1F2OA

Crystal structure of the streptomyces griseus aminopeptidase complexed with l-leucine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Interactions of Streptomyces griseus aminopeptidase with amino acid reaction products and their implications toward a catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
total genus 107
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1f2oA00
3D4UA 3TX8A 3VARA 4MCQA 2CIJA 3PB6X 1XMBA 4F8ZA 4YWYA 2PJCA 3KR4A 3IC1A 4O23A 2ZEHA 2AFMA 4WJBA 4OC3A 1XFOA 1RTQA 2GREA 4MHNA 2BOAA 4LQGA 3H8FA 4ZX8A 5HVHA 3K2KA 1Y0YA 4EMEA 1EE3P 2AFXA 3SI1A 2ZEEA 2F8HA 2J9AA 5CBMA 2AFOA 5LYIA 4RUHA 3K9TA 1IY7A 3KHZA 4NGTA 3CT9A 3GUXA 1CP7A 3GB0A 3N5FA 4OC4A 3KR5A 1CX8A 3SI0A 5LYLA 4EWTA 2G9DA 2V8GA 4PPZA 2Q43A 2C1CA 1VIXA 3RBUA 2PIYA 3SJGA 2AFZA 4FWUA 4R7MA 2ZEOA 3PFEA 1IGBA 4PXBA 3TC8A 2DEAA 4K3NA 4DYOA 3S9MA 5K8NA 2FVGA 4OC2A 5K8OA 4MCPA 4FBEA 5LRGA 4NJRA 4OP4A 1BAVA 3MRUA 2RFHA 4MCRA 3B35A 1BLLE 1YW6A 4OIDA 3IO1A 3D68A 4ZY0A 5J1QA 1ELMP 1FNOA 2WYRA 4P45A 4P4BA 1KWMA 5D8NA 3MN8A 1NSAA 3GLJA 1Y0RA 2GLJA 5LRJA 2PCUA 2ZOFA 3NA6A 4IHMA 3KZWA 3KGQA 2BCOA 2OR4A 4NGQA 5HXDA 4P44A 3S9NA 3D7FA 2ZENA 3IJ3A 4P10A 4NGRA 2AFSA 4OC0A 2EK9A 5THWA 2XEIA 4PXDA 4NGMA 1YMEA 4G1PA 1ZG9A 1QQ9A 2ZEFA 4FUUA 4P4JA 1CBXA 1Z2LA 3FMCA 2I3CA 3HLPA 1QMUA 2ZEDA 3V38A 3ISXA 3IWWA 1TF9A 1BPNA 4X8IA 4Q7AA 2PE3A 5LRKA 4UEFA 4A38A 5JH9A 4ZYQA 4PXEA 3JRUA 3WT4A 1LCPA 4ZY2A 3B3TA 3D7DA 4A94A 2AFWA 4P4FA 3CPAA 3H8EA 2PRQA 2C6GA 3FF3A 3KASA 2QJ8A 4EFDA 3D7GA 4UIAA 3H8GA 3BXMA 2JEWA 3PBBA 3I1UA 2VL1A 3V7ZA 1TKFA 2ZEGA 2C6PA 2ZEMA 2PJ9A 1VHOA 4MXUA 1F2PA 3HUVA 1TF8A 3WABA 2PJ7A 1LOKA 4OKOA 3FEEA 1M4LA 2C6CA 4R8FA 1ARLA 1YLOA 1CPSA 1R43A 2V8DA 1LFWA 3D7HA 3D67A 4X2TA 2O4HA 4MHPA 3PEIA 4MHZA 5K8PA 2WZNA 1F57A 1Y7EA 4FAIA 4OC5A 4TNUA 5HVFA 1YSJA 3B7IA 4NGPA 2XEJA 5DS0A 3FJUA 4ONWA 1LAPA 5HVGA 2JBKA 2Q4ZA 4JYWA 3B3SA 5LYDA 1FT7A 1XJOA 2XEFA 2O53A 4P6YA 3PBEA 3KQXA 2PJBA 3DLJA 3BI0A 1VGYA 1ZG7A 1LANA 1H8LA 4GM5A 1YW4A 1CP6A 2F7VA 3LMSA 3LWUA 3B3WA 1PCAA 4YU9A 2PJ8A 2GU2A 3B2YA 2NYQA 1HDUA 3B3VA 2PJAA 3SJFA 4W9YA 4OIWA 3WC5A 2QVPA 1R3NA 2ABZA 1UWYA 3PB4X 1ZG8A 3KL9A 1LAMA 2ANPA 3IFEA 3PRTA 4NGSA 3QNVA 2V8VA 4A39A 1ARMA 4BD9A 6CPAA 2PVVA 1OBRA 2IJZA 3B3CA 4Z65A 2POKA 8CPAA 2CTCA 4R6TA 1VHEA 5I4MA 1ZLIA 2HC9A 4A37A 4P4DA 2CTBA 1Z5RA 2NSMA 1Z8LA 3NFZA 1XRYA 4P4EA 5K8MA 2PVWA 4TWEA 2Q51A 2ZELA 2OOTA 4ZI6A 1CG2A 4P4IA 1CPXA 7CPAA 3ISZA 3RAMA 3NH4A 2PJ4A 4UIBA 2AFUA 3SI2A 3WC7A 4R76A 4WWVA 2PJ5A 4NGNA 3FX6A 3NH8A 4X3RA 5D29A 2CF4A 1TKHA 2BO9A 1TXRA 2XEGA 3IIBA 4AXVA 4PXCA 2RB7A 1GYTA 3DGVA 2V8HA 1HEEA 4PQAA 4DUKA 3FECA 4OMEA 4F9VA 1TKJA 4OC1A 3NH5A 3VATA 2PJ3A 4JZ0A 4UEZA 3RZAA 3T8WA 1ELLP 3CPXA 4IK2A 4B6ZA 3S9LA 4NJQA 5F09A 3SJEA 3VH9A 5JM6A 4IAVA 4H2KA 2GLFA 2IQ6A 4KSIA 4CPAA 5ELYA 4ZX9A 3KI9A 3SJXA 3KQZA 3PB8X 4MHYA 3BHXA 3KHXA 3BI1A 2JBJA 2QYVA 1AYEA 1BPMA 2EWBA 2ZEPA 3FH4A 3CDXA 3PB7X 5CPAA 1Q7LA 4UF4A 3L2NA 1ZLHA 3FEDA 2HB6A 3D66A 2IMOA 1JQGA 2PJ2A 4NFRA 2PIZA 1XBUA 5LYFA 1DTDA 1DE4C 3FVLA 1F2OA 2EK8A 3WC6A 1PYTB 4ZY1A 2ZOGA 2PJ1A 4DJLA 4MCSA 4MRIA 1HDQA 3PB9X 5JGFA 1AMPA 4UEEA 2V77A 4F9UA 5IB9A 2PJ6A 2PJ0A 3IEHA 3PFOA 4MMOA
chains in the Genus database with same CATH superfamily
