1F2OA

Crystal structure of the streptomyces griseus aminopeptidase complexed with l-leucine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of Streptomyces griseus aminopeptidase with amino acid reaction products and their implications toward a catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE
total genus 107
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1f2oA00
1BPMA 1BLLE 2POKA 4OC0A 4ONWA 3B3WA 3S9NA 3D7HA 2PJBA 4FBEA 4ZX9A 1CPXA 2WZNA 2PVWA 3VH9A 4IAVA 1NSAA 2XEJA 5THWA 2PJ0A 3B3CA 4AXVA 2PIZA 4A94A 2JBKA 1DE4C 1ARMA 4F9VA 4A39A 3PB4X 1YLOA 1R3NA 1TKJA 3ISZA 5LRJA 4X3RA 4OC1A 2EK9A 3IO1A 4NFRA 2ZEMA 4ZX8A 2I3CA 1PYTB 3KHXA 1LAMA 2HB6A 2AFUA 2IMOA 3FX6A 2GREA 3HUVA 2J9AA 3VATA 3IC1A 2V8DA 3B3TA 2AFZA 3DGVA 3NH4A 5LYIA 4NGRA 1KWMA 1AYEA 1AMPA 2ZEGA 2PJ2A 3SI0A 3D67A 4ZYQA 4OMEA 1Z8LA 4UIAA 3WC6A 2Q43A 3FH4A 1VHOA 4UEZA 4CPAA 3PEIA 3FECA 5IB9A 2ABZA 3PRTA 1TKFA 5JM6A 4OKOA 4ZY0A 4X8IA 4YWYA 4MCRA 3KASA 2ZEEA 4P4FA 4P44A 3H8FA 1FNOA 2OR4A 4YU9A 4R76A 1FT7A 2GLJA 4A38A 4NGSA 1CBXA 2ANPA 2BOAA 4OP4A 2NYQA 4P4DA 4OC4A 4NGMA 4PXCA 4TWEA 1VIXA 2PRQA 4PQAA 1ZG7A 2Q51A 1F2OA 3SJEA 2BCOA 3D4UA 3NA6A 3WC7A 3D7GA 1Y7EA 3DLJA 2AFWA 3LWUA 2AFOA 3H8GA 1BPNA 1ARLA 3CT9A 2PJ8A 3IIBA 1ZLIA 1TF8A 2XEFA 3NFZA 4NJQA 3SJXA 3D68A 3RZAA 2V77A 4KSIA 2WYRA 4P4JA 1Y0RA 2ZOGA 4PXDA 3IEHA 4GM5A 3PB9X 2ZOFA 5CBMA 1Q7LA 1ZLHA 2V8HA 2QJ8A 4MCSA 3WC5A 3B2YA 3JRUA 3L2NA 4UF4A 4DJLA 2Q4ZA 2V8GA 8CPAA 3LMSA 4NGPA 4H2KA 3IJ3A 3KQXA 4PXBA 3QNVA 3GUXA 4MCPA 1HDUA 3RAMA 1TXRA 1LANA 3NH5A 1TF9A 4WJBA 5HVFA 3KHZA 1ELMP 2IQ6A 3PB6X 3BI0A 3B7IA 4FUUA 2GU2A 3D7FA 4MCQA 3MN8A 3N5FA 2O53A 3KZWA 2XEIA 4P4EA 3T8WA 1VGYA 2EWBA 3FEEA 4MHZA 5I4MA 4WWVA 3KGQA 5LYLA 2DEAA 3B35A 1XRYA 4TNUA 4UIBA 1CP6A 3D66A 4IK2A 5K8OA 3IFEA 3NH8A 3TC8A 1CG2A 1QQ9A 1YMEA 2O4HA 1UWYA 4ZI6A 3CPXA 4K3NA 4NGQA 1VHEA 2GLFA 4OIDA 2C6CA 1IGBA 4R7MA 3ISXA 4R6TA 1XMBA 4P4IA 3KR5A 2PJ6A 4P6YA 2C1CA 1HEEA 2C6PA 5K8MA 2F8HA 4MHNA 3KL9A 4OC5A 3BHXA 4NJRA 1DTDA 2HC9A 2ZENA 3K9TA 1ZG8A 5LRKA 2CF4A 3IWWA 2AFSA 2V8VA 1ZG9A 5JGFA 3SI1A 4DUKA 4JYWA 2RB7A 1F2PA 4EWTA 4B6ZA 2PIYA 2NSMA 3PB8X 3B3SA 4MXUA 1H8LA 1IY7A 3FMCA 4NGTA 2PJ1A 3MRUA 3PFEA 4A37A 2JBJA 4FWUA 1HDQA 4MMOA 4X2TA 4ZY1A 4Q7AA 1Z2LA 3H8EA 3TX8A 3S9LA 7CPAA 2PJ7A 5DS0A 4UEFA 1QMUA 2EK8A 1LFWA 3K2KA 2ZEFA 4R8FA 4ZY2A 5LRGA 1CP7A 4O23A 4BD9A 2ZEDA 5HXDA 3D7DA 3PB7X 5F09A 3SI2A 1LCPA 1Z5RA 2PJAA 2C6GA 2BO9A 2PE3A 4F8ZA 1BAVA 5D29A 4FAIA 1OBRA 2CIJA 3SJGA 2PJ9A 1XFOA 1F57A 3KR4A 1M4LA 3PFOA 5CPAA 4PXEA 2AFMA 4F9UA 3KQZA 4Z65A 2AFXA 1CPSA 2ZELA 4MRIA 4PPZA 3RBUA 2FVGA 1JQGA 4IHMA 3V7ZA 5J1QA 1LAPA 3SJFA 