZUA 3GG0A 1F5ZA 4DXXA 1MEIA 4F0HA 1DXIA 2D0HA 1MRQA 4GFSA 2FB3A 4MGGA 1E1EA 2WHMA 3THDA 1XIMA 3OVPA 2AQOA 2DIJA 3CWHA 4XBJA 3FX4A 4KERA 3GDBA 2XGZA 3H55A 3RMJA 3W01A 4DWSB 1KBKA 5D4YA 2NQHA 3EAUA 1Q45A 4ATLA 1K7FA 3E2QA 3A5FA 3D46A 3QFWA 3NWRA 4JDBA 3BXWA 1Q65A 5HJLA 3P5ZA 3BO9A 1MRAA 2PWVA 1CXIA 3LCWA 3MKVA 5I5RA 1MNSA 3EA3A 4Q8OA 5DT5A 1MXGA 4L5ZA 3PPFA 3Q94A 2ZXBA 1SW0A 4UTUA 5LNRA 1CXLA 4RX0A 3PFRA 3GXFA 3I3BA 1XDJA 3RDKA 1RUSA 4L1GA 4B9YA 1YYAA 3VFLA 4EPBC 2VT0A 1KBJA 4MOZA 1EP2A 1CGVA 3L0KA 4ZOAA 5GJPA 1UW9A 1W54A 2YXXA 1H1YA 3N9RA 4Z1BA 5DF0A 1WDWA 3AIUA 2YCLB 1E43A 3W85A 3WQDA 1XRTA 4YWSA 2IPFA 4Z2LA 4PL2A 4EWJA 4HCLA 1VH7A 1TIMA 3CMGA 4FF7A 2QAPA 2WMJA 4C6FA 3C6CA 4DM1A 3TYEA 3M0VA 2P76A 3AISA 3IACA 1BSIA 3LOTA 3SUUA 4UR8A 2CLMA 5EA9A 1H7XA 4RE0A 3B9DA 5ECVA 1XL9A 4NRSA 3KRBA 1FCUA 1ZS2A 4GJJA 3S1UA 4IIDA 4NZCA 2QCLA 2WYSA 3VNMA 4OBSA 3UY7A 1G6CA 4PEEA 2Y24A 4JNYA 1FKXA 2XSXA 4OIFA 4HPJA 3BZGA 4XZMX 3LGEA 4G56A 3BAJA 4XIMA 4X2PA 3E0FA 1OVDA 1E3ZA 2JF7A 1KGXA 4EXAA 1XP3A 3BG3A 1KCKA 1A0CA 2XFWA 3DENA 1ZCOA 3W53A 2ACSA 1UD5A 4JNMA 2OCZA 1AH3A 3DHFA 2WZEA 1MZHA 1S5VA 3F4NA 2WMFA 4RE3A 3UBPC 3MYPA 3WK3A 5FAGA 1T40A 2XZ9A 4QCEA 4PTNA 4Z2IA 4LUTA 2X30A 3IUIA 2DT1A 3BL3A 4LS0A 5LNUA 5F4XA 2QZRA 1VPQA 3B8WA 2V3GA 2EO7A 4M7SA 3O6CA 4G1KA 1PTAA 2GUYA 4J3ZA 4XV0A 2EPMX 1KM3A 3ABSA 4A6GA 2J4GA 4JPGA 2WMKA 1U5HA 1GEQA 3W37A 4MAVA 1GJWA 4JY8A 1VCFA 4HP5A 2RH9A 3RMEA 5HPCA 4Z1DA 3W2NA 5DLCA 3VC6A 3GZ3A 2HJPA 4O8AA 2GDUA 1B3XA 1Z32X 3EWDA 4PL1A 1KO0A 2VI0A 2VRJA 5FF0A 4WXYA 3RXZA 1OC6A 1EUAA 3M5YA 2V5KA 3LLFA 3UYCA 1H0GA 4JBRA 2G96A 4EXBA 3FEQA 3ITVA 1SU5A 1FH7A 2BGNE 4QCFA 1MZRA 3T42A 5FEXA 3B9OA 4NAFB 4Z42C 1BYDA 3U48A 4RDYA 1EOKA 3OTRA 1H1NA 2E6FA 3O3RA 3MDUA 4L6OA 3DFQA 4QHRA 3BLPX 3AS1A 3GXPA 4WGXA 5D37A 4N0RA 1FA2A 4W9TA 1FHUA 1SM9A 1FHDA 1V6YA 5K9CA 2NQJA 2EPNA 3OP2A 1SFLA 1FWSA 2D3LA 3RR4A 4BF5A 2Y70A 3L4ZA 4RE4A 4A3HA 3SSJA 5FF7A 4CVWA 2J27A 2X09A 1Z69A 4ILSA 1FWCC 4JR5A 3WX7A 3EX2A 2F9RA 2WAGA 1R3SA 3C0LA 3HU7A 1HKWA 2GVEA 4GACA 3GY1A 3MMWA 2GGIA 1T8XA 2IKGA 1E73M 4IF2A 3URAA 3NTYA 3WDHA 1BD0A 4U10A 3SQSA 3L21A 3BZJA 2XTKA 4BQ2A 3CUHA 4ERGA 5D05A 1TYGA 1S5TA 4FHAA 3B97A 4TTGA 1I75A 2EKGA 4JFWA 3WH9A 2RJGA 3RIKA 4D8AA 1ICPA 3ABQA 1EXPA 3A3HA 1U5VA 6REQB 2FJUB 2NVCA 3EDEA 4PUWA 3MMTA 4CCEA 1KXQA 4UB9A 1E6RA 5FJTA 3JZUA 1U22A 1MFUA 2A3CA 2V2CA 3TK7A 1FWDC 2XH2A 1SJBA 3LDVA 3E74A 1MMFA 3TYUA 2Q3RA 2YZ5A 3WNNA 2H8ZA 2NXGA 4GIRA 1VFOA 3LPGA 4KBXA 3W87A 3K30A 2BOGX 4FNRA 1OT2A 4UTTC 3UG5A 3VK5A 2ZC8A 2HZGA 3QW3A 5D8WA 5EMJA 4OWGA 3WLOA 1QXLA 4FOUA 3UWEA 4H7CA 4YYFA 4GE8A 1IEWA 4XX6A 1BLIA 1M41A 4AMAA 2UBPC 3QYSA 3KS6A 3ME3A 4XD3A 2Z24A 1W3IA 4LH8A 2TODA 1W1A1 4RDZA 4TTUA 4ZR8A 3LCGA 1ZJHA 1NTHA 3E5PA 4WKFA 1KM4A 4L64A 1B5TA 4QE1A 4QJ1A 1VJZA 3PBUA 1KFLA 2WCGA 1JYWA 2GK1A 3LHVA 3UZYA 2BSLA 3SCUA 4IJBA 3AS0A 1J11A 3PUGA 4S2CA 1TWDA 1X1ZA 2ZTJA 1BTCA 2A79A 3IIXA 4AXNA 1QVBA 3REQB 2NT1A 4WXZA 4QR6A 2VM8A 3W7QA 4FNPA 3OYZA 4HVXA 2DVTA 3T07A 4GUIA 4AIEA 1NOFA 1PKLA 5HANA 4Z1AA 3P0WA 1L6GA 4MY8A 1HTIA 3TXZA 4CKQA 1LWIA 2CNCA 2IKIA 3U3HA 3CV2A 3CV6A 2VXNA 4KCWA 1Q8JA 3RM8A 2AAAA 4FXSA 2RUSA 4IMCA 3W2KA 4GINA 