1F2OA

Crystal structure of the streptomyces griseus aminopeptidase complexed with l-leucine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Interactions of Streptomyces griseus aminopeptidase with amino acid reaction products and their implications toward a catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
total genus 107
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1f2oA00
4ZI6A 3S9NA 2ZEEA 2PVWA 4IHMA 1F57A 3T8WA 3IC1A 3NH8A 3FECA 1XRYA 3KQXA 4ZYQA 2PIZA 3CT9A 4EMEA 4LQGA 3FVLA 2GREA 3H8GA 1LAMA 2C6PA 3SI2A 1EE3P 1TF9A 2ABZA 2IJZA 2J9AA 2PJ5A 3IO1A 5JM6A 2BOAA 1PCAA 3H8EA 1ZG7A 3QNVA 4P4IA 3VARA 3WC6A 1CPXA 4P4FA 3B7IA 2AFXA 3D67A 3KASA 4FUUA 2FVGA 2PVVA 2ZEGA 4DUKA 1YW6A 3D66A 2ZEMA 1ZLHA 2ZOGA 3WC7A 3TX8A 5I4MA 4MHPA 3SJFA 4FBEA 4AXVA 4ONWA 4UF4A 4H2KA 5LYFA 3GB0A 5D8NA 2WYRA 3CPXA 2V8GA 3SI0A 4R6TA 1HEEA 3WABA 2PRQA 3KL9A 4P4DA 3SJEA 2CIJA 2PJCA 1F2OA 2ZEPA 2AFMA 1IY7A 3BXMA 5ELYA 5LRKA 4OKOA 4TNUA 4MMOA 2EK9A 2PJ4A 1FT7A 4OP4A 1BAVA 1AMPA 4EFDA 3D4UA 3LWUA 1TF8A 4OMEA 4UIBA 4F9UA 1JQGA 6CPAA 3B2YA 3PB8X 4NGNA 4OC5A 3KI9A 1R43A 1TKHA 1YMEA 3S9LA 2HC9A 2ZELA 3D7GA 2ZOFA 3SJXA 4DJLA 2PJ2A 5HVGA 4Q7AA 2GLJA 3JRUA 4NFRA 2QYVA 2XEJA 3NA6A 2PJ7A 4P4JA 5CPAA 5LYDA 2C1CA 3VATA 1BPNA 5K8NA 2G9DA 3DGVA 3RBUA 4A39A 2XEFA 4NGRA 4JZ0A 3S9MA 3WT4A 1Z5RA 4X8IA 1TXRA 3GUXA 3N5FA 2GU2A 1CBXA 2CF4A 1ZG9A 4UEEA 4WWVA 4PPZA 1QMUA 4B6ZA 1Q7LA 3H8FA 4P10A 5HXDA 4PQAA 2PJ0A 3LMSA 3BHXA 4OC3A 2Q43A 1R3NA 5JGFA 4MHYA 5LYIA 1DE4C 3IJ3A 2ZEFA 4PXBA 1YSJA 4R76A 2EK8A 1XBUA 1BPMA 3NFZA 1CP6A 3PBBA 4OC4A 1LANA 1VGYA 2IQ6A 3WC5A 2JBKA 1Y7EA 2EWBA 4PXEA 1LOKA 4NJRA 1UWYA 4ZY1A 4F9VA 3HUVA 2F8HA 2JBJA 1FNOA 2PJ8A 1HDQA 1HDUA 5HVHA 1OBRA 3B3SA 4MRIA 4YWYA 1QQ9A 2RB7A 3GLJA 4A37A 1VHOA 4UIAA 4K3NA 3D7DA 2ZEDA 3IIBA 1XFOA 4P4EA 4PXDA 2WZNA 3PFOA 2ANPA 3SJGA 3B3CA 2JEWA 4X3RA 2AFOA 3MRUA 5IB9A 4NGSA 3PB4X 4G1PA 1VHEA 4KSIA 4R8FA 4P6YA 4IAVA 2QVPA 2DEAA 1DTDA 4DYOA 3FX6A 3ISZA 4ZY2A 1ELLP 3BI0A 2PCUA 5LYLA 3D68A 4MCQA 2O53A 3FF3A 2OOTA 3PBEA 3K2KA 3CPAA 3PB9X 2V8DA 3L2NA 4O23A 4NGPA 3KHXA 4IK2A 4ZY0A 3VH9A 2C6GA 1M4LA 4P45A 2Q4ZA 3K9TA 3B3WA 4TWEA 3B35A 3I1UA 5LRJA 2ZEOA 5CBMA 3IFEA 1TKJA 3BI1A 4NGQA 1VIXA 2V77A 2XEIA 5DS0A 4OC1A 2V8HA 5LRGA 1LCPA 3NH5A 1LAPA 5D29A 2PJ6A 3FEDA 1XMBA 1CPSA 3KR5A 4YU9A 3PEIA 4FAIA 1ARLA 4GM5A 1RTQA 2HB6A 4NJQA 4PXCA 3PB6X 1GYTA 1YW4A 2AFWA 5J1QA 2OR4A 3HLPA 2RFHA 4UEZA 4P4BA 1LFWA 2PIYA 2QJ8A 4MCSA 4MHNA 2AFSA 3B3TA 4F8ZA 7CPAA 3MN8A 1Y0RA 1CX8A 5K8PA 2ZEHA 2C6CA 4ZX9A 1PYTB 4MCPA 3V7ZA 3FMCA 4OC0A 4R7MA 1XJOA 3CDXA 1ZLIA 4W9YA 5HVFA 2BO9A 2CTBA 3PFEA 3KQZA 2CTCA 2PE3A 2PJ1A 3IWWA 2V8VA 5JH9A 3IEHA 4P44A 3D7HA 4OC2A 1TKFA 4UEFA 3D7FA 3RZAA 3TC8A 4MHZA 2PJAA 4A94A 3FJUA 4WJBA 4JYWA 4MCRA 4BD9A 1F2PA 5F09A 4FWUA 2PJ9A 1IGBA 4Z65A 4NGTA 3B3VA 4OIWA 1YLOA 3DLJA 2ZENA 1BLLE 2PJ3A 8CPAA 2I3CA 4A38A 4EWTA 3KHZA 1Z8LA 1AYEA 2NYQA 2BCOA 3KR4A 4ZX8A 1ARMA 1KWMA 2AFUA 1ELMP 2AFZA 2O4HA 3FH4A 1NSAA 3FEEA 1ZG8A 2XEGA 5K8MA 4MXUA 4OIDA 1Y0YA 3RAMA 2PJBA 5K8OA 1Z2LA 2VL1A 3KZWA 2NSMA 3PRTA 1H8LA 4CPAA 2POKA 5THWA 4RUHA 2GLFA 3SI1A 3V38A 2Q51A 3PB7X 1CG2A 1CP7A 3NH4A 3ISXA 2IMOA 4NGMA 3KGQA 2F7VA 4X2TA
chains in the Genus database with same CATH superfamily