3D4UA 3TX8A 3VARA 4MCQA 5G1ZA 2CY2A 2CIJA 3PB6X 1XMBA 4F8ZA 4YWYA 1J4JA 2PJCA 3KR4A 3IC1A 2FIAA 2ZEHA 4HNYB 4O23A 4PSXA 1IIDA 1M4IA 2EO8A 2Z11A 2CNSA 4KOTA 2AFMA 4WJBA 4OC3A 2HUZA 2PDOA 1XFOA 4XPKA 3PFOA 4UFVA 2EBJA 2KCWA 4B12A 4CGOA 2FCKA 2ZXVA 1RTQA 2GREA 5G21A 4MHNA 2BOAA 4OAEA 2BL1A 4LQGA 4MFJA 4MFKA 2YNEA 3H8FA 3W6XA 4ZX8A 3FYNA 1L0CA 3K2KA 5HVHA 2CNMA 1Y0YA 4EMEA 5ISVA 1EE3P 2AFXA 5JQ4A 3SI1A 2ZEEA 3TTHA 4MBUA 2I00A 2F8HA 2WPWA 1KUYA 2J9AA 1Z8XA 2I79A 4M6HA 5CBMA 2AFOA 5LYIA 3D3SA 4RUHA 3K9TA 1IY7A 3KHZA 4NGTA 2OZGA 3CT9A 3GUXA 2PR8A 1CP7A 3GB0A 3N5FA 3A9LA 4OC4A 1IYLA 5F49A 4BINA 3KR5A 1CX8A 2BSWA 3R96A 4CAVA 3SI0A 2A4NA 3GYAA 5LYLA 4EWTA 2G9DA 2V8GA 4KSFA 2BEIA 4PPZA 4DNCA 1BOBA 3R9GA 2Q43A 3D2PA 4UFXA 2C1CA 1VIXA 2QIRA 3GKRA 3RBUA 2PIYA 3SJGA 2Z3MA 4A31A 4CYQA 3EC4A 4J3GA 4HNXB 2AFZA 4U9ZA 5C88A 4FWUA 4R7MA 2ZEOA 2VEZA 3PFEA 4JXRA 1IGBA 4PXBA 4M85A 2OB0A 4UCPA 2QMLA 5HMNA 2R98A 3TC8A 4R87A 2DEAA 4K3NA 4A2ZA 4DYOA 4QB9A 4U5YA 3S9MA 3W91A 4LQ6A 5C82A 3RO0A 4CAEA 5K8NA 2FVGA 4OC2A 3CXPA 2YNCC 4MCPA 4PSWA 4X5KA 5LRGA 4NJRA 4FBEA 4YFJA 2RC4A 1K4JA 3JVNA 2H5MA 4OP4A 4QC6A 4CYNA 1BAVA 3H4QA 4B5PA 3MRUA 2Q4YA 2RFHA 3IWGA 4MCRA 3LODA 3B35A 4UA3A 2X7BA 1BLLE 3F0AA 1YW6A 3EFAA 4KUAA 4OIDA 4E2AA 2FT0A 3IO1A 4OADA 4AVCA 4M6GA 3D68A 4ZY0A 1YLEA 5J1QA 2Z3KA 1ELMP 1FNOA 2WYRA 2ZW6A 3PGPA 4P45A 1S60A 4P4BA 1MJ9A 2B5GA 2YNCA 1KWMA 4E8OA 2Y0MA 5D8NA 2FS5A 3MN8A 1NSAA 4FD4A 3GLJA 1Y0RA 2GLJA 4KLWA 5LRJA 4H6UA 5A28A 2PCUA 2ZOFA 1XF8A 4JXQA 1PUAA 2QECA 5EBVA 3NA6A 2CNTA 1M44A 4IHMA 1IU8A 3KZWA 3KGQA 2BCOA 2OR4A 4NGQA 3PP9A 3EY5A 4KORA 5HXDA 4H6ZA 2DXQA 4P44A 3S9NA 4KOVA 1A2ZA 3D7FA 2ZENA 2Q4VA 3LD2A 3IJ3A 4P10A 1YR0A 3IGRA 3V8IA 4FD6A 4C2ZA 4NGRA 2D4PA 2AFSA 4OC0A 4MI4A 2EK9A 5DWMA 5THWA 4A95A 2XEIA 1S3ZA 4PXDA 3H5ZA 4NGMA 1YMEA 4AVBA 1ON0A 4G1PA 2FXFA 3RNZA 2JDCA 1ZG9A 4LX9A 1QQ9A 2ZEFA 4FUUA 2EVNA 2P6GA 4KOXA 1RO5A 4P4JA 3R9FA 3LACA 1CBXA 2O28A 1Z2LA 3FMCA 4RN7A 2I3CA 1IB1E 2DF5A 4RI1A 3HLPA 1U6MA 2Z3NA 4C68A 2VI7A 1MK4A 1QMUA 2ZEDA 1QSTA 3R95A 3PZJA 4HPSA 4CGPA 1Q2YA 3S6KA 3V38A 3ISXA 3IWWA 1TF9A 1BPNA 3CXQA 4CRZB 4X8IA 2EUIA 3EO4A 4Q7AA 4XPDB 2PE3A 5LRKA 4UEFA 4A38A 5I0CA 1Z9UA 2OH1A 5JH9A 4KOWA 4ZYQA 3P2FA 2Q7SA 4CRYB 4PXEA 3TT2A 1XOVA 4MY0A 1KZFA 3GIUA 3JRUA 4KS9A 1LCPA 3WT4A 4ZY2A 2REFA 2DPSA 1KUXA 3DDDA 3R9EA 3B3TA 3D7DA 1MJBA 4A94A 4ONUA 4B10A 2P6EA 2B58A 2P0WA 2Z3OA 4BBHA 2AFWA 4P4FA 2VBQA 4IF5A 1YK3A 3TO6A 3CPAA 2ATRA 3H8EA 4F0YA 1V0CA 3S6FA 2PRQA 2C6GA 3FF3A 3T90A 3KASA 2QJ8A 4C2YA 4EFDA 1B87A 1UFHA 4A30A 4Q36A 1TIQA 4NEXA 3D7GA 5E96A 3TOAA 1NSLA 4UIAA 3FXTA 3H8GA 2YNDA 3BXMA 2JEWA 3PBBA 1VHSA 1P4NA 3I1UA 4NCZA 2VL1A 3V7ZA 3FB3A 1TKFA 2ZEGA 1IYKA 2C6PA 4MJ8A 3DR6A 5AG4A 4XNHC 2PR1A 5F48A 3K9UA 4B13A 1NMTA 2B4BA 2ZEMA 4E0AA 2PJ9A 2IL4A 1VHOA 4MXUA 1F2PA 3CZXA 3I3GA 4KVME 3HUVA 1XEBA 1TF8A 3BJ8A 1Q2DA 4UCMA 4A32A 3TOBA 4BMHA 3WABA 4MFZA 1Y7RA 4UWIA 3VWDA 2PJ7A 1LOKA 4NSQA 2FE7A 5EMIA 4CGMA 3N7ZA 3BLNA 4GS4A 4OKOA 4II9A 3FEEA 1M4LA 2C6CA 5DWNA 4XPLA 4R8FA 5F47A 1SQHA 5AGEA 1ARLA 4L8AA 1YLOA 1CPSA 1R43A 2V8DA 1LFWA 3D8PA 3D7HA 3D67A 4X2TA 4KVXA 1QSNA 2O4HA 2Q04A 3TCVA 4LUAA 4MHPA 4OLLA 2ARHA 3PEIA 3F8KA 5BWAB 4MHZA 2B4DB 2CXAA 4CS0B 5K8PA 4NF1A 2P6FA 2WZNA 1F57A 1Y7EA 4FAIA 3IU2A 4OC5A 4TNUA 5HVFA 1YSJA 1BO4A 1QSRA 3R1KA 4UCNA 4CYOA 4MHDA 4MY3A 3MGDA 3B7IA 2JDDA 4IUSA 1N71A 4HNWB 5KTCA 4NGPA 2Z3PA 2OU2A 2XEJA 4B5PB 5DS0A 2R7HA 3FJUA 1M4DA 4ONWA 4AG9A 1LAPA 5HVGA 2PC1A 3FIXA 2JBKA 1YGHA 4AB7A 2Q4ZA 4JD6A 4JYWA 3B3SA 5LYDA 3TE4A 1FT7A 1QSMA 1XJOA 2Q0YA 2XEFA 1JWQA 3FRMA 2O53A 4QBJA 4P6YA 3PBEA 2B5GB 3KQXA 3QAHA 2PJBA 2ZW4A 5J8FA 4JJXA 4CAFA 4CGLA 2Z0ZA 3BJ7A 3DLJA 3BI0A 4KOUA 4HKFA 1NE9A 4R3LA 1X10A 1VGYA 1ZG7A 4F0XA 1LANA 2Q44A 2J8MA 1H8LA 4GM5A 1M1DA 1YW4A 1CP6A 2F7VA 1XMTA 1YVKA 5AG7A 4F6AA 3LMSA 3LWUA 3B3WA 4ZBGA 1PCAA 3IWEA 4YU9A 4B11A 2PJ8A 2GU2A 2R1IA 3B2YA 2NYQA 5HH1A 1HDUA 3S6GA 1Q2CA 4Y49B 2VXKA 3B3VA 3FBUA 1X12A 4PV6A 2PJAA 4NXYA 3SJFA 4RS2A 4W9YA 1YX0A 4OIWA 3WC5A 2QVPA 1R3NA 1RXTA 2ABZA 1UWYA 2ZW7A 4C7HA 3G3SA 4MFPA 3PB4X 1VKCA 1ZG8A 4KUBA 4PK3A 4R57A 3KL9A 1LAMA 2ANPA 4CAXA 2OZUA 3IFEA 1IOFA 3PRTA 5GCNA 5K8OA 4NGSA 5G22A 1WK4A 3QNVA 4EVYA 5A27A 2JEVA 2V8VA 4A39A 2C27A 2ZPAA 5F46A 1ARMA 4BD9A 6CPAA 2PVVA 4L89A 1OBRA 2IJZA 4R3KA 4AG7A 3JTKA 3B3CA 4Z65A 1R57A 3WR7A 2POKA 8CPAA 3TO9A 3RYOA 2CTCA 3SXNA 4AVAA 