4GX8A 2X7WA 3F5KA 2Z2AA 5JXQA 3EPMA 3N13A 4YMZA 1G94A 2NWRA 4LPCA 4KWUA 3CL7A 2GWGA 1M68A 2ZUMA 1S1RA 3W3OA 3OEXA 2Z1SA 4I9MA 1O66A 2RGLA 1JF5A 2WXDM 4DELA 1TTQA 5BOEA 1HKIA 2RJHA 4L4MA 1WUFA 1KR0A 3CTLA 4K7YA 4AWSA 3LCHA 1C9WA 1HP5A 1HL9A 2V5DA 1GJUA 3PBVA 1AJZA 4QTGA 2XISA 2CWNA 3WH5A 3LQGA 3KLKA 4HOXA 5A1AA 2UWFA 1M3UA 1A5BA 3IUDA 1H1ZA 1W1B1 3O2LA 1B2YA 3BW3A 2D3NA 2JIEA 3VE9A 3OG2A 4IIFA 1K7XA 4ML4A 2ZUNA 1B31A 4P2VA 2WKGA 2QDGA 5PTDA 3FEMA 3R11A 4MYXA 4KH2A 3TFCA 1HXJA 5EY5A 5HMEA 3GNPA 1UKQA 3IV3A 3W7NA 3IGHX 2VR4A 4C1NB 1IV8A 3LM7A 1ITUA 5HA7A 3G2GA 2POTA 3GZAA 4Z17A 1JUEA 3NAVA 2FHCA 2KX9A 4KS0A 3IK4A 2WQDA 3STGA 2JBMA 4FF5A 3W70A 4HSHA 4PBFA 1EA0A 4RPQA 4JIQA 1JZ8A 2NUWA 4WD0A 4HU8A 4ORIA 2NQZA 3EXSA 2FHFA 4AZCB 3H2OA 2TRSA 1DPMA 4GUJA 3NZQA 4JTHA 3VIGA 1M7XA 4E5TA 2YL5A 2PRLA 3N2CA 2XVNA 4M80A 3WF4A 1HJXA 3D47A 4CD7A 4Z0JA 4CU8A 1KRCC 5G2IA 4M6QA 2J88A 3UVAA 4YL2A 2E5CA 1Z89A 2ZXDA 5AY7A 1A5UA 3WMSA 1W1VA 4DM2A 1ISZA 3MVTA 2V5JA 2BY1A 1XH2A 1QNQA 3NPXA 1O5RA 3QY7A 2WCSA 4XO7A 4UQ9A 5F4WA 2V38A 1K77A 3AMLA 4H41A 1AW5A 1SO3A 3S9ZA 4Y7EA 2BLEA 2HROA 3WMLA 1VC4A 1SW3A 2PDLA 5I79A 4DO7A 1A49A 4WEVX 3AJXA 4GLEA 3S5SA 3CZ8A 1PTDA 4Z1CA 1FWJC 3GG1A 1GVQA 5G1TA 1KGUA 1QUMA 2UY3A 1C92A 3H70A 2J25A 3M0JA 2BXYA 1QO5A 5JQ9A 3KVKA 1E0VA 2GFTA 6ALDA 1FWGC 2G41A 1R87A 4RW3A 3N14A 1JDDA 4LALA 3R8RA 5XIAA 3KZSA 4OV4A 1QO2A 2V2DA 3F03K 4WHBA 3LCXA 4LYRA 1ZFJA 4IMEA 1V0KA 1JDFA 3GS6A 3VD7A 1KM0A 3CQKA 3UZXA 4XZLX 1X96A 3H53A 3QOKA 3HJZA 2J8GA 2PWGA 3ARWA 3LZ3A 1KFKA 4HPGA 1D3CA 3WFZA 1W1TA 2VCAA 5DN1A 4QE4A 4MDPA 4N4PA 4FB7A 1VHCA 3FYPA 1CBGA 2EBNA 2ZE0A 3VOFA 2EXOA 4L1XA 4DZHA 3A13A 1E51A 2ODOA 5DXXA 1VF8A 3WF3A 4W88A 1K03A 3TYDA 1PBGA 4RLIA 1UH2A 4M5PA 2BV9A 5IRPA 1PIGA 5I3IA 1EA9C 1FX6A 1NEYA 3CWOX 3OVRA 1EX1A 6A3HA 1GQNA 3B8UA 5BROA 2C8NA 2O7SA 4JEQA 2QHAA 4IQJA 5CBIA 3FK4A 1REQA 3HFTA 2VKZG 1XLBA 5D33A 3MANA 2PU0A 3W1TA 4DI8A 2FVLA 4GQRA 3G18A 4AEOA 1ENUA 2WZHA 3VOGA 3G1RA 3W7JA 4AUBA 1XLAA 1KCZA 1HUVA 3FKKA 3FN9A 3WF0A 4G9PA 3SDOA 2Z1VA 1YPFA 3B06A 4AC7C 4DPQA 1MEHA 1LJYA 4MFEA 4F0LA 4LW7A 1MO0A 2ZRVA 1RAKA 3V5CA 5ENLA 1GQIA 4PODA 1XLMA 1XBYA 4HCHA 4WDWA 2ACUA 3SURA 3TQPA 3WJYA 3WUBA 1CWYA 4GIEA 3DYOA 3WL1A 3O1NA 1J0HA 1KGWA 1Q7QA 1QI0A 2G3IA 1GTEA 1JVNA 3OLDA 3ZOAA 2GVJA 3KRUA 1E0TA 4U2YA 4WCJA 3LTYA 1S5NA 3NQBA 5A6TC 3MUXA 3LHWA 4HKPA 2C71A 1RPKA 1HN1A 3EOUA 2OKOA 4OUEA 2V2HA 1TO3A 4FX7A 1O5QA 5CXPA 3WH8A 3EB2A 1K9DA 4F0SA 3KWSA 1UBPC 3NR0A 3GKAA 1JCXA 1VS1A 4LCQA 9XIAA 4EAYA 3DAQA 4MWAB 3TE9A 4UQAA 5FEZA 3RR1A 2Y8VA 5HINA 4JTJA 3LNMA 3VD4A 5G1MA 3QH2A 1WOAA 2UY4A 1BYBA 2CERA 2OFJA 1JZ6A 1KTBA 3S5NA 4QX4A 3DXIA 5D2VA 1IF2A 3JS3A 3M46A 2Z26A 4RV8A 3GR8A 1K9TA 2OEKA 4I3GA 1XGDA 1BHGA 3F5JA 4FPSA 4Y9OA 3ZMRA 1DTNA 1NF0A 3CTTA 3NQAA 3HZ3A 4C6QA 1OEPA 1UOZA 4I9JA 5CZ0A 1UH3A 4H9TA 1QAPA 1L0PA 1LWHA 1MVYA 4JTLA 4PTXA 3U2OA 2HDJA 1S5MA 2R1MA 3SCOA 1GOQA 3RLHA 1CDGA 1UD8A 2OT0A 2D24A 3OGRA 4UZSA 3M9YA 3U2CA 5BRBA 4C7FA 5I3DA 1JF6A 4FS9A 1LOQA 1H5YA 4FNSA 4E4UA 1KM1A 2ZYFA 1PEZA 2A6NA 2XVPA 2CU0A 4ZO8A 3O7UA 2DZVA 5FJOA 3A9IA 2X1SA 4IJRA 3ELFA 4IFOA 1XIJA 4ROPA 3LNPA 2A1YA 3G8EA 4BR1A 3AWOA 3T0DA 4FLSA 3WYZA 