1F2OA

Crystal structure of the streptomyces griseus aminopeptidase complexed with l-leucine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of Streptomyces griseus aminopeptidase with amino acid reaction products and their implications toward a catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE
total genus 107
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1f2oA00
2IJZA 1PCAA 4X3RA 1OBRA 3K9TA 3K2KA 3RBUA 4P4EA 5D29A 2C6GA 2ZEHA 2PJ4A 4OC4A 3IC1A 3H8EA 4O23A 1FT7A 2CF4A 3KQXA 4OC2A 4GM5A 4UEEA 5K8MA 1VIXA 4UF4A 4P4BA 1XBUA 4P4IA 5ELYA 3KI9A 1VHOA 3RAMA 3GLJA 3FEEA 4ZX8A 2V8DA 4G1PA 4MHYA 4F8ZA 1BAVA 4PXDA 3SI2A 3LMSA 3V7ZA 1VHEA 4OKOA 4FUUA 3FH4A 2IQ6A 5LRGA 3D7DA 1EE3P 4NJQA 2ZELA 3NH8A 1IGBA 2GREA 2QVPA 3D66A 2PJ0A 4OMEA 5HVFA 1ZG8A 3PB4X 2NSMA 2PJ3A 3DGVA 1R3NA 5JGFA 3PFOA 1CX8A 3KR4A 3TC8A 2QJ8A 4DJLA 4ZX9A 1CPSA 1CG2A 4ZY0A 2JBJA 4MCRA 4P10A 3D7FA 3SI0A 5IB9A 3VARA 3B2YA 3D4UA 1F2OA 1KWMA 3BI0A 3GB0A 4FAIA 2GLFA 1GYTA 1HDQA 5LYFA 1Y7EA 1NSAA 5K8PA 1YW4A 2VL1A 1ARLA 4MCSA 1CPXA 2PIYA 2AFXA 2G9DA 2PCUA 2QYVA 2C6PA 3KHXA 1QQ9A 2DEAA 4UIBA 3RZAA 1PYTB 2BOAA 2PJAA 3H8FA 4IK2A 4UEFA 5F09A 3S9LA 3D7GA 3I1UA 5K8NA 1RTQA 2J9AA 2AFZA 3ISZA 3LWUA 3CPAA 4MCPA 1ZLIA 3B3TA 4WJBA 1Y0RA 4TNUA 4NGPA 1YMEA 4MCQA 2V8HA 5JM6A 4IHMA 4PPZA 3IIBA 3BI1A 1CBXA 2AFOA 1ELLP 4EFDA 3B3VA 5LYIA 4FBEA 4Z65A 2OOTA 5J1QA 2EK8A 4JYWA 4P4FA 3PEIA 2ZEEA 2EK9A 2PJ1A 4MHNA 4OC3A 4P4DA 5HXDA 4ONWA 3BXMA 3KHZA 4OIWA 3IEHA 2Q51A 3FJUA 3WABA 2OR4A 4OIDA 3NH4A 3B3SA 4W9YA 3KR5A 5CBMA 1CP6A 2PJ7A 1CP7A 6CPAA 3ISXA 2ZEDA 4RUHA 3B3WA 4H2KA 4AXVA 4A38A 1Z8LA 1TKFA 3WC7A 1R43A 2PE3A 3KL9A 2ZEPA 2ANPA 3JRUA 2PIZA 3PFEA 8CPAA 2PVWA 4R76A 3NH5A 3D68A 3N5FA 4EWTA 3CDXA 3KGQA 1LCPA 2V8GA 4NGRA 2V77A 4WWVA 4EMEA 2CIJA 2O53A 3PRTA 3FECA 1F57A 3FEDA 3PB9X 1LAMA 1LANA 2PJ6A 2PJ5A 1ELMP 4FWUA 3V38A 5THWA 4X8IA 4P44A 1LFWA 5LYLA 2F8HA 1TF9A 2JEWA 4OC0A 4YU9A 1XMBA 2ZOFA 2WYRA 2Q43A 2GLJA 2PJCA 1LOKA 3WC5A 3HLPA 3SJEA 1TF8A 3PB6X 4A37A 3PBBA 3CPXA 2C1CA 1ZG7A 2PJ8A 2XEFA 3TX8A 1XRYA 4MHPA 2PJ2A 2AFMA 1ARMA 5CPAA 1QMUA 1YSJA 4MMOA 1YLOA 1BLLE 2O4HA 4F9VA 3IO1A 3T8WA 5JH9A 3PB7X 5K8OA 4NFRA 4LQGA 4TWEA 7CPAA 5DS0A 4ZYQA 1BPMA 3FX6A 2XEJA 3S9NA 4MHZA 3KQZA 3D7HA 2GU2A 2HB6A 1AMPA 3IFEA 3MRUA 1UWYA 2AFWA 1DE4C 5HVHA 2POKA 3KZWA 4OC5A 2PJ9A 3WT4A 1TKJA 4P4JA 2BCOA 4JZ0A 4UEZA 4X2TA 5LYDA 3B35A 3QNVA 2RFHA 4MXUA 4B6ZA 1Y0YA 4Q7AA 4DYOA 3FF3A 4YWYA 3B3CA 4R7MA 3L2NA 4DUKA 1HDUA 3MN8A 4CPAA 4P45A 2CTBA 2CTCA 2ZENA 2ZEGA 4PXBA 3KASA 1XFOA 2XEGA 4A94A 4PXCA 3S9MA 3SI1A 3WC6A 2AFUA 2PVVA 1AYEA 2Q4ZA 3GUXA 3IWWA 2F7VA 4BD9A 4OC1A 3NFZA 5I4MA 3BHXA 1TKHA 4NGTA 4KSIA 2WZNA 3D67A 1XJOA 1Z5RA 1Q7LA 2ZEOA 3FMCA 2HC9A 1M4LA 4ZY1A 4ZI6A 2AFSA 2I3CA 2PRQA 4PQAA 2XEIA 1FNOA 1Z2LA 2NYQA 4K3NA 1H8LA 5LRKA 5D8NA 3PB8X 5HVGA 3VH9A 1JQGA 3HUVA 3SJFA 1ZG9A 2ABZA 3VATA 2ZEFA 2JBKA 3SJXA 4NGNA 2PJBA 1VGYA 3B7IA 4NGQA 2ZEMA 2C6CA 4NJRA 4A39A 3NA6A 4IAVA 4P6YA 4OP4A 2RB7A 1F2PA 4UIAA 2FVGA 2V8VA 1IY7A 4MRIA 3CT9A 1DTDA 1TXRA 2BO9A 3DLJA 3SJGA 4ZY2A 1BPNA 1YW6A 4NGMA 4NGSA 2IMOA 2ZOGA 3IJ3A 3FVLA 4R8FA 1HEEA 3PBEA 3H8GA 4F9UA 5LRJA 4R6TA 2EWBA 1ZLHA 1LAPA 4PXEA
chains in the Genus database with same CATH superfamily
