1F2JA

Crystal structure analysis of aldolase from t. brucei
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
357
structure length
357
Chain Sequence
b'SKRVEVLLTQLPAYNRLKTPYEAELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYRALMLECEGFEQYISGVILHDETVYQKAKTGETFPQYLRRRGVVPGIKTDCGLEPLVEGAKGEQMTAGLDGYIKRAKKYYAMGCRFCKWRNVYKIQNGTVSEAVVRFNAETLARYAILSQLCGLVPIVEPEVMIDGTHDIETCQRVSQHVWSEVVSALHRHGVVWEGCLLKPNMVVPGAESGLKGHAEQVAEYTVKTLARVIPPALPGVTFLSGGLSEVMASEYLNAMNNCPLPRPWKLTFSYARALQSSAIKRWGGKESGVEAGRRAFMHRAKMNSLAQLGKYNRADD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE, GLYCOSOMAL
publication title Structures of type 2 peroxisomal targeting signals in two trypanosomatid aldolases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Lyase
total genus 145
structure length 357
sequence length 357
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2000-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f2jA00
3PG8A 3G1YA 1OFBA 1W5MA 3NL6A 1TIMA 4NJHA 1JCXA 4WY0A 3B8DA 4AAJA 2X16A 2C0AA 3C52A 3RF9A 1QOQA 4NJGA 4JTHA 5MHBA 1QDSA 4KFNA 1SPQA 1OX4A 2H8XA 3M41A 3MUXA 1T8XA 3L65A 1Q3NA 5H91A 3R8RA 3LBMA 5U4NA 4AH7A 4NZJA 5FI8A 1KM0A 2QKFA 3IRDA 1SSDA 3NOEA 3GZ3A 3OVPA 1MZHA 4RLIA 5CZSA 3SIZA 4WXYA 5HWNA 5DBUA 2W0UA 1BWLA 4UTMA 3L66A 1W5OA 1LLWA 3F4WA 2B4GA 1P0NA 3S9YA 1FXQA 4ZQPA 2QJHA 1YPFA 1ZJIA 2VFFA 5I3JA 3EKLA 2J9YA 1EUAA 3O1NA 1ONRA 1VS1A 3W2MA 2C3ZA 3GB6A 3SSJA 3ATYA 1QNVA 1EP2A 1W54A 1D3GA 3DFQA 3M6YA 1SZEA 3OVQA 5BNKA 3MP3A 2A2IA 3BW3A 2FPTA 2C6QA 2ZA3A 4WY0F 3KOFA 3RFAA 4FNSA 4LC6A 1I4NA 1TPWA 3TJLA 5AN7A 3EXSA 2C19A 3EX4A 3IVSA 3O63A 4XZ9A 4O4WA 3M9YA 3CEPA 2H90A 1YLVA 3WJXA 2QDHA 2X1UA 5G1TA 3NYZA 1S5TA 1UBSA 3AO0A 3B0VC 4GUGA 3B4UA 4KWVA 4JIQA 5HUPA 3HGJA 1G69A 3S1WA 5FF3A 1EP1A 1GTEA 4GJ1A 5HINA 8TIMA 3NA8A 5SWUA 3F1QA 1IXOA 5F2IA 4IWWA 2B7OA 2DZUA 1J4EA 1N8FA 4BWLA 1YPIA 1R2RA 4UCGA 3DBPA 1SR9A 1IGSA 3P84A 1T99A 2H6RA 3L5AA 3HG4A 2QEZA 1YXCA 5D32A 1K7FA 1U83A 3SI9A 3BW4A 1LBFA 2RDUA 2DZTA 2WSRA 2GPTA 4PFMA 2P0OA 3PAJA 3W73A 2XFWA 3UYCA 4GFSA 2V2DA 1LCOA 5BW6A 2VFDA 2NUWA 2PRHA 4PA8A 1LOQA 3UY7A 4O53A 4O1BA 1AK5A 4LUJA 3S1XA 1SU5A 1UASA 5T26A 1SZNA 3LTSA 3G0SA 3CWOX 3S8HA 4UTUA 3W1PA 1LP6A 3DFOA 2Y85A 3O6CA 3OIXA 3O05A 4RX0A 1LZOA 4JEQA 1NAL1 5DCBA 4K7YA 4O8RA 1FY6A 3KFTA 3LV6A 4ADUA 4P61A 2ZZ2A 4ML9A 1KLYA 2E1DA 2FPVA 4ZQMA 4FNUA 1TPEA 3NPUA 3ZWTA 2WV8A 3M5VA 4OQVA 3E9AA 3C8FA 2G97A 1THFD 3L9CA 4K36A 4Q4KA 3UD6A 2DP3A 1QCWA 3I65A 5EBUA 3QQ0A 2TSYA 4O0KA 4M5PA 1GG1A 3I68A 1M7OA 2A0NA 4A3UA 3PULA 3KAOA 2VELA 1JQXA 2QCMA 5FEPA 4WOQA 4Y90A 1JRCA 1L6WA 3PUEA 3W71A 3O16A 3DU0A 1P1XA 1VHCA 2I9EA 3PM6A 4CNPA 5HWMA 3UWUA 3C2EA 4UFHA 4HKPA 3TSBA 3WK2A 2R14A 5TBOA 1HO1A 4O52A 3ABQA 1GOXA 4AHOA 2YSWA 1V7YA 2BLEA 3PBVA 5EA9A 1ZCOA 3GDMA 3CU2A 4E2BA 3HPSA 1XKYA 1YADA 3GKAA 5I3KA 3EX6A 4JNMA 3NL2A 3B04A 1OJXA 2JGQA 3P8JA 3PUOA 5KZDA 2A7PA 1OG0A 4Z0SA 1DBTA 1GVSA 4MYXA 5L9FA 5AC7A 2CWNA 4YCOA 4AHQA 1K8XA 4LVDA 3N73A 1OHLA 5LKYA 3S0CA 4LT9A 3W1MA 1F7BA 3NXFA 2V81A 2C1HA 4CQ9A 5AC6A 1MEIA 2VXNA 1B57A 4GUHA 1JCLA 3NNTA 1JULA 3O15A 2WKJA 2QDGA 3HG3A 3TV8A 2C18A 4YXGA 4N6EA 2QCGA 1N7KA 3EKZA 2Q8LA 4AB4A 2CW6A 3P7YA 3WK3A 3G1XA 1KFCA 1OK4A 3FLUA 1QPRA 2UV8G 1GWJA 4MZ8A 5D2WA 3TQVA 2NZLA 4NX5A 4DBEA 3QEZA 3TX9A 5IBXC 4UMBA 4FXSA 1Z48A 3M16A 4UTTA 3Q94A 5CSRA 3NQEA 4O1AA 1OYCA 2GVJA 3C2RA 3BGGA 1NF7A 1ADOA 5H2ZA 1LOLA 4MZYA 3GXNA 1PIIA 3T78A 3DFPA 2VEMA 5C5YA 2NX1A 1KFLA 4GUJA 3GKFA 1JVNA 1F6PA 3UWVA 4UTWC 1OK6A 4WXZA 3LLDA 3HO8A 4UFMA 1QO2A 1H7WA 3O6YX 3S5OA 4FEZA 3UXDA 3GR7A 2NXHA 2JK2A 1D9EA 3UNDA 4A22A 4JYFA 4DXVA 1F5ZA 3M5ZA 4IMEA 3TE9A 1W31A 1D3HA 5DCEA 1X1OA 3G1AA 1LORA 3HBLA 1K03A 4O17A 3HJZA 5G4EA 1G4TA 3I7QA 2J24A 1RPXA 1FWRA 3W7KA 1I2PA 2QCNA 3MI6A 2CZEA 2B0MA 1ZAJA 3N9SA 5LSMA 4X3ZA 3P81A 1JCNA 2NUXA 2ZRUA 3BW2A 3NM1A 4HNUA 3A21A 2WOQA 3LCXA 1SW3A 2NV1A 1KBJA 3FOKA 4GC4A 4QISA 4KWWA 1VGAA 1I2OA 2WQPA 1T96A 3MW7A 3JRKA 1RV8A 3C56A 3TA6A 3LX9A 4Q32A 1I45A 3MJYA 1XBVA 1NFBA 4NX0A 1DQWA 4DO4A 2NXIA 3B0UX 4OV4A 3LM7A 3TSDA 1GQNA 3TNOA 4RJEA 3FS2A 1WBJA 3W1UA 3FJ6A 5I3IA 2J6XA 2ISSA 1X8FA 3NZRA 4LOCA 1SUXA 1IIGA 1A50A 3IIVA 3LXCA 3G1HA 2V2HA 3UWYA 2AAMA 3DFNA 3OEXA 2GOUA 2DJXA 3G3DA 3W7OA 3PY2A 3ABRA 3P5YA 4BI7A 3QZEA 4QIUA 3IIXA 4M7TA 5CKSA 1ME8A 1AG1O 4R53A 1K8YA 4N4PA 4JDBA 1VCFA 4NZFA 4P2VA 3LHYA 1DQXA 2VOMA 5I3HA 4QAIA 5I3FA 4O13A 3SFKA 3M5XA 3H55A 2ZBTA 2E5DA 3M0ZA 4DF2A 2BXVA 3WK0A 2V8ZA 4Y96A 1ZHAA 3SGUA 3LHZA 1KFKA 5BOOA 4MUZA 1G7VA 1JCYA 3MMTA 3T7VA 4WY0B 2Y70A 4K37A 3STEA 3L5MA 3OA3A 3HOJA 4K38A 1GT8A 2JBMA 5C54A 2V5BA 1OX4B 4BF9A 3TXVA 2YZRA 2Q3OA 5K2ZA 1XBYA 1B3OA 4K8HA 1A5BA 2X1SA 3LCHA 2C15A 4UNKA 4CNOA 3GYEA 4FNTA 1W5QA 4HN4A 1OABA 4XKYB 4RXFA 3TW6A 1EPXA 2FTPA 1OFDA 2DZXA 4JTEA 4O1DA 3F4NA 2ZZ7A 3BLFA 1A5SA 1AL8A 1H51A 3O06A 3M43A 3LLFA 4ZQCA 2Y7EA 3SW6A 2J9XA 2RHGA 3L5LA 4KFPA 3TKFA 1M6JA 3PBUA 1GYLA 1OX6A 3NQ8A 2ZZ3A 4PCFA 2ZTJA 2BX7A 5K7JA 3MP5A 3KRSA 3TDFA 3S42A 1JQVA 1SZGA 3TIMA 3STCA 2PURA 1ICPA 2YGYA 4O14A 3G1VA 4JD4A 5HULA 5F2LA 1SSGA 2ZFAA 3C3NA 2HS8A 5K9CA 