2ZW5A 2PSWA 2VZYA 4R6TA 1Y9WA 1VHEA 4KVOE 5I4MA 1ZLIA 4FD7A 4I49A 5AG5A 2HC9A 4A37A 4PK2A 4P4DA 2CTBA 5H86A 3B8GA 1Z5RA 5H84A 2YGWA 3IU1A 2NSMA 2D4OA 1Z8LA 2DPTA 3NFZA 3P2HA 1XRYA 4P4EA 5K8MA 2PVWA 4TWEA 4C7IA 1M4GA 2Q51A 2ZELA 4KOSA 2AE6A 2OZHA 2AJ6A 1ZO0A 2WPXA 2OOTA 3W6SA 4B14A 4ZI6A 1Z8WA 1CG2A 4JWPA 4P4IA 4CAWA 3QB8A 1CPXA 7CPAA 3TFYA 3ISZA 1GHEA 1FY7A 3RAMA 4CGNA 2K5TA 3NH4A 3S6HA 1PU9A 2PJ4A 2J8RA 2BUEA 4KLVA 4UIBA 2GANA 3DR8A 4KOYA 5FVJA 3DSBA 3I9SA 2AFUA 3SI2A 3C26A 3WC7A 4R76A 4WWVA 1OZPA 3NE7A 2ODFA 2PJ5A 1Z8TA 4NGNA 5JPHA 3FX6A 3NH8A 1IOIA 4UFWA 4X3RA 4YRHA 5D29A 2CF4A 1TKHA 2BO9A 1TXRA 2Z3LA 4H89A 2XEGA 3IIBA 2B3UA 4AXVA 4PXCA 2RB7A 1GYTA 3DGVA 2V8HA 1HEEA 2REEA 5J8CA 4PQAA 4DUKA 3FECA 2GE3A 4OMEA 2G3AA 4KSAA 4F9VA 1AUGA 4R9MA 1QSOA 1TKJA 4OC1A 1Y9KA 4XNHB 2VZZA 4KZTA 3NH5A 3VATA 2PJ3A 5G20A 3NE8A 5EC4A 4JZ0A 4UEZA 3RZAA 3T8WA 5IV0A 2B4DA 1ELLP 3CPXA 4IK2A 3T9YA 4B6ZA 3JUWA 4B5OA 4UWJA 3SHPA 3S9LA 5KTDA 4NJQA 1I21A 2Z10A 3GY9A 5F09A 1YQEA 1S7FA 3FNCA 1S7LA 4ORFA 3SJEA 3VH9A 2G3TA 5KTAA 5JM6A 4IAVA 4H2KA 2GLFA 2IQ6A 4KSIA 4CPAA 4Q38A 5ELYA 3TO7A 4ZX9A 1XE4A 2NMTA 2PQ8A 2VQYA 3KI9A 1S7NA 3KQZA 3PB8X 4MHYA 3BHXA 3SJXA 1IICA 3KHXA 2R8VA 1MJAA 2FL4A 1YVOA 3BI1A 1LRZA 4CYPA 2JBJA 2HV2A 4C2XA 2QYVA 3E0KA 1CJWA 1AYEA 3UY5A 1B6BA 3D2MA 1BPMA 4U9YA 2GIVA 2EWBA 2ZEPA 3FH4A 2J8NA 3CDXA 3PB7X 4Y49C 5CPAA 1Q7LA 4UF4A 2HQYA 3L2NA 1XIXA 3QAYA 4QVTA 1P0HA 1ZLHA 3FEDA 2HB6A 3D66A 4MFQA 3CXSA 1I1DA 2JLMA 2IMOA 1JQGA 1KUVA 5IB0A 2PJ2A 4M3SA 2GFQA 4NFRA 1Z4RA 2PIZA 1XBUA 4XPDC 5AG6A 1DTDA 3SXOA 4MFLA 1DE4C 5LYFA 3FVLA 3VWEA 4M6IA 1F2OA 2EK8A 3EXNA 3OWCA 3WC6A 2B3VA 1PYTB 1S7KA 2FSRA 4ZY1A 3DNSA 4GXHA 3ZJ0A 5IX3A 1CM0A 2ZOGA 2PRBA 2G0BA 2WSAA 2PJ1A 4QUSA 2Q7BA 4K30A 1Z4EA 2WUUA 4MCSA 4DJLA 4YGOA 4FD5A 1S5KA 4MRIA 3ZZIA 1HDQA 3KKWA 3PB9X 5JGFA 1AMPA 2F5IA 1YREA 1WWZA 4UEEA 2V77A 4JLYA 4A33A 4F9UA 5CNPA 3F5BA 5IB9A 4ZGYB 2PJ6A 4UBRA 2PJ0A 3IEHA 3G8WA 4MMOA 2FIWA 1I12A
chains in the Genus database with same CATH topology
3D4UA 3TX8A 3VARA 4MCQA 2CIJA 3PB6X 1XMBA 4F8ZA 4YWYA 2PJCA 3KR4A 3IC1A 4O23A 2ZEHA 2AFMA 4WJBA 4OC3A 1XFOA 1RTQA 2GREA 4MHNA 2BOAA 4LQGA 3H8FA 4ZX8A 5HVHA 3K2KA 1Y0YA 4EMEA 1EE3P 2AFXA 3SI1A 2ZEEA 2F8HA 2J9AA 5CBMA 2AFOA 5LYIA 4RUHA 3K9TA 1IY7A 3KHZA 4NGTA 3CT9A 3GUXA 1CP7A 3GB0A 3N5FA 4OC4A 3KR5A 1CX8A 3SI0A 5LYLA 4EWTA 2G9DA 2V8GA 4PPZA 2Q43A 2C1CA 1VIXA 3RBUA 2PIYA 3SJGA 2AFZA 4FWUA 4R7MA 2ZEOA 3PFEA 1IGBA 4PXBA 3TC8A 2DEAA 4K3NA 4DYOA 3S9MA 5K8NA 2FVGA 4OC2A 5K8OA 4MCPA 4FBEA 5LRGA 4NJRA 4OP4A 1BAVA 3MRUA 2RFHA 4MCRA 3B35A 1BLLE 1YW6A 4OIDA 3IO1A 3D68A 4ZY0A 5J1QA 1ELMP 1FNOA 2WYRA 4P45A 4P4BA 1KWMA 5D8NA 3MN8A 1NSAA 3GLJA 1Y0RA 2GLJA 5LRJA 2PCUA 2ZOFA 3NA6A 4IHMA 3KZWA 3KGQA 2BCOA 2OR4A 4NGQA 5HXDA 4P44A 3S9NA 3D7FA 2ZENA 3IJ3A 4P10A 4NGRA 2AFSA 4OC0A 2EK9A 5THWA 2XEIA 4PXDA 4NGMA 1YMEA 4G1PA 1ZG9A 1QQ9A 2ZEFA 4FUUA 4P4JA 1CBXA 1Z2LA 3FMCA 2I3CA 3HLPA 1QMUA 2ZEDA 3V38A 3ISXA 3IWWA 1TF9A 1BPNA 4X8IA 4Q7AA 2PE3A 5LRKA 4UEFA 4A38A 5JH9A 4ZYQA 4PXEA 3JRUA 3WT4A 1LCPA 4ZY2A 3B3TA 3D7DA 4A94A 2AFWA 4P4FA 3CPAA 3H8EA 2PRQA 2C6GA 3FF3A 3KASA 2QJ8A 4EFDA 3D7GA 4UIAA 3H8GA 3BXMA 2JEWA 3PBBA 3I1UA 2VL1A 3V7ZA 1TKFA 2ZEGA 2C6PA 2ZEMA 2PJ9A 1VHOA 4MXUA 1F2PA 3HUVA 1TF8A 3WABA 2PJ7A 1LOKA 4OKOA 3FEEA 1M4LA 2C6CA 4R8FA 1ARLA 1YLOA 1CPSA 1R43A 2V8DA 1LFWA 3D7HA 3D67A 4X2TA 2O4HA 4MHPA 3PEIA 4MHZA 5K8PA 2WZNA 1F57A 1Y7EA 4FAIA 4OC5A 4TNUA 5HVFA 1YSJA 3B7IA 4NGPA 2XEJA 5DS0A 3FJUA 4ONWA 1LAPA 5HVGA 2JBKA 2Q4ZA 4JYWA 3B3SA 5LYDA 1FT7A 1XJOA 2XEFA 2O53A 4P6YA 3PBEA 3KQXA 2PJBA 3DLJA 3BI0A 1VGYA 1ZG7A 1LANA 1H8LA 4GM5A 1YW4A 1CP6A 2F7VA 3LMSA 3LWUA 3B3WA 1PCAA 4YU9A 2PJ8A 2GU2A 3B2YA 2NYQA 1HDUA 3B3VA 2PJAA 3SJFA 4W9YA 4OIWA 3WC5A 2QVPA 1R3NA 2ABZA 1UWYA 3PB4X 1ZG8A 3KL9A 1LAMA 2ANPA 3IFEA 3PRTA 