4MHYA 3V38A 3CDXA 2PCUA 2F7VA 4EFDA 4G1PA 4NGNA 1TKHA 1PCAA 2ZEPA 1YW4A 3GB0A 1EE3P 2XEGA 4RUHA 2IJZA 2PJCA 3PBEA 5HVGA 1LOKA 2PJ3A 1GYTA 1CX8A 2ZEHA 4OIWA 1XJOA 4W9YA 3CPAA 5HVHA 4LQGA 2QVPA 3HLPA 3PBBA 5ELYA 2ZEOA 1YSJA 2OOTA 5K8PA 1Y0YA 2QYVA 3FEDA 4UEEA 6CPAA 3GLJA 2RFHA 1RTQA 4EMEA 5D8NA 2CTBA 3WABA 4JZ0A 1ELLP 3WT4A 3VARA 3BI1A 3I1UA 3KI9A 4P4BA 3FJUA 3FVLA 5JH9A 5K8NA 4MHPA 5LYFA 2JEWA 4DYOA 4P45A 2CTCA 3BXMA 1XBUA 3FF3A 5LYDA 3B3VA 3S9MA 4P10A 2PJ5A 2PJ4A 1R43A 2G9DA 1YW6A 2PVVA 4OC2A 4OC3A 2VL1A
chains in the Genus database with same CATH superfamily
1BPMA 1BLLE 2POKA 2B3VA 4H6UA 4MFQA 3CXQA 1BOBA 1J4JA 3B3WA 2Q4YA 4ONWA 4F0YA 3S9NA 3D7HA 3EXNA 2PJBA 4LUAA 4FBEA 3IWGA 4ZX9A 4KLVA 1CPXA 4M3SA 4GS4A 2WZNA 2J8NA 2PVWA 3TCVA 3VH9A 4IAVA 5F49A 1NSAA 2XEJA 2VXKA 3BLNA 5THWA 2PJ0A 3B3CA 1MJBA 2FXFA 3LD2A 1S60A 4AXVA 4CYPA 4K30A 4PSWA 2PIZA 3FNCA 1X10A 3FRMA 3SHPA 4A94A 5C88A 3QAYA 1Y9KA 1IYLA 2JBKA 1DE4C 2QMLA 1ARMA 2WUUA 3IWEA 4XPDB 4A39A 2B4DB 4F9VA 4KOYA 3PB4X 2D4PA 2D4OA 1YLOA 1R3NA 4MI4A 4Q36A 1Z4EA 4CS0B 4KVOE 1TKJA 3ISZA 4F0XA 5LRJA 4X3RA 1AUGA 1BO4A 4OC1A 2EK9A 1Q2DA 3IO1A 4NFRA 1LRZA 2ZEMA 2I3CA 5GCNA 4MBUA 2GANA 4ZX8A 5KTCA 1PYTB 4MJ8A 3S6KA 4CYOA 3KHXA 4XPDC 4B13A 1NE9A 3F0AA 3IGRA 3OWCA 1XEBA 4GXHA 4AVAA 1MJ9A 2FS5A 1LAMA 2BUEA 5CNPA 2ZW4A 4HNWB 2HB6A 2AFUA 5DWMA 3TE4A 2FE7A 5G20A 2IMOA 3FX6A 2ARHA 4KVME 1YK3A 2OU2A 2FIWA 2GREA 4M6GA 3DNSA 2J9AA 3HUVA 1XIXA 4HNYB 3IC1A 2V8DA 3VATA 4B5PA 4CRZB 3B3TA 4A31A 2AFZA 3DGVA 2P6GA 4C7IA 3LACA 3NH4A 5LYIA 4YFJA 4NGRA 1KWMA 3W6SA 1AYEA 4ONUA 1AMPA 4PV6A 5H86A 3FYNA 2ZEGA 5G22A 2WPWA 1JWQA 5G21A 5A27A 2PJ2A 1M1DA 3SI0A 2CNSA 3D67A 4ZYQA 4OMEA 4A2ZA 3H5ZA 5JQ4A 1Z8LA 4UIAA 3WC6A 1S7KA 3N7ZA 2B58A 2Q43A 3KKWA 2EBJA 1QSMA 4QC6A 4RI1A 1A2ZA 1VHOA 3FH4A 4KOUA 4UEZA 4CPAA 3PEIA 2OZGA 3FECA 3PGPA 4KOVA 1L0CA 5IB9A 2ABZA 3PRTA 1TKFA 4J3GA 4KZTA 3DSBA 1IYKA 1B6BA 4B11A 5JM6A 4OKOA 4CAEA 2Z3LA 2BL1A 4X8IA 1Q2YA 4YWYA 4MCRA 2C27A 4ZY0A 3VWEA 3KASA 4LQ6A 2Z11A 2ZEEA 4P4FA 4P44A 4FD6A 3H8FA 2OR4A 1FNOA 3C26A 5AG6A 4L89A 2ATRA 1QSNA 2FIAA 4YU9A 4II9A 3I9SA 4R76A 1FT7A 2GLJA 1NSLA 1IOFA 4A38A 4NGSA 1CBXA 2ANPA 3SXOA 2BOAA 3P2HA 4OP4A 1I1DA 4CAWA 2NYQA 2OZHA 4JD6A 2P6EA 2PRBA 4P4DA 4OC4A 4CGOA 3JTKA 2ZXVA 4E8OA 4KS9A 4NGMA 4PXCA 3EC4A 4TWEA 1VIXA 2JDCA 4KLWA 2PRQA 1VHSA 4PK2A 1Y9WA 4PQAA 1ZG7A 2Q51A 4U5YA 4KVXA 2EVNA 1F2OA 2OH1A 1YREA 4UFXA 4R3LA 3SJEA 2BCOA 3D4UA 4Q38A 3NA6A 5AGEA 2NMTA 3WC7A 3D7GA 1Y7EA 3DLJA 2R1IA 4FD4A 3TO6A 2AFWA 3EY5A 3LWUA 1IOIA 2AFOA 3H8GA 1P4NA 1M44A 1BPNA 1ARLA 2PJ8A 2K5TA 2QIRA 3CT9A 2EO8A 3IIBA 1ZLIA 4JJXA 4B5PB 1XOVA 2DPTA 3LODA 1V0CA 