3T4CA 4RZ4A 4UTIA 4YLWA 3NPVA 2Y89A 5EY5A 3R2GA 3TROA 3WK1A 4ZZ9A 4I7UA 3LCWA 3MBDA 1I8JA 2NX9A 4LRSA 3NZ1A 3IVTA 1O60A 4IMFA 2H3BA 1NEYA 1TTPA 3IGSA 3M1ZA 4MY1A 3W6YA 1K8ZA 3BV4A 3U6WA 3GDRA 1TPFA 4HSNA 4OU1A 4ZVJA 1DJNA 2D73A 4MKNA 4FB7A 1ME9A 3DKLA 3LB0A 1H5YA 4ICNA 4LW7A 4B5NA 4PTNA 3TAKA 3M44A 5LNWA 4EIVA 1R47A 1K7XA 3C61A 4XKYA 1LOSA 2F7FA 4HIBA 7TIMA 3BG9A 3TUUA 2ZDRA 4MJMA 1EEPA 3W85A 1BKSA 2QAPA 3TQKA 3MHGA 3T40A 2R94A 4WJEA 3VI2A 4FX6M 4AMAA 3GNNA 1OYAA 4A21A 1GEQA 1IF2A 4WUIA 3W7DA 2Z2UA 3GR8A 1PHWA 3LRMA 1TPB1 4TU1A 5HNRA 5D2VA 1G4PA 3H54A 1Q6QA 1H61A 1TREA 4DEFA 2A6NA 3S1UA 2ZRYA 5FEXA 3NQMA 1G6CA 4RR4A 2V2CA 1GG0A 1F6KA 1PCWA 2OZ0A 3I7RA 3U2OA 4Z1BA 5K9DA 3KRUA 1ZENA 5D2TA 1DVJA 5G1YA 4WZHA 3E12A 2B7NA 3IEBA 2P10A 3W1XA 4Z1DA 3KVKA 2H8ZA 4FNQA 3T55A 1X7FA 2DJLA 4M6PA 3A22A 1FX6A 4W9TA 3W7IA 3HGOA 3G18A 4CCDA 1VYRA 2B7PA 2QCEA 1MEHA 1FQ0A 2AGKA 5CPLA 5LGXA 1VCGA 2ZA2A 3EX1A 3P82A 2GQ9A 1RQBA 2BWGA 2Z1BA 5K3VA 1SFLA 4FX7A 2YYUA 3A5VA 3VCRA 4ORMA 1LRTA 4H6KA 2H3DA 3PF3A 3UWQA 1HO4A 3BPWA 2QUVA 3UPWA 5AB3A 4JTFA 5LHFA 3W7PA 1EA0A 4ALDA 1VPXA 3Q37A 3W7LA 1E51A 4RV8A 1N55A 4UR7A 5DCDA 5HJLA 3VE9A 1VYSX 5KSWA 2WSQA 2FB3A 3TAOA 3W1AA 3KVLA 1FCUA 1LDCA 2J9ZA 3QPYA 5F1UA 4UFKA 4N9CA 1VLIA 4JTKA 5A5WA 3G22A 4OT7A 3N2MA 4IXHA 3RLVA 2GUUA 4LY8A 3TC7A 5C55A 3O6DA 1ICSA 5G2WA 1TO3A 5FF0A 1WBHA 2A7RA 5LGZA 2Y7FA 2O7QA 3N3MA 1IXPA 4ADSA 2DORA 2VFGA 3DHDA 1SZFA 4PODA 4S2BA 1A53A 2X2GA 3W2NA 1XCFA 3STFA 2NLIA 4JY8A 4R7JA 4WD0A 4I7WA 3G8RA 3N34A 3V1PA 3BLEA 3LI1A 1I2NA 1YXYA 2Z6JA 4NNBA 3T44A 2OMAA 4Z0JA 2CLIA 4QM1A 1NF0A 2C14A 5AHEA 1QFEA 1TTJA 2QCDA 4JTLA 4QITA 1O95A 4UTTC 2EHHA 4DF0A 2V82A 4ZQNA 1B4KA 1TRIA 1IXNA 1OVDA 3MP4A 3NO5A 2QCFA 1G4EA 1TV7A 1FDYA 5L6UA 5TQLA 1I2QA 3ABSA 1EP3A 5AFDA 4JX4A 3W3OA 1EIXA 3NPWA 3GK0A 4LV4A 1YYAA 1BTMA 3L0GA 3LGEA 1M5WA 4MY8A 2QUUA 4AHPA 3DENA 4MPQA 3R89A 4S2CA 3ANYA 3ZFHA 1DORA 4OBTA 1A5CA 4QNWA 1Q6LA 2E6AA 3MBFA 1W3NA 1A5AA 1SO3A 2QUTA 4PL1A 2YR1A 2G5WA 5HUOA 2KZHA 3E49A 2VC6A 5BMWA 2OT1A 2V5LA 1IXQA 3W70A 4MIMA 3W1QA 5HR7A 5BRBA 1LBMA 2Y88A 4M7SA 4MYAA 2R91A 1GVFA 3WJSA 5A8GA 1IIHA 3E0IA 5D09A 3QPZA 1FXPA 5GVJA 4EF9A 5C2XA 5K4XA 3MWAA 3W7GA 3E02A 3N19B 1OX5A 3TFCA 3N2XA 5LHEA 1H62A 2FB2A 3QF0A 4M19A 4OGZA 1FDZA 3LXAA 5D2XA 3P67A 4LNYA 4IMCA 2ZZ4A 1W0MA 1YDNA 1WV2A 3PR2A 3CTLA 2ZZ5A 4HHPA 2GVLA 4LWWA 4UMCA 3MHFA 4MOZA 1H7XA 1YXDA 3CWNA 2B7QA 4IMGA 2CZFA 4A2SA 1OYBA 3N14A 1F73A 4FO4A 3NPXA 1TPH1 3W2LA 1KTNA 3LHWA 3OG3A 3TFXA 4CCCA 1VLWA 3HPZA 3S6DA 1JCMP 1L6YA 2A21A 5U7SA 3NQGA 4MLRA 3GX9A 4JS3A 1LM1A 3FJLA 3A23A 2PCQA 1KM4A 3Q2DA 5E93A 1QR7A 4RZ5A 2JKEA 3NQAA 5CPNA 3L67A 3EEGA 4QNEA 5C6MA 3G3MA 1O94A 3Q58A 3HGRA 4PL2A 3LV5A 4NU7A 1W8SA 3EWWA 3DXIA 4O54A 2YW3A 1WYIA 1K3UA 2OX1A 4DO6A 1WAUA 3EX3A 2CU0A 3LCGA 3CQ0A 1EWEA 1CI1A 1QMLA 1QPOA 4LC8A 1KM3A 5D38A 4IPJA 3NQ2A 4ZL1A 1JRBA 3M5YA 2QJIA 1G7UA 1LBLA 4FIQA 4H3DA 2ATSA 3BG5A 5AHNA 5EKYA 1KM6A 2QF7A 4U4MA 5LNSA 3LOTA 3NQDA 3CEUA 1S5WA 4N9EA 3RU6A 2Q8ZA 4I7VA 4EVZA 1UUMA 2WPBA 5DXXA 4EF8A 3AJXA 3GDTA 1OFQA 4JGDA 4YL2A 3BK0A 4O50A 3IGUA 5G2IA 4IUOA 3W1NA 4ZQOA 3TMLA 5K9XA 5FF4A 3NL5A 3MYOA 2GQAA 3W7MA 4Y8FA 2ZA1A 5HWJA 1MO0A 4UFJA 1PCKA 4PH6A 2R8WA 1JUBA 3LCIA 4R33A 1YTDA 2DU2A 2OCZA 1I2RA 3KVJA 2HTMA 4ONVA 2CZDA 1R46A 5E0KA 1GPWA 5CPMA 3ZWSA 5HQEA 1PHQA 3B05A 1LRNA 3HMJG 1VRDA 1W5NA 2A85A 1H1ZA 2TYSA 4S1FA 1H1YA 5FEWA 4LVBA 1YDVA 3U8GA 3GDLA 5IBXA 3W86A 3JS3A 2WSYA 4JYDA 3GXTA 4LS2A 1VC4A 6ALDA 2NUYA 1AW1A 2DZSA 2C16A 5AHMA 1XI3A 3H53A 2C13A 4NQ1A 4TMBA 3LHUA 4JTTA 5AYZA 6TIMA 2ZTKA 5ABTA 3I6RA 1RQHA 3PVFA 2ISWA 3A5FA 3PSWA 3R12A 4DPPA 5HR6A 2E77A 3W22A 1XDMA 2QCCA 1XUUA 1H7PA 3NEVA 3FKRA 4CQAA 2Q3RA 5KMYA 2V0TA 4FIRA 3O07A 4FF7A 1FWTA 2E5CA 2FJKA 1HUVA 1Q45A 4O57A 2PRMA 3W7EA 2EAWA 1WOAA 2Y7DA 4IXXA 1KM5A 4BFAA 2E09A 4WOZA 3UWZA 3NQVA 2ZYFA 3BLIA 1K7EA 2IQTA 1Z42A 3HPXA 4JTGA 3LTYA 4BR1A 4DO5A 2X1RA 1L2UA 4POCA 4NXSA 2E5BA 5AOUA 4G1KA 4JR5A 4EOUA 2GQ8A 1XDLA 2A6LA 4KFOA 2NV2A 4KKXA 2YFOA 4A29A 4ZMGA 3W7JA 3W83A 2FPYA 5J5DA 1SFJA 1KTCA 2CFFA 1ICQA 1VYPX 4CNNA 3P60A 5DBTA 4AF0B 4U28A 2J27A 2Y61A 1G4SA 4LS0A 3EWXA 3QW4B 2ZQ0A 2EKCA 3SGZA 1DL3A 1F2JA 3LERA 4MLJA 1O5KA 4TIMA 3HB9A 1TQXA 1RR2A 5G5IA 1JR1A 2XN0A 1UUOA 4K8EA 4N9BA 4WQ6A 4OHQA 5CZTA 5EYWA 3THAA 2Z0IA 3KVMA 1CX9A 1C29A 2HMCA 2XN2A 2WNNA 3P5ZA 4JIPA 4M6QA 4JICA 4BK9A 3B06A 4GRSA 4X2RA 2CLFA 4O11A 3FIGA 3G1DA 1OFPA 1C8VA 1CW2A 1OF8A 1WX0A 3NAVA 2CLMA 1VHNA 3L68A 3PS7A 3PC0A 1UB3A 1TSIA 3QMTA 3VE7A 2VENA 1FCBA 1ZNNA 3IVUA 4XQ6A 1RD5A 2I1OA 2OT0A 2YX0A 3EB2A 3EXTA 2E68A 3GNDA 4NXKA 3EWBX 4BWLC 2I14A 4X9SA 3RLUA 4NUWA 1V5XA 4JTSA 3CPRA 3F03K 3BGJA 1XUZA 4QQ3A 1TTIA 4IJBA 3W1RA 4GBUA 3W87A 4L4LA 4HT3A 4X22A 1Z41A 2A7NA 1L6SA 3UZ5A 2ABAA 3W1LA 3UPBA 2EPHA 4UXDA 3WJYA 1OFEA 2W6RA 4LVGA 3W72A 4IX2A 3WFAA 5IM51 4BI6A 4CCEA 1Q6OA 4O15A 4O0ZA 4HPXA 2W79A 3JR2A 3PUDA 4N9DA 4AF0A 5K4ZA 1R2TA 2TMDA 4IQLA 3OBKA 4C1KA 1H63A 1X6UA 3QQ1A 3HG2A 4D2JA 5G2HA 3N9RA 3CHVA 3DI1A 4YCPA 4GNJA 3PB2A 2FFCA 1PL9A 1QWGA 5D03A 5D04C 3TQ0A 3C2VA 4ADTA 5F1VA 2HS6A 3LI0A 1KFBA 