3B0XA 5AOUA 3WLLA 3R2GA 1MDLA 4GZEA 3FSTA 4GNKB 3A23A 1SQ7A 5DMMA 1GG1A 3W71A 1W6TA 2Z2UA 4GBDA 5AHNA 4I6KA 1DIKA 2PPGA 2HCVA 3BGGA 2EHHA 4IMGA 2ZX5A 1ZNNA 2DUZA 1UKOA 1NELA 3W27A 3W7EA 4K6AA 1XSKA 4LVFA 1ONRA 2Q8XA 5A3HA 4FOKA 1Q6QA 4YTRA 2DQXA 1BGGA 1H3GA 1FFQA 4I5UA 3MP4A 2VURA 3H7VA 3N6HA 4MB1A 1KRBC 3GH5A 4DO5A 4QEHA 3L4XA 4YU1A 2WSRA 1HT6A 2CLKA 1ONEA 2OQYA 3GSMA 3GNDA 3AIWA 1QPOA 3BARA 3PBGA 4D6DA 2XZ7A 3ZLFA 3E12A 1R85A 4IQDA 3N6QA 4XB3A 2X1IA 3HQOA 2DZUA 1WP6A 1Y5XA 2QPUA 3OIHA 4OKDA 4KCVA 4M3PA 3WLJA 1CYGA 4FIRA 2J7DA 2WW5A 3E02A 3SIMA 4AIBA 1K4GA 4GK8A 1XQLA 4RXFA 1VGAA 1UP0A 4MJ4A 3PPHA 1TELA 5CJNA 3W1MA 3BOXA 4S23A 1P0KA 1EHAA 2WVTA 2PU1A 5H2ZA 3W75A 2Y1HA 1OCJA 3HOJA 1CXKA 1C29A 5BMXA 1RA0A 2WVSA 3MI6A 4HA0A 2F61A 3NUKA 1XYAA 3BLEA 3QHNA 2OLSA 2DIEA 4NAEB 3NZPA 1W3HA 1XIIA 3H26A 3TWAA 3U9IA 5D2TA 1ZAJA 3S1VA 3BSMA 5KZMA 3TC6A 2OSWA 3F4WA 4S3AA 3GC5A 3VFCA 1I2QA 1JPKA 1ZP4A 3B8DA 3D5HA 1AMYA 4IGHA 3VM5A 4N6FA 4D6CA 2RHGA 3GYCA 4PTMA 1QNVA 4F2TA 3AHZA 4PB3A 1SGJA 3P61A 1E1CB 2ABBA 5BCAA 4MUZA 1H62A 2RAGA 1TWWA 3PZUA 3LMYA 2GOUA 3ARYA 1RJQA 4PTWA 4LUYA 4MZ1A 1F8MA 2W5FA 2G8ZA 2PRHA 3DCPA 4JGDA 1QK2A 3MW7A 2R1NA 4XUGA 4I8DA 3MZ2A 4ZEPA 4HHPA 2PDFA 5EU9A 1A5SA 5AC8A 3LHYA 3OQ8A 3CIVA 1UR0A 1EZ2A 1R2TA 3CPRA 1BF2A 1BEUA 1F73A 4HNLA 3BCDA 4BFAA 1QBBA 4TVCA 3NM1A 4D6HA 3TW6A 2VFGA 1OABA 2OR2A 3TH6A 4INFA 4UTLA 3TTYA 4DRSA 4JIRA 2EG8A 2DT3A 2QUUA 5LA1A 1W37A 2XG9A 1OX4A 4JTGA 4XD5A 1G5AA 3NQMA 3IGXA 3T9PA 2Y89A 4GQ0A 3NQ2A 2AL2B 4Z0SA 4MZ8A 3FIGA 3ARTA 3UCDA 4TX6A 2C1IA 3EWCA 2YA0A 1IXPA 3AC0A 1SMDA 1OCNA 3NJ3A 1GPWA 3KBSA 3UPBA 3S4TA 4RZ5A 3HPAA 1VQTA 3U8GA 4HTYA 2C79A 4LWWA 1PKNA 2I7GA 4FK9A 4DBSA 4LEFA 4JFSA 4EXQA 1BGAA 1SW7A 1KWGA 3G1XA 4PUMA 3DG6A 2Q3OA 5LIUX 1X7FA 5BRQA 1NWUA 3WEOA 2WZTA 3ZJ7A 2NWSA 1TPDA 1UWSA 2E6YA 7ENLA 2VR5A 4DHGA 1UOKA 4ZOEA 1LT7A 3EEGA 3R0DA 2QPXA 1W3JA 3AUOA 3OZPA 2FZMA 1JUBA 1BVNP 1YMYA 4LUTB 3K1DA 3WD2A 2VZOA 2QUVA 4MJZA 4KWSA 4L4LA 1FWAC 4XTIA 4DF1A 1F6PA 3MT1A 5H6HA 2V30A 3ABOA 3GVQA 3O63A 3PBMA 3WDRA 1W91A 3JR2A 4NU7A 4KESA 2DZAA 2VELA 4JFUA 3I68A 3WQCA 5D30A 3QMTA 4NHVA 3ITYA 1RCQA 4PCTA 4S39A 4CCZA 4BWLA 4KPLA 5CZJA 3VILA 4K37A 3VC5A 1Q2RA 2A6LA 4ZODA 2X2GA 1V7AA 2QIWA 3UEQA 2NX9A 3VU2A 1UZ1A 1GTHA 1M65A 5HPOA 1JL8A 1H2JA 1JZ7A 1WZAA 3JW7A 2Y5SA 1JCTA 2VRKA 3RLUA 2YFNA 1EJTC 4QE5A 5C55A 2QJMA 5F2LA 5HOSA 4B5VA 1TMHA 2FDMA 3LXCA 1KXTA 3SEPA 4UTHA 4LF1A 5CJ5A 5G1YA 1F4HA 2ONEA 4C7GA 4IZGA 4LANA 1ADOA 3NXLA 5JBEA 3NURA 5FIPA 1B3OA 4C6PA 2Q71A 2HE5A 3AXKA 2PCQA 4GI4A 3LM3A 2WSPA 3SZ8A 3UWUA 1LQ0A 2P8BA 3TP4A 4O1CA 1UIPA 1EKOA 2BTMA 2DW7A 2JQXA 1AL8A 4XZWA 4CD8A 2MNRA 3H7UA 2VD9A 1GNXA 5EPDA 2DEPA 4G8TA 2FPYA 2GSEA 1W1IE 4UQCA 4OVXA 3ICJA 1M7OA 4Z2KA 3ORWA 4Q8QA 3WJXA 3MUCA 5DCEA 3UWQA 5BXRA 1VFLA 4PB4A 4G5DA 4S3CA 2CZVA 2W27A 3BVJA 5HJYA 4OQVA 3GIYA 4GY1A 1W9XA 2XPKA 1IZCA 4MMWA 1P4CA 1UH4A 3FCPA 3M0IA 1A3WA 2J78A 5D9PA 4E2BA 3Q2DA 3BJTA 5KZEA 4LOCA 4CN6A 1AG1O 2O9OA 2YDAA 4FNQA 4O1BA 2ANUA 1XI3A 3OPSA 1O60A 3MI2A 2Y88A 2VDGA 4B4HA 3PY2A 1I1WA 1D7FA 1V51A 5M03A 5DCBA 4PFHA 3SM0A 3TTSA 4ZQNA 3W1NA 1NFPA 4DB7A 4C1KA 1TE1A 4UTFA 4BEQA 4P8WA 1PX3A 1Q6EA 5LKYA 