2Z3PA 1TF8A 2B5GB 2XEFA 3R95A 3NFZA 3IU1A 2RC4A 4NJQA 3SJXA 4MY0A 4QBJA 1X12A 4HNXB 2GIVA 1YVOA 4NSQA 4A30A 3D68A 3RZAA 2V77A 4KSIA 2WYRA 4P4JA 4YRHA 4FD5A 1Y0RA 2ZOGA 4KOSA 4PXDA 1KUYA 3IEHA 3IU2A 4GM5A 3G8WA 3PB9X 2ZOFA 5CBMA 1MJAA 1WK4A 1M4DA 1Q7LA 1ZLHA 1Z9UA 2QJ8A 2V8HA 2YNCA 3ZZIA 3JVNA 4MCSA 4B10A 4AVBA 3WC5A 1GHEA 1M4IA 3B2YA 1YX0A 3JRUA 3L2NA 4UF4A 4DJLA 3BJ7A 2Q4ZA 4HPSA 2V8GA 3RO0A 3S6HA 1Z4RA 4JXRA 3LMSA 4NGPA 8CPAA 2B4DA 4H2KA 3IJ3A 5F47A 3KQXA 4PXBA 3QNVA 4UBRA 1YQEA 1ZO0A 3GUXA 4MCPA 1HDUA 3EFAA 1MK4A 3RAMA 1TXRA 1LANA 1N71A 2Z3MA 3NH5A 1TF9A 1IIDA 4WJBA 5HVFA 3KHZA 4B12A 5F46A 1I12A 1ELMP 2YNCC 2IQ6A 3PB6X 3BI0A 5IX3A 4AG9A 3B7IA 3A9LA 4FUUA 2GU2A 3D7FA 4KSAA 2ZW5A 3MN8A 4MCQA 2R7HA 2G0BA 3N5FA 2FL4A 2O53A 4MFLA 4RS2A 3W91A 3KZWA 4QVTA 2XEIA 4P4EA 2REFA 4LX9A 3T8WA 1VGYA 4IUSA 3NE8A 4XPKA 2EWBA 3FXTA 3FEEA 4MHZA 5I4MA 4WWVA 3KGQA 4BBHA 2Q44A 2DEAA 5LYLA 3B35A 2HV2A 2Q04A 1XRYA 4MFZA 2JEVA 4JXQA 2B3UA 4TNUA 3D8PA 4UIBA 1CP6A 3D66A 4IK2A 4KOXA 4R3KA 5K8OA 1RXTA 4CYNA 1IICA 1XMTA 1QSOA 3IFEA 3CZXA 3NH8A 3TC8A 4CGLA 2O28A 4A33A 1CG2A 2KCWA 4EVYA 1U6MA 1QQ9A 1YMEA 3D2PA 1B87A 2O4HA 3UY5A 1UWYA 2PC1A 4ZI6A 3F5BA 3CPXA 4K3NA 4NGQA 3S6GA 1VHEA 2GLFA 2REEA 1QSRA 4OIDA 4Y49C 3T90A 1VKCA 2C6CA 1IGBA 2VBQA 4R7MA 3ISXA 4R6TA 5J8FA 4X5KA 4AVCA 1XMBA 3I3GA 4NXYA 4P4IA 4B14A 3KR5A 4BINA 3D2MA 4MY3A 4NEXA 4MFKA 2PJ6A 4P6YA 2C1CA 1HEEA 2C6PA 4BMHA 5K8MA 2F8HA 2X7BA 1Z8WA 4MHNA 1P0HA 5IV0A 3KL9A 4OC5A 1S3ZA 3BHXA 4C7HA 4KUBA 3B8GA 4NJRA 4UWJA 4OAEA 5EC4A 2G3TA 1DTDA 2HC9A 2ZENA 3CXSA 3K9TA 3R9FA 3GY9A 1ZG8A 2VEZA 5LRKA 2CF4A 4DNCA 5C82A 3DR8A 3FIXA 3IWWA 4MHDA 2AFSA 1NMTA 1ZG9A 2V8VA 3TT2A 4H6ZA 2CNTA 5JGFA 3CXPA 2ODFA 3SI1A 3FB3A 4B5OA 1R57A 4A95A 4DUKA 4R57A 4JYWA 2PR8A 1QSTA 2PQ8A 1PUAA 1F2PA 2Q4VA 2RB7A 2Q7SA 4NF1A 4EWTA 4B6ZA 2PIYA 1Z8XA 2NSMA 3H4QA 4U9YA 4E0AA 3PB8X 2EUIA 3B3SA 4MXUA 4PK3A 1H8LA 3GKRA 2A4NA 5EMIA 1IY7A 3QAHA 3G3SA 4MFPA 5F48A 1K4JA 2F5IA 3BJ8A 2FSRA 2Z3OA 3FMCA 4NGTA 2PJ1A 3MRUA 4Y49B 3PFEA 4A37A 4KOTA 4UA3A 2PSWA 1OZPA 2JBJA 4FWUA 5G1ZA 4UCMA 1HDQA 2P6FA 2JDDA 4MMOA 4X2TA 4ZY1A 1KZFA 4Q7AA 1Z2LA 3H8EA 1Q2CA 1S7FA 1YR0A 2R98A 3TX8A 1WWZA 5KTAA 3S9LA 7CPAA 1FY7A 5AG4A 4AB7A 2GE3A 4RN7A 2PJ7A 5DS0A 1KUXA 3TFYA 4UEFA 2FT0A 2H5MA 4XNHC 2BSWA 4CAXA 1QMUA 1IB1E 4UWIA 1UFHA 5EBVA 2EK8A 4JWPA 3RYOA 1LFWA 3K2KA 5A28A 4L8AA 5I0CA 3GYAA 1YGHA 2ZEFA 4R8FA 4ZY2A 5LRGA 1CP7A 4IF5A 4O23A 2ZEDA 4BD9A 5HXDA 4UCNA 3SXNA 3D7DA 3PB7X 5F09A 3SI2A 4HKFA 1LCPA 5BWAB 1XE4A 2HUZA 2Z3KA 3TO9A 1Z5RA 2PJAA 2VI7A 2C6GA 2BO9A 2GFQA 2Q7BA 1I21A 2PE3A 2BEIA 2J8RA 3TTHA 5AG7A 4F8ZA 1BAVA 2DPSA 2CY2A 4M6IA 