4Z1AA 2Y7GA 3S5NA 4MJZA 1B9BA 2EF9A 5AHIA 3L0NA 2ZRZA 3ZR4A 3CC1A 3FA5A 3DI0A 1TPDA 3TJXA 1HFBA 2XN1A 3C4UA 1W5PA 2NX3A 2ZRWA 5CG7A 1O4UA 1GVQA 4L4MA 3W7QA 2CLLA 3R13A 2LLEA 3W74A 3R5EA 3L2IA 3NQ7A 5D02A 4FNRA 2ZZ6A 1NSJA 3E96A 4TR9A 1SO4A 1UJPA 3C6CA 3W07A 4TMCA 1P4CA 1F74A 1FDJA 1VZWA 3DH7A 1KV8A 4WX2A 1PV8A 4HNTA 2F84A 4XWUA 2QCDB 2CLEA 1PS9A 1C9DA 3TMQA 3ABOA 3C2OA 5F4SA 4UNLA 1J2WA 4UTHA 2CLKA 4JN6A 1G67A 1QOPA 3TCEA 3VKJA 2FQIA 4O16A 3ATZA 4FXRA 1TTQA 3S5ZA 2VEPA 2X30A 3NDOA 4MFEA 5G4WA 1JCJA 4N2YA 3QYQA 4HNVA 4FNPA 5FF7A 3IIPA 3W7RA 2BSLA 3LHTA 1X1ZA 2A4AA 3BO9A 4XTDA 5D2YA 3P61A 3EX2A 2P1FA 4A2RA 4O12A 1EB3A 2Y62A 4QJ1A 5DN1A 1P5BA 2AQWA 3NQCA 1LLZA 2V9DA 5D30A 3NM3A 3BG3A 4GE8A 3PB0A 4IOTA 1QPNA 3UWWA 4DBDA 2TPSA 1MSSA 4N6FA 5FESA 2PC4A 3G8EA 3M7WA 1LTDA 3PBWA 4RK8A 4AWTA 5CGQA 3WJWA 3DZ1A 2QCLA 3INPA 1HTIA 3LHVA 4EWND 1Y0EA 4MFDA 1TYGA 1XBZA 4IMDA 4O19A 3UXAA 4HNNA 1TV8A 1DJQA 4UFIA 3W9ZA 1R2SA 4Z08A 4UTKA 3UY8A 2BZNA 2WJZA 3K30A 5DLCA 4JX5A 5D37A 5DELA 1LROA 5E1QA 2VFHA 1QPQA 2ZCGA 1OF6A 4DF1A 5CPOA 1FCVA 3NL3A 4UFLA 2ZRXA 1T0OA 1KFEA 2V30A 5F2GA 2E6YA 5LNRA 2E6DA 4LRTA 4AWSA 1WDWA 3FYPA 5DY2A 1KA9F 1XBXA 3RNDA 2CLHA 3NVTA 4XUGA 3P62A 1R30A 3TU9A 1ZAHA 1EX5A 3C2FA 4JYEA 1VR6A 4GUFA 3DFTA 1Z44A 4NJKA 3L21A 1QO5A 5KITA 1TPUA 3LCFA 3HF3A 3FFSA 1RZMA 4HPJA 4E38A 3WJZA 5AC8A 2CLOA 1GZGA 3G24A 1H7NA 4DPQA 3CIXA 3O8AA 1S3HA 3GIYA 3W7CA 5LNUA 2BTMA 1JUKA 1W3TA 4GXMA 5LZLA 1YTKA 1AW2A 1TCDA 4NJJA 4FHAA 1OFRA 5DXYA 4O28A 3P8IA 4UR8A 3NGJA 3C0JA 1HG3A 3TH6A 4HSOA 1O5XA 2GJNA 2WNZA 1HL2A 4QSHA 3QW3A 2ALDA 3TSMA 4AWUA 3FEMA 2NWRA 2DZPA 4O4VA 1TPVA 4MY9A 1TQJA 3LBCA 2ATMA 3G0XA 2NXGA 3CM4A 1ALDA 1YDOA 2YPIA 3SR7A 3QM3A 4LU0A 4LS1A 5KZEA 1K02A 1GYNA 1RVGA 5FF2A 4AVFA 1LYXA 2FLIA 2G95A 3A9IA 4NVTA 1W1ZA 3W2JA 4RZ6A 2ISVA 1M7PA 2ZZ1A 3MHUA 4M6VA 4LUIA 3IGXA 3MO7A 3W76A 3QFEA 1BWKA 1XM3A 4XBKA 4IGHA 3NG3A 4UTLA 2QCHA 3V75A 1TJPA 1WOBA 1OFOA 2TRSA 4TO8A 5EMUA 3HIJA 3QMSA 4CQ8A 3TW7A 5AHFA 2X1TA 4J9JA 3LXBA 3QH2A 3OHIA 1P0KA 3QC3A 1ML1A 1KM1A 2VKZG 3P74A 3ZS4A 1ZY9A 3S5YA 1AMKA 4UMAA 4AXKA 3GVGA 2CZ5A 4C1LA 1FWSA 1TB3A 3TR2A 3USBA 1B4EA 3W1TA 1WA3A 1GVOA 4O18A 3IIZA 4PC8A 1Q6RA 1FWNA 4UIOA 5J5RA 1ZAIA 1GTHA 2FIQA 1WXJA 4N02A 1DV7A 3THQA 1JJKA 1ME7A 4JTUA 4LTSA 3I7SA 2FDSA 1DOSA 4IPIA 4RKAA 2RKXA 3ELFA 2ABBA 2VEKA 4O1CA 2YFNA 3W2UA 5D33A 2VFEA 4LVFA 3TK7A 3S1VA 1JUEA 1TMHA 3L0KA 3IIOA 2QR6A 4Z1CA 2J88A 3BVJA 5EPDA 5F2MA 2DZVA 3W88A 1EUNA 3KRZA 1J5TA 1W37A 2RDTA 1ZFJA 3CIWA 1FUYA 2VEIA 3GXPA 3D0CA 3RK8A 1S5VA 1H60A 3P80A 3SECA 3B0PA 1QAPA 4JDYA 3QJAA 3CB8A 3GDKA 3M47A 3FKKA 1VJIA 1SQ7A 4GUIA 1KLZA 1TRDA 2JGYA 3G0UA 3BARA 4Y6GA 4MZ1A 3LCLA 3DGRA 1W56A 3NQ6A 4XTIA 2RH9A 5D05A 2OJPA 1SO5A 1TJRA 2E6FA 4Y9AA 3W7NA 3LRKA 1XC4A 2YDAA 3PSVA 1VCVA 4FX8A 3PG9A 1TPC1 2RDWA 4N4QA 3TC6A 2YYTA 4LV9A 4ORIA 3UQNA 2G96A 4MVAA 1FWWA 2WO5A 4K6AA 3A24A 3G1FA 1TV5A 1L9WA 1GJPA 1KTBA 1MXSA 1U5JA 4AEOA 4CLMA 5AYXA 3KX6A 4E2DA 1XFBA 2JKAA 3CLMA 2Y6ZA 2YCEA 3GAYA 1FCQA 3G1SA 1EWDA 4DELA 5KZMA 1SW0A 5KTLA 3W84A 2PRLA 3HGSA 3W2KA 2QJGA 3LRLA 3EWZA 4JXCA 2JKPA 2EGZA 3NQFA 3MYPA 3IV3A 2YXGA 1WQ5A 1DHPA 3HQ1A 4UTWA 3DFSA 3NR0A 1KFJA 1FBAA 3SJ3A 5AYYA 2Z6IA 4NT0A 5I3GA 2ZRVA 4GWEA 3W7HA 1GVRA 1DKWA 3OVRA 3PBYA 3EWYA 3B03A 5LNVA 4YMZA 4IX0A 2HSAA 5FEZA 1VH7A 4NNCA 4BI5A 3STGA 3TXZA 4OE7A 3FYOA 3LTPA 3KHJA 4RXGA 3MI2A 4R34A 4OV9A 3PWAA 3MI3A 4JX6A 1H7OA 5F4XA 3W23A 4K7VA 3EXRA 3EWUA 4RCXA 1KM2A 1SO6A 1F76A 4YWIA 4O10A 5CZJA 2NWSA 3CT7A 4NJIA 1AL7A 5KINA 1H50A 1PVNA 3VFLA 2YW4A 4JY9A 4UTJA 2GJLA 1UCWA 3W75A 1PE1A 4NNAA 4E0CA 2A1YA 1KW1A 1OFAA 3QSRA 5AHLA 4K39A 3QRHA 1KBIA 2O7SA 3HG5A 5DY3A 4XBSA 3QMRA 2DZWA 2RFGA 1LRQA 3UZJA 5CZ0A 3YPIA 1AW5A 4OWGA 1H7RA 1ZALA 2GVGA 1MEWA 4ZQRA 5HMSA 1SW7A 4DQWA 4TX9A 3QSTA 4LVAA 5CSSA 5EL1A 1KV5A 5BMXA 4H4IA 1W3IA 1XL9A 4PEKA 3SZ8A 3GLCA 2VFIA 3SY5A 4JTIA 2QAFA 2WNQA 4JTJA 1RQEA 3VNDA 2A5HA 1NVMA 2Y63A 3RMJA 3LDVA 4UC5A 3DAQA 4I9AA 5TIMA 5F4WA 3DHFA 1F05A 1VQTA 4UUIA 1BEUA 3GAKA 1XXXA 3DKJA 3KXQA 1YTEA 2PE4A 4Q33A
chains in the Genus database with same CATH superfamily
3M4HA 2PP0A 2YCIX 3PZQA 1TIMA 1TE6A 4WY0A 2YBUA 3LD5A 3AXHA 1RAKA 4AAJA 3RF9A 2RJHA 1Q6DA 2EPMX 4OTKA 5MHBA 2QVHA 4KFNA 1UIPA 2B31A 3L65A 3LBMA 4AH7A 3OW1A 4NZJA 1J10A 2QKFA 2D22A 3IRDA 2QJJA 1EZWA 3NOEA 4GQRA 3SIZA 1XLMA 1YKWA 1I0BA 4UZSA 1W5OA 4WF7A 1CXIA 5I3JA 1JFHA 2PDCA 4BCEA 2JIEA 4H9VA 3ZYZA 4Z2HA 3CAWA 2XIJA 3SSJA 3M6YA 3UBPC 3MP3A 2R1PA 4Q4MA 5FSDC 5I2UA 1CEOA 3KOFA 4FNSA 4OECA 3AJ7A 1TWIA 1PJ9A 1KCKA 1X38A 4WKAA 3EMQA 4ZA0A 2P3ZA 3RX4A 3VNYA 3TNBA 2G3FA 4JPGA 3NYZA 3LS9A 5FF3A 5HINA 2XSXA 1EJWC 3QHOA 3R0UA 2DZUA 1PWLA 3E2QA 1N8FA 3WLHA 4Z2KA 1UWRA 3M0XA 1T5AA 2OEKA 3P84A 3LY0A 2H6RA 1V3IA 1JYVA 5D32A 3U3HA 3WLRA 4F66A 5CC7A 5DT7A 1UR2A 1S39A 1UWQA 1R0MA 3W73A 2V2DA 2NUWA 1BQCA 3SRDA 2WC7A 3UY7A 1KCZA 2HXUA 1TV4A 1SZNA 1W3KA 3CK5A 1VEOA 3O6CA 3FK4A 4A3HA 1QW9A 4RX0A 4JEQA 4R3UA 1OGBA 1IR1A 4K7YA 4O8RA 3C2YA 1IEXA 3KS5A 1JNDA 3KFTA 4LUTB 2D20A 4ML9A 4QE5A 3DEQA 3V18A 1F8IA 1IHIA 3ARUA 4Q4KA 3UD6A 1OCJA 2X1IA 2C1GA 