4ZI6A 3S9NA 1Q2YA 2G0BA 2O28A 4QC6A 2Q44A 1UFHA 2FS5A 2OB0A 2ZEEA 4GXHA 4B13A 2PVWA 4IHMA 3B8GA 1F57A 3T8WA 5A27A 3IC1A 3TO7A 4CAEA 2YNCC 2HV2A 2BSWA 3NH8A 5KTAA 1I21A 4KUAA 4JXRA 4C68A 1MK4A 3FECA 1XRYA 1Y7RA 4Q38A 5AG4A 2Z11A 3KQXA 4ZYQA 2PIZA 2G3AA 3PGPA 1IYKA 3CT9A 3MGDA 1XIXA 4EMEA 4LQGA 2B5GB 4HNYB 3FVLA 2GREA 3H8GA 1K4JA 1LAMA 1BOBA 4XNHC 1VKCA 1NSLA 2C6PA 2FT0A 3SI2A 4R3LA 1EE3P 4C2ZA 1TF9A 2ABZA 2IJZA 2J9AA 2PJ5A 3IO1A 5JM6A 2BOAA 2VXKA 2JLMA 2IL4A 1PCAA 3H8EA 1ZG7A 3QNVA 4FD7A 2KCWA 4UFXA 4CRYB 4P4IA 3VARA 2DXQA 3LD2A 3WC6A 1CPXA 4P4FA 2J8NA 3B7IA 2AFXA 3D67A 3KASA 4CAVA 1S7FA 4H6ZA 5AG6A 3W6SA 4P4EA 2QECA 4HKFA 4FUUA 5GCNA 1Z8XA 2FVGA 2FXFA 5EBVA 2OZUA 1VHSA 1I12A 2PVVA 3TCVA 4F6AA 2ZEGA 2HQYA 1YW6A 2BEIA 4DUKA 3D66A 1Q2CA 2ZEMA 1ZLHA 2ZOGA 4MY0A 3SXNA 2REFA 3WC7A 3TX8A 5I4MA 4MHPA 3SJFA 4FBEA 4AXVA 3E0KA 4ONWA 4UF4A 4KLWA 5AGEA 4H2KA 4E0AA 2YNEA 1RXTA 5LYFA 1Q2DA 2Q4VA 3P2FA 3GB0A 4HNWB 3DR6A 5D8NA 5G22A 2AE6A 2WYRA 3CPXA 3LACA 2V8GA 3SI0A 1KUXA 4B5PB 4R6TA 1HEEA 2ZW7A 3WABA 2PRQA 1IU8A 1KUYA 4KVOE 3KL9A 4QUSA 4CGPA 4P4DA 4YFJA 3SJEA 4OLLA 2CIJA 2PJCA 1F2OA 2ZEPA 2AFMA 4M6HA 1IY7A 3BXMA 2YGWA 4JD6A 4KLVA 4OKOA 4M6GA 4L89A 5ELYA 4TNUA 4AVCA 5LRKA 4MMOA 2EK9A 2PJ4A 1FT7A 4AB7A 4OP4A 4GS4A 4IUSA 1BAVA 4U5YA 1PU9A 1X12A 4LUAA 4A30A 1MJBA 2JDDA 1M1DA 4AG7A 1Z9UA 2GFQA 2P6FA 4MBUA 2B4DA 3F8KA 3PP9A 1AMPA 3D3SA 4MHDA 4EFDA 3D4UA 5KTCA 2FIAA 3LWUA 1TF8A 3DDDA 4OMEA 4ZGYB 4MI4A 4UIBA 4BINA 2X7BA 3W91A 1IICA 4UCMA 2PR8A 4F9UA 4CYOA 4RS2A 1JQGA 2Z3NA 6CPAA 3B2YA 3PB8X 4NGNA 1XF8A 3CXPA 4FD6A 4OC5A 3FBUA 3KI9A 1R43A 3CXSA 4CGOA 1TKHA 1YMEA 3S9LA 2HC9A 4JXQA 4ORFA 2ZELA 3D7GA 3G8WA 1P0HA 2ZOFA 3SJXA 3SXOA 4DJLA 2PJ2A 4B12A 5HVGA 4Q7AA 1A2ZA 1BO4A 2GLJA 4ZBGA 2VBQA 3JRUA 4NFRA 3K9UA 4MJ8A 2QYVA 3W6XA 2Q7SA 1S3ZA 2XEJA 2PJ7A 3NA6A 4P4JA 5CPAA 5G20A 5LYDA 2C1CA 3VATA 1BPNA 1IOIA 2G9DA 2EBJA 5K8NA 3DGVA 4KZTA 3RBUA 4A39A 3TT2A 2XEFA 4JWPA 4NGRA 4JZ0A 3S9MA 3WT4A 1Z5RA 3LODA 4X8IA 4EVYA 5J8FA 4MFZA 2Q0YA 3KKWA 2FL4A 1TXRA 3GUXA 4R57A 3N5FA 2GU2A 5F46A 1CBXA 4OAEA 2CF4A 2B5GA 1ZG9A 4UEEA 2WPWA 4XPKA 2VI7A 4PPZA 4WWVA 1QMUA 5IX3A 2VZYA 4XPLA 4B6ZA 2Z10A 4LX9A 3BJ7A 1QSNA 3VWEA 1KUVA 4A2ZA 1Q7LA 3H8FA 3FYNA 5FVJA 4P10A 5HXDA 5C88A 4PQAA 2PJ0A 3LMSA 4MFKA 4NF1A 3BHXA 3D8PA 4OC3A 2GE3A 5F47A 2Q43A 2QMLA 1R3NA 5JGFA 4MHYA 5LYIA 1DE4C 4QVTA 1Y9WA 3IJ3A 3R1KA 1NMTA 4KOVA 2ZEFA 5F48A 4PXBA 1WK4A 1CJWA 1YSJA 4M3SA 4R76A 2EK8A 4A32A 4AVAA 4PV6A 1XBUA 4H6UA 1BPMA 3IU1A 3NFZA 3OWCA 2CNMA 2R7HA 1CP6A 3PBBA 2ZW5A 3TE4A 1XOVA 2A4NA 4OC4A 1LANA 3GYAA 4L8AA 1VGYA 2IQ6A 4RI1A 3V8IA 3WC5A 4F0YA 2RC4A 2Z3OA 2JBKA 1Y7EA 2EWBA 4PXEA 4KUBA 1LOKA 1ON0A 1UWYA 2Q4YA 4NJRA 3TOBA 4ZY1A 5C82A 4F9VA 3HUVA 2GIVA 2FSRA 2Z3KA 2F8HA 3T9YA 2H5MA 4C2XA 4PK3A 2JBJA 3ZZIA 1FNOA 5IV0A 2PJ8A 1M4GA 3IWEA 4A33A 3CZXA 4MY3A 1HDQA 1HDUA 5HVHA 1B6BA 1OBRA 2B3VA 4B14A 3B3SA 4MRIA 4J3GA 4YWYA 3FRMA 1S7NA 4B11A 2YNCA 3F5BA 3NE8A 4OADA 4CGNA 1QQ9A 2RB7A 3GLJA 5DWMA 1WWZA 4A37A 4A31A 5J8CA 1S7KA 3FB3A 3JUWA 2PRBA 1VHOA 4UIAA 4K3NA 3D7DA 4C7HA 2B4BA 2ZEDA 4R87A 2VEZA 4C7IA 3UY5A 3T90A 2ARHA 2R98A 3IIBA 4Y49B 5HH1A 1XFOA 4K30A 2GANA 2JDCA 2WZNA 3DSBA 4PXDA 2CNTA 3PFOA 4H89A 3TO9A 2ANPA 2DPTA 3SJGA 2EUIA 3B3CA 2JEWA 4F0XA 1M4DA 4X3RA 2AFOA 3MRUA 5IB9A 4NGSA 2CXAA 3PB4X 4KVXA 4G1PA 1VHEA 3IGRA 4KSIA 4IF5A 4P6YA 2BL1A 4R8FA 4KVME 4IAVA 4BBHA 2QVPA 2NMTA 1R57A 2DEAA 2Z3LA 2YNDA 1DTDA 2Y0MA 4DYOA 3FX6A 1AUGA 3ISZA 3R9GA 4ZY2A 3RNZA 1Z8WA 5G21A 1ELLP 3BI0A 3EC4A 1ZO0A 3N7ZA 2PCUA 4MFQA 5LYLA 2Q04A 1YVOA 3D68A 2G3TA 4MFPA 2O53A 4MCQA 3FF3A 2OH1A 2OOTA 4CS0B 3PBEA 2AJ6A 4KOYA 3K2KA 3CPAA 3PB9X 1YGHA 2V8DA 3EXNA 3L2NA 4O23A 4E8OA 4AVBA 4NGPA 4UFVA 1KZFA 3KHXA 3F0AA 4IK2A 5JQ4A 2EO8A 4ZY0A 5KTDA 3VH9A 2C6GA 1M4LA 3EFAA 4P45A 3PZJA 4XPDB 5A28A 2Z3PA 2Q4ZA 4R3KA 3RO0A 3K9TA 4CYPA 2PSWA 3B3WA 4TWEA 1IYLA 1QSOA 2FCKA 3D2PA 3B35A 3I1UA 5ISVA 5LRJA 2ZEOA 4M85A 5CBMA 3IFEA 2I79A 5EMIA 1TKJA 3BI1A 1VIXA 4NGQA 2V77A 2XEIA 5DS0A 4OC1A 2D4OA 2WUUA 5F49A 2I00A 2V8HA 3A9LA 3DNSA 1CM0A 5LRGA 1LCPA 3D2MA 4Y49C 3JTKA 3NH5A 1LAPA 4NSQA 1Y9KA 5D29A 2PJ6A 5IB0A 3TFYA 3FEDA 1XMBA 4CAWA 3QB8A 1YLEA 4HNXB 3BLNA 1Z8TA 1GHEA 1U6MA 5H84A 1Z4EA 1CPSA 4HPSA 3KR5A 2REEA 4YU9A 3PEIA 4FAIA 1L0CA 1ARLA 2R1IA 3H5ZA 1RTQA 4GM5A 3EO4A 1TIQA 3RYOA 2HB6A 4NJQA 3R9EA 1MJ9A 3PB6X 4KSAA 4PXCA 3P2HA 4KOUA 5AG5A 1GYTA 