4R87A 5D29A 4CGPA 4FAIA 1OBRA 2CIJA 4M85A 3SJGA 1ON0A 2PJ9A 3WR7A 1XFOA 3DR6A 4CYQA 4C2ZA 3D3SA 1F57A 3KR4A 1M4LA 2ZW6A 3PFOA 1IU8A 4C2YA 3R96A 4OLLA 5CPAA 2FCKA 2JLMA 2I79A 2CXAA 4PXEA 2AFMA 4F9UA 3KQZA 2WPXA 3VWDA 2AFXA 1RO5A 4Z65A 1CPSA 2ZELA 4MRIA 4PPZA 3RBUA 4QUSA 1Y7RA 1JQGA 1PU9A 1YVKA 2FVGA 4IHMA 5FVJA 3V7ZA 5J1QA 4ORFA 3TO7A 1YLEA 1LAPA 3SJFA 4MHYA 3P2FA 4JLYA 4M6HA 3V38A 2HQYA 1KUVA 3ZJ0A 4CGNA 2OB0A 3V8IA 3CDXA 2PCUA 2F7VA 4EFDA 4FD7A 2AE6A 4G1PA 4OC0A 3S6FA 3QB8A 1TKHA 4NGNA 1CM0A 1PCAA 2ZEPA 3TOAA 4ZGYB 1YW4A 2PR1A 3E0KA 4C68A 4CGMA 5IB0A 3RNZA 4A32A 3GB0A 2YGWA 2P0WA 4NCZA 1EE3P 2XEGA 2IL4A 2PDOA 2Z3NA 5KTDA 4RUHA 1M4GA 4CAFA 2IJZA 2PJCA 3PBEA 5HVGA 1TIQA 1LOKA 2PJ3A 3MGDA 4KORA 1GYTA 2VZZA 1CX8A 2ZEHA 4OIWA 4XNHB 1XJOA 4W9YA 5H84A 2QECA 3CPAA 4MFJA 5DWNA 5HVHA 4H89A 3GIUA 4KUAA 2J8MA 3K9UA 4LQGA 2QVPA 3HLPA 3PBBA 4XPLA 5ELYA 1SQHA 2ZEOA 1S7NA 4F6AA 4OADA 2YNEA 2DF5A 1YSJA 3JUWA 4UFWA 2OOTA 3W6XA 1Y0YA 2ZPAA 2QYVA 5K8PA 3FEDA 4UEEA 1S7LA 6CPAA 2I00A 2OZUA 3GLJA 2RFHA 1RTQA 2ZW7A 4EMEA 4U9ZA 5D8NA 3DDDA 2CTBA 4CRYB 3R9GA 3WABA 4CAVA 4E2AA 2CNMA 4JZ0A 3R9EA 1ELLP 1XF8A 4PSXA 4YGOA 4ZBGA 3T9YA 2VZYA 3WT4A 3VARA 3BI1A 5J8CA 4KOWA 3R1KA 3I1UA 2YNDA 2G3AA 2Y0MA 3PP9A 3KI9A 5E96A 1S5KA 2Z10A 4P4BA 3FJUA 5HMNA 3FVLA 2Z0ZA 5HH1A 5JH9A 3NE7A 2WSAA 5K8NA 4MHPA 5LYFA 4R9MA 4UCPA 2Q0YA 4KSFA 1Z8TA 2JEWA 1CJWA 2B5GA 4DYOA 3F8KA 2CTCA 3BXMA 4P45A 3FBUA 5ISVA 2R8VA 1XBUA 3FF3A 5LYDA 3TOBA 3B3VA 3S9MA 4AG7A 2B4BA 2VQYA 4P10A 4QB9A 5JPHA 4UFVA 2DXQA 2PJ5A 2PJ4A 3PZJA 1R43A 3EO4A 2G9DA 1YW6A 4I49A 2AJ6A 2PVVA 5AG5A 4OC2A 4OC3A 4C2XA 2VL1A
chains in the Genus database with same CATH topology
1BPMA 1BLLE 2POKA 4OC0A 4ONWA 3B3WA 3S9NA 3D7HA 2PJBA 4FBEA 4ZX9A 1CPXA 2WZNA 2PVWA 3VH9A 4IAVA 1NSAA 2XEJA 5THWA 2PJ0A 3B3CA 4AXVA 2PIZA 4A94A 2JBKA 1DE4C 1ARMA 4F9VA 4A39A 3PB4X 1YLOA 1R3NA 1TKJA 3ISZA 5LRJA 4X3RA 4OC1A 2EK9A 3IO1A 4NFRA 2ZEMA 4ZX8A 2I3CA 1PYTB 3KHXA 1LAMA 2HB6A 2AFUA 2IMOA 3FX6A 2GREA 3HUVA 2J9AA 3VATA 3IC1A 2V8DA 3B3TA 2AFZA 3DGVA 3NH4A 5LYIA 4NGRA 1KWMA 1AYEA 1AMPA 2ZEGA 2PJ2A 3SI0A 3D67A 4ZYQA 4OMEA 1Z8LA 4UIAA 3WC6A 2Q43A 3FH4A 1VHOA 4UEZA 4CPAA 3PEIA 3FECA 5IB9A 2ABZA 3PRTA 1TKFA 5JM6A 4OKOA 4ZY0A 4X8IA 4YWYA 4MCRA 3KASA 2ZEEA 4P4FA 4P44A 3H8FA 1FNOA 2OR4A 4YU9A 4R76A 1FT7A 2GLJA 4A38A 4NGSA 1CBXA 2ANPA 2BOAA 4OP4A 2NYQA 4P4DA 4OC4A 4NGMA 4PXCA 4TWEA 1VIXA 2PRQA 4PQAA 1ZG7A 2Q51A 1F2OA 3SJEA 2BCOA 3D4UA 3NA6A 3WC7A 3D7GA 1Y7EA 3DLJA 2AFWA 3LWUA 2AFOA 3H8GA 1BPNA 1ARLA 3CT9A 2PJ8A 3IIBA 1ZLIA 1TF8A 2XEFA 3NFZA 4NJQA 3SJXA 3D68A 3RZAA 2V77A 4KSIA 2WYRA 4P4JA 1Y0RA 2ZOGA 4PXDA 3IEHA 4GM5A 3PB9X 