1HO4A 3ID7A 3T08A 3NOEA 1N8IA 2A3AA 2EKCA 5I09A 4TXEA 5I07A 4RNJA 2YL9A 4IP5A 2C18A 2I16A 3VGFA 2C6QA 4W84A 2V5CA 1J0YA 7XIMA 2PLJA 2W4XA 5DMNA 4J3UA 2Y7DA 2DSVA 5F2IA 4EF8A 3GDLA 7PTDA 2AMXA 3IJDA 5ABEA 1E55A 2P1FA 3GH7A 3VE7A 4FAMA 5A8PA 3GFZA 1Q4WA 3VOJA 3KWXA 2EG7A 1LL7A 1ISXA 3H24A 1ZRQA 1EZWA 5AVHA 4LXFA 4EE9A 4AG0A 4O1DA 2J8TA 3NZRA 1FWWA 3LXBA 4KWVA 4K8HA 2AKZA 3CPUA 4BI6A 4MWAD 3UWZA 4AD3A 1NSJA 1JZ5A 4XAZA 4G6CA 1S3HA 3WG6A 3WIJA 3PWIA 4DLMA 4CEUC 3TNOA 4HYVA 4OOZA 1EBHA 3L67A 2XFYA 3C61A 4ZO7A 5J8LA 5CEWA 5KSWA 3U0HA 4LU0A 4NQ1A 3M5ZA 3WQWA 5E0CA 4KETA 3RF9A 2VWSA 1RHCA 2ZX9A 4JHMA 5CPMA 3QVQA 3LTSA 2PCEA 2PS2A 1P0NA 1C91A 5XINA 2ZICA 5LXEA 4UFLA 4O1EA 1I1XA 1AUSL 1VPYA 4N9DA 1J0JA 3W7IA 1DJHA 1DJIA 5IDZA 4HIBA 4EPEC 2GL5A 2ZDSA 3ATYA 5DBTA 5EL1A 3G1FA 1EWEA 2J8FA 3AS2A 1BWLA 1EC7A 3W25A 2OPJA 4OHQA 1SPQA 3DHUA 1PB0A 1B0IA 1YADA 2FIQA 3AU2A 3UY8A 1XYCA 3SCSA 4AZBA 5C5YA 3MUAA 1KBIA 2PDJA 2WC7A 2CWXA 3MA8A 3W88A 2E40A 2G95A 3CIXA 2YBVA 1LBFA 1BG9A 3RHGA 1OFOA 3L5MA 3EMCA 4MJ2A 3P2VA 2A7NA 4AC1X 1Q6DA 5AC7A 2RDUA 1KM5A 4F2BA 4H01A 3OBKA 2VZUA 3ARRA 2E25A 3O06A 2CEQA 1CGYA 2FQIA 4YN5A 1KXVA 2NLIA 4OZOA 5BMWA 3MCMA 1HKJA 4ZB2A 5J5RA 4ZQRA 5CPSA 1CGXA 4MKVA 2DSZA 4QDPA 3BLDA 3B3DA 4CEXC 1T96A 3C0JA 3SCPA 2E09A 3ZLGA 3CC1A 2NQ5A 5AN7A 3B9EA 3U6WA 1IE7C 3I7RA 3H2FA 5LA0A 2VFFA 4FXRA 5IHRA 4O0KA 1ZGDA 3UWWA 5IOBA 3APGA 4AIUA 3QZEA 3W28A 4H8VA 2Y7GA 2X0SA 2PDYA 4JY9A 3AU6A 2BHYA 3HGOA 3BH4A 2VFIA 3FVDA 1CPUA 1ZPTA 1RR2A 3KRSA 1VYRA 4F79A 2H9AA 1XIGA 4H8NA 3EDKA 3W1RA 3VX0A 2WMGA 1VP5A 4GQGA 2GOKA 2R8WA 2YYTA 1OFAA 1TVPA 2YLAA 4ADUA 1GHRA 1W56A 2DSUA 5F1VA 1L6YA 3KCLA 1L2QA 1NARA 2H6RA 3GUWA 4GY7A 1WDPA 3LENA 3DYPA 1J2BA 1ZJBA 3RO8A 1E4IA 4GIYA 5GQBA 3PB0A 1UKSA 4JAWA 4UOQA 2PWDA 2C13A 4S3DA 4W87A 3UWVA 5A8MA 1XINA 4QNEA 3KVLA 2QV5A 2CW6A 2ZZ4A 5CAKA 1HQTA 1RBOB 3BLIA 5EMMA 4A22A 3W1XA 1UWRA 1YNQA 1AZ2A 1W5QA 1E0WA 2PUZA 3AJ7A 2PZ0A 1TPVA 4F0MA 1QK0A 1LLWA 3CZGA 1ZTVA 2ZTKA 4F40A 3HB9A 4HHHA 1LG1A 1KKOA 1UQZA 1TV3A 3LPOA 1CNVA 4LVBA 1GKQA 2XHYA 1OADA 2OGJA 1V03A 1ZCCA 1X6LA 4KFNA 3NZ1A 2WLZA 1FRBA 4HZ6A 1JCYA 4ADTA 3W6YA 4C91A 1ADDA 1RV8A 4R53A 2PWHA 3USBA 3TYAA 2GPTA 2VDHA 4G7FA 3VIOA 1ZQ5A 3OODA 1NH6A 1GQJA 2GJPA 2OWWA 1RALA 2A5HA 3UF9A 4WZHA 3WK2A 3BSGA 3WLNA 4K8GA 2VX5A 4GQBA 3LUTA 1H7NA 2PZNA 2HE8A 1R9YA 2ESCA 2ZXQA 3VNLA 2IW0A 4ROQA 4UOZA 3E5BA 5BU6A 4LRSA 5EGRA 1U2YA 1YPIA 4OTKA 3OO2A 3W23A 1DIDA 2C16A 1MW2A 3ARPA 2VFEA 3M0ZA 3W22A 1IXOA 4MADA 4MAZA 4TV6A 1KQZA 3T1GA 3IV8A 3ECQA 4WLCA 1E9IA 3NQ7A 1L9WA 4MJMA 3SJ3A 1JD7A 1FDJA 1VFMA 2PD5A 5HK4A 1NWTA 3WMCA 3EB3A 2UV8G 2UY2A 3S83A 5I0DA 4HZ7A 3LXAA 3VI2A 1TMLA 4H8UA 3SECA 1WPCA 1CGTA 4DUOA 4DUXA 1WYIA 3CPGA 2QW5A 5I03A 3F2DA 1W9UA 3EKGA 1VFSA 1VCVA 2G4JA 2XINA 5KINA 2VTFA 4KIRA 4S3BA 3AZRA 3OBAA 3KTXA 4QFUA 4JTDA 2BOFX 3IPWA 4JCMA 4RDVA 4Q22A 4F0KA 2P8CA 2QCCA 2J13A 5DY3A 4LYKA 4IP7A 1ML1A 5CZSA 2OELA 5D09A 1VD6A 5E0KA 3N3MA 2OZ3A 3C2FA 2ZA2A 2D2OA 3R6IA 4A21A 2WO5A 3K13A 3LEPA 4NKCA 5A6AA 2D23A 2FZ8A 1V5XA 5BOFA 4D1JA 2VJXA 4PCPA 4W5ZA 5CLWA 3TMLA 5KETA 3BOFA 1KNWA 4M51A 1TA3A 3DERA 4UTKA 4AXKA 5HWMA 1L6FA 2VCCA 4H9YA 2Q02A 4EK7A 1ZLPA 3O6YX 