4CAFA 4DNCA 5JPHA 1YW4A 1SQHA 1M4IA 2AFWA 5J1QA 3QAHA 4PSXA 2OZGA 2C27A 2OR4A 2RFHA 3HLPA 4UA3A 4UEZA 3FIXA 4FD5A 4UWIA 3S6HA 2PQ8A 1QSRA 2PDOA 1LFWA 4P4BA 3FNCA 4UBRA 2PIYA 1YREA 3TOAA 5I0CA 1P4NA 5EC4A 2QJ8A 4MCSA 4CAXA 4CRZB 2R8VA 4B10A 4R9MA 2ZW4A 1QSTA 1M44A 4MHNA 4C2YA 1NE9A 2EVNA 2AFSA 2K5TA 4PSWA 3B3TA 3G3SA 4F8ZA 3TO6A 7CPAA 3MN8A 4XPDC 2BUEA 3R96A 3H4QA 1Y0RA 1CX8A 2Z0ZA 4PK2A 2Z3MA 4RN7A 5H86A 3ZJ0A 2ZEHA 5K8PA 2C6CA 1FY7A 4ZX9A 3EY5A 1YR0A 1PYTB 1JWQA 4MCPA 3V7ZA 3FMCA 2Q7BA 4OC0A 4KORA 4R7MA 3IWGA 4B5PA 4E2AA 1XJOA 3CDXA 1PUAA 1YK3A 1ZLIA 1B87A 3I9SA 4B5OA 4KOXA 4W9YA 5HVFA 1XMTA 3FXTA 2BO9A 2CTBA 1MJAA 3C26A 3NE7A 3PFEA 3KQZA 2DPSA 1S60A 2CTCA 2PE3A 2JEVA 2PJ1A 3IWWA 3CXQA 3IU2A 2OZHA 2V8VA 4QBJA 5JH9A 1N71A 4UCNA 2PC1A 2QIRA 1X10A 3IEHA 1S5KA 4P44A 2P0WA 3D7HA 4OC2A 3S6GA 1TKFA 3BJ8A 4II9A 2J8MA 4YRHA 4UEFA 4I49A 3D7FA 3R95A 3RZAA 3TC8A 2P6EA 4JJXA 4MHZA 2PJAA 4A94A 4KOWA 2B58A 3FJUA 4WJBA 4JYWA 2WSAA 4MCRA 1F2PA 3SHPA 4BD9A 1RO5A 2CNSA 3I3GA 3DR8A 4BMHA 5F09A 3JVNA 4NCZA 2P6GA 4FWUA 4UWJA 1QSMA 2PJ9A 1IGBA 5DWNA 4Z65A 4QB9A 4Q36A 1OZPA 2F5IA 4UFWA 4NGTA 2J8RA 4FD4A 2ATRA 3B3VA 1YQEA 4OIWA 3VWDA 5BWAB 1YLOA 3DLJA 4CGLA 2ZENA 2ZXVA 5AG7A 1BLLE 2PJ3A 3S6KA 8CPAA 2I3CA 1J4JA 3WR7A 4A38A 4EWTA 4KOSA 4MFLA 2DF5A 3GKRA 3KHZA 1XE4A 1V0CA 1Z8LA 3QAYA 1S7LA 2CY2A 1AYEA 2NYQA 4XNHB 1IIDA 2BCOA 3KR4A 4ZX8A 1ARMA 2VZZA 1IB1E 4MFJA 4KOTA 4U9YA 1KWMA 4KS9A 2AFUA 2HUZA 1ELMP 4LQ6A 2AFZA 2O4HA 1IOFA 1NSAA 3FH4A 3GIUA 4NEXA 2FE7A 2B3UA 1XEBA 2B4DB 2VQYA 1ZG8A 3FEEA 5G1ZA 4JLYA 2XEGA 5K8MA 4MXUA 4OIDA 5HMNA 1Y0YA 2PR1A 4CGMA 2WPXA 3RAMA 2D4PA 2PJBA 2ZW6A 1YVKA 5CNPA 5K8OA 1Z2LA 4M6IA 2ODFA 2VL1A 3KZWA 2NSMA 3PRTA 1H8LA 4AG9A 4CPAA 1I1DA 2POKA 4KSFA 4U9ZA 5THWA 4RUHA 2GLFA 3SI1A 4CYNA 3V38A 1Z4RA 2Q51A 3PB7X 2ZPAA 3TTHA 1CG2A 2FIWA 4UCPA 1CP7A 3S6FA 1LRZA 3NH4A 4NXYA 4CYQA 3ISXA 2OU2A 2IMOA 4NGMA 3GY9A 1YX0A 4YGOA 4ONUA 5E96A 3R9FA 4A95A 4X5KA 3KGQA 2F7VA 4X2TA
chains in the Genus database with same CATH topology
4ZI6A 3S9NA 2ZEEA 2PVWA 4IHMA 1F57A 3T8WA 3IC1A 3NH8A 3FECA 1XRYA 3KQXA 4ZYQA 2PIZA 3CT9A 4EMEA 4LQGA 3FVLA 2GREA 3H8GA 1LAMA 2C6PA 3SI2A 1EE3P 1TF9A 2ABZA 2IJZA 2J9AA 2PJ5A 3IO1A 5JM6A 2BOAA 1PCAA 3H8EA 1ZG7A 3QNVA 4P4IA 3VARA 3WC6A 1CPXA 4P4FA 3B7IA 2AFXA 3D67A 3KASA 4FUUA 2FVGA 2PVVA 2ZEGA 4DUKA 1YW6A 3D66A 2ZEMA 1ZLHA 2ZOGA 3WC7A 3TX8A 5I4MA 4MHPA 3SJFA 4FBEA 4AXVA 4ONWA 4UF4A 4H2KA 5LYFA 3GB0A 5D8NA 2WYRA 3CPXA 2V8GA 3SI0A 4R6TA 1HEEA 3WABA 2PRQA 3KL9A 4P4DA 3SJEA 2CIJA 2PJCA 1F2OA 2ZEPA 2AFMA 1IY7A 3BXMA 5ELYA 5LRKA 4OKOA 4TNUA 4MMOA 2EK9A 2PJ4A 1FT7A 4OP4A 1BAVA 1AMPA 4EFDA 3D4UA 3LWUA 1TF8A 4OMEA 4UIBA 4F9UA 1JQGA 6CPAA 3B2YA 3PB8X 4NGNA 4OC5A 3KI9A 1R43A 1TKHA 1YMEA 3S9LA 2HC9A 2ZELA 3D7GA 2ZOFA 3SJXA 4DJLA 2PJ2A 5HVGA 4Q7AA 2GLJA 3JRUA 4NFRA 2QYVA 2XEJA 3NA6A 2PJ7A 4P4JA 5CPAA 5LYDA 2C1CA 3VATA 1BPNA 5K8NA 2G9DA 3DGVA 3RBUA 4A39A 2XEFA 4NGRA 4JZ0A 3S9MA 3WT4A 1Z5RA 4X8IA 1TXRA 3GUXA 3N5FA 2GU2A 1CBXA 2CF4A 1ZG9A 4UEEA 4WWVA 4PPZA 1QMUA 4B6ZA 1Q7LA 3H8FA 4P10A 5HXDA 4PQAA 2PJ0A 3LMSA 3BHXA 4OC3A 2Q43A 1R3NA 5JGFA 4MHYA 5LYIA 1DE4C 3IJ3A 2ZEFA 4PXBA 1YSJA 4R76A 2EK8A 1XBUA 1BPMA 3NFZA 1CP6A 3PBBA 4OC4A 1LANA 1VGYA 2IQ6A 3WC5A 2JBKA 1Y7EA 2EWBA 4PXEA 1LOKA 4NJRA 1UWYA 4ZY1A 4F9VA 3HUVA 2F8HA 2JBJA 1FNOA 2PJ8A 1HDQA 1HDUA 5HVHA 1OBRA 3B3SA 4MRIA 4YWYA 1QQ9A 2RB7A 3GLJA 4A37A 1VHOA 4UIAA 4K3NA 3D7DA 2ZEDA 3IIBA 1XFOA 4P4EA 4PXDA 2WZNA 3PFOA 2ANPA 3SJGA 3B3CA 2JEWA 4X3RA 2AFOA 3MRUA 5IB9A 4NGSA 3PB4X 4G1PA 1VHEA 4KSIA 4R8FA 4P6YA 4IAVA 2QVPA 2DEAA 1DTDA 4DYOA 3FX6A 3ISZA 4ZY2A 1ELLP 3BI0A 2PCUA 5LYLA 3D68A 4MCQA 2O53A 3FF3A 2OOTA 3PBEA 3K2KA 3CPAA 3PB9X 2V8DA 3L2NA 4O23A 4NGPA 3KHXA 4IK2A 4ZY0A 3VH9A 2C6GA 1M4LA 4P45A 2Q4ZA 3K9TA 3B3WA 4TWEA 3B35A 3I1UA 5LRJA 2ZEOA 5CBMA 3IFEA 