2DP3A 1ZBVA 4PGLA 1GG1A 4A3UA 3PULA 4AIOA 2GQ3A 2QCMA 4NAEA 2VUNA 4Y90A 1R85A 5D9NA 3VIGA 3W71A 2YDQA 3O16A 4YTUA 1JYNA 3GTXA 1P1XA 3AHZA 2RUSA 4UFHA 4AFYA 4IICA 2XGZA 3UEQA 4UNIA 1BAGA 5TBOA 2PEVA 4O52A 1V93A 2CNCA 3L4WA 2YSWA 3KCLA 3O9NA 5EA9A 1ZCOA 3GDMA 3LUTA 4AX6A 1EO5A 3E3HA 3HPSA 1PO9A 1E1FA 1QBAA 3ANUA 3I3EA 4JNMA 1EXBA 1RY0A 2C79A 4GMEA 3B04A 1EBHA 3BSHA 4DX3A 2A7PA 4F9JA 2EXOA 3TJ4A 4DWSD 5A6TC 4YCOA 4HK7A 2O4QA 5FOOA 4IQDA 1YHTA 4DBUA 3ZJ7A 1F7BA 1YBQA 1BG4A 4JIRA 1MEIA 1WZAA 3O15A 4WR3A 4D6JA 3BJTA 3QV7A 1UZ4A 3HG3A 3CT2A 3W82A 3EKZA 3BOLA 1R9YA 3WK3A 3S2JA 3DG3A 3G1XA 4Z42C 3EPOA 5FKYA 1QPRA 1K4HA 3CUFA 3VX0A 3TQVA 1E0UA 4NX5A 4GPNA 4HHLA 3TX9A 4RZBA 3WLNA 5HATA 3Q94A 5CSRA 2GLKA 2WQDA 4FA3A 1NF7A 1EPVA 5H2ZA 3ITCA 5I24A 4GX9A 3GXNA 7REQA 4CU8A 1O6IA 5FA5A 3T78A 2AMGA 2PDUA 5CAKA 4XO7A 1DE6A 4M1RA 4WXZA 1ITXA 3HO8A 3OPSA 4UFMA 4FMVA 3O6YX 3S5OA 1V0KA 4N42A 3UXDA 1E6RA 1IWPA 3E5BA 1K6AA 1GOOA 2IKGA 1XIJA 4IIGA 4Y9MA 3BMXA 1XD0A 3OGSA 3F5KA 2WVVA 3AIUA 3JZEA 2GGGA 4AQLA 1W3LA 1G4TA 3WDRA 3WUBA 1VP5A 1FWRA 3W7KA 1I2PA 2QCNA 4X60A 5D9PA 3A12A 1ZAJA 1A5NC 4TXEA 3P81A 2EEXA 2ZRUA 3RGTA 4HNUA 2WOQA 1J2BA 1YW1A 4JL1A 3KTCA 4GC4A 4QISA 1YE4A 1RV8A 3C56A 3P14A 3VGGA 1R9ZA 2BHZA 3CZ8A 1VKFA 3K13A 4ZE5A 5E09A 1XBVA 1Q65A 4NX0A 1DQWA 3AMCA 3VUPA 4HSHA 1HL8A 2NXIA 4CU7A 3FS2A 3IARA 3V4BA 3BSMA 4LOCA 1A50A 3LXCA 2V2HA 1Q4WA 1H09A 3NDZA 1VF8A 4LFYA 3DFNA 4I90A 3G3DA 3WF4A 2YA2A 1YIXA 4YTQA 3VIKA 2PF8A 3WLJA 5GNZA 3ORWA 3BV7A 4H00A 4ATDA 5JBFA 5I3HA 4QAIA 3M5XA 3H55A 2E5DA 3M0ZA 2IS7A 4Y96A 1VD6A 4DI8A 4GC3A 4R7OA 4F2BA 5BOOA 1JCYA 3T7VA 4TQTA 2BY1A 2NW0A 1EJXC 4K37A 1J18A 2P3EA 4Y9PA 4BF9A 4GKTA 1A5BA 4YTTA 3GFXA 2C15A 4UNKA 2OX4A 2FTYA 3WEZA 1FFQA 4FNTA 1OABA 2Q09A 3N15A 1DIOA 4QJ4B 1EPXA 2X0YA 3LPPA 3VAVA 4PMUA 3USZA 1JEZA 3WQCA 1IE7C 4WKHA 3CGTA 3BQ5A 3UG5A 3O0KA 3BDKA 1UA3A 1QNQA 2J9XA 2RHGA 3TKFA 1UKPA 4C6NA 1JG9A 1GYLA 3PWIA 3QHMA 3NQ8A 2ZZ3A 3CZGA 4C6CA 4PCFA 5REQB 4QLKA 2QDEA 3KL0A 7XIMA 3KRSA 4QG6A 3S42A 4H6RA 1SZGA 3S9ZA 6XIAA 1RJRA 5HULA 1FWDC 4WDTA 1B3ZA 2ZFAA 2HS8A 1A5LC 2BGQA 4YJ5A 4UTIA 3NPVA 2V63A 4CN6A 2G41A 4E4PA 4WGXA 7CGTA 3L4VA 5M2FX 3WDQA 2JEPA 3EDDA 3TLLA 1QK0A 5CC5A 4IMFA 4DJED 1XLKA 3BAJA 1NEYA 4GX8A 4GY0A 3U7BA 3ZT6A 3M1ZA 3V35A 2DQWA 2QQ6A 4AG0A 5IFTA 2D73A 4FB7A 2DEPA 2J8FA 5E0FA 3BOFA 2PLCA 2AGTA 4PTNA 3M44A 1BQGA 4EIVA 4CNSA 1K7XA 3C61A 3LQLA 4XKYA 1JI1A 1BKSA 2QAPA 3R0KA 3T40A 3VI2A 4B5UA 3THUA 1GEQA 3H2EA 3VIPA 1NDVA 2XVLA 4PMYA 4NZ5A 1ZGDA 4XIMA 3V5FA 5D2VA 1G4PA 3H6OA 3RPTA 1TREA 2CXEA 3CJPA 4CQCA 4MKVA 1XLAA 1RSCA 5LIWX 2A6NA 3WBXA 2ZRYA 3R79A 4B2DA 1L0PA 3FY1A 2V2CA 3RCNA 4RDYA 1F6KA 1OC5A 3U2OA 4Z1BA 2D1ZA 3TTQA 4GZEA 5D2TA 1HT6A 5G1YA 2DT2A 3IEBA 2P10A 1JYXA 3W1XA 4Z1DA 1ZBWA 4C91A 2H8ZA 1BTCA 1QHZA 2DJLA 4D6FA 2GGHA 5FJPA 4W9TA 1E1EA 1MUWA 3HGOA 1X1NA 4CCDA 1PWMA 2BG5A 5A6LA 2B7PA 1TUFA 5CPLA 4HHHA 4LSBA 1EQPA 3B9EA 1XYBA 1RQBA 2Z1BA 5K3VA 1SFLA 2YYUA 3PBGA 4H6KA 3DC0A 2GOKA 2H3DA 1KD0A 3UWQA 1HO4A 3A9BA 2QUVA 3S2LA 2I7GA 3JUGA 3QR3A 5GNXA 5AB3A 4AEFA 3W7PA 1EA0A 3C5QA 2V3DA 5DCDA 1VYSX 2PODA 3FHAA 4AZ7A 5KSWA 2FB3A 3TAOA 4WLCA 1LDCA 2WC4A 3GXDA 2OPJA 5A5WA 3APGA 4IM4A 2BOGX 3N2MA 3RLVA 4U5KA 3T1GA 4FXJA 3E0WA 3O6DA 1ICSA 4KRZA 3B8TA 1TO3A 5FF0A 4B16A 1WBHA 3RMEA 2FGZA 1FWBC 1I0DA 3L4ZA 2I57A 5IHRA 2J8TA 2NQLA 4WD0A 4J3UA 4HA3A 4JNYA 1Q6FA 1ODUA 1EC9A 2GK1A 3GTHA 2Z6JA 3F7JA 2GDQA 5AVNA 4Z0JA 6XIMA 2CLIA 4QM1A 4QX4A 1NF0A 4IJRA 4D1IA 4JTLA 2A3CA 3L2LA 2EHHA 3T42A 4ZQNA 3WLIA 3MP4A 3MKVA 3NO5A 3CMGA 1TV7A 2XVKA 4XSMA 3UYIA 2FZDA 4IPPA 1I2QA 1JD9A 1RH9A 1XP3A 3H2MA 5FIPA 4LV4A 1YYAA 3ITLA 4YU1A 3U2ZA 4JHOA 4QNWA 4BF5A 6REQB 3MSGA 4PL1A 1A5AA 2QUTA 5HUOA 3E49A 2OT1A 4B3KA 3KCOA 3ARQA 1H1NA 3W70A 4WJ8A 1JGIA 1GEHA 1S2WA 5BRBA 3QR1A 4MYAA 1W1YA 2R91A 2ANUA 2ZX6A 5D9MA 2G0WA 3VK5A 3E0IA 1FXPA 4UQ9A 4NAFA 1B3WA 3OBAA 3GO2A 5BXSA 3N2XA 4ZOCA 3WQ5A 5AC5A 2DVUA 2FB2A 1AODA 4LNYA 3HPAA 2ZZ4A 1W0MA 2G3IA 3IGHX 4HHPA 1O5RA 3T0DA 1YX1A 4LWWA 2HBVA 3ARTA 3MHFA 4O8AA 1H7XA 2JQXA 1OD0A 1OYBA 1UKOA 1F73A 2XPKA 3W2LA 3MPGA 4PZVA 4CCCA 4TTUA 3CZJA 1F3TA 4AD1A 3HPZA 4Q8OA 4KRUA 1RBAA 1TE1A 4JS3A 3FJLA 4BEQA 1KM4A 5E93A 2VI0A 2VJXA 4W86A 1BHGA 4QNEA 1QT1A 1KKRA 3LV5A 3F5LA 1W8SA 4DUWA 4O54A 3ZQ9A 2QMKA 2CU0A 3LCGA 4PTWA 1NIUA 3WQGA 1UH3A 1CI1A 1QPOA 5D38A 1EDGA 2Z2BA 2W66A 4IPJA 4ZL1A 4HB7A 1DWFM 1DIKA 3APYA 4FIQA 5AHNA 3BG5A 2QF7A 4QAWA 1RLDA 2ZXAA 3H24A 4F48A 4DWSC 3BJFA 1S5WA 1XIGA 5DXXA 3GDTA 5A8PA 1IV8A 3BK0A 3M6DA 4O50A 3WLLA 1XGDA 3OIHA 1HIZA 1UWIA 3NL5A 4YHEA 3AMLA 4L9XA 4Y8FA 1PUDA 1J0ZA 2W9MA 4LALA 4UFJA 1PCKA 1JUBA 1GOKA 1E0XA 5AYIA 2DU2A 4LUSA 3I6TA 1IZJA 2CZDA 2Y5JA 4HMEA 3WF3A 1QJWA 2WZEA 3HMJG 1KFWA 1CLXA 1B3YA 2J7FA 2WMJA 1QRQA 2WBKA 3M0JA 1J93A 1YDVA 3U8GA 1E1CB 3GDLA 4MB5A 5IBXA 5H6HA 2G3NA 1JDDA 1OSEA 2QUMA 2XIQA 4LS2A 6ALDA 5AHMA 1JL8A 4Z2LA 1XI3A 3PAOA 4NQ1A 3B8IA 3SUSA 4ZBCA 4J3WA 4CVUA 3BLPX 1WPCA 5LA2A 4EE9A 2XH2A 2CITA 4QEEA 4DUXA 2ISWA 3A5FA 4DPPA 4Q7BA 4EPKA 1ZRQA 2QCCA 4W8LA 1BGGA 4YS1A 2QF8A 4WVXA 2V0TA 5I79A 4FIRA 3O07A 3BC9A 4HCDA 3IACA 