3L5LA 1VBRA 4UXDA 4RW5A 3UD6A 1RPXA 2FDSA 2CBIA 5CPTA 3ISIX 2O4MA 2CFFA 2OZ0A 1TJPA 1C8XA 1O5XA 5HMDA 7REQA 3GUGA 3A47A 1SSDA 3PBWA 5HMSA 3G0UA 2UY5A 4IM4A 4R34A 2HBXA 3OA5A 2MANA 1XBZA 4LUJA 4NL1A 1UD3A 2XIJA 2FH8A 4HU4A 5AKQA 3VNKA 2PTDA 3MJYA 3W1LA 1O1HA 6CGTA 3G1SA 5HQEA 4W89A 4JN8A 2PTYA 3UCCA 4NY2A 3AO0A 2J6VA 1MW3A 4ICCX 1B9ZA 3WZ0E 5EKYA 3QQWA 1HJUA 1RLCL 5AFDA 4DZ5A 1CCWB 3GAYA 4IG2A 1UUQA 2R24A 4ACZA 3D3FA 3TTOA 1VZWA 3NIYA 1VFFA 4UTMA 4OECA 1GUVA 1TTIA 3W1PA 3W2MA 1CX9A 1QPKA 3BW4A 3OIXA 1E15A 2VGGA 5CPLA 5H8MA 4PE8A 3WELA 4JD4A 2C19A 1H7OA 4IICA 2XIQA 1TUXA 1R3QA 3EKZA 1XHGA 3XISA 1K8ZA 3DFYA 1V7YA 4ECLA 4L7ZA 3AYTA 3LD5A 4IMAA 2FFIA 1B3WA 1SUXA 1QASA 3P3BA 3WK0A 1UD2A 2OODA 2YKKA 1SJCA 5LNWA 2F6XA 3LSCA 2DQWA 1HG3A 2F8QA 5CPNA 3GXIA 3P6LA 4QAWA 5LXXA 3PC0A 1TPFA 4HNUA 4LTSA 1R30A 1N2VA 2XGBA 5F4SA 3V36A 3WKZA 3HA1A 2TAAA 1TE6A 4AD1A 4GVIA 3NSXA 3TR9A 4ERAA 1H7WA 3TJXA 5IHSA 2IS7A 2GVYA 1DQWA 4RDWA 2TSYA 1ITXA 2GJRA 3I7SA 2ALDA 3VZXA 1Q3NA 1RD5A 4ZQPA 4ZXLA 1TTPA 3LHZA 3T40A 1R9ZA 4K68A 3W7LA 4IISA 2F38A 3LRMA 1HJQA 4IOTA 5EFFA 3UG3A 2DH3A 1NIUA 4B3LA 4O1AA 4JYDA 1WKEA 2W61A 3BQ5A 1R2RA 4HB7A 5TQLA 1DE5A 3K4AA 2QJHA 4PCFA 1EGZA 1NM9A 1AH4A 1RP8A 3HM7A 4UTWC 2GQ3A 4FZIA 2DORA 2VUYA 4DLFA 2HNHA 3AZSA 4YXGA 4LBSA 1EP3A 5B80A 2VR2A 5DMLA 2OU4A 4Q4SA 4IPPA 1JI2A 2ZCGA 2B7OA 4CCDA 4XTDA 4L80A 5CSSA 1XYMA 3TQKA 1PKMA 4K39A 1QOPA 3C2YA 3SUTA 3V1PA 4B5XA 3TV8A 2GJLA 3E49A 4YHGA 4Y8EA 4JX5A 4UR9A 4UFIA 3DGRA 2YB1A 4AWUA 4D6EA 4M1RA 1CXHA 3W76A 1YPXA 4Q7IA 4EWND 1AW2A 4UNKA 2YJQA 4BWLC 4F9DA 1ICSA 1R86A 2PDHA 5AYIA 5LIWX 3BOLA 3QLLA 4JNZA 2O0TA 4V1XA 1KCLA 5FEPA 1EOMA 4M7TA 3NYDA 1MUWA 2DFAA 4M29A 3N12A 1DJZA 1G4TA 4E8CA 1LT8A 3PTMA 4DUVA 1UR4A 4J2MA 4CNNA 2INFA 3K46A 3FFSA 4X60A 2C0HA 3KP1A 1XDLA 3RILA 5E9AA 4J1OA 5T9CE 4GC4A 2CZ5A 4D9PA 4D8LA 2QCDB 4GWEA 5D9OA 4CU6A 2JALA 1J9YA 1G69A 2BMBA 4QLLA 2A3EA 4DY1A 4PR4A 1CLVA 3LU2A 1HL8A 2EPKX 2WM1A 2EQDA 3INPA 4AQLA 3H6OA 1X38A 1W31A 1SZGA 1T6MA 1XIBA 4RZ6A 4UWMA 1EFZA 1C3FA 3I65A 4PSPA 3P60A 5C2GA 1LUCA 3WNLA 1O95A 1TX0A 3NXFA 3SRFA 4QM1A 1NJJA 2YGYA 4E2DA 1DQUA 2D22A 3HG4A 4J3XA 2H3DA 3KOZA 3DH7A 4KW2A 3VGBA 4B16A 5B7ZA 1WE5A 3GW0A 1UJQA 2DUXA 1YDYA 4V27A 1IIGA 2WMIB 2NVDA 4NZFA 4NVTA 4PC8A 1EO7A 2HV5A 3T05A 2IKHA 5D32A 3NSNA 4LY8A 3FVMA 4JX4A 1UPPA 3P82A 3TR2A 2OLAA 1DXEA 2WKLA 3P5YA 2YA1A 3WQFA 2G5WA 2YBTA 3WNOA 1ZAHA 3AWNA 2IMRA 1KQYA 1K8YA 4G1NA 2ZADA 1H09A 1JDAA 4R9OA 1B9BA 4R88A 3IARA 1Z44A 1POKA 4JOMA 4B9ZA 1TZ9A 4N4QA 3T44A 2QS8A 1V3IA 1HVQA 1YIXA 1R3VA 3H2MA 1Y8BA 4CQ9A 3MVIA 3S5OA 2AQVA 4OU1A 4X0NA 1AQMA 4IMDA 1D8WA 4B90A 3RJYA 3TJLA 3BQ6A 2DY3A 1G4SA 3CQJA 3SGGA 5U4NA 3KRZA 4E0CA 4FO4A 4UQBA 1KFBA 4TVUA 1PWLA 1EPVA 4JDYA 3VD5A 4UCFA 3VKBA 3LI1A 1AL7A 3OZOA 1W2VA 1JJKA 3MBDA 7TIMA 2OO0A 3U7BA 4DJFC 3WNPA 3IIOA 1XM3A 3URQA 2UZ9A 5AHMA 3IWPA 2QGYA 4XIAA 3IJ6A 3TZNA 5GJMA 4NZ4A 5CPQA 3DBPA 4Q8PA 2ZA3A 1UD4A 5A6JA 4DJED 1UR3M 3TSMA 4H19A 2Y6ZA 2QV4A 4WRHA 4ENLA 2XGIA 4NXKA 1IT0A 2E9LA 1EUNA 2WJFA 2WNQA 4M6PA 4I9AA 2CCRA 1R6WA 4AB4A 2V81A 1IXQA 3CZEA 3OA3A 2OQLA 1JG9A 1DWIM 4C7DA 2QUNA 5AYBA 5MKGB 5HDRA 1BRLB 2VDIA 2PLMA 1VEMA 4IWWA 2GGEA 4IPNB 