1TKJA 3BI1A 4NGQA 1VIXA 2V77A 2XEIA 5DS0A 4OC1A 2V8HA 5LRGA 1LCPA 3NH5A 1LAPA 5D29A 2PJ6A 3FEDA 1XMBA 1CPSA 3KR5A 4YU9A 3PEIA 4FAIA 1ARLA 4GM5A 1RTQA 2HB6A 4NJQA 4PXCA 3PB6X 1GYTA 1YW4A 2AFWA 5J1QA 2OR4A 3HLPA 2RFHA 4UEZA 4P4BA 1LFWA 2PIYA 2QJ8A 4MCSA 4MHNA 2AFSA 3B3TA 4F8ZA 7CPAA 3MN8A 1Y0RA 1CX8A 5K8PA 2ZEHA 2C6CA 4ZX9A 1PYTB 4MCPA 3V7ZA 3FMCA 4OC0A 4R7MA 1XJOA 3CDXA 1ZLIA 4W9YA 5HVFA 2BO9A 2CTBA 3PFEA 3KQZA 2CTCA 2PE3A 2PJ1A 3IWWA 2V8VA 5JH9A 3IEHA 4P44A 3D7HA 4OC2A 1TKFA 4UEFA 3D7FA 3RZAA 3TC8A 4MHZA 2PJAA 4A94A 3FJUA 4WJBA 4JYWA 4MCRA 4BD9A 1F2PA 5F09A 4FWUA 2PJ9A 1IGBA 4Z65A 4NGTA 3B3VA 4OIWA 1YLOA 3DLJA 2ZENA 1BLLE 2PJ3A 8CPAA 2I3CA 4A38A 4EWTA 3KHZA 1Z8LA 1AYEA 2NYQA 2BCOA 3KR4A 4ZX8A 1ARMA 1KWMA 2AFUA 1ELMP 2AFZA 2O4HA 3FH4A 1NSAA 3FEEA 1ZG8A 2XEGA 5K8MA 4MXUA 4OIDA 1Y0YA 3RAMA 2PJBA 5K8OA 1Z2LA 2VL1A 3KZWA 2NSMA 3PRTA 1H8LA 4CPAA 2POKA 5THWA 4RUHA 2GLFA 3SI1A 3V38A 2Q51A 3PB7X 1CG2A 1CP7A 3NH4A 3ISXA 2IMOA 4NGMA 3KGQA 2F7VA 4X2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI6 A;  3S9N A;  2ZEE A;  2PVW A;  4IHM A;  1F57 A;  3T8W A;  3IC1 A;  3NH8 A;  3FEC A;  1XRY A;  3KQX A;  4ZYQ A;  2PIZ A;  3CT9 A;  4EME A;  4LQG A;  3FVL A;  2GRE A;  3H8G A;  1LAM A;  2C6P A;  3SI2 A;  1EE3 P;  1TF9 A;  2ABZ A;  2IJZ A;  2J9A A;  2PJ5 A;  3IO1 A;  5JM6 A;  2BOA A;  1PCA A;  3H8E A;  1ZG7 A;  3QNV A;  4P4I A;  3VAR A;  3WC6 A;  1CPX A;  4P4F A;  3B7I A;  2AFX A;  3D67 A;  3KAS A;  4FUU A;  2FVG A;  2PVV A;  2ZEG A;  4DUK A;  1YW6 A;  3D66 A;  2ZEM A;  1ZLH A;  2ZOG A;  3WC7 A;  3TX8 A;  5I4M A;  4MHP A;  3SJF A;  4FBE A;  4AXV A;  4ONW A;  4UF4 A;  4H2K A;  5LYF A;  3GB0 A;  5D8N A;  2WYR A;  3CPX A;  2V8G A;  3SI0 A;  4R6T A;  1HEE A;  3WAB A;  2PRQ A;  3KL9 A;  4P4D A;  3SJE A;  2CIJ A;  2PJC A;  1F2O A;  2ZEP A;  2AFM A;  1IY7 A;  3BXM A;  5ELY A;  5LRK A;  4OKO A;  4TNU A;  4MMO A;  2EK9 A;  2PJ4 A;  1FT7 A;  4OP4 A;  1BAV A;  1AMP A;  4EFD A;  3D4U A;  3LWU A;  1TF8 A;  4OME A;  4UIB A;  4F9U A;  1JQG A;  6CPA A;  3B2Y A;  3PB8 X;  4NGN A;  4OC5 A;  3KI9 A;  1R43 A;  1TKH A;  1YME A;  3S9L A;  2HC9 A;  2ZEL A;  3D7G A;  2ZOF A;  3SJX A;  4DJL A;  2PJ2 A;  5HVG A;  4Q7A A;  2GLJ A;  3JRU A;  4NFR A;  2QYV A;  2XEJ A;  3NA6 A;  2PJ7 A;  4P4J A;  5CPA A;  5LYD A;  2C1C A;  3VAT A;  1BPN A;  5K8N A;  2G9D A;  3DGV A;  3RBU A;  4A39 A;  2XEF A;  4NGR A;  4JZ0 A;  3S9M A;  3WT4 A;  1Z5R A;  4X8I A;  1TXR A;  3GUX A;  3N5F A;  2GU2 A;  1CBX A;  2CF4 A;  1ZG9 A;  4UEE A;  4WWV A;  4PPZ A;  1QMU A;  4B6Z A;  1Q7L A;  3H8F A;  4P10 A;  5HXD A;  4PQA A;  2PJ0 A;  3LMS A;  3BHX A;  4OC3 A;  2Q43 A;  1R3N A;  5JGF A;  4MHY A;  5LYI A;  1DE4 C;  3IJ3 A;  2ZEF A;  4PXB A;  1YSJ A;  4R76 A;  2EK8 A;  1XBU A;  1BPM A;  3NFZ A;  1CP6 A;  3PBB A;  4OC4 A;  1LAN A;  1VGY A;  2IQ6 A;  3WC5 A;  2JBK A;  1Y7E A;  2EWB A;  4PXE A;  1LOK A;  4NJR A;  1UWY A;  4ZY1 A;  4F9V A;  3HUV A;  2F8H A;  2JBJ A;  1FNO A;  2PJ8 A;  1HDQ A;  1HDU A;  5HVH A;  1OBR A;  3B3S A;  4MRI A;  4YWY A;  1QQ9 A;  2RB7 A;  3GLJ A;  4A37 A;  1VHO A;  4UIA A;  4K3N A;  3D7D A;  2ZED A;  3IIB A;  1XFO A;  4P4E A;  4PXD A;  2WZN A;  3PFO A;  2ANP A;  3SJG A;  3B3C A;  2JEW A;  4X3R A;  2AFO A;  3MRU A;  5IB9 A;  4NGS A;  3PB4 X;  4G1P A;  1VHE A;  4KSI A;  4R8F A;  4P6Y A;  4IAV A;  2QVP A;  2DEA A;  1DTD A;  4DYO A;  3FX6 A;  3ISZ A;  4ZY2 A;  1ELL P;  3BI0 A;  2PCU A;  5LYL A;  3D68 A;  4MCQ A;  2O53 A;  3FF3 A;  2OOT A;  3PBE A;  3K2K A;  3CPA A;  3PB9 X;  2V8D A;  3L2N A;  4O23 A;  4NGP A;  3KHX A;  4IK2 A;  4ZY0 A;  3VH9 A;  2C6G A;  1M4L A;  4P45 A;  2Q4Z A;  3K9T A;  3B3W A;  4TWE A;  3B35 A;  3I1U A;  5LRJ A;  2ZEO A;  5CBM A;  3IFE A;  1TKJ A;  3BI1 A;  4NGQ A;  1VIX A;  2V77 A;  2XEI A;  5DS0 A;  4OC1 A;  2V8H A;  5LRG A;  