4NGSA 3QNVA 2V8VA 4A39A 1ARMA 4BD9A 6CPAA 2PVVA 1OBRA 2IJZA 3B3CA 4Z65A 2POKA 8CPAA 2CTCA 4R6TA 1VHEA 5I4MA 1ZLIA 2HC9A 4A37A 4P4DA 2CTBA 1Z5RA 2NSMA 1Z8LA 3NFZA 1XRYA 4P4EA 5K8MA 2PVWA 4TWEA 2Q51A 2ZELA 2OOTA 4ZI6A 1CG2A 4P4IA 1CPXA 7CPAA 3ISZA 3RAMA 3NH4A 2PJ4A 4UIBA 2AFUA 3SI2A 3WC7A 4R76A 4WWVA 2PJ5A 4NGNA 3FX6A 3NH8A 4X3RA 5D29A 2CF4A 1TKHA 2BO9A 1TXRA 2XEGA 3IIBA 4AXVA 4PXCA 2RB7A 1GYTA 3DGVA 2V8HA 1HEEA 4PQAA 4DUKA 3FECA 4OMEA 4F9VA 1TKJA 4OC1A 3NH5A 3VATA 2PJ3A 4JZ0A 4UEZA 3RZAA 3T8WA 1ELLP 3CPXA 4IK2A 4B6ZA 3S9LA 4NJQA 5F09A 3SJEA 3VH9A 5JM6A 4IAVA 4H2KA 2GLFA 2IQ6A 4KSIA 4CPAA 5ELYA 4ZX9A 3KI9A 3SJXA 3KQZA 3PB8X 4MHYA 3BHXA 3KHXA 3BI1A 2JBJA 2QYVA 1AYEA 1BPMA 2EWBA 2ZEPA 3FH4A 3CDXA 3PB7X 5CPAA 1Q7LA 4UF4A 3L2NA 1ZLHA 3FEDA 2HB6A 3D66A 2IMOA 1JQGA 2PJ2A 4NFRA 2PIZA 1XBUA 5LYFA 1DTDA 1DE4C 3FVLA 1F2OA 2EK8A 3WC6A 1PYTB 4ZY1A 2ZOGA 2PJ1A 4DJLA 4MCSA 4MRIA 1HDQA 3PB9X 5JGFA 1AMPA 4UEEA 2V77A 4F9UA 5IB9A 2PJ6A 2PJ0A 3IEHA 3PFOA 4MMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4U A;  3TX8 A;  3VAR A;  4MCQ A;  2CIJ A;  3PB6 X;  1XMB A;  4F8Z A;  4YWY A;  2PJC A;  3KR4 A;  3IC1 A;  4O23 A;  2ZEH A;  2AFM A;  4WJB A;  4OC3 A;  1XFO A;  1RTQ A;  2GRE A;  4MHN A;  2BOA A;  4LQG A;  3H8F A;  4ZX8 A;  5HVH A;  3K2K A;  1Y0Y A;  4EME A;  1EE3 P;  2AFX A;  3SI1 A;  2ZEE A;  2F8H A;  2J9A A;  5CBM A;  2AFO A;  5LYI A;  4RUH A;  3K9T A;  1IY7 A;  3KHZ A;  4NGT A;  3CT9 A;  3GUX A;  1CP7 A;  3GB0 A;  3N5F A;  4OC4 A;  3KR5 A;  1CX8 A;  3SI0 A;  5LYL A;  4EWT A;  2G9D A;  2V8G A;  4PPZ A;  2Q43 A;  2C1C A;  1VIX A;  3RBU A;  2PIY A;  3SJG A;  2AFZ A;  4FWU A;  4R7M A;  2ZEO A;  3PFE A;  1IGB A;  4PXB A;  3TC8 A;  2DEA A;  4K3N A;  4DYO A;  3S9M A;  5K8N A;  2FVG A;  4OC2 A;  5K8O A;  4MCP A;  4FBE A;  5LRG A;  4NJR A;  4OP4 A;  1BAV A;  3MRU A;  2RFH A;  4MCR A;  3B35 A;  1BLL E;  1YW6 A;  4OID A;  3IO1 A;  3D68 A;  4ZY0 A;  5J1Q A;  1ELM P;  1FNO A;  2WYR A;  4P45 A;  4P4B A;  1KWM A;  5D8N A;  3MN8 A;  1NSA A;  3GLJ A;  1Y0R A;  2GLJ A;  5LRJ A;  2PCU A;  2ZOF A;  3NA6 A;  4IHM A;  3KZW A;  3KGQ A;  2BCO A;  2OR4 A;  4NGQ A;  5HXD A;  4P44 A;  3S9N A;  3D7F A;  2ZEN A;  3IJ3 A;  4P10 A;  4NGR A;  2AFS A;  4OC0 A;  2EK9 A;  5THW A;  2XEI A;  4PXD A;  4NGM A;  1YME A;  4G1P A;  1ZG9 A;  1QQ9 A;  2ZEF A;  4FUU A;  4P4J A;  1CBX A;  1Z2L A;  3FMC A;  2I3C A;  3HLP A;  1QMU A;  2ZED A;  3V38 A;  3ISX A;  3IWW A;  1TF9 A;  1BPN A;  4X8I A;  4Q7A A;  2PE3 A;  5LRK A;  4UEF A;  4A38 A;  5JH9 A;  4ZYQ A;  4PXE A;  3JRU A;  3WT4 A;  1LCP A;  4ZY2 A;  3B3T A;  3D7D A;  4A94 A;  2AFW A;  4P4F A;  3CPA A;  3H8E A;  2PRQ A;  2C6G A;  3FF3 A;  3KAS A;  2QJ8 A;  4EFD A;  3D7G A;  4UIA A;  3H8G A;  3BXM A;  2JEW A;  3PBB A;  3I1U A;  2VL1 A;  3V7Z A;  1TKF A;  2ZEG A;  2C6P A;  2ZEM A;  2PJ9 A;  1VHO A;  4MXU A;  1F2P A;  3HUV A;  1TF8 A;  3WAB A;  2PJ7 A;  1LOK A;  4OKO A;  3FEE A;  1M4L A;  2C6C A;  4R8F A;  1ARL A;  1YLO A;  1CPS A;  1R43 A;  2V8D A;  1LFW A;  3D7H A;  3D67 A;  4X2T A;  2O4H A;  4MHP A;  3PEI A;  4MHZ A;  5K8P A;  2WZN A;  1F57 A;  1Y7E A;  4FAI A;  4OC5 A;  4TNU A;  5HVF A;  1YSJ A;  3B7I A;  4NGP A;  2XEJ A;  5DS0 A;  3FJU A;  4ONW A;  1LAP A;  5HVG A;  2JBK A;  2Q4Z A;  4JYW A;  3B3S A;  5LYD A;  1FT7 A;  1XJO A;  2XEF A;  2O53 A;  4P6Y A;  3PBE A;  3KQX A;  2PJB A;  3DLJ A;  3BI0 A;  1VGY A;  1ZG7 A;  1LAN A;  1H8L A;  4GM5 A;  1YW4 A;  1CP6 A;  2F7V A;  3LMS A;  3LWU A;  3B3W A;  1PCA A;  4YU9 A;  2PJ8 A;  2GU2 A;  3B2Y A;  2NYQ A;  1HDU A;  3B3V A;  2PJA A;  3SJF A;  4W9Y A;  4OIW A;  3WC5 A;  2QVP A;  1R3N A;  2ABZ A;  1UWY A;  3PB4 X;  1ZG8 A;  3KL9 A;  1LAM A;  2ANP A;  3IFE A;  3PRT A;  4NGS A;  3QNV A;  2V8V A;  4A39 A;  1ARM A;  4BD9 A;  6CPA A;  2PVV A;  1OBR A;  2IJZ A;  