5H84A 2IJZA 1PCAA 2REEA 4BINA 2FIAA 4LX9A 4X3RA 5DWMA 2P6GA 1OBRA 3EFAA 3K2KA 3K9TA 3RBUA 5FVJA 4P4EA 2YNCA 5D29A 1IICA 1QSMA 2C6GA 2ZW5A 3P2HA 4GXHA 2DXQA 3BJ7A 2ZEHA 2PJ4A 4OC4A 1GHEA 3IC1A 2Q44A 3H8EA 4CGLA 4O23A 1FT7A 2CF4A 1I1DA 3N7ZA 1J4JA 1Z4RA 3CXSA 4M6IA 3KQXA 4OC2A 2G0BA 4GM5A 4UEEA 5K8MA 4KVME 2Q0YA 1VIXA 3TOBA 1U6MA 2VZYA 4UF4A 4P4BA 1XBUA 4J3GA 4CYNA 4P4IA 4KOXA 5ELYA 3KI9A 4CRYB 4UCNA 2REFA 1VHOA 3CXQA 1KUYA 3RAMA 3GLJA 4IUSA 2QECA 2ZW4A 3FEEA 4MJ8A 4ZX8A 5C88A 2V8DA 4G1PA 4KORA 4MHYA 4F8ZA 4KSAA 1BAVA 1LRZA 4PXDA 4QB9A 3LMSA 3SI2A 3V7ZA 1Z4EA 1VHEA 4OKOA 4FUUA 3FH4A 4E8OA 2D4OA 1KZFA 3EC4A 1CJWA 3WR7A 2IQ6A 3DR6A 4F6AA 5LRGA 4C68A 3D7DA 2Q4VA 1EE3P 2OH1A 4L8AA 4NJQA 3S6HA 3IWEA 2ZELA 3R9EA 2P6EA 5IB0A 2QVPA 1IGBA 2GREA 3NH8A 2Q04A 3D66A 3DDDA 5A27A 2PJ0A 4OMEA 5HVFA 4HNXB 4BMHA 1ZG8A 1YREA 3PB4X 2NSMA 1ON0A 2OZGA 4UWIA 2PJ3A 2WUUA 1R3NA 2VEZA 3DGVA 3H5ZA 3PFOA 1CX8A 4CS0B 5HH1A 5JGFA 3BLNA 3KR4A 4OADA 2QJ8A 3TC8A 4ZX9A 1CPSA 1CG2A 4LQ6A 4DJLA 3PP9A 4CAWA 1IYKA 2ARHA 4R9MA 2JBJA 3FRMA 3G8WA 1S7FA 4MCRA 1M4IA 4P10A 3D7FA 4NF1A 5EC4A 4MHDA 3SI0A 5IB9A 1Q2CA 5HMNA 3VARA 2PQ8A 2PSWA 2Q7BA 4PK3A 3B2YA 3D4UA 3S6GA 2JDCA 2CNSA 1MJBA 4C2XA 1F2OA 3D8PA 1KWMA 3BI0A 3GB0A 2JEVA 3IU1A 4KUAA 4FAIA 1S5KA 2GLFA 2D4PA 4JXQA 1JWQA 4LUAA 1M4DA 1GYTA 3EY5A 5F47A 3V8IA 4B11A 4CAEA 1HDQA 5LYFA 1Y7EA 1NSAA 5K8PA 1YW4A 2VL1A 4KOUA 1ARLA 5JPHA 2Y0MA 4MCSA 1CPXA 1RXTA 2EVNA 2PIYA 2AFXA 3FNCA 1BO4A 4FD5A 2G9DA 2GE3A 3S6KA 2B4DB 2PCUA 1YGHA 2QYVA 2BSWA 2OZHA 2C6PA 3E0KA 3H4QA 3KHXA 1QQ9A 3JTKA 2DEAA 3RNZA 4JXRA 4UIBA 4A32A 2JDDA 3F0AA 5H86A 3RZAA 1PYTB 2BOAA 2PJAA 1XEBA 3F5BA 3H8FA 2OZUA 4IK2A 3GKRA 4UEFA 4XNHC 4A95A 4B13A 2HQYA 3JVNA 4UFWA 1XF8A 3IGRA 5F09A 4UBRA 3S9LA 3D7GA 4B5PA 1YVKA 3I1UA 5K8NA 1YLEA 1RTQA 2J9AA 2AFZA 3PGPA 4YGOA 3ISZA 1NSLA 1QSOA 4U5YA 4CAXA 3DR8A 3LWUA 3CPAA 4MFKA 4MFQA 4MCPA 3TTHA 1ZLIA 3B3TA 4WJBA 2BEIA 1Y0RA 4TNUA 5IX3A 2DF5A 2WPXA 3GY9A 1YMEA 4MCQA 4NGPA 5GCNA 2Z3LA 2V8HA 5JM6A 4IHMA 4PPZA 3IIBA 3RO0A 3BI1A 1CBXA 2AFOA 1ELLP 3FIXA 4EFDA 3B3VA 5AG4A 2CXAA 4M85A 2B58A 5LYIA 2O28A 3D3SA 4FBEA 4Z65A 2OOTA 5J1QA 2EK8A 4JYWA 3PZJA 4KOWA 2VBQA 4P4FA 3PEIA 4F0XA 1QSRA 2BUEA 2ZEEA 2EK9A 1XMTA 2PJ1A 2J8NA 4MHNA 4NEXA 4OC3A 4P4DA 1Z8TA 5G20A 1XOVA 2ATRA 3TCVA 5HXDA 4PSWA 4ONWA 1BOBA 3BXMA 3KHZA 4OIWA 3IEHA 4XPLA 2Q51A 4A33A 3FJUA 3WABA 2OR4A 3EO4A 3LACA 2B5GA 3B3SA 3NH4A 4JLYA 4OIDA 4W9YA 4AVBA 3KR5A 4M3SA 1CP6A 5CBMA 3LD2A 2PJ7A 3QB8A 1S60A 4PSXA 2C27A 4KVXA 3NE7A 4Y49B 1CP7A 6CPAA 2ODFA 3ISXA 2ZEDA 2JLMA 4RUHA 3P2FA 2P6FA 3B3WA 2FIWA 2YGWA 4H2KA 3BJ8A 4AXVA 4X5KA 4A38A 3TO6A 5KTCA 1Z8LA 1XIXA 3R95A 1PUAA 3FXTA 1TKFA 3FB3A 4C7IA 1NMTA 3WC7A 4KZTA 1R43A 2PE3A 3TT2A 1I21A 2YNEA 1I12A 2R8VA 2ZEPA 3KL9A 3R9GA 5A28A 3TE4A 2ANPA 3FBUA 4YRHA 5BWAB 2PDOA 5IV0A 4XPDC 1OZPA 4E2AA 4QBJA 3JRUA 2YNCC 2I79A 2H5MA 3CZXA 2PIZA 3PFEA 4MY3A 4QVTA 5CNPA 3RYOA 1M1DA 1IYLA 8CPAA 3TFYA 1S7KA 2PVWA 4AVAA 4R76A 3NH5A 4RI1A 3D68A 1ZO0A 3N5FA 4EWTA 3CDXA 3KGQA 5F48A 1LCPA 2V8GA 1A2ZA 4NXYA 4CAFA 2J8RA 1KUVA 3K9UA 1VKCA 4NGRA 5AGEA 2V77A 2OB0A 2X7BA 2Z3KA 4WWVA 2PRBA 4C2YA 4EMEA 2CIJA 2O53A 4II9A 3PRTA 3GYAA 2G3AA 3FECA 4RS2A 1FY7A 1F57A 2FL4A 2CNTA 3ZJ0A 1QSNA 4ZGYB 3FEDA 3PB9X 3TO9A 1LAMA 1S7LA 2AE6A 1RO5A 3QAHA 1LANA 3JUWA 2PJ6A 2PJ5A 5J8FA 1ELMP 4FWUA 3V38A 1YK3A 5THWA 4X8IA 4P44A 3FYNA 1MJAA 1VHSA 4RN7A 2Z11A 1X10A 4QC6A 1LFWA 5LYLA 2F8HA 1TF9A 3A9LA 2QIRA 1IU8A 4UA3A 2Z0ZA 2JEWA 2A4NA 4BBHA 5E96A 4OC0A 3NE8A 4B5OA 2WSAA 4KSFA 4YU9A 1TIQA 3IWGA 4A30A 1XMBA 2ZOFA 2WYRA 2Q43A 2VQYA 2GLJA 2PR1A 4PV6A 4L89A 4YFJA 2PJCA 4QUSA 3TOAA 1LOKA 3WC5A 3HLPA 1CM0A 3SJEA 2ZXVA 1YX0A 1TF8A 1B87A 4MFJA 3PB6X 1YQEA 2G3TA 4M6HA 1S3ZA 4A37A 4NSQA 1KUXA 3PBBA 4C2ZA 3CPXA 2C1CA 2F5IA 2Z3OA 1ZG7A 2PJ8A 4KUBA 4CGMA 3QAYA 2XEFA 4XNHB 2FE7A 3R9FA 3ZZIA 3TX8A 1XRYA 4KS9A 1YR0A 4MHPA 4F0YA 5J8CA 2PJ2A 2GANA 5AG7A 2AFMA 1ARMA 3I9SA 3EXNA 5CPAA 1QMUA 2Z10A 4KOYA 1YSJA 2VI7A 3F8KA 4MMOA 3OWCA 1YLOA 1BLLE 2NMTA 2O4HA 3DNSA 3IO1A 4CGPA 3T8WA 4F9VA 5JH9A 3PB7X 5K8OA 4NFRA 1S7NA 2FCKA 4AVCA 1NE9A 4LQGA 4TWEA 2FSRA 4B12A 4PK2A 3GIUA 7CPAA 2EBJA 5DS0A 1IOFA 1WK4A 1BPMA 4HNYB 4XPKA 4FD7A 1SQHA 4ZYQA 3FX6A 4M6GA 5C82A 2XEJA 3S9NA 2Q4YA 2EUIA 2AJ6A 4MHZA 4KOTA 4Q38A 3KQZA 4R57A 4E0AA 3D7HA 4IF5A 4H6UA 4OAEA 3W6XA 4B5PB 2GU2A 2HB6A 1AMPA 2EO8A 5F46A 4JWPA 2B3UA 3IFEA 3MRUA 1UWYA 