1LCP A;  3NH5 A;  1LAP A;  5D29 A;  2PJ6 A;  3FED A;  1XMB A;  1CPS A;  3KR5 A;  4YU9 A;  3PEI A;  4FAI A;  1ARL A;  4GM5 A;  1RTQ A;  2HB6 A;  4NJQ A;  4PXC A;  3PB6 X;  1GYT A;  1YW4 A;  2AFW A;  5J1Q A;  2OR4 A;  3HLP A;  2RFH A;  4UEZ A;  4P4B A;  1LFW A;  2PIY A;  2QJ8 A;  4MCS A;  4MHN A;  2AFS A;  3B3T A;  4F8Z A;  7CPA A;  3MN8 A;  1Y0R A;  1CX8 A;  5K8P A;  2ZEH A;  2C6C A;  4ZX9 A;  1PYT B;  4MCP A;  3V7Z A;  3FMC A;  4OC0 A;  4R7M A;  1XJO A;  3CDX A;  1ZLI A;  4W9Y A;  5HVF A;  2BO9 A;  2CTB A;  3PFE A;  3KQZ A;  2CTC A;  2PE3 A;  2PJ1 A;  3IWW A;  2V8V A;  5JH9 A;  3IEH A;  4P44 A;  3D7H A;  4OC2 A;  1TKF A;  4UEF A;  3D7F A;  3RZA A;  3TC8 A;  4MHZ A;  2PJA A;  4A94 A;  3FJU A;  4WJB A;  4JYW A;  4MCR A;  4BD9 A;  1F2P A;  5F09 A;  4FWU A;  2PJ9 A;  1IGB A;  4Z65 A;  4NGT A;  3B3V A;  4OIW A;  1YLO A;  3DLJ A;  2ZEN A;  1BLL E;  2PJ3 A;  8CPA A;  2I3C A;  4A38 A;  4EWT A;  3KHZ A;  1Z8L A;  1AYE A;  2NYQ A;  2BCO A;  3KR4 A;  4ZX8 A;  1ARM A;  1KWM A;  2AFU A;  1ELM P;  2AFZ A;  2O4H A;  3FH4 A;  1NSA A;  3FEE A;  1ZG8 A;  2XEG A;  5K8M A;  4MXU A;  4OID A;  1Y0Y A;  3RAM A;  2PJB A;  5K8O A;  1Z2L A;  2VL1 A;  3KZW A;  2NSM A;  3PRT A;  1H8L A;  4CPA A;  2POK A;  5THW A;  4RUH A;  2GLF A;  3SI1 A;  3V38 A;  2Q51 A;  3PB7 X;  1CG2 A;  1CP7 A;  3NH4 A;  3ISX A;  2IMO A;  4NGM A;  3KGQ A;  2F7V A;  4X2T A; 
#chains in the Genus database with same CATH topology
 4ZI6 A;  3S9N A;  1Q2Y A;  2G0B A;  2O28 A;  4QC6 A;  2Q44 A;  1UFH A;  2FS5 A;  2OB0 A;  2ZEE A;  4GXH A;  4B13 A;  2PVW A;  4IHM A;  3B8G A;  1F57 A;  3T8W A;  5A27 A;  3IC1 A;  3TO7 A;  4CAE A;  2YNC C;  2HV2 A;  2BSW A;  3NH8 A;  5KTA A;  1I21 A;  4KUA A;  4JXR A;  4C68 A;  1MK4 A;  3FEC A;  1XRY A;  1Y7R A;  4Q38 A;  5AG4 A;  2Z11 A;  3KQX A;  4ZYQ A;  2PIZ A;  2G3A A;  3PGP A;  1IYK A;  3CT9 A;  3MGD A;  1XIX A;  4EME A;  4LQG A;  2B5G B;  4HNY B;  3FVL A;  2GRE A;  3H8G A;  1K4J A;  1LAM A;  1BOB A;  4XNH C;  1VKC A;  1NSL A;  2C6P A;  2FT0 A;  3SI2 A;  4R3L A;  1EE3 P;  4C2Z A;  1TF9 A;  2ABZ A;  2IJZ A;  2J9A A;  2PJ5 A;  3IO1 A;  5JM6 A;  2BOA A;  2VXK A;  2JLM A;  2IL4 A;  1PCA A;  3H8E A;  1ZG7 A;  3QNV A;  4FD7 A;  2KCW A;  4UFX A;  4CRY B;  4P4I A;  3VAR A;  2DXQ A;  3LD2 A;  3WC6 A;  1CPX A;  4P4F A;  2J8N A;  3B7I A;  2AFX A;  3D67 A;  3KAS A;  4CAV A;  1S7F A;  4H6Z A;  5AG6 A;  3W6S A;  4P4E A;  2QEC A;  4HKF A;  4FUU A;  5GCN A;  1Z8X A;  2FVG A;  2FXF A;  5EBV A;  2OZU A;  1VHS A;  1I12 A;  2PVV A;  3TCV A;  4F6A A;  2ZEG A;  2HQY A;  1YW6 A;  2BEI A;  4DUK A;  3D66 A;  1Q2C A;  2ZEM A;  1ZLH A;  2ZOG A;  4MY0 A;  3SXN A;  2REF A;  3WC7 A;  3TX8 A;  5I4M A;  4MHP A;  3SJF A;  4FBE A;  4AXV A;  3E0K A;  4ONW A;  4UF4 A;  4KLW A;  5AGE A;  4H2K A;  4E0A A;  2YNE A;  1RXT A;  5LYF A;  1Q2D A;  2Q4V A;  3P2F A;  3GB0 A;  4HNW B;  3DR6 A;  5D8N A;  5G22 A;  2AE6 A;  2WYR A;  3CPX A;  3LAC A;  2V8G A;  3SI0 A;  1KUX A;  4B5P B;  4R6T A;  1HEE A;  2ZW7 A;  3WAB A;  2PRQ A;  1IU8 A;  1KUY A;  4KVO E;  3KL9 A;  4QUS A;  4CGP A;  4P4D A;  4YFJ A;  3SJE A;  4OLL A;  2CIJ A;  2PJC A;  1F2O A;  2ZEP A;  2AFM A;  4M6H A;  1IY7 A;  3BXM A;  2YGW A;  4JD6 A;  4KLV A;  4OKO A;  4M6G A;  4L89 A;  5ELY A;  4TNU A;  4AVC A;  5LRK A;  4MMO A;  2EK9 A;  2PJ4 A;  1FT7 A;  4AB7 A;  4OP4 A;  4GS4 A;  4IUS A;  1BAV A;  4U5Y A;  1PU9 A;  1X12 A;  4LUA A;  4A30 A;  1MJB A;  2JDD A;  1M1D A;  4AG7 A;  1Z9U A;  2GFQ A;  2P6F A;  4MBU A;  2B4D A;  3F8K A;  3PP9 A;  1AMP A;  3D3S A;  4MHD A;  4EFD A;  3D4U A;  5KTC A;  2FIA A;  3LWU A;  1TF8 A;  3DDD A;  4OME A;  4ZGY B;  4MI4 A;  4UIB A;  4BIN A;  2X7B A;  3W91 A;  1IIC A;  4UCM A;  2PR8 A;  4F9U A;  4CYO A;  4RS2 A;  1JQG A;  2Z3N A;  6CPA A;  3B2Y A;  3PB8 X;  4NGN A;  1XF8 A;  