3B3C A;  4Z65 A;  2POK A;  8CPA A;  2CTC A;  4R6T A;  1VHE A;  5I4M A;  1ZLI A;  2HC9 A;  4A37 A;  4P4D A;  2CTB A;  1Z5R A;  2NSM A;  1Z8L A;  3NFZ A;  1XRY A;  4P4E A;  5K8M A;  2PVW A;  4TWE A;  2Q51 A;  2ZEL A;  2OOT A;  4ZI6 A;  1CG2 A;  4P4I A;  1CPX A;  7CPA A;  3ISZ A;  3RAM A;  3NH4 A;  2PJ4 A;  4UIB A;  2AFU A;  3SI2 A;  3WC7 A;  4R76 A;  4WWV A;  2PJ5 A;  4NGN A;  3FX6 A;  3NH8 A;  4X3R A;  5D29 A;  2CF4 A;  1TKH A;  2BO9 A;  1TXR A;  2XEG A;  3IIB A;  4AXV A;  4PXC A;  2RB7 A;  1GYT A;  3DGV A;  2V8H A;  1HEE A;  4PQA A;  4DUK A;  3FEC A;  4OME A;  4F9V A;  1TKJ A;  4OC1 A;  3NH5 A;  3VAT A;  2PJ3 A;  4JZ0 A;  4UEZ A;  3RZA A;  3T8W A;  1ELL P;  3CPX A;  4IK2 A;  4B6Z A;  3S9L A;  4NJQ A;  5F09 A;  3SJE A;  3VH9 A;  5JM6 A;  4IAV A;  4H2K A;  2GLF A;  2IQ6 A;  4KSI A;  4CPA A;  5ELY A;  4ZX9 A;  3KI9 A;  3SJX A;  3KQZ A;  3PB8 X;  4MHY A;  3BHX A;  3KHX A;  3BI1 A;  2JBJ A;  2QYV A;  1AYE A;  1BPM A;  2EWB A;  2ZEP A;  3FH4 A;  3CDX A;  3PB7 X;  5CPA A;  1Q7L A;  4UF4 A;  3L2N A;  1ZLH A;  3FED A;  2HB6 A;  3D66 A;  2IMO A;  1JQG A;  2PJ2 A;  4NFR A;  2PIZ A;  1XBU A;  5LYF A;  1DTD A;  1DE4 C;  3FVL A;  1F2O A;  2EK8 A;  3WC6 A;  1PYT B;  4ZY1 A;  2ZOG A;  2PJ1 A;  4DJL A;  4MCS A;  4MRI A;  1HDQ A;  3PB9 X;  5JGF A;  1AMP A;  4UEE A;  2V77 A;  4F9U A;  5IB9 A;  2PJ6 A;  2PJ0 A;  3IEH A;  3PFO A;  4MMO A; 
#chains in the Genus database with same CATH topology
 3D4U A;  3TX8 A;  3VAR A;  4MCQ A;  5G1Z A;  2CY2 A;  2CIJ A;  3PB6 X;  1XMB A;  4F8Z A;  4YWY A;  1J4J A;  2PJC A;  3KR4 A;  3IC1 A;  2FIA A;  2ZEH A;  4HNY B;  4O23 A;  4PSX A;  1IID A;  1M4I A;  2EO8 A;  2Z11 A;  2CNS A;  4KOT A;  2AFM A;  4WJB A;  4OC3 A;  2HUZ A;  2PDO A;  1XFO A;  4XPK A;  3PFO A;  4UFV A;  2EBJ A;  2KCW A;  4B12 A;  4CGO A;  2FCK A;  2ZXV A;  1RTQ A;  2GRE A;  5G21 A;  4MHN A;  2BOA A;  4OAE A;  2BL1 A;  4LQG A;  4MFJ A;  4MFK A;  2YNE A;  3H8F A;  3W6X A;  4ZX8 A;  3FYN A;  1L0C A;  3K2K A;  5HVH A;  2CNM A;  1Y0Y A;  4EME A;  5ISV A;  1EE3 P;  2AFX A;  5JQ4 A;  3SI1 A;  2ZEE A;  3TTH A;  4MBU A;  2I00 A;  2F8H A;  2WPW A;  1KUY A;  2J9A A;  1Z8X A;  2I79 A;  4M6H A;  5CBM A;  2AFO A;  5LYI A;  3D3S A;  4RUH A;  3K9T A;  1IY7 A;  3KHZ A;  4NGT A;  2OZG A;  3CT9 A;  3GUX A;  2PR8 A;  1CP7 A;  3GB0 A;  3N5F A;  3A9L A;  4OC4 A;  1IYL A;  5F49 A;  4BIN A;  3KR5 A;  1CX8 A;  2BSW A;  3R96 A;  4CAV A;  3SI0 A;  2A4N A;  3GYA A;  5LYL A;  4EWT A;  2G9D A;  2V8G A;  4KSF A;  2BEI A;  4PPZ A;  4DNC A;  1BOB A;  3R9G A;  2Q43 A;  3D2P A;  4UFX A;  2C1C A;  1VIX A;  2QIR A;  3GKR A;  3RBU A;  2PIY A;  3SJG A;  2Z3M A;  4A31 A;  4CYQ A;  3EC4 A;  4J3G A;  4HNX B;  2AFZ A;  4U9Z A;  5C88 A;  4FWU A;  4R7M A;  2ZEO A;  2VEZ A;  3PFE A;  4JXR A;  1IGB A;  4PXB A;  4M85 A;  2OB0 A;  4UCP A;  2QML A;  5HMN A;  2R98 A;  3TC8 A;  4R87 A;  2DEA A;  4K3N A;  4A2Z A;  4DYO A;  4QB9 A;  4U5Y A;  3S9M A;  3W91 A;  4LQ6 A;  5C82 A;  3RO0 A;  4CAE A;  5K8N A;  2FVG A;  4OC2 A;  3CXP A;  2YNC C;  4MCP A;  4PSW A;  4X5K A;  5LRG A;  4NJR A;  4FBE A;  4YFJ A;  2RC4 A;  1K4J A;  3JVN A;  2H5M A;  4OP4 A;  4QC6 A;  4CYN A;  1BAV A;  3H4Q A;  4B5P A;  3MRU A;  2Q4Y A;  2RFH A;  3IWG A;  4MCR A;  3LOD A;  3B35 A;  4UA3 A;  2X7B A;  1BLL E;  3F0A A;  1YW6 A;  3EFA A;  4KUA A;  4OID A;  4E2A A;  2FT0 A;  3IO1 A;  4OAD A;  4AVC A;  4M6G A;  3D68 A;  4ZY0 A;  1YLE A;  5J1Q A;  2Z3K A;  1ELM P;  1FNO A;  2WYR A;  2ZW6 A;  3PGP A;  4P45 A;  1S60 A;  4P4B A;  1MJ9 A;  2B5G A;  2YNC A;  1KWM A;  4E8O A;  2Y0M A;  5D8N A;  2FS5 A;  3MN8 A;  1NSA A;  4FD4 A;  3GLJ A;  1Y0R A;  2GLJ A;  4KLW A;  5LRJ A;  4H6U A;  5A28 A;  2PCU A;  2ZOF A;  1XF8 A;  4JXQ A;  1PUA A;  2QEC A;  5EBV A;  3NA6 A;  2CNT A;  1M44 A;  4IHM A;  1IU8 A;  3KZW A;  