2AFWA 1AUGA 1DE4C 1IIDA 5DWNA 1XE4A 5HVHA 2POKA 3KZWA 1N71A 4R3LA 2QMLA 4ZBGA 4UWJA 4MBUA 4OC5A 4FD6A 1WWZA 3R96A 2PJ9A 3SHPA 3LODA 3WT4A 5ISVA 2ZW6A 4R87A 2VZZA 1TKJA 4P4JA 2BCOA 1Z8XA 4CYQA 3TO7A 4JZ0A 3D2PA 4UEZA 4X2TA 4Y49C 5LYDA 4HKFA 1Y9WA 3SXOA 3B35A 3I3GA 3QNVA 4ZY0A 2RFHA 4MXUA 2GIVA 3DSBA 4B6ZA 2BL1A 1Y0YA 2R98A 4Q7AA 2Z3NA 4U9YA 4DYOA 4OLLA 3FF3A 2VXKA 4YWYA 3B3CA 1MK4A 4Q36A 4R7MA 3L2NA 4MY0A 2P0WA 2FXFA 3MGDA 5AG6A 3T9YA 4DUKA 2B4DA 1HDUA 1IB1E 3MN8A 4UCPA 4CPAA 2Z3MA 4P45A 2CTBA 3VWDA 2DPTA 2CTCA 1M4GA 2WPWA 4CYPA 2ZENA 2ZEGA 4PXBA 3KASA 4MFZA 1XFOA 2R1IA 2OU2A 2XEGA 4A94A 4PXCA 2ZW7A 1P0HA 1PU9A 4UFVA 1M44A 1Q2YA 3S9MA 3SI1A 3WC6A 4A2ZA 2AFUA 2PVVA 1AYEA 2Q4ZA 4GS4A 3GUXA 4HNWB 2YNDA 3IWWA 2R7HA 5EMIA 4MFPA 4ORFA 4AG9A 3C26A 4CGNA 2F7VA 4CRZB 1IOIA 4BD9A 4OC1A 3NFZA 2HV2A 4JJXA 5I4MA 4A31A 2B5GB 4H89A 4I49A 4UFXA 1B6BA 2B4BA 3UY5A 3BHXA 4XPDB 4AB7A 1R57A 1TKHA 5EBVA 4NGTA 4KSIA 1Z9UA 1V0CA 2WZNA 2CNMA 2ZPAA 3D67A 1XJOA 2PC1A 2I00A 4H6ZA 1Z5RA 4ONUA 5G1ZA 1Y9KA 1Q7LA 2ZEOA 4MFLA 2CY2A 2PR8A 3FMCA 4DNCA 2HC9A 1M4LA 2Q7SA 1YVOA 1Z8WA 2K5TA 3CXPA 3VWEA 4ZI6A 4ZY1A 1MJ9A 2AFSA 2I3CA 3SXNA 5G22A 4UCMA 2PRQA 5G21A 4PQAA 2XEIA 2DPSA 3T90A 1FNOA 1Z2LA 2NYQA 4K3NA 1H8LA 5LRKA 5D8NA 2IL4A 3PB8X 5HVGA 4JD6A 3VH9A 1JQGA 3HUVA 4CGOA 3SJFA 1ZG9A 2ABZA 3VATA 2ZEFA 2JBKA 3SJXA 2HUZA 4NGNA 4U9ZA 1L0CA 3IU2A 2PJBA 1X12A 1VGYA 3B7IA 4HPSA 4NGQA 2ZEMA 2C6CA 4NJRA 4A39A 4B14A 2GFQA 4FD4A 3KKWA 2FT0A 4B10A 1P4NA 3D2MA 4AG7A 3NA6A 1QSTA 4IAVA 4P6YA 2KCWA 4OP4A 4MI4A 2RB7A 1Q2DA 2Z3PA 1F2PA 4UIAA 2FVGA 2V8VA 5KTAA 1IY7A 4KOVA 4MRIA 3CT9A 1Y7RA 1DTDA 5KTDA 1TXRA 2BO9A 3DLJA 4KVOE 3W6SA 3SJGA 4ZY2A 4EVYA 1BPNA 1K4JA 1YW6A 4NGMA 4K30A 4NGSA 4CYOA 4C7HA 2IMOA 1UFHA 2ZOGA 2FS5A 5AG5A 3IJ3A 2J8MA 3FVLA 4R8FA 1HEEA 3S6FA 3PBEA 3H8GA 4KLVA 3R1KA 5F49A 3B8GA 4KLWA 4R3KA 3W91A 4F9UA 4CAVA 5LRJA 4R6TA 4KOSA 2B3VA 2EWBA 4NCZA 5I0CA 1ZLHA 3G3SA 2RC4A 1LAPA 4PXEA 5JQ4A
chains in the Genus database with same CATH topology
2IJZA 1PCAA 4X3RA 1OBRA 3K9TA 3K2KA 3RBUA 4P4EA 5D29A 2C6GA 2ZEHA 2PJ4A 4OC4A 3IC1A 3H8EA 4O23A 1FT7A 2CF4A 3KQXA 4OC2A 4GM5A 4UEEA 5K8MA 1VIXA 4UF4A 4P4BA 1XBUA 4P4IA 5ELYA 3KI9A 1VHOA 3RAMA 3GLJA 3FEEA 4ZX8A 2V8DA 4G1PA 4MHYA 4F8ZA 1BAVA 4PXDA 3SI2A 3LMSA 3V7ZA 1VHEA 4OKOA 4FUUA 3FH4A 2IQ6A 5LRGA 3D7DA 1EE3P 4NJQA 2ZELA 3NH8A 1IGBA 2GREA 2QVPA 3D66A 2PJ0A 4OMEA 5HVFA 1ZG8A 3PB4X 2NSMA 2PJ3A 3DGVA 1R3NA 5JGFA 3PFOA 1CX8A 3KR4A 3TC8A 2QJ8A 4DJLA 4ZX9A 1CPSA 1CG2A 4ZY0A 2JBJA 4MCRA 4P10A 3D7FA 3SI0A 5IB9A 3VARA 3B2YA 3D4UA 1F2OA 1KWMA 3BI0A 3GB0A 4FAIA 2GLFA 1GYTA 1HDQA 5LYFA 1Y7EA 1NSAA 5K8PA 1YW4A 2VL1A 1ARLA 4MCSA 1CPXA 2PIYA 2AFXA 2G9DA 2PCUA 2QYVA 2C6PA 3KHXA 1QQ9A 2DEAA 4UIBA 3RZAA 1PYTB 2BOAA 2PJAA 3H8FA 4IK2A 4UEFA 5F09A 3S9LA 3D7GA 3I1UA 5K8NA 1RTQA 2J9AA 2AFZA 3ISZA 3LWUA 3CPAA 4MCPA 1ZLIA 3B3TA 4WJBA 1Y0RA 4TNUA 4NGPA 1YMEA 4MCQA 2V8HA 5JM6A 4IHMA 4PPZA 3IIBA 3BI1A 1CBXA 2AFOA 1ELLP 4EFDA 3B3VA 5LYIA 4FBEA 4Z65A 2OOTA 5J1QA 2EK8A 4JYWA 4P4FA 3PEIA 2ZEEA 2EK9A 2PJ1A 4MHNA 4OC3A 4P4DA 5HXDA 4ONWA 3BXMA 3KHZA 4OIWA 3IEHA 2Q51A 3FJUA 3WABA 2OR4A 4OIDA 3NH4A 3B3SA 4W9YA 3KR5A 5CBMA 1CP6A 2PJ7A 1CP7A 6CPAA 3ISXA 2ZEDA 4RUHA 3B3WA 4H2KA 4AXVA 4A38A 1Z8LA 1TKFA 3WC7A 1R43A 2PE3A 3KL9A 2ZEPA 2ANPA 3JRUA 2PIZA 3PFEA 8CPAA 2PVWA 4R76A 3NH5A 3D68A 3N5FA 4EWTA 3CDXA 3KGQA 1LCPA 2V8GA 4NGRA 2V77A 4WWVA 4EMEA 2CIJA 2O53A 3PRTA 3FECA 1F57A 3FEDA 3PB9X 1LAMA 1LANA 2PJ6A 2PJ5A 1ELMP 4FWUA 3V38A 5THWA 4X8IA 4P44A 1LFWA 5LYLA 2F8HA 1TF9A 2JEWA 4OC0A 4YU9A 1XMBA 2ZOFA 2WYRA 2Q43A 2GLJA 2PJCA 1LOKA 3WC5A 3HLPA 3SJEA 1TF8A 3PB6X 4A37A 3PBBA 3CPXA 2C1CA 1ZG7A 2PJ8A 2XEFA 3TX8A 1XRYA 4MHPA 2PJ2A 2AFMA 1ARMA 5CPAA 1QMUA 1YSJA 4MMOA 1YLOA 1BLLE 2O4HA 4F9VA 3IO1A 3T8WA 5JH9A 3PB7X 5K8OA 4NFRA 4LQGA 4TWEA 7CPAA 