3CXP A;  4FD6 A;  4OC5 A;  3FBU A;  3KI9 A;  1R43 A;  3CXS A;  4CGO A;  1TKH A;  1YME A;  3S9L A;  2HC9 A;  4JXQ A;  4ORF A;  2ZEL A;  3D7G A;  3G8W A;  1P0H A;  2ZOF A;  3SJX A;  3SXO A;  4DJL A;  2PJ2 A;  4B12 A;  5HVG A;  4Q7A A;  1A2Z A;  1BO4 A;  2GLJ A;  4ZBG A;  2VBQ A;  3JRU A;  4NFR A;  3K9U A;  4MJ8 A;  2QYV A;  3W6X A;  2Q7S A;  1S3Z A;  2XEJ A;  2PJ7 A;  3NA6 A;  4P4J A;  5CPA A;  5G20 A;  5LYD A;  2C1C A;  3VAT A;  1BPN A;  1IOI A;  2G9D A;  2EBJ A;  5K8N A;  3DGV A;  4KZT A;  3RBU A;  4A39 A;  3TT2 A;  2XEF A;  4JWP A;  4NGR A;  4JZ0 A;  3S9M A;  3WT4 A;  1Z5R A;  3LOD A;  4X8I A;  4EVY A;  5J8F A;  4MFZ A;  2Q0Y A;  3KKW A;  2FL4 A;  1TXR A;  3GUX A;  4R57 A;  3N5F A;  2GU2 A;  5F46 A;  1CBX A;  4OAE A;  2CF4 A;  2B5G A;  1ZG9 A;  4UEE A;  2WPW A;  4XPK A;  2VI7 A;  4PPZ A;  4WWV A;  1QMU A;  5IX3 A;  2VZY A;  4XPL A;  4B6Z A;  2Z10 A;  4LX9 A;  3BJ7 A;  1QSN A;  3VWE A;  1KUV A;  4A2Z A;  1Q7L A;  3H8F A;  3FYN A;  5FVJ A;  4P10 A;  5HXD A;  5C88 A;  4PQA A;  2PJ0 A;  3LMS A;  4MFK A;  4NF1 A;  3BHX A;  3D8P A;  4OC3 A;  2GE3 A;  5F47 A;  2Q43 A;  2QML A;  1R3N A;  5JGF A;  4MHY A;  5LYI A;  1DE4 C;  4QVT A;  1Y9W A;  3IJ3 A;  3R1K A;  1NMT A;  4KOV A;  2ZEF A;  5F48 A;  4PXB A;  1WK4 A;  1CJW A;  1YSJ A;  4M3S A;  4R76 A;  2EK8 A;  4A32 A;  4AVA A;  4PV6 A;  1XBU A;  4H6U A;  1BPM A;  3IU1 A;  3NFZ A;  3OWC A;  2CNM A;  2R7H A;  1CP6 A;  3PBB A;  2ZW5 A;  3TE4 A;  1XOV A;  2A4N A;  4OC4 A;  1LAN A;  3GYA A;  4L8A A;  1VGY A;  2IQ6 A;  4RI1 A;  3V8I A;  3WC5 A;  4F0Y A;  2RC4 A;  2Z3O A;  2JBK A;  1Y7E A;  2EWB A;  4PXE A;  4KUB A;  1LOK A;  1ON0 A;  1UWY A;  2Q4Y A;  4NJR A;  3TOB A;  4ZY1 A;  5C82 A;  4F9V A;  3HUV A;  2GIV A;  2FSR A;  2Z3K A;  2F8H A;  3T9Y A;  2H5M A;  4C2X A;  4PK3 A;  2JBJ A;  3ZZI A;  1FNO A;  5IV0 A;  2PJ8 A;  1M4G A;  3IWE A;  4A33 A;  3CZX A;  4MY3 A;  1HDQ A;  1HDU A;  5HVH A;  1B6B A;  1OBR A;  2B3V A;  4B14 A;  3B3S A;  4MRI A;  4J3G A;  4YWY A;  3FRM A;  1S7N A;  4B11 A;  2YNC A;  3F5B A;  3NE8 A;  4OAD A;  4CGN A;  1QQ9 A;  2RB7 A;  3GLJ A;  5DWM A;  1WWZ A;  4A37 A;  4A31 A;  5J8C A;  1S7K A;  3FB3 A;  3JUW A;  2PRB A;  1VHO A;  4UIA A;  4K3N A;  3D7D A;  4C7H A;  2B4B A;  2ZED A;  4R87 A;  2VEZ A;  4C7I A;  3UY5 A;  3T90 A;  2ARH A;  2R98 A;  3IIB A;  4Y49 B;  5HH1 A;  1XFO A;  4K30 A;  2GAN A;  2JDC A;  2WZN A;  3DSB A;  4PXD A;  2CNT A;  3PFO A;  4H89 A;  3TO9 A;  2ANP A;  2DPT A;  3SJG A;  2EUI A;  3B3C A;  2JEW A;  4F0X A;  1M4D A;  4X3R A;  2AFO A;  3MRU A;  5IB9 A;  4NGS A;  2CXA A;  3PB4 X;  4KVX A;  4G1P A;  1VHE A;  3IGR A;  4KSI A;  4IF5 A;  4P6Y A;  2BL1 A;  4R8F A;  4KVM E;  4IAV A;  4BBH A;  2QVP A;  2NMT A;  1R57 A;  2DEA A;  2Z3L A;  2YND A;  1DTD A;  2Y0M A;  4DYO A;  3FX6 A;  1AUG A;  3ISZ A;  3R9G A;  4ZY2 A;  3RNZ A;  1Z8W A;  5G21 A;  1ELL P;  3BI0 A;  3EC4 A;  1ZO0 A;  3N7Z A;  2PCU A;  4MFQ A;  5LYL A;  2Q04 A;  1YVO A;  3D68 A;  2G3T A;  4MFP A;  2O53 A;  4MCQ A;  3FF3 A;  2OH1 A;  2OOT A;  4CS0 B;  3PBE A;  2AJ6 A;  4KOY A;  3K2K A;  3CPA A;  3PB9 X;  1YGH A;  2V8D A;  3EXN A;  3L2N A;  4O23 A;  4E8O A;  4AVB A;  4NGP A;  4UFV A;  1KZF A;  3KHX A;  3F0A A;  4IK2 A;  5JQ4 A;  2EO8 A;  4ZY0 A;  5KTD A;  3VH9 A;  2C6G A;  1M4L A;  3EFA A;  4P45 A;  3PZJ A;  4XPD B;  5A28 A;  2Z3P A;  2Q4Z A;  4R3K A;  3RO0 A;  3K9T A;  4CYP A;  2PSW A;  3B3W A;  4TWE A;  1IYL A;  1QSO A;  2FCK A;  3D2P A;  3B35 A;  3I1U A;  5ISV A;  5LRJ A;  2ZEO A;  4M85 A;  5CBM A;  3IFE A;  2I79 A;  5EMI A;  1TKJ A;  3BI1 A;  1VIX A;  4NGQ A;  2V77 A;  2XEI A;  5DS0 A;  4OC1 A;  2D4O A;  2WUU A;  5F49 A;  2I00 A;  2V8H A;  3A9L A;  3DNS A;  1CM0 A;  5LRG A;  1LCP A;  3D2M A;  4Y49 C;  3JTK A;  3NH5 A;  1LAP A;  4NSQ A;  1Y9K A;  5D29 A;  2PJ6 