2ZOFA 5CBMA 1Q7LA 1ZLHA 2V8HA 2QJ8A 4MCSA 3WC5A 3B2YA 3JRUA 3L2NA 4UF4A 4DJLA 2Q4ZA 2V8GA 8CPAA 3LMSA 4NGPA 4H2KA 3IJ3A 3KQXA 4PXBA 3QNVA 3GUXA 4MCPA 1HDUA 3RAMA 1TXRA 1LANA 3NH5A 1TF9A 4WJBA 5HVFA 3KHZA 1ELMP 2IQ6A 3PB6X 3BI0A 3B7IA 4FUUA 2GU2A 3D7FA 4MCQA 3MN8A 3N5FA 2O53A 3KZWA 2XEIA 4P4EA 3T8WA 1VGYA 2EWBA 3FEEA 4MHZA 5I4MA 4WWVA 3KGQA 5LYLA 2DEAA 3B35A 1XRYA 4TNUA 4UIBA 1CP6A 3D66A 4IK2A 5K8OA 3IFEA 3NH8A 3TC8A 1CG2A 1QQ9A 1YMEA 2O4HA 1UWYA 4ZI6A 3CPXA 4K3NA 4NGQA 1VHEA 2GLFA 4OIDA 2C6CA 1IGBA 4R7MA 3ISXA 4R6TA 1XMBA 4P4IA 3KR5A 2PJ6A 4P6YA 2C1CA 1HEEA 2C6PA 5K8MA 2F8HA 4MHNA 3KL9A 4OC5A 3BHXA 4NJRA 1DTDA 2HC9A 2ZENA 3K9TA 1ZG8A 5LRKA 2CF4A 3IWWA 2AFSA 2V8VA 1ZG9A 5JGFA 3SI1A 4DUKA 4JYWA 2RB7A 1F2PA 4EWTA 4B6ZA 2PIYA 2NSMA 3PB8X 3B3SA 4MXUA 1H8LA 1IY7A 3FMCA 4NGTA 2PJ1A 3MRUA 3PFEA 4A37A 2JBJA 4FWUA 1HDQA 4MMOA 4X2TA 4ZY1A 4Q7AA 1Z2LA 3H8EA 3TX8A 3S9LA 7CPAA 2PJ7A 5DS0A 4UEFA 1QMUA 2EK8A 1LFWA 3K2KA 2ZEFA 4R8FA 4ZY2A 5LRGA 1CP7A 4O23A 4BD9A 2ZEDA 5HXDA 3D7DA 3PB7X 5F09A 3SI2A 1LCPA 1Z5RA 2PJAA 2C6GA 2BO9A 2PE3A 4F8ZA 1BAVA 5D29A 4FAIA 1OBRA 2CIJA 3SJGA 2PJ9A 1XFOA 1F57A 3KR4A 1M4LA 3PFOA 5CPAA 4PXEA 2AFMA 4F9UA 3KQZA 4Z65A 2AFXA 1CPSA 2ZELA 4MRIA 4PPZA 3RBUA 2FVGA 1JQGA 4IHMA 3V7ZA 5J1QA 1LAPA 3SJFA 4MHYA 3V38A 3CDXA 2PCUA 2F7VA 4EFDA 4G1PA 4NGNA 1TKHA 1PCAA 2ZEPA 1YW4A 3GB0A 1EE3P 2XEGA 4RUHA 2IJZA 2PJCA 3PBEA 5HVGA 1LOKA 2PJ3A 1GYTA 1CX8A 2ZEHA 4OIWA 1XJOA 4W9YA 3CPAA 5HVHA 4LQGA 2QVPA 3HLPA 3PBBA 5ELYA 2ZEOA 1YSJA 2OOTA 5K8PA 1Y0YA 2QYVA 3FEDA 4UEEA 6CPAA 3GLJA 2RFHA 1RTQA 4EMEA 5D8NA 2CTBA 3WABA 4JZ0A 1ELLP 3WT4A 3VARA 3BI1A 3I1UA 3KI9A 4P4BA 3FJUA 3FVLA 5JH9A 5K8NA 4MHPA 5LYFA 2JEWA 4DYOA 4P45A 2CTCA 3BXMA 1XBUA 3FF3A 5LYDA 3B3VA 3S9MA 4P10A 2PJ5A 2PJ4A 1R43A 2G9DA 1YW6A 2PVVA 4OC2A 4OC3A 2VL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPM A;  1BLL E;  2POK A;  4OC0 A;  4ONW A;  3B3W A;  3S9N A;  3D7H A;  2PJB A;  4FBE A;  4ZX9 A;  1CPX A;  2WZN A;  2PVW A;  3VH9 A;  4IAV A;  1NSA A;  2XEJ A;  5THW A;  2PJ0 A;  3B3C A;  4AXV A;  2PIZ A;  4A94 A;  2JBK A;  1DE4 C;  1ARM A;  4F9V A;  4A39 A;  3PB4 X;  1YLO A;  1R3N A;  1TKJ A;  3ISZ A;  5LRJ A;  4X3R A;  4OC1 A;  2EK9 A;  3IO1 A;  4NFR A;  2ZEM A;  4ZX8 A;  2I3C A;  1PYT B;  3KHX A;  1LAM A;  2HB6 A;  2AFU A;  2IMO A;  3FX6 A;  2GRE A;  3HUV A;  2J9A A;  3VAT A;  3IC1 A;  2V8D A;  3B3T A;  2AFZ A;  3DGV A;  3NH4 A;  5LYI A;  4NGR A;  1KWM A;  1AYE A;  1AMP A;  2ZEG A;  2PJ2 A;  3SI0 A;  3D67 A;  4ZYQ A;  4OME A;  1Z8L A;  4UIA A;  3WC6 A;  2Q43 A;  3FH4 A;  1VHO A;  4UEZ A;  4CPA A;  3PEI A;  3FEC A;  5IB9 A;  2ABZ A;  3PRT A;  1TKF