1P7TB 1GZGA 2REQA 4NAFA 5FSDC 1CB7B 1QHZA 4YLWA 1SO6A 4XKYB 5CSYA 1XCXA 3BAWA 4ONVA 5BWAA 1K8CA 3WD0A 5MHBA 2XFFA 1GW1A 5DANA 2GVGA 3CMFA 4QG9A 4V28A 2I14A 3WJSA 1SJDA 3OOQA 4QISA 3QPYA 4UUIA 3HGSA 1GVRA 1UWQA 1ZBKA 3C2RA 3ZVHA 1JRCA 1XLJA 2GDQA 1F6YA 5BNKA 1MYRA 3A6OA 1U1UA 3WF2A 5IFPA 1U33A 4GXPA 1E4LA 1MXDA 3G0SA 1HNYA 3L4VA 4QRNA 3GRIA 5KZDA 1TG7A 2JKEA 3T4WA 4M82A 1RD6A 1J4EA 1W9BM 2GGHA 2FTYA 2XM2A 4BQ5A 2ALRA 4IPIA 2O9RA 3GG8A 1WXZA 3TJ4A 3QMSA 2WBGA 1Z41A 2YX0A 4YNGA 1A5KC 2QUMA 4O0ZA 4IX2A 1IZJA 3IJ9A 3NQCA 1YTEA 1GYNA 1T0OA 4GY0A 3TVAA 1V3JA 1JAEA 5JH2A 3LHUA 4K38A 2Q6ZA 3B0PA 1QNOA 1A3HA 1BKSA 4IHCA 1XLHA 3V4BA 4E3VA 1OD0A 3LTPA 3C0QA 2POZA 1TJRA 5BW6A 1G9HA 4MNJA 3MHGA 1DWHM 1OX4B 1FXPA 2F2KA 5A2AA 3LGGA 1KBLA 1YBQA 2DZBA 1BVWA 4GI9A 1W3NA 3SRHA 4WF7A 4NX0A 4O18A 1W8SA 2A7PA 3UJFA 1Q7ZA 3IAQA 4LCRA 3BGAA 4W4QA 3PFMA 5DCDA 2QF7A 1W5PA 3BLKA 4H00A 2OX1A 4KCTA 2CBUA 1OX6A 2ZOXA 3NSMA 1K02A 3FGCB 1WXJA 5BXTA 4W8AA 3DG7A 1QWGA 4GISA 3K5XA 4H6EA 1DP0A 3T2OA 4FX8A 3MUIA 5A8QA 4LB3A 1OB0A 4QSFA 3C56A 1TQJA 4PMZA 3S1GA 4LQ1A 2DGAA 3IEBA 1XKYA 2NV1A 1PTGA 3N4AA 4F3HA 3FJNA 4H6KA 1UROA 4J3VA 3MC5A 4CU7A 3SQMA 4KT2A 2E7FA 4ZL1A 4H2CA 5KTLA 2XSAA 4NILA 4JYFA 2V3DA 3PZOA 4IIGA 4W8BA 3DGBA 3FAWA 4LVAA 1QW9A 2BS9A 2A21A 3GDRA 3JZEA 1J12A 5HMFA 3W7KA 5EMLA 5CGQA 4FR6A 2BVWA 4UFHA 3FHAA 5C8BB 3AXMA 4H8HA 1THFD 3WEZA 4L4PA 5CGMA 4NJHA 2R82A 4J27A 1QATA 2ZZ3A 3S1XA 2GQAA 4AZ6A 3CWNA 2J47A 3BW2A 3HF3A 2Z27A 1V02A 1I0DA 4DJDD 4MB4A 5KMYA 3CIWA 3RCNA 3CM4A 2D0FA 2H3BA 4DWSA 1ZHAA 6XIAA 3PJTA 3WSUA 4Y9AA 5IM51 2BY3A 2ZZ2A 1GEHA 2AQWA 4LSBA 4IJCA 3G1AA 1IEQA 4PEKA 1TKKA 4Z1YA 4DEFA 3GG7A 4X2RA 2YLLA 1TCMA 2QCDA 3FA5A 1XX1A 3LCLA 4MY1A 3KDNA 3LI0A 3KHJA 3N2BA 4RR4A 4WGHA 3U4FA 1W32A 1B4KA 3S2JA 3UR7A 4RCXA 3EWBX 1EB3A 2W63A 4QLJA 4IH3A 4RJEA 3AIQA 3W7HA 1L6SA 3QKZA 4S1FA 2QEZA 3GH4A 1OG0A 1UASA 3SI9A 4FNTA 1KA9F 2QGHA 3KBJA 3P62A 3LV5A 3IGUA 1CLXA 2YCJA 4UFMA 3W38A 1J8VA 2OOFA 4FSAA 5E6YA 3R8GA 3HO8A 1XJBA 3P8JA 1J79A 3VNDA 3GFYA 1QT1A 4NZ5A 1FH9A 1GYMA 4JKLA 1P0BA 3RCMA 4XAFA 4DJEA 4Q4RA 4CGTA 3JU2A 4JTCA 4WY0A 3WQ4A 1UKPA 3L4TA 3ONBA 4KF1A 1BQGA 4AZ7A 4MNMA 4ZCWA 4EOUA 3WQGA 3EX3A 3OW1A 4LBUA 3K8LA 2JEQA 3GIQA 1E56A 3LRKA 4O11A 2B7PA 3C3UA 3P74A 3ABZA 1EEPA 4WY0F 1GKPA 5G4WA 1I2PA 2QQ6A 1MWOA 1P1MA 2E28A 5A2CA 1TVNA 3MPGA 1K70A 1IT8A 5I06A 3A4XA 1R5YA 1DE6A 2PBOA 2E8ZA 3NOYA 4QG6A 4O16A 1XRFA 2F6UA 3MS8A 1ISVA 1QWKA 3OB8A 3S5YA 5D8ZA 3L12A 2WJZA 1OBAA 1E4MM 3PHAA 2HPIA 3ZQ9A 3GTHA 2CKSA 4P7NA 3TYBA 5F7UA 1OG6A 4GYKA 3FNDA 2WANA 1CIUA 4J40A 1TR1A 1LBLA 3OGSA 5BZAA 1UUMA 1JCNA 2PWEA 3H4WA 1C90A 1UYQA 3LG3A 3TLLA 3TYCA 1BVZA 2V67A 2XU2A 3CUGA 1E6SM 1RVGA 3W1QA 4GG9A 5T91A 1Q4NX 2I5QA 3QM3A 4D1IA 4IQLA 4BKNA 3FSUA 1L2UA 1I60A 3I4KA 3K8MA 1RH9A 3BMVA 3OVQA 3EB4A 4DWDA 2DH2A 2XN1A 4IIBA 3S47A 4L9ZA 1BG4A 3BJSA 1KC7A 1VFUA 3P7YA 3FYYA 3H2NA 3RITA 1IHIA 4WIWA 1PCKA 1CT5A 3CASA 1BWKA 4H9VA 4GZIA 3VIPA 1PYMA 4H7VA 3V18A 4D8ZA 1MW1A 3YPIA 2J6XA 3TROA 4AMCA 4HHLA 1W9VA 2WC3A 1OM0A 2HVOA 5E1QA 5T9BG 2KAUC 3WN6A 4B5TA 3EEZA 1F76A 1OD8A 4KQNA 1XFBA 2OB3A 3ITTA 3HG5A 3M5VA 1HFBA 1KV5A 3PPGA 1RLDA 4MDOA 3U2ZA 4BF7A 4C5ZA 