3KGQ A;  2BCO A;  2OR4 A;  4NGQ A;  3PP9 A;  3EY5 A;  4KOR A;  5HXD A;  4H6Z A;  2DXQ A;  4P44 A;  3S9N A;  4KOV A;  1A2Z A;  3D7F A;  2ZEN A;  2Q4V A;  3LD2 A;  3IJ3 A;  4P10 A;  1YR0 A;  3IGR A;  3V8I A;  4FD6 A;  4C2Z A;  4NGR A;  2D4P A;  2AFS A;  4OC0 A;  4MI4 A;  2EK9 A;  5DWM A;  5THW A;  4A95 A;  2XEI A;  1S3Z A;  4PXD A;  3H5Z A;  4NGM A;  1YME A;  4AVB A;  1ON0 A;  4G1P A;  2FXF A;  3RNZ A;  2JDC A;  1ZG9 A;  4LX9 A;  1QQ9 A;  2ZEF A;  4FUU A;  2EVN A;  2P6G A;  4KOX A;  1RO5 A;  4P4J A;  3R9F A;  3LAC A;  1CBX A;  2O28 A;  1Z2L A;  3FMC A;  4RN7 A;  2I3C A;  1IB1 E;  2DF5 A;  4RI1 A;  3HLP A;  1U6M A;  2Z3N A;  4C68 A;  2VI7 A;  1MK4 A;  1QMU A;  2ZED A;  1QST A;  3R95 A;  3PZJ A;  4HPS A;  4CGP A;  1Q2Y A;  3S6K A;  3V38 A;  3ISX A;  3IWW A;  1TF9 A;  1BPN A;  3CXQ A;  4CRZ B;  4X8I A;  2EUI A;  3EO4 A;  4Q7A A;  4XPD B;  2PE3 A;  5LRK A;  4UEF A;  4A38 A;  5I0C A;  1Z9U A;  2OH1 A;  5JH9 A;  4KOW A;  4ZYQ A;  3P2F A;  2Q7S A;  4CRY B;  4PXE A;  3TT2 A;  1XOV A;  4MY0 A;  1KZF A;  3GIU A;  3JRU A;  4KS9 A;  1LCP A;  3WT4 A;  4ZY2 A;  2REF A;  2DPS A;  1KUX A;  3DDD A;  3R9E A;  3B3T A;  3D7D A;  1MJB A;  4A94 A;  4ONU A;  4B10 A;  2P6E A;  2B58 A;  2P0W A;  2Z3O A;  4BBH A;  2AFW A;  4P4F A;  2VBQ A;  4IF5 A;  1YK3 A;  3TO6 A;  3CPA A;  2ATR A;  3H8E A;  4F0Y A;  1V0C A;  3S6F A;  2PRQ A;  2C6G A;  3FF3 A;  3T90 A;  3KAS A;  2QJ8 A;  4C2Y A;  4EFD A;  1B87 A;  1UFH A;  4A30 A;  4Q36 A;  1TIQ A;  4NEX A;  3D7G A;  5E96 A;  3TOA A;  1NSL A;  4UIA A;  3FXT A;  3H8G A;  2YND A;  3BXM A;  2JEW A;  3PBB A;  1VHS A;  1P4N A;  3I1U A;  4NCZ A;  2VL1 A;  3V7Z A;  3FB3 A;  1TKF A;  2ZEG A;  1IYK A;  2C6P A;  4MJ8 A;  3DR6 A;  5AG4 A;  4XNH C;  2PR1 A;  5F48 A;  3K9U A;  4B13 A;  1NMT A;  2B4B A;  2ZEM A;  4E0A A;  2PJ9 A;  2IL4 A;  1VHO A;  4MXU A;  1F2P A;  3CZX A;  3I3G A;  4KVM E;  3HUV A;  1XEB A;  1TF8 A;  3BJ8 A;  1Q2D A;  4UCM A;  4A32 A;  3TOB A;  4BMH A;  3WAB A;  4MFZ A;  1Y7R A;  4UWI A;  3VWD A;  2PJ7 A;  1LOK A;  4NSQ A;  2FE7 A;  5EMI A;  4CGM A;  3N7Z A;  3BLN A;  4GS4 A;  4OKO A;  4II9 A;  3FEE A;  1M4L A;  2C6C A;  5DWN A;  4XPL A;  4R8F A;  5F47 A;  1SQH A;  5AGE A;  1ARL A;  4L8A A;  1YLO A;  1CPS A;  1R43 A;  2V8D A;  1LFW A;  3D8P A;  3D7H A;  3D67 A;  4X2T A;  4KVX A;  1QSN A;  2O4H A;  2Q04 A;  3TCV A;  4LUA A;  4MHP A;  4OLL A;  2ARH A;  3PEI A;  3F8K A;  5BWA B;  4MHZ A;  2B4D B;  2CXA A;  4CS0 B;  5K8P A;  4NF1 A;  2P6F A;  2WZN A;  1F57 A;  1Y7E A;  4FAI A;  3IU2 A;  4OC5 A;  4TNU A;  5HVF A;  1YSJ A;  1BO4 A;  1QSR A;  3R1K A;  4UCN A;  4CYO A;  4MHD A;  4MY3 A;  3MGD A;  3B7I A;  2JDD A;  4IUS A;  1N71 A;  4HNW B;  5KTC A;  4NGP A;  2Z3P A;  2OU2 A;  2XEJ A;  4B5P B;  5DS0 A;  2R7H A;  3FJU A;  1M4D A;  4ONW A;  4AG9 A;  1LAP A;  5HVG A;  2PC1 A;  3FIX A;  2JBK A;  1YGH A;  4AB7 A;  2Q4Z A;  4JD6 A;  4JYW A;  3B3S A;  5LYD A;  3TE4 A;  1FT7 A;  1QSM A;  1XJO A;  2Q0Y A;  2XEF A;  1JWQ A;  3FRM A;  2O53 A;  4QBJ A;  4P6Y A;  3PBE A;  2B5G B;  3KQX A;  3QAH A;  2PJB A;  2ZW4 A;  5J8F A;  4JJX A;  4CAF A;  4CGL A;  2Z0Z A;  3BJ7 A;  3DLJ A;  3BI0 A;  4KOU A;  4HKF A;  1NE9 A;  4R3L A;  1X10 A;  1VGY A;  1ZG7 A;  4F0X A;  1LAN A;  2Q44 A;  2J8M A;  1H8L A;  4GM5 A;  1M1D A;  1YW4 A;  1CP6 A;  2F7V A;  1XMT A;  1YVK A;  5AG7 A;  4F6A A;  3LMS A;  3LWU A;  3B3W A;  4ZBG A;  1PCA A;  3IWE A;  4YU9 A;  4B11 A;  2PJ8 A;  2GU2 A;  2R1I A;  3B2Y A;  2NYQ A;  5HH1 A;  1HDU A;  3S6G A;  1Q2C A;  4Y49 B;  2VXK A;  3B3V A;  3FBU A;  1X12 A;  4PV6 A;  2PJA A;  4NXY A;  3SJF A;  4RS2 A;  4W9Y A;  1YX0 A;  4OIW A;  3WC5 A;  2QVP A;  1R3N A;  1RXT A;  2ABZ A;  1UWY A;  2ZW7 A;  4C7H A;  3G3S A;  4MFP A;  3PB4 X;  1VKC A;  1ZG8 A;  4KUB A;  4PK3 A;  4R57 A;  3KL9 A;  1LAM