A;  5JM6 A;  4OKO A;  4ZY0 A;  4X8I A;  4YWY A;  4MCR A;  3KAS A;  2ZEE A;  4P4F A;  4P44 A;  3H8F A;  1FNO A;  2OR4 A;  4YU9 A;  4R76 A;  1FT7 A;  2GLJ A;  4A38 A;  4NGS A;  1CBX A;  2ANP A;  2BOA A;  4OP4 A;  2NYQ A;  4P4D A;  4OC4 A;  4NGM A;  4PXC A;  4TWE A;  1VIX A;  2PRQ A;  4PQA A;  1ZG7 A;  2Q51 A;  1F2O A;  3SJE A;  2BCO A;  3D4U A;  3NA6 A;  3WC7 A;  3D7G A;  1Y7E A;  3DLJ A;  2AFW A;  3LWU A;  2AFO A;  3H8G A;  1BPN A;  1ARL A;  3CT9 A;  2PJ8 A;  3IIB A;  1ZLI A;  1TF8 A;  2XEF A;  3NFZ A;  4NJQ A;  3SJX A;  3D68 A;  3RZA A;  2V77 A;  4KSI A;  2WYR A;  4P4J A;  1Y0R A;  2ZOG A;  4PXD A;  3IEH A;  4GM5 A;  3PB9 X;  2ZOF A;  5CBM A;  1Q7L A;  1ZLH A;  2V8H A;  2QJ8 A;  4MCS A;  3WC5 A;  3B2Y A;  3JRU A;  3L2N A;  4UF4 A;  4DJL A;  2Q4Z A;  2V8G A;  8CPA A;  3LMS A;  4NGP A;  4H2K A;  3IJ3 A;  3KQX A;  4PXB A;  3QNV A;  3GUX A;  4MCP A;  1HDU A;  3RAM A;  1TXR A;  1LAN A;  3NH5 A;  1TF9 A;  4WJB A;  5HVF A;  3KHZ A;  1ELM P;  2IQ6 A;  3PB6 X;  3BI0 A;  3B7I A;  4FUU A;  2GU2 A;  3D7F A;  4MCQ A;  3MN8 A;  3N5F A;  2O53 A;  3KZW A;  2XEI A;  4P4E A;  3T8W A;  1VGY A;  2EWB A;  3FEE A;  4MHZ A;  5I4M A;  4WWV A;  3KGQ A;  5LYL A;  2DEA A;  3B35 A;  1XRY A;  4TNU A;  4UIB A;  1CP6 A;  3D66 A;  4IK2 A;  5K8O A;  3IFE A;  3NH8 A;  3TC8 A;  1CG2 A;  1QQ9 A;  1YME A;  2O4H A;  1UWY A;  4ZI6 A;  3CPX A;  4K3N A;  4NGQ A;  1VHE A;  2GLF A;  4OID A;  2C6C A;  1IGB A;  4R7M A;  3ISX A;  4R6T A;  1XMB A;  4P4I A;  3KR5 A;  2PJ6 A;  4P6Y A;  2C1C A;  1HEE A;  2C6P A;  5K8M A;  2F8H A;  4MHN A;  3KL9 A;  4OC5 A;  3BHX A;  4NJR A;  1DTD A;  2HC9 A;  2ZEN A;  3K9T A;  1ZG8 A;  5LRK A;  2CF4 A;  3IWW A;  2AFS A;  2V8V A;  1ZG9 A;  5JGF A;  3SI1 A;  4DUK A;  4JYW A;  2RB7 A;  1F2P A;  4EWT A;  4B6Z A;  2PIY A;  2NSM A;  3PB8 X;  3B3S A;  4MXU A;  1H8L A;  1IY7 A;  3FMC A;  4NGT A;  2PJ1 A;  3MRU A;  3PFE A;  4A37 A;  2JBJ A;  4FWU A;  1HDQ A;  4MMO A;  4X2T A;  4ZY1 A;  4Q7A A;  1Z2L A;  3H8E A;  3TX8 A;  3S9L A;  7CPA A;  2PJ7 A;  5DS0 A;  4UEF A;  1QMU A;  2EK8 A;  1LFW A;  3K2K A;  2ZEF A;  4R8F A;  4ZY2 A;  5LRG A;  1CP7 A;  4O23 A;  4BD9 A;  2ZED A;  5HXD A;  3D7D A;  3PB7 X;  5F09 A;  3SI2 A;  1LCP A;  1Z5R A;  2PJA A;  2C6G A;  2BO9 A;  2PE3 A;  4F8Z A;  1BAV A;  5D29 A;  4FAI A;  1OBR A;  2CIJ A;  3SJG A;  2PJ9 A;  1XFO A;  1F57 A;  3KR4 A;  1M4L A;  3PFO A;  5CPA A;  4PXE A;  2AFM A;  4F9U A;  3KQZ A;  4Z65 A;  2AFX A;  1CPS A;  2ZEL A;  4MRI A;  4PPZ A;  3RBU A;  2FVG A;  1JQG A;  4IHM A;  3V7Z A;  5J1Q A;  1LAP A;  3SJF A;  4MHY A;  3V38 A;  3CDX A;  2PCU A;  2F7V A;  4EFD A;  4G1P A;  4NGN A;  