5DS0A 4ZYQA 1BPMA 3FX6A 2XEJA 3S9NA 4MHZA 3KQZA 3D7HA 2GU2A 2HB6A 1AMPA 3IFEA 3MRUA 1UWYA 2AFWA 1DE4C 5HVHA 2POKA 3KZWA 4OC5A 2PJ9A 3WT4A 1TKJA 4P4JA 2BCOA 4JZ0A 4UEZA 4X2TA 5LYDA 3B35A 3QNVA 2RFHA 4MXUA 4B6ZA 1Y0YA 4Q7AA 4DYOA 3FF3A 4YWYA 3B3CA 4R7MA 3L2NA 4DUKA 1HDUA 3MN8A 4CPAA 4P45A 2CTBA 2CTCA 2ZENA 2ZEGA 4PXBA 3KASA 1XFOA 2XEGA 4A94A 4PXCA 3S9MA 3SI1A 3WC6A 2AFUA 2PVVA 1AYEA 2Q4ZA 3GUXA 3IWWA 2F7VA 4BD9A 4OC1A 3NFZA 5I4MA 3BHXA 1TKHA 4NGTA 4KSIA 2WZNA 3D67A 1XJOA 1Z5RA 1Q7LA 2ZEOA 3FMCA 2HC9A 1M4LA 4ZY1A 4ZI6A 2AFSA 2I3CA 2PRQA 4PQAA 2XEIA 1FNOA 1Z2LA 2NYQA 4K3NA 1H8LA 5LRKA 5D8NA 3PB8X 5HVGA 3VH9A 1JQGA 3HUVA 3SJFA 1ZG9A 2ABZA 3VATA 2ZEFA 2JBKA 3SJXA 4NGNA 2PJBA 1VGYA 3B7IA 4NGQA 2ZEMA 2C6CA 4NJRA 4A39A 3NA6A 4IAVA 4P6YA 4OP4A 2RB7A 1F2PA 4UIAA 2FVGA 2V8VA 1IY7A 4MRIA 3CT9A 1DTDA 1TXRA 2BO9A 3DLJA 3SJGA 4ZY2A 1BPNA 1YW6A 4NGMA 4NGSA 2IMOA 2ZOGA 3IJ3A 3FVLA 4R8FA 1HEEA 3PBEA 3H8GA 4F9UA 5LRJA 4R6TA 2EWBA 1ZLHA 1LAPA 4PXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJZ A;  1PCA A;  4X3R A;  1OBR A;  3K9T A;  3K2K A;  3RBU A;  4P4E A;  5D29 A;  2C6G A;  2ZEH A;  2PJ4 A;  4OC4 A;  3IC1 A;  3H8E A;  4O23 A;  1FT7 A;  2CF4 A;  3KQX A;  4OC2 A;  4GM5 A;  4UEE A;  5K8M A;  1VIX A;  4UF4 A;  4P4B A;  1XBU A;  4P4I A;  5ELY A;  3KI9 A;  1VHO A;  3RAM A;  3GLJ A;  3FEE A;  4ZX8 A;  2V8D A;  4G1P A;  4MHY A;  4F8Z A;  1BAV A;  4PXD A;  3SI2 A;  3LMS A;  3V7Z A;  1VHE A;  4OKO A;  4FUU A;  3FH4 A;  2IQ6 A;  5LRG A;  3D7D A;  1EE3 P;  4NJQ A;  2ZEL A;  3NH8 A;  1IGB A;  2GRE A;  2QVP A;  3D66 A;  2PJ0 A;  4OME A;  5HVF A;  1ZG8 A;  3PB4 X;  2NSM A;  2PJ3 A;  3DGV A;  1R3N A;  5JGF A;  3PFO A;  1CX8 A;  3KR4 A;  3TC8 A;  2QJ8 A;  4DJL A;  4ZX9 A;  1CPS A;  1CG2 A;  4ZY0 A;  2JBJ A;  4MCR A;  4P10 A;  3D7F A;  3SI0 A;  5IB9 A;  3VAR A;  3B2Y A;  3D4U A;  1F2O A;  1KWM A;  3BI0 A;  3GB0 A;  4FAI A;  2GLF A;  1GYT A;  1HDQ A;  5LYF A;  1Y7E A;  1NSA A;  5K8P A;  1YW4 A;  2VL1 A;  1ARL A;  4MCS A;  1CPX A;  2PIY A;  2AFX A;  2G9D A;  2PCU A;  2QYV A;  2C6P A;  3KHX A;  1QQ9 A;  2DEA A;  4UIB A;  3RZA A;  1PYT B;  2BOA A;  2PJA A;  3H8F A;  4IK2 A;  4UEF A;  5F09 A;  3S9L A;  3D7G A;  3I1U A;  5K8N A;  1RTQ A;  2J9A A;  2AFZ A;  3ISZ A;  3LWU A;  3CPA A;  4MCP A;  1ZLI A;  3B3T A;  4WJB A;  1Y0R A;  4TNU A;  4NGP A;  1YME A;  4MCQ A;  2V8H A;  5JM6 A;  4IHM A;  4PPZ A;  3IIB A;  3BI1 A;  1CBX A;  2AFO A;  1ELL P;  4EFD A;  3B3V A;  5LYI A;  4FBE A;  4Z65 A;  2OOT A;  5J1Q A;  2EK8 A;  4JYW A;  4P4F A;  3PEI A;  2ZEE A;  2EK9 A;  2PJ1 A;  4MHN A;  4OC3 A;  4P4D A;  5HXD A;  4ONW A;  3BXM A;  3KHZ A;  4OIW A;  3IEH A;  2Q51 A;  3FJU A;  3WAB A;  2OR4 A;  4OID A;  3NH4 A;  3B3S A;  4W9Y A;  3KR5 A;  5CBM A;  1CP6 A;  2PJ7 A;  1CP7 A;  6CPA A;  3ISX A;  2ZED A;  4RUH A;  3B3W A;  4H2K A;  4AXV A;  4A38 A;  1Z8L A;  1TKF A;  3WC7 A;  1R43 A;  2PE3 A;  3KL9 A;  2ZEP A;  2ANP A;  3JRU A;  2PIZ A;  3PFE A;  8CPA A;  2PVW A;  4R76 A;  3NH5 A;  3D68 A;  3N5F A;  4EWT A;  3CDX A;  3KGQ A;  1LCP A;  2V8G A;  4NGR A;  2V77 A;  4WWV A;  4EME A;  2CIJ A;  2O53 A;  3PRT A;  3FEC A;  1F57 A;  3FED A;  3PB9 X;  1LAM A;  1LAN A;  2PJ6 A;  2PJ5 A;  1ELM P;  4FWU A;  3V38 A;  5THW A;  4X8I A;  4P44 A;  1LFW A;  5LYL A;  2F8H A;  1TF9 A;  2JEW A;  4OC0 A;  4YU9 A;  1XMB A;  2ZOF A;  2WYR A;  2Q43 A;  2GLJ A;  2PJC A;  1LOK A;  3WC5 A;  3HLP A;  3SJE A;  1TF8 A;  3PB6 X;  4A37 A;  3PBB A;  3CPX A;  2C1C A;  1ZG7 A;  2PJ8 A;  2XEF A;  3TX8 A;  1XRY A;  4MHP A;  2PJ2 A;  2AFM A;  1ARM A;  5CPA A;  1QMU A;  1YSJ A;  4MMO A;  1YLO A;  1BLL E;  2O4H A;  4F9V A;  3IO1 A;  3T8W A;  5JH9 A;  3PB7 X;  5K8O A;  4NFR A;  4LQG A;  4TWE A;  7CPA A;  5DS0 A;  4ZYQ A;  1BPM A;  3FX6 A;  2XEJ A;  3S9N A;  4MHZ A;  3KQZ A;  3D7H