4O57A 4N0RA 3E5PA 4IXXA 4BFAA 3UWZA 2AKMA 3DOPA 1K7EA 1S1PA 2DVXA 4BR1A 4MF4A 2X1RA 4GVGA 4FR1A 2G4JA 4G1KA 2GQ8A 2XHYA 3MCOA 2A6LA 4KFOA 2NV2A 1WUFA 1ZB5A 1HZYA 2YXXA 5J5DA 1SFJA 3PJTA 2ACQA 2QV4A 4DLFA 1LL7A 1DJZA 1UOKA 2XIMA 3FVDA 4S3CA 2HK0A 4I5RA 3VD5A 2Y61A 3SRHA 3QW4B 2EKCA 2VEFA 1TQXA 4PYSA 1UIOA 2XN0A 5I5RA 1UUOA 4K8EA 1GVYA 3BMVA 4WQ6A 5CZTA 5EYWA 3KVMA 1C29A 3P5ZA 4PCTA 1GOQA 1PKMA 5FAJA 3FIGA 1FTXA 3G1DA 5DEZA 1XSJA 1T7LA 1WX0A 3B8UA 2XH0A 3NAVA 4PMJA 1FKWA 5BU6A 3L68A 3PPCA 4H9TA 4IIEA 4F2TA 1EA9C 2WANA 3GU1A 1ZNNA 1POJA 2I1OA 2OT0A 3T05A 4QDPA 4PR4A 4AX7A 1UP2A 3BGJA 2Y5EA 1TTIA 1BVZA 1WO2A 3W87A 1DQUA 2J47A 3MVTA 3W1LA 1L6SA 3UZ5A 5CLTA 3PJUA 1UKSA 3TWBA 2E9LA 4YVXA 3WJYA 1LWIA 3CUGA 1GQIA 4IX2A 4M0XA 1V03A 3ZSTA 1IQ8A 3QLDA 3I4KA 4O0ZA 1JD7A 4D71A 3SUWA 3EDEA 4A3QA 4ZB2A 4S3AA 3CUIA 4AC7C 2JF7A 3PJXA 2TMDA 4JFVA 1XCWA 3OBKA 4C1KA 4DZAA 1XH0A 1NTHA 2CERA 3QQ1A 1R9XA 4D2JA 5G2HA 3CZKA 4LCQA 3CHVA 5CBIA 4YCPA 4GYPA 5D03A 3UFYA 4PTXA 2PTYA 4ADTA 1NARA 4MWAD 2XISA 4EX4A 3S5NA 3LENA 3ZOAA 1XLGA 2ACRA 3N17A 7TAAA 1HFBA 2XN1A 2WWDA 4GK8A 3AISA 2NX3A 1O4UA 3WQEA 2CLLA 3GSMA 4QEHA 5C7HA 4FNRA 4KGLA 4RW3A 4TR9A 1UJPA 4TMCA 3KDOA 1P4CA 2QJMA 5T9CE 2QCDB 3ABOA 2FZNA 4JN6A 4O16A 4XVEA 3S5ZA 4DJEC 2VEPA 4A8NA 4N2YA 2EPLX 4HK5A 3CUZA 3ECQA 2QYGA 2OLHA 4FNPA 3IIPA 4FOKA 3D46A 2R9RA 3WNPA 4ENLA 2HVOA 2A4AA 5D2YA 5T91A 3G5EA 4A2RA 1QI4A 5DN1A 2GSEA 2WMKA 2QLYA 1OD8A 3NM3A 3BG3A 4V33A 3ES7A 4DBDA 4GO8A 4Q4RA 5FESA 3G8EA 1LTDA 3PBWA 4AWTA 9XIMA 2QCLA 1HTIA 4EWND 3WENA 4MFDA 1XBZA 4MNMA 3UXAA 4HNNA 3EOEA 1R2SA 4Z08A 5TNVA 3AHTA 5DLCA 3L4YA 3ZVHA 2OZ8A 1SJBA 3N11A 3E0LA 1OZQA 4P7OA 2ZCGA 1OF6A 2BB0A 3IS4A 3NL3A 3QV8A 2Z7KA 2MUCA 2ZRXA 3UVAA 5F2GA 2YCKX 5LNRA 2E6DA 4LRTA 3FYPA 4O1EA 5HMEA 2OEJA 2OO6A 1R30A 1QW7A 1SJCA 1RJPA 3C2FA 3WQPA 1PTDA 3G2GA 1JZ3A 3KOZA 1VFMA 3L21A 2YLLA 4QR6A 5LYRA 2A3BA 1TPUA 3XISA 4XUYA 2Y1HA 1DXEA 1XS2A 3EDJA 5JBDA 1W9BM 5AZ1A 1XYZA 3GIYA 1NOUA 1W1IE 3M0MA 3NIYA 3W7CA 4K68A 1JUKA 4MKSA 4IG2B 3OG2A 2WZMA 5E6YA 3RJYA 1XQKA 4FHAA 1OFRA 5DXYA 3GVQA 2PGFA 4GIYA 1HG3A 3FNDA 4HSOA 4G7EB 2WNZA 4QSHA 1JPHA 3AHYA 1Q85A 4KEMA 4O4VA 1F9CA 1TPVA 1XF0A 5JU6A 1TQJA 3R4IA 4L1WA 2VC7A 1UPMB 1CGTA 1T41A 1A4LA 1GYNA 1BXBA 4XX6A 1PPIA 4CCZA 5FF2A 3JZUA 1LYXA 2YA1A 3B3DA 1RA5A 3N2TA 5BROA 1TA3B 4QCEA 4HU3A 3A9IA 3C0LA 3AZSA 1XLEA 1M7PA 3T0AA 3VO0A 3MHUA 3OBEA 3ONCA 3H7UA 3IGXA 3DBNA 1EFZA 4DXXA 4M1BA 1BWKA 4Y7EA 2ZUNA 2MANA 4TO8A 5EMUA 3BZJA 3LYEA 3HIJA 3TW7A 3GE7A 3U2EA 2B81A 3LXBA 4XVDA 3QH2A 3OHIA 1AJZA 2VKZG 1Y5WA 1ZY9A 1AMKA 3OJGA 2R1MA 3TR2A 1AQ0A 3OQEA 5EFDA 1K9EA 4AD5A 4B4HA 3N3TA 4GNVA 1Q6RA 1JGMA 5J5RA 1ZAIA 3AUJA 2FIQA 4C6FA 1WXJA 2I5QA 3TA9A 1T6MA 4F2UA 4DYKA 3FX4A 2VYOA 3VKBA 4Q8QA 5CGMA 1C91A 1DOSA 5HXMA 3URNA 2RKXA 4FALA 1KBKA 1ZJAA 4RV3A 5D33A 3TK7A 4LVFA 3L0KA 5BWAA 3RYSA 2GSHA 4F0KA 2QR6A 3BVJA 3MY9A 4DZIA 1KBBA 5A95A 3TEVA 3TZNA 1REQA 4OKDA 1GOIA 2AL2B 2YZ5A 3RK8A 1S5VA 4L6DA 1H60A 3VC6A 4EP8C 1QAPA 1VFUA 4KCVA 4F8XA 5GJNA 1EDQA 3GU2A 1TRDA 2XH7A 3BARA 1ZBKA 3AXXA 1W56A 3NQ6A 4XTIA 3WQ8A 3VTRA 3OU8A 2HBXA 2F2HA 1TJRA 3LRKA 3EWCA 1VCVA 4KEZA 4N4QA 3TC6A 2YYTA 4AZGA 4LV9A 5AYBA 2G96A 1HXJA 3WMCA 1TV5A 1L9WA 3V3WA 2REQA 1RUSA 1WZMA 4B3LA 3RLGA 5AYXA 3GG7A 3QY8A 2BY3A 2JKAA 5HDRA 3GAYA 2OG9A 1FCQA 3ICJA 3C3UA 2VRJA 1SW0A 3SCOA 5KTLA 1PZ3A 3OQ8A 1BXCA 2ZUMA 2QJGA 1H2JA 1ZP4A 3LSBA 4FOJA 2FZMA 2OWCA 3IV3A 4HGXA 2WJEA 4MB1A 1LT7A 4BA0A 5GQBA 5FCZA 1LUCA 2PB1A 4JTCA 3NSMA 4NT0A 2ZRVA 4LUYA 1ITUA 4JKLA 4CD6A 8RUCA 1X6NA 3SFWA 4ACYA 4AIEA 1DKWA 3PPHA 1PIGA 4YMZA 4IX0A 2HSAA 1M9HA 4HK6A 3FYOA 4F79A 4RXGA 3S4TA 4XAYA 4R34A 2ZXDA 1XKJA 4ZENA 3PWAA 1J96A 3WELA 3SIMA 1W17A 2RAGA 4HU8A 4RCXA 3VNKA 2I5GA 2D3NA 1B90A 4C6QA 4P7LA 1F76A 3R6IA 1S46A 3CT7A 4NJIA 1H50A 3R11A 3B4YA 4JY9A 3VFLA 3A47A 3TP4A 4E0CA 1JAEA 1NWSA 6CGTA 3ARYA 5DY3A 3YPIA 3I3DA 1A0CA 1H7RA 1MEWA 4JL2A 4H19A 2BMBA 4S3KA 4DQWA 1QI2A 4IIFA 1I6NA 4J3TA 5EL1A 3A4XA 1GORA 1C9WA 4H4IA 3CL6A 2VFIA 2OQLA 5BU9A 4J40A 1E0VA 3WIJA 5F4WA 3II1A 3DHFA 1UC5A 3CV2A 1RCOB 2A3AA 4UUIA 1ISWA 3UNTA 1BEUA 1KR0A 1V6VA 3PTKA 4J3XA 3C8NA 1XXXA 3MUZ1 3KXQA 5CAHA 1YTEA 4Q33A 3G1YA 1EH9A 1OFBA 2YCLA 3NL6A 5HAOA 2P8CA 4NJHA 3IJLA 3B8DA 2OGYA 4JTHA 4K1WA 1SPQA 3B9NA 4MSSA 1Q5MA 2DSZA 3SAZA 1ENUA 1EXPA 2QPUA 3IK4A 5H91A 4US5A 2WCGA 5FI8A 1IGWA 4QRNA 4MAZA 5CQ1A 5BXTA 8XIAA 3TYUA 4RLIA 5CZSA 4WXYA 5DBUA 1BWLA 1OGGA 1JAKA 3L66A 1OM0A 3F4WA 1P0NA 3SN4A 1UZHA 2QJHA 2VFFA 1ZJIA 5M03A 1AQHA 4J7RA 3V16A 1R7AA 1EUAA 3AIEA 4DUOA 1ONRA 1VS1A 3Q65A 3VKKA 4H9MA 3SCTA 1QNVA 1EP2A 1D3GA 1SZEA 4DJFA 2J7HA 2FPTA 2VZSA 5MKGB 4U5IA 2ZA3A 3QKZA 1QHPA 4MUPA 5DT5A 4LC6A 4HPNA 5FL0A 4D6EA 3EX4A 2BY2A 3T08A 2Y4SA 3W4RA 3O63A 1MDLA 4IFKB 3RN6A 4F4RA 2H90A 4G7FA 5CZKA 4GA8A 1S5TA 3RUBL 3B0VC 4GUGA 3C0SA 4JTAA 3HGJA 1EP1A 4AD4A 4GJ1A 4LF1A 3NA8A 5SWUA 4M3PA 2X05A 1J0KA 5F2IA 1M03A 4ZR8A 4A8RA 3VOCA 4IWWA 2B7OA 4CNUA 4JTDA 4BWLA 1YPIA 4KEVA 4LANA 3KBWA 1R2RA 4UCGA 3BCFA 1F8MA 3MMWA 5EB8A 3HG4A 3PZGA 1GVEA 2HNEA 4RL3A 1U83A 3SI9A 4OOZA 1LBFA 1XLDA 2RDUA 1MYRA 2DZTA 