1TKH A;  1PCA A;  2ZEP A;  1YW4 A;  3GB0 A;  1EE3 P;  2XEG A;  4RUH A;  2IJZ A;  2PJC A;  3PBE A;  5HVG A;  1LOK A;  2PJ3 A;  1GYT A;  1CX8 A;  2ZEH A;  4OIW A;  1XJO A;  4W9Y A;  3CPA A;  5HVH A;  4LQG A;  2QVP A;  3HLP A;  3PBB A;  5ELY A;  2ZEO A;  1YSJ A;  2OOT A;  5K8P A;  1Y0Y A;  2QYV A;  3FED A;  4UEE A;  6CPA A;  3GLJ A;  2RFH A;  1RTQ A;  4EME A;  5D8N A;  2CTB A;  3WAB A;  4JZ0 A;  1ELL P;  3WT4 A;  3VAR A;  3BI1 A;  3I1U A;  3KI9 A;  4P4B A;  3FJU A;  3FVL A;  5JH9 A;  5K8N A;  4MHP A;  5LYF A;  2JEW A;  4DYO A;  4P45 A;  2CTC A;  3BXM A;  1XBU A;  3FF3 A;  5LYD A;  3B3V A;  3S9M A;  4P10 A;  2PJ5 A;  2PJ4 A;  1R43 A;  2G9D A;  1YW6 A;  2PVV A;  4OC2 A;  4OC3 A;  2VL1 A; 
#chains in the Genus database with same CATH topology
 1BPM A;  1BLL E;  2POK A;  2B3V A;  4H6U A;  4MFQ A;  3CXQ A;  1BOB A;  1J4J A;  3B3W A;  2Q4Y A;  4ONW A;  4F0Y A;  3S9N A;  3D7H A;  3EXN A;  2PJB A;  4LUA A;  4FBE A;  3IWG A;  4ZX9 A;  4KLV A;  1CPX A;  4M3S A;  4GS4 A;  2WZN A;  2J8N A;  2PVW A;  3TCV A;  3VH9 A;  4IAV A;  5F49 A;  1NSA A;  2XEJ A;  2VXK A;  3BLN A;  5THW A;  2PJ0 A;  3B3C A;  1MJB A;  2FXF A;  3LD2 A;  1S60 A;  4AXV A;  4CYP A;  4K30 A;  4PSW A;  2PIZ A;  3FNC A;  1X10 A;  3FRM A;  3SHP A;  4A94 A;  5C88 A;  3QAY A;  1Y9K A;  1IYL A;  2JBK A;  1DE4 C;  2QML A;  1ARM A;  2WUU A;  3IWE A;  4XPD B;  4A39 A;  2B4D B;  4F9V A;  4KOY A;  3PB4 X;  2D4P A;  2D4O A;  1YLO A;  1R3N A;  4MI4 A;  4Q36 A;  1Z4E A;  4CS0 B;  4KVO E;  1TKJ A;  3ISZ A;  4F0X A;  5LRJ A;  4X3R A;  1AUG A;  1BO4 A;  4OC1 A;  2EK9 A;  1Q2D A;  3IO1 A;  4NFR A;  1LRZ A;  2ZEM A;  2I3C A;  5GCN A;  4MBU A;  2GAN A;  4ZX8 A;  5KTC A;  1PYT B;  4MJ8 A;  3S6K A;  4CYO A;  3KHX A;  4XPD C;  4B13 A;  1NE9 A;  3F0A A;  3IGR A;  3OWC A;  1XEB A;  4GXH A;  4AVA A;  1MJ9 A;  2FS5 A;  1LAM A;  2BUE A;  5CNP A;  2ZW4 A;  4HNW B;  2HB6 A;  2AFU A;  5DWM A;  3TE4 A;  2FE7 A;  5G20 A;  2IMO A;  3FX6 A;  2ARH A;  4KVM E;  1YK3 A;  2OU2 A;  2FIW A;  2GRE A;  4M6G A;  3DNS A;  2J9A A;  3HUV A;  1XIX A;  4HNY B;  3IC1 A;  2V8D A;  3VAT A;  4B5P A;  4CRZ B;  3B3T A;  4A31 A;  2AFZ A;  3DGV A;  2P6G A;  4C7I A;  3LAC A;  3NH4 A;  5LYI A;  4YFJ A;  4NGR A;  1KWM A;  3W6S A;  1AYE A;  4ONU A;  1AMP A;  4PV6 A;  5H86 A;  3FYN A;  2ZEG A;  5G22 A;  2WPW A;  1JWQ A;  5G21 A;  5A27 A;  2PJ2 A;  1M1D A;  3SI0 A;  2CNS A;  3D67 A;  4ZYQ A;  4OME A;  4A2Z A;  3H5Z A;  5JQ4 A;  1Z8L A;  4UIA A;  3WC6 A;  1S7K A;  3N7Z A;  2B58 A;  2Q43 A;  3KKW A;  2EBJ A;  1QSM A;  4QC6 A;  4RI1 A;  1A2Z A;  1VHO A;  3FH4 A;  4KOU A;  4UEZ A;  4CPA A;  3PEI A;  2OZG A;  3FEC