A;  2GU2 A;  2HB6 A;  1AMP A;  3IFE A;  3MRU A;  1UWY A;  2AFW A;  1DE4 C;  5HVH A;  2POK A;  3KZW A;  4OC5 A;  2PJ9 A;  3WT4 A;  1TKJ A;  4P4J A;  2BCO A;  4JZ0 A;  4UEZ A;  4X2T A;  5LYD A;  3B35 A;  3QNV A;  2RFH A;  4MXU A;  4B6Z A;  1Y0Y A;  4Q7A A;  4DYO A;  3FF3 A;  4YWY A;  3B3C A;  4R7M A;  3L2N A;  4DUK A;  1HDU A;  3MN8 A;  4CPA A;  4P45 A;  2CTB A;  2CTC A;  2ZEN A;  2ZEG A;  4PXB A;  3KAS A;  1XFO A;  2XEG A;  4A94 A;  4PXC A;  3S9M A;  3SI1 A;  3WC6 A;  2AFU A;  2PVV A;  1AYE A;  2Q4Z A;  3GUX A;  3IWW A;  2F7V A;  4BD9 A;  4OC1 A;  3NFZ A;  5I4M A;  3BHX A;  1TKH A;  4NGT A;  4KSI A;  2WZN A;  3D67 A;  1XJO A;  1Z5R A;  1Q7L A;  2ZEO A;  3FMC A;  2HC9 A;  1M4L A;  4ZY1 A;  4ZI6 A;  2AFS A;  2I3C A;  2PRQ A;  4PQA A;  2XEI A;  1FNO A;  1Z2L A;  2NYQ A;  4K3N A;  1H8L A;  5LRK A;  5D8N A;  3PB8 X;  5HVG A;  3VH9 A;  1JQG A;  3HUV A;  3SJF A;  1ZG9 A;  2ABZ A;  3VAT A;  2ZEF A;  2JBK A;  3SJX A;  4NGN A;  2PJB A;  1VGY A;  3B7I A;  4NGQ A;  2ZEM A;  2C6C A;  4NJR A;  4A39 A;  3NA6 A;  4IAV A;  4P6Y A;  4OP4 A;  2RB7 A;  1F2P A;  4UIA A;  2FVG A;  2V8V A;  1IY7 A;  4MRI A;  3CT9 A;  1DTD A;  1TXR A;  2BO9 A;  3DLJ A;  3SJG A;  4ZY2 A;  1BPN A;  1YW6 A;  4NGM A;  4NGS A;  2IMO A;  2ZOG A;  3IJ3 A;  3FVL A;  4R8F A;  1HEE A;  3PBE A;  3H8G A;  4F9U A;  5LRJ A;  4R6T A;  2EWB A;  1ZLH A;  1LAP A;  4PXE A; 
#chains in the Genus database with same CATH topology
 5H84 A;  2IJZ A;  1PCA A;  2REE A;  4BIN A;  2FIA A;  4LX9 A;  4X3R A;  5DWM A;  2P6G A;  1OBR A;  3EFA A;  3K2K A;  3K9T A;  3RBU A;  5FVJ A;  4P4E A;  2YNC A;  5D29 A;  1IIC A;  1QSM A;  2C6G A;  2ZW5 A;  3P2H A;  4GXH A;  2DXQ A;  3BJ7 A;  2ZEH A;  2PJ4 A;  4OC4 A;  1GHE A;  3IC1 A;  2Q44 A;  3H8E A;  4CGL A;  4O23 A;  1FT7 A;  2CF4 A;  1I1D A;  3N7Z A;  1J4J A;  1Z4R A;  3CXS A;  4M6I A;  3KQX A;  4OC2 A;  2G0B A;  4GM5 A;  4UEE A;  5K8M A;  4KVM E;  2Q0Y A;  1VIX A;  3TOB A;  1U6M A;  2VZY A;  4UF4 A;  4P4B A;  1XBU A;  4J3G A;  4CYN A;  4P4I A;  4KOX A;  5ELY A;  3KI9 A;  4CRY B;  4UCN A;  2REF A;  1VHO A;  3CXQ A;  1KUY A;  3RAM A;  3GLJ A;  4IUS A;  2QEC A;  2ZW4 A;  3FEE A;  4MJ8 A;  4ZX8 A;  5C88 A;  2V8D A;  4G1P A;  4KOR A;  4MHY A;  4F8Z A;  4KSA A;  1BAV A;  1LRZ A;  4PXD A;  4QB9 A;  3LMS A;  3SI2 A;  3V7Z A;  1Z4E A;  1VHE A;  4OKO A;  4FUU A;  3FH4 A;  4E8O A;  2D4O A;  1KZF A;  3EC4 A;  1CJW A;  3WR7 A;  2IQ6 A;  3DR6 A;  4F6A A;  5LRG A;  4C68 A;  3D7D A;  2Q4V A;  1EE3 P;  2OH1 A;  4L8A A;  4NJQ A;  3S6H A;  3IWE A;  2ZEL A;  3R9E A;  2P6E A;  5IB0 A;  2QVP A;  1IGB A;  2GRE A;  3NH8 A;  2Q04 A;  3D66 A;  3DDD A;  5A27 A;  2PJ0 A;  4OME A;  5HVF A;  4HNX B;  4BMH A;  1ZG8 A;  1YRE A;  3PB4 X;  2NSM A;  1ON0 A;  2OZG A;  4UWI A;  2PJ3 A;  2WUU A;  1R3N A;  2VEZ A;  3DGV A;  3H5Z A;  3PFO A;  1CX8 A;  4CS0 B;  5HH1 A;  5JGF A;  3BLN A;  3KR4 A;  4OAD A;  2QJ8 A;  3TC8 A;  4ZX9 A;  1CPS A;  1CG2 A;  4LQ6 A;  4DJL A;  3PP9 A;  4CAW A;  1IYK A;  2ARH A;  4R9M A;  2JBJ A;  3FRM A;  3G8W A;  1S7F A;  4MCR A;  1M4I A;  4P10 A;  3D7F A;  4NF1 A;  5EC4 A;  4MHD A;  3SI0 A;  5IB9 A;  1Q2C A;  5HMN A;  3VAR A;  2PQ8 A;  2PSW A;  2Q7B A;  4PK3 A;  3B2Y A;  3D4U A;  3S6G A;  2JDC A;  2CNS A;  1MJB A;  4C2X A;  1F2O A;  3D8P A;  1KWM A;  3BI0 A;  3GB0 A;  2JEV A;  3IU1 A;  4KUA A;  4FAI A;  1S5K A;  2GLF A;  2D4P A;  4JXQ A;  1JWQ A;  4LUA A;  1M4D A;  1GYT A;  3EY5 A;  5F47 A;  3V8I A;  4B11 A;  4CAE A;  1HDQ A;  5LYF A;  1Y7E A;  1NSA A;  5K8P A;  1YW4 A;  2VL1 A;  4KOU A;  1ARL A;  5JPH A;  2Y0M A;  4MCS A;  1CPX A;  1RXT A;  2EVN A;  2PIY A;  2AFX A;  3FNC A;  1BO4 A;  4FD5 A;  2G9D A;  2GE3 A;  3S6K A;  2B4D B;  2PCU A;  1YGH A;  2QYV A;  2BSW A;  2OZH A;  2C6P A;  3E0K A;  3H4Q A;  3KHX A;  1QQ9 A;  3JTK A;  2DEA