A;  5IB0 A;  3TFY A;  3FED A;  1XMB A;  4CAW A;  3QB8 A;  1YLE A;  4HNX B;  3BLN A;  1Z8T A;  1GHE A;  1U6M A;  5H84 A;  1Z4E A;  1CPS A;  4HPS A;  3KR5 A;  2REE A;  4YU9 A;  3PEI A;  4FAI A;  1L0C A;  1ARL A;  2R1I A;  3H5Z A;  1RTQ A;  4GM5 A;  3EO4 A;  1TIQ A;  3RYO A;  2HB6 A;  4NJQ A;  3R9E A;  1MJ9 A;  3PB6 X;  4KSA A;  4PXC A;  3P2H A;  4KOU A;  5AG5 A;  1GYT A;  4CAF A;  4DNC A;  5JPH A;  1YW4 A;  1SQH A;  1M4I A;  2AFW A;  5J1Q A;  3QAH A;  4PSX A;  2OZG A;  2C27 A;  2OR4 A;  2RFH A;  3HLP A;  4UA3 A;  4UEZ A;  3FIX A;  4FD5 A;  4UWI A;  3S6H A;  2PQ8 A;  1QSR A;  2PDO A;  1LFW A;  4P4B A;  3FNC A;  4UBR A;  2PIY A;  1YRE A;  3TOA A;  5I0C A;  1P4N A;  5EC4 A;  2QJ8 A;  4MCS A;  4CAX A;  4CRZ B;  2R8V A;  4B10 A;  4R9M A;  2ZW4 A;  1QST A;  1M44 A;  4MHN A;  4C2Y A;  1NE9 A;  2EVN A;  2AFS A;  2K5T A;  4PSW A;  3B3T A;  3G3S A;  4F8Z A;  3TO6 A;  7CPA A;  3MN8 A;  4XPD C;  2BUE A;  3R96 A;  3H4Q A;  1Y0R A;  1CX8 A;  2Z0Z A;  4PK2 A;  2Z3M A;  4RN7 A;  5H86 A;  3ZJ0 A;  2ZEH A;  5K8P A;  2C6C A;  1FY7 A;  4ZX9 A;  3EY5 A;  1YR0 A;  1PYT B;  1JWQ A;  4MCP A;  3V7Z A;  3FMC A;  2Q7B A;  4OC0 A;  4KOR A;  4R7M A;  3IWG A;  4B5P A;  4E2A A;  1XJO A;  3CDX A;  1PUA A;  1YK3 A;  1ZLI A;  1B87 A;  3I9S A;  4B5O A;  4KOX A;  4W9Y A;  5HVF A;  1XMT A;  3FXT A;  2BO9 A;  2CTB A;  1MJA A;  3C26 A;  3NE7 A;  3PFE A;  3KQZ A;  2DPS A;  1S60 A;  2CTC A;  2PE3 A;  2JEV A;  2PJ1 A;  3IWW A;  3CXQ A;  3IU2 A;  2OZH A;  2V8V A;  4QBJ A;  5JH9 A;  1N71 A;  4UCN A;  2PC1 A;  2QIR A;  1X10 A;  3IEH A;  1S5K A;  4P44 A;  2P0W A;  3D7H A;  4OC2 A;  3S6G A;  1TKF A;  3BJ8 A;  4II9 A;  2J8M A;  4YRH A;  4UEF A;  4I49 A;  3D7F A;  3R95 A;  3RZA A;  3TC8 A;  2P6E A;  4JJX A;  4MHZ A;  2PJA A;  4A94 A;  4KOW A;  2B58 A;  3FJU A;  4WJB A;  4JYW A;  2WSA A;  4MCR A;  1F2P A;  3SHP A;  4BD9 A;  1RO5 A;  2CNS A;  3I3G A;  3DR8 A;  4BMH A;  5F09 A;  3JVN A;  4NCZ A;  2P6G A;  4FWU A;  4UWJ A;  1QSM A;  2PJ9 A;  1IGB A;  5DWN A;  4Z65 A;  4QB9 A;  4Q36 A;  1OZP A;  2F5I A;  4UFW A;  4NGT A;  2J8R A;  4FD4 A;  2ATR A;  3B3V A;  1YQE A;  4OIW A;  3VWD A;  5BWA B;  1YLO A;  3DLJ A;  4CGL A;  2ZEN A;  2ZXV A;  5AG7 A;  1BLL E;  2PJ3 A;  3S6K A;  8CPA A;  2I3C A;  1J4J A;  3WR7 A;  4A38 A;  4EWT A;  4KOS A;  4MFL A;  2DF5 A;  3GKR A;  3KHZ A;  1XE4 A;  1V0C A;  1Z8L A;  3QAY A;  1S7L A;  2CY2 A;  1AYE A;  2NYQ A;  4XNH B;  1IID A;  2BCO A;  3KR4 A;  4ZX8 A;  1ARM A;  2VZZ A;  1IB1 E;  4MFJ A;  4KOT A;  4U9Y A;  1KWM A;  4KS9 A;  2AFU A;  2HUZ A;  1ELM P;  4LQ6 A;  2AFZ A;  2O4H A;  1IOF A;  1NSA A;  3FH4 A;  3GIU A;  4NEX A;  2FE7 A;  2B3U A;  1XEB A;  2B4D B;  2VQY A;  1ZG8 A;  3FEE A;  5G1Z A;  4JLY A;  2XEG A;  5K8M A;  4MXU A;  4OID A;  5HMN A;  1Y0Y A;  2PR1 A;  4CGM A;  2WPX A;  3RAM A;  2D4P A;  2PJB A;  2ZW6 A;  1YVK A;  5CNP A;  5K8O A;  1Z2L A;  4M6I A;  2ODF A;  2VL1 A;  3KZW A;  2NSM A;  3PRT A;  1H8L A;  4AG9 A;  4CPA A;  1I1D A;  2POK A;  4KSF A;  4U9Z A;  5THW A;  4RUH A;  2GLF A;  3SI1 A;  4CYN A;  3V38 A;  1Z4R A;  2Q51 A;  3PB7 X;  2ZPA A;  3TTH A;  1CG2 A;  2FIW A;  4UCP A;  1CP7 A;  3S6F A;  1LRZ A;  3NH4 A;  4NXY A;  4CYQ A;  3ISX A;  2OU2 A;  2IMO A;  4NGM A;  3GY9 A;  1YX0 A;  4YGO A;  4ONU A;  5E96 A;  3R9F A;  4A95 A;  4X5K A;  3KGQ A;  2F7V A;  4X2T A; 
#chains in the Genus database with same CATH homology