4ZTYA 3NCOA 1DXIA 2P0OA 3PAJA 4ECLA 4A3YA 3WQ6A 2WMHA 1LCOA 1LWJA 2NV9A 1UD3A 3VXGA 1LOQA 4MNJA 5JXQA 1AK5A 1SU5A 4Z1YA 2NQ9A 1UBPC 3RDKA 4UTUA 3S8HA 3W1PA 4MWAC 4KWUA 1FRBA 1LP6A 3DFOA 3VOFA 2Y85A 1PKLA 4JQ3A 3OIXA 3T4WA 3O05A 4Z17A 2WHJA 1I9CB 4MM1A 4H8VA 1FY6A 1W1PA 4MNKA 4P61A 1XPYA 1KLYA 1H0GA 1TPEA 3NPUA 2WV8A 4IMAA 4U3CA 4GI6A 1UKQA 4OQVA 3E9AA 2G97A 5CBJA 4KRTA 1ECQA 1QCWA 8A3HA 3MQTA 3DGBA 4M5PA 1M7OA 4GINA 3DECA 4OOUA 3M7SA 2VELA 3RLHA 3LMYA 1JQXA 2WB5A 5T8GA 4WOQA 1JRCA 1L6WA 3PUEA 3UU0A 3DU0A 4KWOA 1E56A 2FH6A 1TX2A 4HNCA 3UWUA 3TSBA 3WK2A 3CASA 3TN4A 1DIDA 3ABQA 1M53A 4U3AA 3SRKA 2XM1A 1GOXA 3PBVA 1E6PA 2P50A 1R3WA 1YADA 3NDYA 3EX6A 1E73M 1CXKA 1OJXA 5KZDA 1DBTA 4HOWA 3W6MA 5HBFA 4AHQA 2WYSA 3W6LA 1OHLA 4IIHA 4LT9A 4CKQA 2ZC8A 3GUWA 4ACZB 5JBEA 7ODCA 3QOKA 2C1HA 4CQ9A 1JCLA 1KGWA 2CBIA 3NNTA 5JUVA 2XM2A 1P7TB 3PZMA 3VIFA 3NZGA 1F6YA 2C18A 5AECA 4YXGA 3LA4A 1KFCA 3ITGA 1BPLB 3AS1A 2AMXA 4DBEA 3QEZA 1XH2A 5IBXC 3VM7A 4UTTA 4IISA 3V36A 5CH9A 4IPNB 3RCYA 1ADOA 1Z7AA 2PC8A 1E0TA 2VGBA 4DJDD 4D6GA 1G9HA 3PZOA 4WJXA 4Z2GA 3UJRA 4AMCA 5C5YA 3WLOA 3GKFA 1JVNA 1ZZMA 1TVLA 3W26A 4ZEPA 3KDNA 4X0NA 3IAQA 4L4PA 3S2CA 3AS3A 1ZJBA 1QO2A 4A05A 5I78A 4FEZA 2NSXA 1AVAA 3VABA 2NXHA 1D9EA 4A22A 3VOJA 4BHYA 4JYFA 3FXGA 4IPLA 2OFJA 4GI8A 4LJ3A 2VZTA 1W31A 3MUAA 4GI9A 4B92A 2VNCA 3OB8A 3P3BA 4JCLA 4PE8A 3PZUA 1WP6A 3U7VA 3K2GA 3SBFA 3P93A 3HJZA 3MUCA 4IQJA 5DX7A 1RPXA 3URQA 2ZUVA 3T0TA 3EPMA 2VZOA 4FS9A 1YNPA 3GXIA 2ZVRA 2EJ1A 4GY1A 1EKOA 5LSMA 3R58A 1I60A 3DDMA 3IJ8A 3H8AA 3FOKA 3SURA 1V6TA 4ZO9A 3KBNA 2WQPA 1ZQ5A 1HNYA 4V28A 2OWXA 3JRKA 1EJ7L 2BNJA 3LX9A 1JZ8A 2OZ3A 3EDFA 4Q32A 2P53A 5C9WA 1B3XA 1AQMA 1X39A 4NSBA 4OV4A 1GQNA 1WBJA 3W1UA 3FJ6A 1RHCA 1X8FA 2J6XA 3N2CA 5DMNA 1GW9A 1VJSA 1IIGA 3CQKA 3EOUA 3WDHA 2BVWA 2NSOA 5CSUA 2DJXA 1I75A 3MV11 3QC0A 3HV9A 1WZKA 3ABRA 4BI7A 5HK4A 4QIUA 3H23A 2ESCA 1AZ2A 3QLLA 1P43A 3JU2A 1HKKA 2OR2A 3SCNA 1GOMA 1KQYA 3LHYA 3HZ3A 3OODA 5H8MA 1XINA 2F6KA 3SFKA 1EC7A 2JIWA 1N8IA 2OKTA 2V8ZA 3RCMA 3B40A 3KHDA 3SGUA 4MUZA 1BSIA 1G7VA 4WY0B 5FD0A 3STEA 2H9AA 4HD5A 7ENLA 4PCSA 5C54A 4OUIA 2V5BA 3H4GA 1U1UA 1BFNA 3TXVA 4HOXA 3B9OA 5BXPA 2WJDA 5K2ZA 3ARPA 3NSNA 2X1SA 1Y65A 5A2AA 3L23A 3KRBA 2YB4A 5CJ5A 3KW3A 4V2XA 1W5QA 4GZIA 4Q6XA 3BANA 1U30A 3WLSA 3TW6A 2FTPA 4O1DA 5I09A 1AL8A 1H51A 1WDPA 4ZQCA 4JNZA 1HJXA 3HFTA 1EL3A 1CXEA 1XYLA 3SW6A 4R27A 4KFPA 3TN3A 1M6JA 3QVQA 1OX6A 2HWGA 3DFYA 3MANA 1R8LA 4MPKA 2BX7A 2P5NA 4H8UA 3MP5A 3LG3A 3KBSA 4UTFA 4IH3A 1U22A 4LF2A 2WMFA 4OZOA 1WKFA 1VFOA 2PURA 3QV6A 2YGYA 4O14A 1D8CA 4JD4A 4JKMA 3REQB 1LJYA 4F0LA 2NVAA 3VMNA 3C3NA 1WUEA 5K9CA 1ZLPA 1QOXA 1PXGA 3WF1A 5A6BA 3R2GA 1F61A 1NDWA 3BTNA 3VOHA 2D23A 3D47A 3H2AA 3IVTA 4J4KA 1O60A 4JFTA 3IGSA 3W6YA 3SUVA 2DZAA 1K8ZA 5FJUA 2D0HA 4L64A 1W9UA 3BCDA 1V6WA 4HSNA 3LEPA 3T07A 1C92A 2E4TA 2HCVA 1QU4A 4JCMA 1SGJA 1YE6A 4D6DA 4LW7A 5LNWA 3PTMA 3SCWA 2F7FA 4HIBA 1AJ2A 1E4IA 3B9AA 4MJMA 1E5NA 1OADA 2R94A 4WJEA 5ECUA 1OYAA 1JZ4A 4TV5A 1XDJA 4R7WA 2Z2UA 3GR8A 3CXOA 4QE4A 3AHXA 1HJWA 1ITQA 4EPBC 4TU1A 5HNRA 5BZAA 1V3MA 4P8WA 1SM9A 3GW3A 1OB0A 4V27A 5FEXA 3S2MA 2QDDA 1V6XA 4L6HA 2R1KA 2PP1A 3GXMA 2BGSA 3GTIA 4L6OA 3I7RA 3B0YA 3TR9A 4M81A 3KE0A 3KRUA 1ZENA 3KWXA 3B9DA 2E9MA 1A5KC 3E12A 2B7NA 3T0BA 3B0XA 4GIEA 4IP4A 1B1YA 4KCUA 1DJYA 1PDYA 3GDBA 3T55A 1X7FA 4M6PA 1FX6A 5C2CA 1EJTC 1VYRA 4RE0A 1H0IA 2CKSA 2INZA 4AVNA 3KZSA 4NAEB 2GQ9A 1C8QA 1NQ6A 1F3XA 3SUTA 3QV9A 3VCRA 4HZMA 3WNOA 1P48A 2PBGA 3GIPA 1KC7A 3BJSA 3BPWA 5I23A 2Z1XA 4JTFA 4HZ7A 1BYBA 1VAHA 1FCUA 2J9ZA 4O0QA 4DYJA 1M65A 2Z4GA 3ITXA 5F1UA 3WH8A 3U9IA 4PB5A 4DZ5A 3QFWA 4JTKA 2VR4A 1SJDA 1W1B1 3G22A 1ELSA 2PDBA 1XG3A 3T9PA 3PANA 2PWEA 4LNCA 2OVLA 2A7RA 5LGZA 2Y7FA 2O7QA 1IXPA 1YBQB 5JVLA 2VMFA 3DHDA 2IXVA 2V69A 4S3JA 4WSJA 4HYVA 2D2HA 1A0DA 1XCFA 2PDMA 4I7WA 3A3HA 3G8RA 1GGOA 2IPFA 3N34A 1E40A 3FAWA 1GZJA 4QG8A 3T44A 3R0DA 2C14A 3BLOA 4H2CA 5AHEA 2RDXA 2Y24A 1QFEA 2OYLA 4QITA 3EAUA 2YOCA 1UH2A 5A6KA 3KP1A 5A69A 3DFHA 1TRIA 1X96A 2W62A 1DWGM 1G4EA 4E3VA 3WCZA 4CN4A 5CCZA 1FDYA 2O9PA 2GWGA 1EP3A 3W3OA 1Z9AA 1PX3A 3NPWA 2F38A 4QG9A 7REQB 4YTSA 4MY8A 4AHPA 2CIPA 3DENA 4MPQA 2WCAA 4LQ1A 3R89A 4OBTA 1Q6LA 4JIIX 2FZ8A 5AZ0A 2PLJA 1SO3A 4IFOA 2G5WA 4C6PA 2ZXBA 3VZXA 4ZSUA 2UY5A 1DWJM 1LBMA 3HM7A 3TC3A 1P6CA 3E2SA 5CPSA 5A8GA 1IIHA 3BMWA 5D09A 3QPZA 5H8PA 2VTFA 4UQCA 2DIEA 1TX0A 3R1ZA 2NQHA 3E02A 2WVVB 1OX5A 3TFCA 1H62A 3H12A 3P0WA 2W4XA 3ITOA 3VDBA 1WV2A 2YBTA 2GVLA 3AIQA 4AIBA 1IEWA 3Q4DA 1YXDA 2YL8A 1DTUA 2B7QA 3WG6A 1NQKA 3N14A 4NZ1A 2XYLA 4FO4A 1TPH1 3RITA 3OG3A 1M1BA 4XD4A 3S5SA 2BVYA 1VLWA 3R25A 4NYYA 3H4XA 1ZPTA 3A23A 4C65A 2XFYA 1T8QA 3Q2DA 2XUCA 1D3CA 3WKZA 4RZ5A 3NQAA 2O0TA 1PB0A 4G8TA 3WBEA 1AH3A 2CWXA 1BRLA 3EEGA 2QIWA 1XYMA 2ZDSA 4W8AA 2QS8A 2FKPA 1O94A 1RLCL 4JQ4A 3WNKA 3EWWA 6REQA 1VJZA 3UR8A 1LG2A 3QQWA 2ISFA 4PMXA 2PDYA 4DI9A 3W24A 3WD2A 5FL1A 1EHNA 1QMLA 3NQ2A 1VFFA 1JRBA 2WKGA 1R38A 4KETA 1G7UA 1LBLA 3ABZA 4WGHA 5EKYA 2PDPA 4U4MA 4PRWA 1QNRA 4LPCA 1XQLA 2Q8ZA 1UUMA 2WPBA 3AJXA 4JGDA 1OFQA 1WNOA 1EZ2A 4YVVA 1ONEA 2DIJA 5G2IA 4XKMA 