A;  3RNZ A;  4JXR A;  4UIB A;  4A32 A;  2JDD A;  3F0A A;  5H86 A;  3RZA A;  1PYT B;  2BOA A;  2PJA A;  1XEB A;  3F5B A;  3H8F A;  2OZU A;  4IK2 A;  3GKR A;  4UEF A;  4XNH C;  4A95 A;  4B13 A;  2HQY A;  3JVN A;  4UFW A;  1XF8 A;  3IGR A;  5F09 A;  4UBR A;  3S9L A;  3D7G A;  4B5P A;  1YVK A;  3I1U A;  5K8N A;  1YLE A;  1RTQ A;  2J9A A;  2AFZ A;  3PGP A;  4YGO A;  3ISZ A;  1NSL A;  1QSO A;  4U5Y A;  4CAX A;  3DR8 A;  3LWU A;  3CPA A;  4MFK A;  4MFQ A;  4MCP A;  3TTH A;  1ZLI A;  3B3T A;  4WJB A;  2BEI A;  1Y0R A;  4TNU A;  5IX3 A;  2DF5 A;  2WPX A;  3GY9 A;  1YME A;  4MCQ A;  4NGP A;  5GCN A;  2Z3L A;  2V8H A;  5JM6 A;  4IHM A;  4PPZ A;  3IIB A;  3RO0 A;  3BI1 A;  1CBX A;  2AFO A;  1ELL P;  3FIX A;  4EFD A;  3B3V A;  5AG4 A;  2CXA A;  4M85 A;  2B58 A;  5LYI A;  2O28 A;  3D3S A;  4FBE A;  4Z65 A;  2OOT A;  5J1Q A;  2EK8 A;  4JYW A;  3PZJ A;  4KOW A;  2VBQ A;  4P4F A;  3PEI A;  4F0X A;  1QSR A;  2BUE A;  2ZEE A;  2EK9 A;  1XMT A;  2PJ1 A;  2J8N A;  4MHN A;  4NEX A;  4OC3 A;  4P4D A;  1Z8T A;  5G20 A;  1XOV A;  2ATR A;  3TCV A;  5HXD A;  4PSW A;  4ONW A;  1BOB A;  3BXM A;  3KHZ A;  4OIW A;  3IEH A;  4XPL A;  2Q51 A;  4A33 A;  3FJU A;  3WAB A;  2OR4 A;  3EO4 A;  3LAC A;  2B5G A;  3B3S A;  3NH4 A;  4JLY A;  4OID A;  4W9Y A;  4AVB A;  3KR5 A;  4M3S A;  1CP6 A;  5CBM A;  3LD2 A;  2PJ7 A;  3QB8 A;  1S60 A;  4PSX A;  2C27 A;  4KVX A;  3NE7 A;  4Y49 B;  1CP7 A;  6CPA A;  2ODF A;  3ISX A;  2ZED A;  2JLM A;  4RUH A;  3P2F A;  2P6F A;  3B3W A;  2FIW A;  2YGW A;  4H2K A;  3BJ8 A;  4AXV A;  4X5K A;  4A38 A;  3TO6 A;  5KTC A;  1Z8L A;  1XIX A;  3R95 A;  1PUA A;  3FXT A;  1TKF A;  3FB3 A;  4C7I A;  1NMT A;  3WC7 A;  4KZT A;  1R43 A;  2PE3 A;  3TT2 A;  1I21 A;  2YNE A;  1I12 A;  2R8V A;  2ZEP A;  3KL9 A;  3R9G A;  5A28 A;  3TE4 A;  2ANP A;  3FBU A;  4YRH A;  5BWA B;  2PDO A;  5IV0 A;  4XPD C;  1OZP A;  4E2A A;  4QBJ A;  3JRU A;  2YNC C;  2I79 A;  2H5M A;  3CZX A;  2PIZ A;  3PFE A;  4MY3 A;  4QVT A;  5CNP A;  3RYO A;  1M1D A;  1IYL A;  8CPA A;  3TFY A;  1S7K A;  2PVW A;  4AVA A;  4R76 A;  3NH5 A;  4RI1 A;  3D68 A;  1ZO0 A;  3N5F A;  4EWT A;  3CDX A;  3KGQ A;  5F48 A;  1LCP A;  2V8G A;  1A2Z A;  4NXY A;  4CAF A;  2J8R A;  1KUV A;  3K9U A;  1VKC A;  4NGR A;  5AGE A;  2V77 A;  2OB0 A;  2X7B A;  2Z3K A;  4WWV A;  2PRB A;  4C2Y A;  4EME A;  2CIJ A;  2O53 A;  4II9 A;  3PRT A;  3GYA A;  2G3A A;  3FEC A;  4RS2 A;  1FY7 A;  1F57 A;  2FL4 A;  2CNT A;  3ZJ0 A;  1QSN A;  4ZGY B;  3FED A;  3PB9 X;  3TO9 A;  1LAM A;  1S7L A;  2AE6 A;  1RO5 A;  3QAH A;  1LAN A;  3JUW A;  2PJ6 A;  2PJ5 A;  5J8F A;  1ELM P;  4FWU A;  3V38 A;  1YK3 A;  5THW A;  4X8I A;  4P44 A;  3FYN A;  1MJA A;  1VHS A;  4RN7 A;  2Z11 A;  1X10 A;  4QC6 A;  1LFW A;  5LYL A;  2F8H A;  1TF9 A;  3A9L A;  2QIR A;  1IU8 A;  4UA3 A;  2Z0Z A;  2JEW A;  2A4N A;  4BBH A;  5E96 A;  4OC0 A;  3NE8 A;  4B5O A;  2WSA A;  4KSF A;  4YU9 A;  1TIQ A;  3IWG A;  4A30 A;  1XMB A;  2ZOF A;  2WYR A;  2Q43 A;  2VQY A;  2GLJ A;  2PR1 A;  4PV6 A;  4L89 A;  4YFJ A;  2PJC A;  4QUS A;  3TOA A;  1LOK A;  3WC5 A;  3HLP A;  1CM0 A;  3SJE A;  2ZXV A;  1YX0 A;  1TF8 A;  1B87 A;  4MFJ A;  3PB6 X;  1YQE A;  2G3T A;  4M6H A;  1S3Z A;  4A37 A;  4NSQ A;  1KUX A;  3PBB A;  4C2Z A;  3CPX A;  2C1C A;  2F5I A;  2Z3O A;  1ZG7 A;  2PJ8 A;  4KUB A;  4CGM A;  3QAY A;  2XEF A;  4XNH B;  2FE7 A;  3R9F A;  3ZZI A;  3TX8 A;  1XRY A;  4KS9 A;  1YR0 A;  4MHP A;  4F0Y A;  5J8C A;  2PJ2 A;  2GAN A;  5AG7 A;  2AFM A;  1ARM A;  3I9S A;  3EXN A;  5CPA A;  1QMU A;  2Z10 A;  4KOY A;  1YSJ A;  2VI7 A;  3F8K A;  4MMO A;  3OWC A;  1YLO A;  1BLL E;  2NMT A;  2O4H A;  3DNS A;  3IO1 A;  4CGP A;  3T8W A;  4F9V A;  5JH9 A;  3PB7 X;  5K8O A;  4NFR A;  1S7N A;  2FCK A;  4AVC A;  1NE9 A;  4LQG A;  4TWE A;  2FSR A;  4B12 A;  