 4ZI6 A;  3S9N A;  2ZEE A;  2PVW A;  4IHM A;  1F57 A;  3T8W A;  3IC1 A;  3NH8 A;  3FEC A;  1XRY A;  3KQX A;  4ZYQ A;  2PIZ A;  3CT9 A;  4EME A;  4LQG A;  3FVL A;  2GRE A;  3H8G A;  1LAM A;  2C6P A;  3SI2 A;  1EE3 P;  1TF9 A;  2ABZ A;  2IJZ A;  2J9A A;  2PJ5 A;  3IO1 A;  5JM6 A;  2BOA A;  1PCA A;  3H8E A;  1ZG7 A;  3QNV A;  4P4I A;  3VAR A;  3WC6 A;  1CPX A;  4P4F A;  3B7I A;  2AFX A;  3D67 A;  3KAS A;  4FUU A;  2FVG A;  2PVV A;  2ZEG A;  4DUK A;  1YW6 A;  3D66 A;  2ZEM A;  1ZLH A;  2ZOG A;  3WC7 A;  3TX8 A;  5I4M A;  4MHP A;  3SJF A;  4FBE A;  4AXV A;  4ONW A;  4UF4 A;  4H2K A;  5LYF A;  3GB0 A;  5D8N A;  2WYR A;  3CPX A;  2V8G A;  3SI0 A;  4R6T A;  1HEE A;  3WAB A;  2PRQ A;  3KL9 A;  4P4D A;  3SJE A;  2CIJ A;  2PJC A;  1F2O A;  2ZEP A;  2AFM A;  1IY7 A;  3BXM A;  5ELY A;  5LRK A;  4OKO A;  4TNU A;  4MMO A;  2EK9 A;  2PJ4 A;  1FT7 A;  4OP4 A;  1BAV A;  1AMP A;  4EFD A;  3D4U A;  3LWU A;  1TF8 A;  4OME A;  4UIB A;  4F9U A;  1JQG A;  6CPA A;  3B2Y A;  3PB8 X;  4NGN A;  4OC5 A;  3KI9 A;  1R43 A;  1TKH A;  1YME A;  3S9L A;  2HC9 A;  2ZEL A;  3D7G A;  2ZOF A;  3SJX A;  4DJL A;  2PJ2 A;  5HVG A;  4Q7A A;  2GLJ A;  3JRU A;  4NFR A;  2QYV A;  2XEJ A;  3NA6 A;  2PJ7 A;  4P4J A;  5CPA A;  5LYD A;  2C1C A;  3VAT A;  1BPN A;  5K8N A;  2G9D A;  3DGV A;  3RBU A;  4A39 A;  2XEF A;  4NGR A;  4JZ0 A;  3S9M A;  3WT4 A;  1Z5R A;  4X8I A;  1TXR A;  3GUX A;  3N5F A;  2GU2 A;  1CBX A;  2CF4 A;  1ZG9 A;  4UEE A;  4WWV A;  4PPZ A;  1QMU A;  4B6Z A;  1Q7L A;  3H8F A;  4P10 A;  5HXD A;  4PQA A;  2PJ0 A;  3LMS A;  3BHX A;  4OC3 A;  2Q43 A;  1R3N A;  5JGF A;  4MHY A;  5LYI A;  1DE4 C;  3IJ3 A;  2ZEF A;  4PXB A;  1YSJ A;  4R76 A;  2EK8 A;  1XBU A;  1BPM A;  3NFZ A;  1CP6 A;  3PBB A;  4OC4 A;  1LAN A;  1VGY A;  2IQ6 A;  3WC5 A;  2JBK A;  1Y7E A;  2EWB A;  4PXE A;  1LOK A;  4NJR A;  1UWY A;  4ZY1 A;  4F9V A;  3HUV A;  2F8H A;  2JBJ A;  1FNO A;  2PJ8 A;  1HDQ A;  1HDU A;  5HVH A;  1OBR A;  3B3S A;  4MRI A;  4YWY A;  1QQ9 A;  2RB7 A;  3GLJ A;  4A37 A;  1VHO A;  4UIA A;  4K3N A;  3D7D A;  2ZED A;  3IIB A;  1XFO A;  4P4E A;  4PXD A;  2WZN A;  3PFO A;  2ANP A;  3SJG A;  3B3C A;  2JEW A;  4X3R A;  2AFO A;  3MRU A;  5IB9 A;  4NGS A;  3PB4 X;  4G1P A;  1VHE A;  4KSI A;  4R8F A;  4P6Y A;  4IAV A;  2QVP A;  2DEA A;  1DTD A;  4DYO A;  3FX6 A;  3ISZ A;  4ZY2 A;  1ELL P;  3BI0 A;  2PCU A;  5LYL A;  3D68 A;  4MCQ A;  2O53 A;  3FF3 A;  2OOT A;  3PBE A;  3K2K A;  3CPA A;  3PB9 X;  2V8D A;  3L2N A;  4O23 A;  4NGP A;  3KHX A;  4IK2 A;  4ZY0 A;  3VH9 A;  2C6G A;  1M4L A;  4P45 A;  2Q4Z A;  3K9T A;  3B3W A;  4TWE A;  3B35 A;  3I1U A;  5LRJ A;  2ZEO A;  5CBM A;  3IFE A;  1TKJ A;  3BI1 A;  4NGQ A;  1VIX A;  2V77 A;  2XEI A;  5DS0 A;  4OC1 A;  2V8H A;  5LRG A;  1LCP A;  3NH5 A;  1LAP A;  5D29 A;  2PJ6 A;  3FED A;  1XMB A;  1CPS A;  3KR5 A;  4YU9 A;  3PEI A;  4FAI A;  1ARL A;  4GM5 A;  1RTQ A;  2HB6 A;  4NJQ A;  4PXC A;  3PB6 X;  1GYT A;  1YW4 A;  2AFW A;  5J1Q A;  2OR4 A;  3HLP A;  2RFH A;  4UEZ A;  4P4B A;  1LFW A;  2PIY A;  2QJ8 A;  4MCS A;  4MHN A;  2AFS A;  3B3T A;  4F8Z A;  7CPA A;  3MN8 A;  1Y0R A;  1CX8 A;  5K8P A;  2ZEH A;  2C6C A;  4ZX9 A;  1PYT B;  4MCP A;  3V7Z A;  3FMC A;  4OC0 A;  4R7M A;  1XJO A;  3CDX A;  1ZLI A;  4W9Y A;  5HVF A;  2BO9 A;  2CTB A;  3PFE A;  3KQZ A;  2CTC A;  2PE3 A;  2PJ1 A;  3IWW A;  2V8V A;  5JH9 A;  3IEH A;  4P44 A;  3D7H A;  4OC2 A;  1TKF A;  4UEF A;  3D7F A;  3RZA A;  3TC8 A;  4MHZ A;  2PJA A;  4A94 A;  3FJU A;  4WJB A;  4JYW A;  4MCR A;  4BD9 A;  1F2P A;  5F09 A;  4FWU A;  2PJ9 A;  1IGB A;  4Z65 A;  4NGT A;  3B3V A;  4OIW A;  1YLO A;  3DLJ A;  2ZEN A;  1BLL E;  2PJ3 A;  8CPA A;  2I3C A;  4A38 A;  4EWT A;  3KHZ A;  1Z8L A;  1AYE A;  2NYQ A;  2BCO A;  3KR4 A;  4ZX8 A;  1ARM A;  1KWM A;  2AFU A;  1ELM P;  2AFZ A;  2O4H A;  3FH4 A;  1NSA A;  3FEE A;  1ZG8 A;  2XEG A;  5K8M A;  4MXU A;  4OID A;  1Y0Y A;  3RAM A;  2PJB A;  5K8O A;  1Z2L A;  2VL1 A;  3KZW A;  2NSM A;  3PRT A;  1H8L A;  4CPA A;  2POK A;  5THW A;  4RUH A;  2GLF A;  3SI1 A;  3V38 A;  2Q51 A;  3PB7 X;  1CG2 A;  1CP7 A;  3NH4 A;  3ISX A;  2IMO A;  4NGM A;  3KGQ A;  2F7V A;  4X2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...