3BQ6A 4ZQOA 3CS2A 1S5MA 3ID7A 2WMIA 5K9XA 5FF4A 1F4AA 3W7MA 2J6VA 4PUDA 4PH6A 4XG1A 2PPGA 3LCIA 1WAWA 2D3LA 1AMYA 2DT0A 1TWZA 1R46A 3R94A 1HKVA 1GPWA 2YL9A 3NO3A 3ZWSA 1JXJA 5HQEA 3QGKC 1XSIA 1CB2A 1VFHA 4M8UA 4IL0A 4AYGA 2TYSA 4S1FA 3POHA 3DYMA 3QHNA 1UJQA 5C9UA 2Y8UA 3JS3A 4DJDC 1NWUA 3CV1A 4WDXA 5I00A 3RRAA 3AZRA 1AW1A 2DZSA 1DWIM 1HP4A 3N4EA 1CECA 3FSTA 5BXRA 4J3SA 5ECVA 3GC5A 1RQHA 3PVFA 4QTGA 3ABXA 3W22A 1V3JA 4QFUA 1XUUA 4REQA 1EIBA 1HW6A 3W01A 5GJPA 1FWTA 3UR7A 4PBFA 2NVCA 4G6CA 1HUVA 1Q45A 2PRMA 1S2UA 9RUBA 1UR0A 1WOAA 4WOZA 1OT1A 2ZYFA 3WN6A 1TZZA 4AISA 3BLIA 4C90A 5EMJA 4ERGA 3K5XA 2F6XA 3WH6A 4DO5A 3LTYA 4POCA 5IOBA 3AIWA 4JR5A 2NVDA 1J8VA 4YIWA 2Z1WA 1NY1A 3ZT5A 4L7ZA 2VX5A 1DWAM 3W7JA 1IEIA 1IEVA 4U10A 1ICQA 5LIUX 3IAPA 1UKTA 3DG6A 2QPXA 4MGGA 4AF0B 4JHMA 4BQ3A 4U28A 1BWVA 2DGAA 3SGZA 4DJFC 1Y7VA 1DXFA 4Y9OA 4W4QA 2EPNA 3EPNA 3WDPP 1RR2A 1JR1A 4H04A 3WD3A 4N9BA 1C7TA 4PB4A 5C71A 2XN2A 4JIPA 5EGRA 2PDLA 2WC3A 1TG7A 4GRSA 4X2RA 2CLFA 3FYYA 3GTFA 1OFPA 1C8VA 1OF8A 4IP5A 3A3WA 1E3ZA 2CLMA 1KRAC 1VHNA 2A3LA 1UB3A 3SCRA 1KGXA 3UGRA 1EJUC 1HN1A 1UYQA 5PTDA 4XQ6A 1RD5A 3I10A 3K4DA 2G8ZA 3GNDA 4BWLC 2I14A 3RLUA 4JTSA 4E8CA 3AZTA 1BD0A 1XUZA 4ZB0A 2OO0A 3W1RA 1PX8A 3CHFA 5I77A 3FVMA 3TYDA 1UMLA 4HT3A 3DIPA 2ABAA 2NQ5A 3UPBA 3PNZA 3WEMA 1CGVA 3VKDA 3MKKA 4W7UA 3SRFA 3MDUA 3LPFA 3E2RA 4LVGA 1UR1A 2F6UA 1U2YA 3M0KA 4CCEA 1JZ6A 4HNOA 4OIFA 2W79A 3IV8A 3JR2A 4N9DA 4PMQA 4LXFA 5CPQA 2JALA 1DE5A 1S2VA 4IQLA 4Q4SA 4W5UA 1H63A 4Q22A 1UH4A 1RY8A 3HG2A 1PYMA 1Q6CA 1IEQA 4ES4A 3DI1A 3TQPA 2FFCA 3LNPA 4U33A 5D04C 4OFCA 3TQ0A 1L2QA 4BQ2A 5F1VA 1MUMA 1KFBA 4JQAA 4HHMA 1B9BA 3GVWA 2EF9A 1KXHA 2QPSA 3GRIA 3L0NA 4M6UA 1V02E 3CUXA 3CC1A 1TPDA 4DM1A 2ZRWA 5CG7A 4L4MA 5CLWA 1GJUA 3R5EA 4PUEA 2GK1B 4GO9A 1KGUA 2ZZ6A 3E96A 3TYCA 1SO4A 3W07A 2C91A 1UHVA 1FDJA 1TVNA 3G6MA 1VZWA 3MJMA 1US2A 1TKKA 4HNTA 4XWUA 2FDMA 3WUFA 3WMLA 1C9DA 3C2OA 4MADA 5F4SA 4UTHA 1QOPA 3VKJA 2XGIA 5H8UA 1TTQA 3KLLA 3QGVA 3VM5A 2BVDA 3NDOA 1JCJA 2RJGA 1A4MA 3QYQA 3WQDA 2XDFA 2OYMA 4HNVA 1E0WA 2BSLA 2O9TA 1P0BA 5KZ6A 4URIA 2XFFA 1ISYA 1EB3A 1Z8AA 2V9DA 5D30A 2BOFX 2HZGA 7A3HA 1MSSA 4KS0A 4NI3A 4RK8A 3UF9A 1HVXA 4HCLA 4XBJA 4D8ZA 5D9OA 1Y0EA 1TYGA 1ISXA 4IMDA 3WLMA 1DJQA 1XRFA 4UTKA 5E70A 4NAFB 5D37A 1LROA 3E1F1 4CUCA 4GIRA 1W1VA 4IT1A 1FCVA 4UFLA 3R8GA 1KFEA 3ARXA 3T6CA 4AWSA 1WDWA 3WUEA 1TMLA 4QROA 1Z69A 4MWAB 1GQJA 1QI5A 1XBXA 3KZPA 1CB7B 3RNDA 2CHNA 3NVTA 3UPMA 2WZTA 3TU9A 1ZAHA 4IIBA 4GXPA 2PGEA 5XINA 4NKCA 4NJKA 3FN9A 3HF3A 4FZIA 3FFSA 4HPJA 4MG4A 1UR4A 5AC8A 4WIWA 4W84A 1ODZA 3W38A 4DPQA 1RA0A 3AYVA 3O8AA 1S3HA 3NYDA 3ZLFA 3O6AA 4LGXA 2NQZA 3AIBA 3EMCA 3VIIA 3HV8A 1GVIA 3TJIA 2DUAA 1JZ5A 3OZOA 4O28A 3P8IA 4UR8A 3NGJA 1KNWA 2EG8A 1O5XA 4AZ5A 1XLIA 2QZRA 1HL2A 2ALDA 8XIMA 1UG6A 3TSMA 4AWUA 2NWRA 3ZLHA 1NELA 1UMYA 2DT1A 4F0MA 2DV0A 3VNIA 3VCNA 4JHZA 3LBCA 2PLKA 3H21A 2ZUTA 3FW6A 2YPIA 4LU0A 5KZEA 1UWUA 2V3FA 1DPMA 4P8XA 1LLOA 4MJ4A 1CWYA 1MW2A 2IQDA 5ENLA 3C86A 5F7UA 1QK2A 3W2JA 3NVDA 1CGUA 1EOKA 3GR4A 4LUIA 2PDXA 5A6JA 3WL1A 3W76A 4X61A 4MB4A 4C6IA 1XM3A 4XBKA 4QCFA 4UTLA 4R5EA 3QYSA 3Q45A 1MDRA 3SQMA 1NWRA 1OFOA 4TUFA 3MO4A 4C6DA 4H6QA 5CSYA 1WB0A 3QMSA 2PSNA 3FA4A 3QC3A 1ML1A 1KM1A 4BS0A 3P74A 5EMMA 3I6EA 3R43A 3SADA 1K9TA 2EG6A 4UMAA 4AXKA 4LAMA 1C8XA 1WKEA 3DUGA 1F3WA 1TB3A 3EDKA 5LIXX 4PMNA 3USBA 4E8DA 2XSAA 1B4EA 3UXIA 3W1TA 1ZL1A 2VR5A 3ZJ8A 1HJQA 4C6BA 1GONA 1FWNA 1A3WA 2RGLA 4B5SA 3NTYA 3CMFA 1O7AA 1DP0A 4N02A 1CXFA 4X0VA 3PN8A 1DV7A 3THQA 1JJKA 1UR8A 3FEQA 4Q8TA 4QDWA 2FDSA 1MQPA 3MU7A 3N18A 3ELFA 3OZYA 2Q71A 3T0CA 4FF5A 3W2UA 2DT3A 1DEDA 3EYPA 3H26A 2C71A 2J88A 2E8YA 1KCLA 1BKHA 4ZCWA 4WCJA 5D4YA 4UOQA 5AVHA 5FSEC 1TUXA 4B9YA 1LQ0A 4V15A 1TIWA 1FUYA 4AZCA 4FPSA 2VEIA 2BBFA 2E1WA 1QATA 2VX7A 3D0CA 2QJNA 4G1NA 3PPFA 4L5ZA 3EEZA 3OLGA 3P80A 3ITTA 3B0PA 1GZ1A 4GHRA 2QGYA 3UESA 3QJAA 1KCXA 1SQ7A 4GUIA 4JEJA 4R9XA 2ZWYA 4Y6GA 3LCLA 1RXOB 2X2YA 5IRPA 2Z7GA 3AXMA 1W1TA 2CLPA 4Y9AA 2DSVA 2JF6A 4AWEA 2ZVIA 2YDAA 3KBMA 3PSVA 3IUIA 2BHUA 1S2CA 1GKRA 4MVAA 4NF7A 1BLIA 1FWWA 3A24A 1MXSA 1GJPA 2BP1A 3GVRA 4E4UA 3MZNA 1U5JA 4JZ5A 3VYLA 4CLMA 4EK7A 1P0DA 3KX6A 4E2DA 3CLMA 2Y6ZA 3DYPA 5KZMA 2IPJA 1UWTA 4HYRA 3W84A 4NZ4A 5ABEA 2JKPA 2EGZA 1SFTA 3B8WA 2GSJA 3DFSA 3NR0A 1KFJA 3SJ3A 2WBGA 5AYYA 5G1MA 4CVWA 1TFVA 4PTMA 3W7HA 1GVRA 3PBYA 3B03A 3POCA 1TJ0A 4D1JA 4UB9A 5FEZA 3VNZA 1MRQA 4Q8PA 3STGA 3TXZA 4OE7A 3KHJA 1X7IA 4GABA 1E43A 3VD9A 3QTGA 1EF3A 4NZ3A 3EXRA 1H11A 2FFIA 3RIKA 3WNLA 1KM2A 5DO8A 2DH2A 3MVIA 4O10A 5CZJA 2NWSA 4ZGYA 1XYFA 4KESA 1AL7A 5KINA 4P8VA 4Q4PA 1PVNA 4UTJA 2EBNA 2GJLA 1DJHA 1N2VA 3W75A 1GOWA 4YVPA 3QZ6A 2A1YA 4TVDA 1KW1A 3RJXA 1KBIA 4UOJA 3H70A 1QBBA 2DZWA 2RFGA 3A13A 2J62A 1AW5A 1GKPA 1SW7A 2CESA 4TX9A 4LVAA 4LY4A 4Q4QA 2WW5A 4IP7A 1W3IA 4CN1A 1XICA 1RQEA 3WEOA 3RMJA 3LDVA 3N1AA 4S3FA 4B5VA 2BASA 3I3BA 1DWHM 4ROPA 2VR2A 4MNLA 1XYCA 1J0YA 4MB3A 2ZE0A 3PG8A 3E2VA 4W89A 1RCXB 2OZTA 2X16A 3C52A 1ADSA 4YYFA 1SMAA 4NJGA 5E6ZA 3NURA 4XB3A 1EGZA 2Z00A 2ZC1A 1GUVA 1OX4A 4M82A 3A4AA 3CO8A 1T8XA 1Q3NA 3E38A 3L4TA 1Q7QA 