4PK2 A;  3GIU A;  7CPA A;  2EBJ A;  5DS0 A;  1IOF A;  1WK4 A;  1BPM A;  4HNY B;  4XPK A;  4FD7 A;  1SQH A;  4ZYQ A;  3FX6 A;  4M6G A;  5C82 A;  2XEJ A;  3S9N A;  2Q4Y A;  2EUI A;  2AJ6 A;  4MHZ A;  4KOT A;  4Q38 A;  3KQZ A;  4R57 A;  4E0A A;  3D7H A;  4IF5 A;  4H6U A;  4OAE A;  3W6X A;  4B5P B;  2GU2 A;  2HB6 A;  1AMP A;  2EO8 A;  5F46 A;  4JWP A;  2B3U A;  3IFE A;  3MRU A;  1UWY A;  2AFW A;  1AUG A;  1DE4 C;  1IID A;  5DWN A;  1XE4 A;  5HVH A;  2POK A;  3KZW A;  1N71 A;  4R3L A;  2QML A;  4ZBG A;  4UWJ A;  4MBU A;  4OC5 A;  4FD6 A;  1WWZ A;  3R96 A;  2PJ9 A;  3SHP A;  3LOD A;  3WT4 A;  5ISV A;  2ZW6 A;  4R87 A;  2VZZ A;  1TKJ A;  4P4J A;  2BCO A;  1Z8X A;  4CYQ A;  3TO7 A;  4JZ0 A;  3D2P A;  4UEZ A;  4X2T A;  4Y49 C;  5LYD A;  4HKF A;  1Y9W A;  3SXO A;  3B35 A;  3I3G A;  3QNV A;  4ZY0 A;  2RFH A;  4MXU A;  2GIV A;  3DSB A;  4B6Z A;  2BL1 A;  1Y0Y A;  2R98 A;  4Q7A A;  2Z3N A;  4U9Y A;  4DYO A;  4OLL A;  3FF3 A;  2VXK A;  4YWY A;  3B3C A;  1MK4 A;  4Q36 A;  4R7M A;  3L2N A;  4MY0 A;  2P0W A;  2FXF A;  3MGD A;  5AG6 A;  3T9Y A;  4DUK A;  2B4D A;  1HDU A;  1IB1 E;  3MN8 A;  4UCP A;  4CPA A;  2Z3M A;  4P45 A;  2CTB A;  3VWD A;  2DPT A;  2CTC A;  1M4G A;  2WPW A;  4CYP A;  2ZEN A;  2ZEG A;  4PXB A;  3KAS A;  4MFZ A;  1XFO A;  2R1I A;  2OU2 A;  2XEG A;  4A94 A;  4PXC A;  2ZW7 A;  1P0H A;  1PU9 A;  4UFV A;  1M44 A;  1Q2Y A;  3S9M A;  3SI1 A;  3WC6 A;  4A2Z A;  2AFU A;  2PVV A;  1AYE A;  2Q4Z A;  4GS4 A;  3GUX A;  4HNW B;  2YND A;  3IWW A;  2R7H A;  5EMI A;  4MFP A;  4ORF A;  4AG9 A;  3C26 A;  4CGN A;  2F7V A;  4CRZ B;  1IOI A;  4BD9 A;  4OC1 A;  3NFZ A;  2HV2 A;  4JJX A;  5I4M A;  4A31 A;  2B5G B;  4H89 A;  4I49 A;  4UFX A;  1B6B A;  2B4B A;  3UY5 A;  3BHX A;  4XPD B;  4AB7 A;  1R57 A;  1TKH A;  5EBV A;  4NGT A;  4KSI A;  1Z9U A;  1V0C A;  2WZN A;  2CNM A;  2ZPA A;  3D67 A;  1XJO A;  2PC1 A;  2I00 A;  4H6Z A;  1Z5R A;  4ONU A;  5G1Z A;  1Y9K A;  1Q7L A;  2ZEO A;  4MFL A;  2CY2 A;  2PR8 A;  3FMC A;  4DNC A;  2HC9 A;  1M4L A;  2Q7S A;  1YVO A;  1Z8W A;  2K5T A;  3CXP A;  3VWE A;  4ZI6 A;  4ZY1 A;  1MJ9 A;  2AFS A;  2I3C A;  3SXN A;  5G22 A;  4UCM A;  2PRQ A;  5G21 A;  4PQA A;  2XEI A;  2DPS A;  3T90 A;  1FNO A;  1Z2L A;  2NYQ A;  4K3N A;  1H8L A;  5LRK A;  5D8N A;  2IL4 A;  3PB8 X;  5HVG A;  4JD6 A;  3VH9 A;  1JQG A;  3HUV A;  4CGO A;  3SJF A;  1ZG9 A;  2ABZ A;  3VAT A;  2ZEF A;  2JBK A;  3SJX A;  2HUZ A;  4NGN A;  4U9Z A;  1L0C A;  3IU2 A;  2PJB A;  1X12 A;  1VGY A;  3B7I A;  4HPS A;  4NGQ A;  2ZEM A;  2C6C A;  4NJR A;  4A39 A;  4B14 A;  2GFQ A;  4FD4 A;  3KKW A;  2FT0 A;  4B10 A;  1P4N A;  3D2M A;  4AG7 A;  3NA6 A;  1QST A;  4IAV A;  4P6Y A;  2KCW A;  4OP4 A;  4MI4 A;  2RB7 A;  1Q2D A;  2Z3P A;  1F2P A;  4UIA A;  2FVG A;  2V8V A;  5KTA A;  1IY7 A;  4KOV A;  4MRI A;  3CT9 A;  1Y7R A;  1DTD A;  5KTD A;  1TXR A;  2BO9 A;  3DLJ A;  4KVO E;  3W6S A;  3SJG A;  4ZY2 A;  4EVY A;  1BPN A;  1K4J A;  1YW6 A;  4NGM A;  4K30 A;  4NGS A;  4CYO A;  4C7H A;  2IMO A;  1UFH A;  2ZOG A;  2FS5 A;  5AG5 A;  3IJ3 A;  2J8M A;  3FVL A;  4R8F A;  1HEE A;  3S6F A;  3PBE A;  3H8G A;  4KLV A;  3R1K A;  5F49 A;  3B8G A;  4KLW A;  4R3K A;  3W91 A;  4F9U A;  4CAV A;  5LRJ A;  4R6T A;  4KOS A;  2B3V A;  2EWB A;  4NCZ A;  5I0C A;  1ZLH A;  3G3S A;  2RC4 A;  1LAP A;  4PXE A;  5JQ4 A; 
#chains in the Genus database with same CATH homology