2Z7KA 3L2LA 3UXKA 3SB0A 4JTEA 1Z9AA 1VYPX 4DXVA 3ZJKA 2WWCA 3UA3A 1WAUA 1BF6A 3VA8A 1RZMA 4XKMA 3QFEA 3QQ1A 4BF9A 2VEGA 1Z7AA 2R14A 1G0CA 1S2CA 1LL4A 4ZOBA 4MIMA 5FJRA 4IP4A 4GFIA 5CH9A 1J6PA 3VDHA 3PF3A 4HNTA 1S2AA 3UJ2A 3EPOA 4E8GA 5LHEA 1C7SA 5E5CA 1QDSA 2DT2A 7REQB 3R10A 4ZB5A 3WFAA 1TMQA 4HA4A 3B9AA 2GYIA 4EANA 3RRXA 1TVLA 2FMOA 4WSKA 3EMQA 3URNA 1DVJA 4HZ8A 3POHA 1MNZA 3SRDA 2P53A 3ZT6A 1LCOA 2VFDA 3AHVA 2QF8A 1FP8A 1B90A 2QCMA 1J01A 3M0MA 3WK1A 4TU1A 1K7EA 5LIXX 2FMNA 3KXQA 2F6KA 4LS2A 2ZUUA 1DL3A 1HKKA 1EXBA 3WCZA 4YTUA 2INEA 4TX8A 3SY5A 4NXSA 3WO8A 4PB5A 4US6A 3UU0A 1ISWA 1UKTA 3CK5A 3A9BA 3BK0A 2R1KA 1C8YA 2VEIA 3SN0A 3P84A 4CQ8A 4MFDA 3QZ6A 3A21A 1MXSA 1FDYA 3NO3A 3OLEA 4ZOCA 3CLMA 3GXTA 4QDMA 2Z6JA 5F1UA 3WD1A 1U30A 4X9SA 1QW7A 2VYOA 3SUSA 4WDTA 1J18A 1WOBA 3TUUA 1H49A 3O05A 1DEDA 2ZBTA 1B57A 3QBUA 3L4UA 1T8QA 4J4KA 4R5EA 4RK8A 3EWZA 5FF4A 4L61A 1CENA 2ABAA 1DHKA 5EFDA 2PODA 5JVLA 5CZTA 1IWPA 4O4WA 1FWBC 3OLGA 3KW3A 3WMBA 3HJEA 5JU6A 2ZZ1A 3WQEA 1VAHA 4CQBA 3NDYA 4DYEA 1XV8A 1Z42A 3H4XA 3L2MA 3T7VA 3OLIA 3PZIA 3BAYA 3EDDA 4AD0A 2YZRA 3AXIA 1DBTA 2RGMA 1RXOB 4O1FA 5A8OA 3MU7A 1E72M 1M7PA 2ZXAA 1IEIA 3QGAC 2EJAA 1XLLA 5HATA 1GVYA 5I23A 3GXNA 2CLFA 2E5BA 3BC9A 3THQA 4O53A 2I1OA 5AHFA 4GGBA 4JZ5A 3GNNA 3MJMA 2OYMA 1CI1A 2PAJA 2ON3A 4B5UA 3RCYA 3R13A 1M5WA 1CXFA 4DVOA 3A64A 1S46A 5E09A 1AH0A 3STCA 2QUTA 1TJ2A 3T2PA 3C4UA 4Y2WA 2Y4SA 4HMEA 3TEVA 3SFWA 5XIMA 1F9CA 3EMZA 3NCOA 4C6KA 2E1DA 2OJPA 3QY8A 4Y9NA 3C0SA 3W82A 3FAXA 1P6CA 5ABTA 4YHEA 4BCEA 5AC6A 4GQQA 4PMQA 1W2PA 5LHFA 1LP6A 1MDRA 3NL5A 2ZX8A 3UR8A 2VEKA 1TREA 4Z2HA 2G3JA 4GKTA 4AYSA 5FI8A 1QI4A 1EO5A 4GVGA 1XWYA 2Y63A 2J9ZA 5KITA 1AW1A 1WAWA 1SYTA 4JCLA 1I8JA 5CAHA 2AGTA 3BPWA 4PMOA 4A05A 1BSLA 1Q66A 2PLKA 1E70M 2ICSA 1P48A 3DI0A 2BODX 2A7RA 1YTKA 2QR6A 1K1DA 3EYPA 3SN4A 3GX9A 3MV11 3QHMA 3NQDA 4QDWA 4QXIA 3EX6A 4IPLA 5CSUA 1J10A 2EPOA 4PUKA 3NNTA 1BFNA 1DYSA 3UXIA 5H8UA 4Z2JA 4KFPA 5HNRA 1UC4A 3RX4A 5JUVA 2DSKA 2PDUA 1REQB 3ARZA 4GOAA 4KMQA 1EJXC 2D2GA 4D72A 2ISVA 3N2MA 5K3VA 5L9FA 2I9UA 1Q6RA 3AYSA 3ZR5A 4I9TA 1E9LA 4DJEC 3VD3A 3KZPA 3NZGA 4O8RA 3HMJG 1G1YA 1BXNA 1UA7A 3AIEA 4MG4A 2RKXA 2E0PA 1K6AA 4R7WA 1LORA 3V5FA 2QJIA 3FXGA 4GKLA 1OGGA 4IIEA 4UNIA 3PBYA 3AMKA 4WDXA 4K8EA 2QMKA 1Y7VA 1LG2A 2XVLA 1TR9A 2J66A 4PUUA 3TFXA 2Z00A 5K4ZA 3AIVA 4Z2GA 1HGWA 3CXOA 3W84A 4KIEA 2IUZA 4NJGA 3TNBA 2W3ZA 3KOFA 5C7HA 1EPXA 1XSIA 1T99A 2QVHA 1Z3NA 2ZRYA 2PRMA 2O9PA 5ECUA 4AAJA 5I02A 2I9EA 3H2AA 4RXGA 3V0SA 4FOJA 3SAZA 2YR1A 4H6QA 3OU8A 1G67A 3RGTA 1VPXA 4BEUA 3BWWA 4V33A 5JH1A 3FY1A 3AIRA 4DF0A 5CC5A 5IFTA 2OZTA 1RK6A 4PMUA 4ACYA 1C8VA 4B3KA 1TPEA 2HK1A 5EMYA 3W24A 4NNCA 3FA4A 1LQAA 1EBGA 2OLHA 2PSNA 3N18A 4JX6A 4R7OA 4TX9A 1HF6A 3IAPA 3M44A 5GNYA 1I9CB 2CLPA 2OOGA 1W3KA 4CNPA 2OYKA 9CGTA 3BSHA 3PTKA 3VIHA 2A3HA 4HNOA 4LX4A 1OQFA 3NQ6A 3H12A 2BG5A 3SQLA 3O16A 2J7HA 4DIAA 2PP0A 1TRDA 4W7UA 2ZUSA 3HV9A 2F2HA 3EX1A 3KL3A 5I3GA 2WNWA 3L68A 1DTUA 2X1RA 2XFRA 3R94A 1OFRA 2PTZA 4UFKA 3I3EA 3VNJA 4BJHA 1KRAC 3Q4DA 3Q37A 3OHMB 4V1YA 3C2OA 3W07A 4N6EA 5C71A 1HP4A 4Q8WA 2NUXA 3CHDA 2QDHA 1W1ZA 1SZRA 2E68A 1UG6A 1VEOA 2X0HA 3KUMA 4JXCA 3WQVA 3S1WA 4BY3A 1PHWA 