1KM0A 5HJYA 1UR9A 1MZHA 4L56A 4Y8EA 3VU2A 2W0UA 2P8BA 4AD2A 2OEMA 1TJ1A 2B4GA 2VWSA 1FXQA 1QASA 1QW8A 3S9YA 3WQWA 4ZQPA 1YPFA 1GPFA 3GW0A 3FJNA 3IJDA 2MNRA 3W2MA 2C3ZA 4B3ZA 3UGVA 3ATYA 1KWKA 2QXWA 3DFQA 3N9KA 5C70A 1FKXA 3OVQA 5BNKA 3ZVHB 4GVHA 2PDHA 4BF7A 2PTDA 4EXAA 3F5JA 3RFAA 4C7GA 3IJ9A 3VZZA 3VKAA 4JBRA 3TJLA 5AN7A 3RM9A 2W5FA 1Q8JA 4XZ9A 3M9YA 1QHOA 2PZNA 3WJXA 2J7BA 1ZSXA 2X1UA 3LZ5A 5G1TA 3FJ4A 1UP0A 3PZNA 5DMMA 3AO0A 3B4UA 3GG8A 4KWVA 1G69A 3S1WA 1GTEA 8TIMA 1G01A 1XIBA 5J8LA 2BDQA 3PZTA 1US3A 3VILA 3F1QA 5EMKA 1H3GA 4J3VA 2EO7A 1J4EA 3W25A 1JI2A 3COTA 1R3SA 1SR9A 4PBGA 4PBEA 1RP9A 2QEZA 4D8AA 1K7FA 4GZJA 1UD4A 1U5HA 3ENLA 2WSRA 4ERAA 4HCHA 2CEQA 3VX1A 2PDJA 1E15A 2J13A 3UYCA 4GFSA 3QZAA 5HJXA 1R7OA 2PDNA 3FHQA 4RE4A 4Y2WA 2VURA 4O1BA 4LUJA 3TTOA 3LTSA 3G0SA 3CWOX 3OYZA 4G5DA 3ALGA 1LZOA 3RO6A 1EGMA 3SO7A 1NAL1 5DCBA 1JF6A 1CZ1A 2GFTA 4WHBA 2E1DA 2FPVA 3M5VA 2D0GA 2PWHA 2PWDA 2R24A 1Z89A 1THFD 4RDVA 3WFLA 3I65A 2TSYA 3I68A 2X40A 1FH9A 4LBUA 2UY2A 2V5JA 4GYFA 2I16A 2XU2A 1G1YA 1JDCA 3KL5A 3UA4A 3PM6A 2PWGA 5HWMA 2O9OA 1VPYA 1A5OC 1HJUA 2R14A 1HO1A 3ZIZA 1OG6A 2PP3A 4JFWA 4S3EA 2PGRA 2ZIDA 4GBDA 4AHOA 1V7YA 5T9BG 2BLEA 2XIIA 2Z1KA 1XKYA 4UQAA 2ICSA 5A8MA 5I3KA 3WLTA 1JPIA 3NL2A 4RDWA 3WBAA 3P8JA 4YYCA 1UR3M 3H22A 1GVSA 2CWNA 1AUSL 3N73A 5LKYA 1WCGA 3S0CA 1FHDA 3GYCA 1Q7MA 3BH4A 3W1MA 3CQJA 3UJSA 3ZR6A 3GNOA 2I5IA 2QNEA 3NXFA 1W9DM 2V81A 4PMZA 1B57A 1JULA 4LB3A 4KCWA 2WKJA 3V5OA 5FAGA 5M17A 1LWHA 2QCGA 3FDKA 2CW6A 2WLYA 3P7YA 1OK4A 4Z2JA 3FLUA 2IQ0A 2UV8G 2QGHA 1XPGA 4MZ8A 3VNLA 5D2WA 2NZLA 3AMKA 3TYAA 3HA1A 3N4AA 4UMBA 4FXSA 1BVWA 4DAIA 4H8NA 3CYVA 4O1AA 4HJWA 1OYCA 2QUNA 2WWCA 2NQJA 1LOLA 4MZYA 1UC4A 2VD9A 3CB3A 2WHLA 2REQB 4XZMX 1PIIA 1GQLA 3QY7A 2VEMA 4GXWA 1BYAA 3SDOA 4GUJA 2CBUA 1F6PA 3UWVA 4BQ5A 4DYEA 4UTWC 1OK6A 4RPPA 5JMUA 4HYWA 3LLDA 4Q4OA 4Q8WA 1H7WA 3VMPA 4FLOA 4ATWA 2UBPC 1LUCB 3IUDA 2JK2A 4KWSA 4KCTA 3CQHA 1F5ZA 2CZVA 1TV2A 4IMEA 3TE9A 3K4WA 3T81A 2YBVA 2AL1A 3NOYA 4G9PA 5DCEA 1X1OA 3ZXWA 3G1AA 1LORA 2P88A 3HBLA 4C1NA 1K03A 4DN1A 3RPDA 4P7NA 4IGSA 5G4EA 5LA1A 1V02A 3VD4A 2J24A 1I1XA 2Z28A 2PTZA 1KRBC 2B0MA 4HTBA 3MV01 3CIVA 5IFPA 1JCNA 3NM1A 3A21A 4KH2A 1OC7A 2AAAA 1SW3A 3NGFA 2NV1A 4IGNA 4TOQA 1KBJA 5FJIA 3A4WA 4KWWA 1VGAA 1I2OA 1VFSA 3SEPA 1UQYA 4FLRA 2D69A 3DHPA 1I45A 1FWJC 3MJYA 1NFBA 1V0NA 4CEUC 4DO4A 4B2DD 1NM9A 3EOLA 3OTRA 3B0UX 3H7VA 4PN2A 3TSDA 3TNOA 4HMCA 4L4OA 4RJEA 5I3IA 5CC3A 1C7SA 3NZRA 5A8QA 1SUXA 3IIVA 3G1HA 1VB9A 2GOUA 4P7QA 1V8EA 3ME3A 3W7OA 1X6LA 2BHYA 3P5YA 3GG1A 4JIEA 3IIXA 2Z27A 1AG1O 4F9DA 3OGRA 1IZKA 4N4PA 4JDBA 4RNIA 4E5TA 1DQXA 1P0EA 4TX8A 3WLPA 5A2CA 2VGGA 1CNVA 1M7JA 2XIOA 2W27A 4YPJA 3WK0A 1MNZA 2E28A 1ZHAA 1MXGA 2OQYA 4DWSA 1XIHA 2DSKA 3CAQA 2BV9A 4NYUA 2Y70A 3L5MA 3OA3A 1VRXA 1GT8A 2JBMA 3DHUA 1X98A 2PA6A 2YZRA 2Q3OA 3VINA 1XBYA 4W93A 3TTYA 1B3OA 3WUGA 4K8HA 3ONBA 5B80A 3VA8A 3BLKA 3LCHA 4IHCA 1E5JA 4CNOA 4IUGA 4HN4A 3CLWA 4RXFA 5DF0A 3EA1A 4INFA 1L6GA 4JTEA 2WVUA 2OODA 2WKLA 2KAUC 1IYXA 2ZZ7A 5A3HA 4CU6A 1V51A 3BLFA 1A5SA 3GIQA 3O06A 4BZYA 3M43A 2PDGA 3KEHA 1S3TC 3PBUA 4J2MA 2ZTJA 3GQYA 5K7JA 3VNMA 1LQAA 3GH7A 1KQZA 1E6XM 3TIMA 3STCA 1NP2A 1ICPA 1ESWA 4GQQA 4DUVA 3BAXA 5F2LA 1J79A 3T4CA 1MXDA 3SCSA 4YLWA 1KWGA 2Y89A 3W02A 1C90A 2Q6ZA 1W1A1 3CHCA 2YCJA 1K6WA 3N6JA 3WK1A 4AC1X 3MC5A 4GVIA 1EQCA 1GNXA 3LCWA 2E8ZA 3MBDA 3NXLA 4LRSA 3NZ1A 3M46A 4OVXA 4LBSA 1TTPA 3UZYA 2O92A 1TPFA 5CGTA 3E0VA 2EPOA 4ZVJA 2CETA 3QKEA 4MKNA 4KPLA 1NOWA 3DKLA 3LB0A 5M3WA 2I17A 4ICNA 3F2CA 4B5NA 3TAKA 3LZ3A 1V6UA 1LOSA 2J74A 1RJQA 7TIMA 3BG9A 1XLFA 3FGCA 3TUUA 3ZVIA 2PZ0A 4Q3MA 2J7EA 2WSPA 3GNNA 1V4YA 4A21A 4U2YA 1R3TA 1PHWA 1JFXA 3LRMA 1TPB1 1IT0A 4PSPA 1K77A 3H4WA 2GJRA 3CMJA 4RW5A 7PTDA 3HQOA 3H54A 1H61A 2D2GA 4ZO6A 4PMVA 6TAAA 1UD2A 4C6OA 4MHBA 1EDTA 1D7KA 1S38A 1G6CA 2PS2A 3REQA 1EBGA 1TZ7A 2GDUA 2I56A 2OZ0A 3LSCA 3LLXA 4PCNA 2VUYA 2VZVA 4GISA 4QP0A 1DVJA 4LAOA 4WZHA 3HPFA 5CEWA 4AZBA 3N25A 3KVKA 4FNQA 4J1OA 1L6FA 3A22A 3W7IA 3MKCA 3G18A 4DRSA 3AICA 1V08A 2QCEA 3L2MA 1MEHA 2AGKA 5LGXA 1VCGA 2ZA2A 3EX1A 3P82A 1VPQA 1UOZA 3LQGA 3W81A 3A5VA 2Y2WA 4DY1A 1S5NA 3L4XA 4US6A 1NDZA 4RNJA 2VP8A 4F3HA 4R88A 4DO7A 3Q37A 4PULA 4RV8A 4B9ZA 3GBDA 1N55A 2NLYA 4UR7A 2D24A 1O66A 4B5WA 1M04A 1FP8A 3W1AA 3KVLA 4LYRA 3QPYA 3EWDA 3RM4A 4KF1A 1SJAA 3BAIA 3BXWA 3F4CA 1UZDA 5KETA 4OT7A 2HPIA 1A5MC 4LY8A 3TC7A 6ENLA 1O1ZA 1JPKA 5I06A 2WCSA 5KEZA 3N3MA 4XAGA 2DORA 3U0HA 3S6OA 2R82A 4W7WA 1SZFA 5BWFA 1A53A 4BJHA 3PNUA 1E9IA 1KXTA 4NL1A 3STFA 4JY8A 4R7JA 4XD5A 4Q6JA 2J75A 1W6TA 3LI1A 2O4MA 2CYGA 1O95A 3QPEA 3P0XA 4JQ1A 2V82A 1US0A 2PAJA 3SSZA 1B4KA 1OVDA 3CH0A 4MMWA 4GGBA 3RX3A 4JX4A 1GYMA 1NDYA 4DJEA 4WSHA 3BAWA 1XGEA 1BTMA 4FXFA 2F61A 2QUUA 1B3VA 4PUKA 1ONXA 2OQHA 2IKJA 4S2CA 3ANYA 2W67A 3ZFHA 4GH1A 1A5CA 3OOQA 4BQ4A 1CDGA 4PMDA 3MBFA 2PD9A 5LIKX 3J7HA 2YR1A 1Y5VA 2VC6A 3TCSA 5BMWA 4F40A 2V5LA 4DBSA 3PTDA 4C6MA 4MIMA 5DFAA 5HR7A 3ZZ1A 1OCQA 3M0IA 5CC6A 3M0VA 2V3GA 1GVFA 3RAOA 1D2KA 3S83A 5GVJA 4EF9A 3W7GA 1UWAA 3VGBA 5DANA 5LHEA 1B2YA 2GGJA 4IMCA 2X0SA 2V6AA 1YDNA 3PR2A 4WRHA