 2IJZ A;  1PCA A;  4X3R A;  1OBR A;  3K9T A;  3K2K A;  3RBU A;  4P4E A;  5D29 A;  2C6G A;  2ZEH A;  2PJ4 A;  4OC4 A;  3IC1 A;  3H8E A;  4O23 A;  1FT7 A;  2CF4 A;  3KQX A;  4OC2 A;  4GM5 A;  4UEE A;  5K8M A;  1VIX A;  4UF4 A;  4P4B A;  1XBU A;  4P4I A;  5ELY A;  3KI9 A;  1VHO A;  3RAM A;  3GLJ A;  3FEE A;  4ZX8 A;  2V8D A;  4G1P A;  4MHY A;  4F8Z A;  1BAV A;  4PXD A;  3SI2 A;  3LMS A;  3V7Z A;  1VHE A;  4OKO A;  4FUU A;  3FH4 A;  2IQ6 A;  5LRG A;  3D7D A;  1EE3 P;  4NJQ A;  2ZEL A;  3NH8 A;  1IGB A;  2GRE A;  2QVP A;  3D66 A;  2PJ0 A;  4OME A;  5HVF A;  1ZG8 A;  3PB4 X;  2NSM A;  2PJ3 A;  3DGV A;  1R3N A;  5JGF A;  3PFO A;  1CX8 A;  3KR4 A;  3TC8 A;  2QJ8 A;  4DJL A;  4ZX9 A;  1CPS A;  1CG2 A;  4ZY0 A;  2JBJ A;  4MCR A;  4P10 A;  3D7F A;  3SI0 A;  5IB9 A;  3VAR A;  3B2Y A;  3D4U A;  1F2O A;  1KWM A;  3BI0 A;  3GB0 A;  4FAI A;  2GLF A;  1GYT A;  1HDQ A;  5LYF A;  1Y7E A;  1NSA A;  5K8P A;  1YW4 A;  2VL1 A;  1ARL A;  4MCS A;  1CPX A;  2PIY A;  2AFX A;  2G9D A;  2PCU A;  2QYV A;  2C6P A;  3KHX A;  1QQ9 A;  2DEA A;  4UIB A;  3RZA A;  1PYT B;  2BOA A;  2PJA A;  3H8F A;  4IK2 A;  4UEF A;  5F09 A;  3S9L A;  3D7G A;  3I1U A;  5K8N A;  1RTQ A;  2J9A A;  2AFZ A;  3ISZ A;  3LWU A;  3CPA A;  4MCP A;  1ZLI A;  3B3T A;  4WJB A;  1Y0R A;  4TNU A;  4NGP A;  1YME A;  4MCQ A;  2V8H A;  5JM6 A;  4IHM A;  4PPZ A;  3IIB A;  3BI1 A;  1CBX A;  2AFO A;  1ELL P;  4EFD A;  3B3V A;  5LYI A;  4FBE A;  4Z65 A;  2OOT A;  5J1Q A;  2EK8 A;  4JYW A;  4P4F A;  3PEI A;  2ZEE A;  2EK9 A;  2PJ1 A;  4MHN A;  4OC3 A;  4P4D A;  5HXD A;  4ONW A;  3BXM A;  3KHZ A;  4OIW A;  3IEH A;  2Q51 A;  3FJU A;  3WAB A;  2OR4 A;  4OID A;  3NH4 A;  3B3S A;  4W9Y A;  3KR5 A;  5CBM A;  1CP6 A;  2PJ7 A;  1CP7 A;  6CPA A;  3ISX A;  2ZED A;  4RUH A;  3B3W A;  4H2K A;  4AXV A;  4A38 A;  1Z8L A;  1TKF A;  3WC7 A;  1R43 A;  2PE3 A;  3KL9 A;  2ZEP A;  2ANP A;  3JRU A;  2PIZ A;  3PFE A;  8CPA A;  2PVW A;  4R76 A;  3NH5 A;  3D68 A;  3N5F A;  4EWT A;  3CDX A;  3KGQ A;  1LCP A;  2V8G A;  4NGR A;  2V77 A;  4WWV A;  4EME A;  2CIJ A;  2O53 A;  3PRT A;  3FEC A;  1F57 A;  3FED A;  3PB9 X;  1LAM A;  1LAN A;  2PJ6 A;  2PJ5 A;  1ELM P;  4FWU A;  3V38 A;  5THW A;  4X8I A;  4P44 A;  1LFW A;  5LYL A;  2F8H A;  1TF9 A;  2JEW A;  4OC0 A;  4YU9 A;  1XMB A;  2ZOF A;  2WYR A;  2Q43 A;  2GLJ A;  2PJC A;  1LOK A;  3WC5 A;  3HLP A;  3SJE A;  1TF8 A;  3PB6 X;  4A37 A;  3PBB A;  3CPX A;  2C1C A;  1ZG7 A;  2PJ8 A;  2XEF A;  3TX8 A;  1XRY A;  4MHP A;  2PJ2 A;  2AFM A;  1ARM A;  5CPA A;  1QMU A;  1YSJ A;  4MMO A;  1YLO A;  1BLL E;  2O4H A;  4F9V A;  3IO1 A;  3T8W A;  5JH9 A;  3PB7 X;  5K8O A;  4NFR A;  4LQG A;  4TWE A;  7CPA A;  5DS0 A;  4ZYQ A;  1BPM A;  3FX6 A;  2XEJ A;  3S9N A;  4MHZ A;  3KQZ A;  3D7H A;  2GU2 A;  2HB6 A;  1AMP A;  3IFE A;  3MRU A;  1UWY A;  2AFW A;  1DE4 C;  5HVH A;  2POK A;  3KZW A;  4OC5 A;  2PJ9 A;  3WT4 A;  1TKJ A;  4P4J A;  2BCO A;  4JZ0 A;  4UEZ A;  4X2T A;  5LYD A;  3B35 A;  3QNV A;  2RFH A;  4MXU A;  4B6Z A;  1Y0Y A;  4Q7A A;  4DYO A;  3FF3 A;  4YWY A;  3B3C A;  4R7M A;  3L2N A;  4DUK A;  1HDU A;  3MN8 A;  4CPA A;  4P45 A;  2CTB A;  2CTC A;  2ZEN A;  2ZEG A;  4PXB A;  3KAS A;  1XFO A;  2XEG A;  4A94 A;  4PXC A;  3S9M A;  3SI1 A;  3WC6 A;  2AFU A;  2PVV A;  1AYE A;  2Q4Z A;  3GUX A;  3IWW A;  2F7V A;  4BD9 A;  4OC1 A;  3NFZ A;  5I4M A;  3BHX A;  1TKH A;  4NGT A;  4KSI A;  2WZN A;  3D67 A;  1XJO A;  1Z5R A;  1Q7L A;  2ZEO A;  3FMC A;  2HC9 A;  1M4L A;  4ZY1 A;  4ZI6 A;  2AFS A;  2I3C A;  2PRQ A;  4PQA A;  2XEI A;  1FNO A;  1Z2L A;  2NYQ A;  4K3N A;  1H8L A;  5LRK A;  5D8N A;  3PB8 X;  5HVG A;  3VH9 A;  1JQG A;  3HUV A;  3SJF A;  1ZG9 A;  2ABZ A;  3VAT A;  2ZEF A;  2JBK A;  3SJX A;  4NGN A;  2PJB A;  1VGY A;  3B7I A;  4NGQ A;  2ZEM A;  2C6C A;  4NJR A;  4A39 A;  3NA6 A;  4IAV A;  4P6Y A;  4OP4 A;  2RB7 A;  1F2P A;  4UIA A;  2FVG A;  2V8V A;  1IY7 A;  4MRI A;  3CT9 A;  1DTD A;  1TXR A;  2BO9 A;  3DLJ A;  3SJG A;  4ZY2 A;  1BPN A;  1YW6 A;  4NGM A;  4NGS A;  2IMO A;  2ZOG A;  3IJ3 A;  3FVL A;  4R8F A;  1HEE A;  3PBE A;  3H8G A;  4F9U A;  5LRJ A;  4R6T A;  2EWB A;  1ZLH A;  1LAP A;  4PXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...