A;  2ANP A;  4CAX A;  2OZU A;  3IFE A;  1IOF A;  3PRT A;  5GCN A;  5K8O A;  4NGS A;  5G22 A;  1WK4 A;  3QNV A;  4EVY A;  5A27 A;  2JEV A;  2V8V A;  4A39 A;  2C27 A;  2ZPA A;  5F46 A;  1ARM A;  4BD9 A;  6CPA A;  2PVV A;  4L89 A;  1OBR A;  2IJZ A;  4R3K A;  4AG7 A;  3JTK A;  3B3C A;  4Z65 A;  1R57 A;  3WR7 A;  2POK A;  8CPA A;  3TO9 A;  3RYO A;  2CTC A;  3SXN A;  4AVA A;  2ZW5 A;  2PSW A;  2VZY A;  4R6T A;  1Y9W A;  1VHE A;  4KVO E;  5I4M A;  1ZLI A;  4FD7 A;  4I49 A;  5AG5 A;  2HC9 A;  4A37 A;  4PK2 A;  4P4D A;  2CTB A;  5H86 A;  3B8G A;  1Z5R A;  5H84 A;  2YGW A;  3IU1 A;  2NSM A;  2D4O A;  1Z8L A;  2DPT A;  3NFZ A;  3P2H A;  1XRY A;  4P4E A;  5K8M A;  2PVW A;  4TWE A;  4C7I A;  1M4G A;  2Q51 A;  2ZEL A;  4KOS A;  2AE6 A;  2OZH A;  2AJ6 A;  1ZO0 A;  2WPX A;  2OOT A;  3W6S A;  4B14 A;  4ZI6 A;  1Z8W A;  1CG2 A;  4JWP A;  4P4I A;  4CAW A;  3QB8 A;  1CPX A;  7CPA A;  3TFY A;  3ISZ A;  1GHE A;  1FY7 A;  3RAM A;  4CGN A;  2K5T A;  3NH4 A;  3S6H A;  1PU9 A;  2PJ4 A;  2J8R A;  2BUE A;  4KLV A;  4UIB A;  2GAN A;  3DR8 A;  4KOY A;  5FVJ A;  3DSB A;  3I9S A;  2AFU A;  3SI2 A;  3C26 A;  3WC7 A;  4R76 A;  4WWV A;  1OZP A;  3NE7 A;  2ODF A;  2PJ5 A;  1Z8T A;  4NGN A;  5JPH A;  3FX6 A;  3NH8 A;  1IOI A;  4UFW A;  4X3R A;  4YRH A;  5D29 A;  2CF4 A;  1TKH A;  2BO9 A;  1TXR A;  2Z3L A;  4H89 A;  2XEG A;  3IIB A;  2B3U A;  4AXV A;  4PXC A;  2RB7 A;  1GYT A;  3DGV A;  2V8H A;  1HEE A;  2REE A;  5J8C A;  4PQA A;  4DUK A;  3FEC A;  2GE3 A;  4OME A;  2G3A A;  4KSA A;  4F9V A;  1AUG A;  4R9M A;  1QSO A;  1TKJ A;  4OC1 A;  1Y9K A;  4XNH B;  2VZZ A;  4KZT A;  3NH5 A;  3VAT A;  2PJ3 A;  5G20 A;  3NE8 A;  5EC4 A;  4JZ0 A;  4UEZ A;  3RZA A;  3T8W A;  5IV0 A;  2B4D A;  1ELL P;  3CPX A;  4IK2 A;  3T9Y A;  4B6Z A;  3JUW A;  4B5O A;  4UWJ A;  3SHP A;  3S9L A;  5KTD A;  4NJQ A;  1I21 A;  2Z10 A;  3GY9 A;  5F09 A;  1YQE A;  1S7F A;  3FNC A;  1S7L A;  4ORF A;  3SJE A;  3VH9 A;  2G3T A;  5KTA A;  5JM6 A;  4IAV A;  4H2K A;  2GLF A;  2IQ6 A;  4KSI A;  4CPA A;  4Q38 A;  5ELY A;  3TO7 A;  4ZX9 A;  1XE4 A;  2NMT A;  2PQ8 A;  2VQY A;  3KI9 A;  1S7N A;  3KQZ A;  3PB8 X;  4MHY A;  3BHX A;  3SJX A;  1IIC A;  3KHX A;  2R8V A;  1MJA A;  2FL4 A;  1YVO A;  3BI1 A;  1LRZ A;  4CYP A;  2JBJ A;  2HV2 A;  4C2X A;  2QYV A;  3E0K A;  1CJW A;  1AYE A;  3UY5 A;  1B6B A;  3D2M A;  1BPM A;  4U9Y A;  2GIV A;  2EWB A;  2ZEP A;  3FH4 A;  2J8N A;  3CDX A;  3PB7 X;  4Y49 C;  5CPA A;  1Q7L A;  4UF4 A;  2HQY A;  3L2N A;  1XIX A;  3QAY A;  4QVT A;  1P0H A;  1ZLH A;  3FED A;  2HB6 A;  3D66 A;  4MFQ A;  3CXS A;  1I1D A;  2JLM A;  2IMO A;  1JQG A;  1KUV A;  5IB0 A;  2PJ2 A;  4M3S A;  2GFQ A;  4NFR A;  1Z4R A;  2PIZ A;  1XBU A;  4XPD C;  5AG6 A;  1DTD A;  3SXO A;  4MFL A;  1DE4 C;  5LYF A;  3FVL A;  3VWE A;  4M6I A;  1F2O A;  2EK8 A;  3EXN A;  3OWC A;  3WC6 A;  2B3V A;  1PYT B;  1S7K A;  2FSR A;  4ZY1 A;  3DNS A;  4GXH A;  3ZJ0 A;  5IX3 A;  1CM0 A;  2ZOG A;  2PRB A;  2G0B A;  2WSA A;  2PJ1 A;  4QUS A;  2Q7B A;  4K30 A;  1Z4E A;  2WUU A;  4MCS A;  4DJL A;  4YGO A;  4FD5 A;  1S5K A;  4MRI A;  3ZZI A;  1HDQ A;  3KKW A;  3PB9 X;  5JGF A;  1AMP A;  2F5I A;  1YRE A;  1WWZ A;  4UEE A;  2V77 A;  4JLY A;  4A33 A;  4F9U A;  5CNP A;  3F5B A;  5IB9 A;  4ZGY B;  2PJ6 A;  4UBR A;  2PJ0 A;  3IEH A;  3G8W A;  4MMO A;  2FIW A;  1I12 A; 
#chains in the Genus database with same CATH homology