3WQPA 3ARUA 4TUFA 1VRXA 1DWJM 3LLDA 2OKTA 1EH9A 4KRZA 3T81A 3TXVA 1XG4A 1XLIA 4Q4QA 4CNTA 2NW0A 4S3FA 5FF3A 4C6NA 3N2OA 3TN6A 4O14A 1LWJA 5ABFA 1XBXA 5CC7A 1LOSA 2W91A 1R3YA 5LGXA 3UPWA 3WENA 3CNYA 1Q6CA 3FS2A 3W00A 2CITA 4GCAA 3VGHA 2IPGA 1QJWA 1EDQA 3BAIA 4UQDA 3ITXA 2G0WA 2Z1XA 1XYFA 1EIXA 3GVRA 4AY1A 4O19A 3TN4A 4ES4A 4ZZ9A 2WC4A 1F2JA 1XC4A 3VKCA 5CBJA 1Q8AA 2FGZA 2WLYA 5I2UA 1ZB5A 3GHTA 1V79A 1PO9A 3V0UA 4S3GA 1W1YA 4IL2A 3UA4A 1O94A 1W5MA 4IGNA 3H22A 2WJDA 1B3YA 1P1XA 5IBXA 2A4AA 2X7VA 8RUCA 3AALA 3K1GA 3VIKA 4D71A 1FCVA 4LNYA 3GW3A 4A8IA 3R58A 1A4MA 4HSNA 1S2VA 3RUBL 2QNEA 1RSCA 2E67A 3AROA 1US3A 3QLDA 4S3EA 4DF2A 1KLZA 2WNZA 1RCOB 1KLYA 3W83A 4PN2A 2CESA 3IJQA 1TFVA 5FJUA 1S2UA 2OSYA 5C9RA 2ZWZA 1JXKA 5C2CA 4N9EA 3UGVA 3NFUA 3P14A 3CLWA 4FALA 1NWRA 3WLQA 1JAKA 1NDWA 3LHTA 3RU6A 1FFRA 5A6KA 3R5EA 3QEZA 4MPKA 3MO4A 1ZP3A 3CL6A 3BMXA 2OEMA 2E9BA 3W26A 4DWSD 1P6WA 3MUY1 4GUGA 4DJFA 3CUXA 2HS6A 2ZZ7A 3A3WA 3OYXA 4POCA 3RX2A 5DQPA 1I45A 3FJ4A 4L9YA 4HMDA 2F84A 1XUUA 4Q4KA 1W9DM 1QPNA 1MEWA 3ITOA 4JIIX 2GUUA 5JMUA 3T4CA 1QHOA 1DJQA 4DWSC 3VYLA 5GPRA 5G4HC 1E0UA 1JEZA 2CZFA 3IS4A 4PMJA 1I6NA 2Z0IA 5C7VA 2I5IA 3M7WA 2WHJA 3WDJA 1FDZA 4Y9MA 1R47A 3GIPA 4XZIA 1J93A 1GOOA 4PBEA 2P10A 3RFAA 3CV1A 1SZFA 4Y90A 5AC5A 3UW6A 4O4VA 4ZB0A 1TJ0A 2E9MA 3TQ0A 4F48A 5L6UA 1FWNA 4D6GA 1KBBA 3U57A 3WLTA 1YBQB 4PULA 3WLSA 3WLMA 4Q33A 1TPC1 1FH8A 5A6BA 3QV9A 4V15A 1LF1A 1UA3A 3CS2A 2CLEA 4AH7A 3TZFA 1ZUAX 4JIEA 4GNJA 2PC8A 3ZSSA 4FIQA 1XLKA 1IZKA 2FTPA 1ZAIA 3UNTA 3ANVA 3ES8A 1MI3A 2BP1A 2P5NA 3M6DA 1VFTA 1TV5A 1JCJA 2E6DA 5FJIA 1O12A 2BGSA 1Q6GA 3CT7A 4WSHA 3BURA 4A3UA 4O17A 3WLHA 4PMXA 1T5AA 3LMZA 1FY6A 4OGZA 3IJ8A 1CXEA 3G1HA 2GJNA 2WMHA 3UCQA 3DKLA 2VQUA 1HJVA 1S39A 1LDCA 1IYXA 3CQ0A 3RPTA 4H9ZA 3LN3A 1QNPA 1QR7A 4U5KA 4K1WA 3GK0A 1JGIA 4AHPA 3BG9A 3KVJA 3GHSA 1I0BA 1H61A 1E6ZA 1IQ8A 4TMCA 3RM4A 3AIBA 3KP0A 1OYAA 3SJNA 2PDIA 3RAOA 2BZNA 3FLUA 4HTBA 1LZOA 1ZBCA 3DBNA 1H0IA 4UMAA 5G4EA 4HPHA 1GOIA 4YTTA 3UZ5A 1Q63A 1NFGA 3V5OA 3SGZA 2EEXA 2REQB 2V5BA 1KFCA 1S2TA 2J7CA 2HQAA 3F7JA 3CHVA 4JTUA 4EF9A 1BRLA 1PYFA 2W67A 3KFTA 1P7TA 3AAMA 1XPGA 2H8XA 4L65A 2FPVA 1YKWA 3V1HA 3EA1A 3UXAA 1XYLA 5MKGA 2OSXA 3C2VA 3W29A 1UMLA 2DVXA 3S2MA 3AYRA 2YBUA 3NQGA 4I6VA 2BVTA 4UC5A 3B0YA 2NX1A 2BXZA 1PVNA 4EX4A 5TF0A 3TC3A 4PRWA 4XQ6A 3S2CA 4C6IA 4BHYA 1VRDA 3N15A 3TWBA 4OE7A 3W72A 4RNFA 4BI7A 1W3LA 4XO6A 1SZEA 1XR2A 1A3XA 3CAQA 4JQ1A 1RQEA 1TV4A 3ZS4A 2PFHA 3WFLA 3ZSTA 2BNJA 1H50A 1A5NC 4Q32A 4MUPA 3TC7A 4CD6A 5FKYA 3W7DA 1IT7A 3TLQA 4N7QA 4TMBA 1AD4A 1RP9A 1R3WA 1PCWA 3FJLA 3PTDA 2R1LA 4EPDC 2J7GA 4LYQA 1K9FA 3HGJA 3MP5A 3QPZA 3KCJA 3O15A 1HJSA 1V3HA 1YW1A 3LLXA 4QJ4B 3XINA 1XLGA 3VTRA 2QCEA 3KS5A 2NSXA 1O5KA 2WWDA 2X40A 4HU0A 3DYMA 1JPIA 3GBDA 3BICA 3SRKA 3TOYA 2ISFA 4GH3A 4X61A 3A12A 4J28A 2WMIA 4GYPC 2FH6A 3N9SA 2PWUA 4O52A 5D2WA 1FWIC 2JIWA 5AHEA 3W73A 3O9NA 2HTMA 2FKPA 4NAEA 3PNUA 3SCRA 4Q6XA 3N19B 3EGJA 3STFA 2XM1A 3ATZA 5LYRA 3IJIA 2NX3A 3QKEA 2HXUA 4YVXA 1A50A 2TPSA 4S3KA 2X05A 2YCLA 1VJSA 3O6AA 4LAUA 2ZUVA 2OWCA 1HIZA 5DMYA 1F4AA 5A8GA 5CC3A 3LYEA 1AVAA 3MUZ1 1DV7A 3TN3A 3MTWA 4JEJA 5EBUA 5FL0A 5HWJA 1HZYA 1Q6OA 4HYRA 4GX9A