 3D4U A;  3TX8 A;  3VAR A;  4MCQ A;  2CIJ A;  3PB6 X;  1XMB A;  4F8Z A;  4YWY A;  2PJC A;  3KR4 A;  3IC1 A;  4O23 A;  2ZEH A;  2AFM A;  4WJB A;  4OC3 A;  1XFO A;  1RTQ A;  2GRE A;  4MHN A;  2BOA A;  4LQG A;  3H8F A;  4ZX8 A;  5HVH A;  3K2K A;  1Y0Y A;  4EME A;  1EE3 P;  2AFX A;  3SI1 A;  2ZEE A;  2F8H A;  2J9A A;  5CBM A;  2AFO A;  5LYI A;  4RUH A;  3K9T A;  1IY7 A;  3KHZ A;  4NGT A;  3CT9 A;  3GUX A;  1CP7 A;  3GB0 A;  3N5F A;  4OC4 A;  3KR5 A;  1CX8 A;  3SI0 A;  5LYL A;  4EWT A;  2G9D A;  2V8G A;  4PPZ A;  2Q43 A;  2C1C A;  1VIX A;  3RBU A;  2PIY A;  3SJG A;  2AFZ A;  4FWU A;  4R7M A;  2ZEO A;  3PFE A;  1IGB A;  4PXB A;  3TC8 A;  2DEA A;  4K3N A;  4DYO A;  3S9M A;  5K8N A;  2FVG A;  4OC2 A;  5K8O A;  4MCP A;  4FBE A;  5LRG A;  4NJR A;  4OP4 A;  1BAV A;  3MRU A;  2RFH A;  4MCR A;  3B35 A;  1BLL E;  1YW6 A;  4OID A;  3IO1 A;  3D68 A;  4ZY0 A;  5J1Q A;  1ELM P;  1FNO A;  2WYR A;  4P45 A;  4P4B A;  1KWM A;  5D8N A;  3MN8 A;  1NSA A;  3GLJ A;  1Y0R A;  2GLJ A;  5LRJ A;  2PCU A;  2ZOF A;  3NA6 A;  4IHM A;  3KZW A;  3KGQ A;  2BCO A;  2OR4 A;  4NGQ A;  5HXD A;  4P44 A;  3S9N A;  3D7F A;  2ZEN A;  3IJ3 A;  4P10 A;  4NGR A;  2AFS A;  4OC0 A;  2EK9 A;  5THW A;  2XEI A;  4PXD A;  4NGM A;  1YME A;  4G1P A;  1ZG9 A;  1QQ9 A;  2ZEF A;  4FUU A;  4P4J A;  1CBX A;  1Z2L A;  3FMC A;  2I3C A;  3HLP A;  1QMU A;  2ZED A;  3V38 A;  3ISX A;  3IWW A;  1TF9 A;  1BPN A;  4X8I A;  4Q7A A;  2PE3 A;  5LRK A;  4UEF A;  4A38 A;  5JH9 A;  4ZYQ A;  4PXE A;  3JRU A;  3WT4 A;  1LCP A;  4ZY2 A;  3B3T A;  3D7D A;  4A94 A;  2AFW A;  4P4F A;  3CPA A;  3H8E A;  2PRQ A;  2C6G A;  3FF3 A;  3KAS A;  2QJ8 A;  4EFD A;  3D7G A;  4UIA A;  3H8G A;  3BXM A;  2JEW A;  3PBB A;  3I1U A;  2VL1 A;  3V7Z A;  1TKF A;  2ZEG A;  2C6P A;  2ZEM A;  2PJ9 A;  1VHO A;  4MXU A;  1F2P A;  3HUV A;  1TF8 A;  3WAB A;  2PJ7 A;  1LOK A;  4OKO A;  3FEE A;  1M4L A;  2C6C A;  4R8F A;  1ARL A;  1YLO A;  1CPS A;  1R43 A;  2V8D A;  1LFW A;  3D7H A;  3D67 A;  4X2T A;  2O4H A;  4MHP A;  3PEI A;  4MHZ A;  5K8P A;  2WZN A;  1F57 A;  1Y7E A;  4FAI A;  4OC5 A;  4TNU A;  5HVF A;  1YSJ A;  3B7I A;  4NGP A;  2XEJ A;  5DS0 A;  3FJU A;  4ONW A;  1LAP A;  5HVG A;  2JBK A;  2Q4Z A;  4JYW A;  3B3S A;  5LYD A;  1FT7 A;  1XJO A;  2XEF A;  2O53 A;  4P6Y A;  3PBE A;  3KQX A;  2PJB A;  3DLJ A;  3BI0 A;  1VGY A;  1ZG7 A;  1LAN A;  1H8L A;  4GM5 A;  1YW4 A;  1CP6 A;  2F7V A;  3LMS A;  3LWU A;  3B3W A;  1PCA A;  4YU9 A;  2PJ8 A;  2GU2 A;  3B2Y A;  2NYQ A;  1HDU A;  3B3V A;  2PJA A;  3SJF A;  4W9Y A;  4OIW A;  3WC5 A;  2QVP A;  1R3N A;  2ABZ A;  1UWY A;  3PB4 X;  1ZG8 A;  3KL9 A;  1LAM A;  2ANP A;  3IFE A;  3PRT A;  4NGS A;  3QNV A;  2V8V A;  4A39 A;  1ARM A;  4BD9 A;  6CPA A;  2PVV A;  1OBR A;  2IJZ A;  3B3C A;  4Z65 A;  2POK A;  8CPA A;  2CTC A;  4R6T A;  1VHE A;  5I4M A;  1ZLI A;  2HC9 A;  4A37 A;  4P4D A;  2CTB A;  1Z5R A;  2NSM A;  1Z8L A;  3NFZ A;  1XRY A;  4P4E A;  5K8M A;  2PVW A;  4TWE A;  2Q51 A;  2ZEL A;  2OOT A;  4ZI6 A;  1CG2 A;  4P4I A;  1CPX A;  7CPA A;  3ISZ A;  3RAM A;  3NH4 A;  2PJ4 A;  4UIB A;  2AFU A;  3SI2 A;  3WC7 A;  4R76 A;  4WWV A;  2PJ5 A;  4NGN A;  3FX6 A;  3NH8 A;  4X3R A;  5D29 A;  2CF4 A;  1TKH A;  2BO9 A;  1TXR A;  2XEG A;  3IIB A;  4AXV A;  4PXC A;  2RB7 A;  1GYT A;  3DGV A;  2V8H A;  1HEE A;  4PQA A;  4DUK A;  3FEC A;  4OME A;  4F9V A;  1TKJ A;  4OC1 A;  3NH5 A;  3VAT A;  2PJ3 A;  4JZ0 A;  4UEZ A;  3RZA A;  3T8W A;  1ELL P;  3CPX A;  4IK2 A;  4B6Z A;  3S9L A;  4NJQ A;  5F09 A;  3SJE A;  3VH9 A;  5JM6 A;  4IAV A;  4H2K A;  2GLF A;  2IQ6 A;  4KSI A;  4CPA A;  5ELY A;  4ZX9 A;  3KI9 A;  3SJX A;  3KQZ A;  3PB8 X;  4MHY A;  3BHX A;  3KHX A;  3BI1 A;  2JBJ A;  2QYV A;  1AYE A;  1BPM A;  2EWB A;  2ZEP A;  3FH4 A;  3CDX A;  3PB7 X;  5CPA A;  1Q7L A;  4UF4 A;  3L2N A;  1ZLH A;  3FED A;  2HB6 A;  3D66 A;  2IMO A;  1JQG A;  2PJ2 A;  4NFR A;  2PIZ A;  1XBU A;  5LYF A;  1DTD A;  1DE4 C;  3FVL A;  1F2O A;  2EK8 A;  3WC6 A;  1PYT B;  4ZY1 A;  2ZOG A;  2PJ1 A;  4DJL A;  4MCS A;  4MRI A;  1HDQ A;  3PB9 X;  5JGF A;  1AMP A;  4UEE A;  2V77 A;  4F9U A;  5IB9 A;  2PJ6 A;  2PJ0 A;  3IEH A;  3PFO A;  4MMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...