A;  3PGP A;  4KOV A;  1L0C A;  5IB9 A;  2ABZ A;  3PRT A;  1TKF A;  4J3G A;  4KZT A;  3DSB A;  1IYK A;  1B6B A;  4B11 A;  5JM6 A;  4OKO A;  4CAE A;  2Z3L A;  2BL1 A;  4X8I A;  1Q2Y A;  4YWY A;  4MCR A;  2C27 A;  4ZY0 A;  3VWE A;  3KAS A;  4LQ6 A;  2Z11 A;  2ZEE A;  4P4F A;  4P44 A;  4FD6 A;  3H8F A;  2OR4 A;  1FNO A;  3C26 A;  5AG6 A;  4L89 A;  2ATR A;  1QSN A;  2FIA A;  4YU9 A;  4II9 A;  3I9S A;  4R76 A;  1FT7 A;  2GLJ A;  1NSL A;  1IOF A;  4A38 A;  4NGS A;  1CBX A;  2ANP A;  3SXO A;  2BOA A;  3P2H A;  4OP4 A;  1I1D A;  4CAW A;  2NYQ A;  2OZH A;  4JD6 A;  2P6E A;  2PRB A;  4P4D A;  4OC4 A;  4CGO A;  3JTK A;  2ZXV A;  4E8O A;  4KS9 A;  4NGM A;  4PXC A;  3EC4 A;  4TWE A;  1VIX A;  2JDC A;  4KLW A;  2PRQ A;  1VHS A;  4PK2 A;  1Y9W A;  4PQA A;  1ZG7 A;  2Q51 A;  4U5Y A;  4KVX A;  2EVN A;  1F2O A;  2OH1 A;  1YRE A;  4UFX A;  4R3L A;  3SJE A;  2BCO A;  3D4U A;  4Q38 A;  3NA6 A;  5AGE A;  2NMT A;  3WC7 A;  3D7G A;  1Y7E A;  3DLJ A;  2R1I A;  4FD4 A;  3TO6 A;  2AFW A;  3EY5 A;  3LWU A;  1IOI A;  2AFO A;  3H8G A;  1P4N A;  1M44 A;  1BPN A;  1ARL A;  2PJ8 A;  2K5T A;  2QIR A;  3CT9 A;  2EO8 A;  3IIB A;  1ZLI A;  4JJX A;  4B5P B;  1XOV A;  2DPT A;  3LOD A;  1V0C A;  2Z3P A;  1TF8 A;  2B5G B;  2XEF A;  3R95 A;  3NFZ A;  3IU1 A;  2RC4 A;  4NJQ A;  3SJX A;  4MY0 A;  4QBJ A;  1X12 A;  4HNX B;  2GIV A;  1YVO A;  4NSQ A;  4A30 A;  3D68 A;  3RZA A;  2V77 A;  4KSI A;  2WYR A;  4P4J A;  4YRH A;  4FD5 A;  1Y0R A;  2ZOG A;  4KOS A;  4PXD A;  1KUY A;  3IEH A;  3IU2 A;  4GM5 A;  3G8W A;  3PB9 X;  2ZOF A;  5CBM A;  1MJA A;  1WK4 A;  1M4D A;  1Q7L A;  1ZLH A;  1Z9U A;  2QJ8 A;  2V8H A;  2YNC A;  3ZZI A;  3JVN A;  4MCS A;  4B10 A;  4AVB A;  3WC5 A;  1GHE A;  1M4I A;  3B2Y A;  1YX0 A;  3JRU A;  3L2N A;  4UF4 A;  4DJL A;  3BJ7 A;  2Q4Z A;  4HPS A;  2V8G A;  3RO0 A;  3S6H A;  1Z4R A;  4JXR A;  3LMS A;  4NGP A;  8CPA A;  2B4D A;  4H2K A;  3IJ3 A;  5F47 A;  3KQX A;  4PXB A;  3QNV A;  4UBR A;  1YQE A;  1ZO0 A;  3GUX A;  4MCP A;  1HDU A;  3EFA A;  1MK4 A;  3RAM A;  1TXR A;  1LAN A;  1N71 A;  2Z3M A;  3NH5 A;  1TF9 A;  1IID A;  4WJB A;  5HVF A;  3KHZ A;  4B12 A;  5F46 A;  1I12 A;  1ELM P;  2YNC C;  2IQ6 A;  3PB6 X;  3BI0 A;  5IX3 A;  4AG9 A;  3B7I A;  3A9L A;  4FUU A;  2GU2 A;  3D7F A;  4KSA A;  2ZW5 A;  3MN8 A;  4MCQ A;  2R7H A;  2G0B A;  3N5F A;  2FL4 A;  2O53 A;  4MFL A;  4RS2 A;  3W91 A;  3KZW A;  4QVT A;  2XEI A;  4P4E A;  2REF A;  4LX9 A;  3T8W A;  1VGY A;  4IUS A;  3NE8 A;  4XPK A;  2EWB A;  3FXT A;  3FEE A;  4MHZ A;  5I4M A;  4WWV A;  3KGQ A;  4BBH A;  2Q44 A;  2DEA A;  5LYL A;  3B35 A;  2HV2 A;  2Q04 A;  1XRY A;  4MFZ A;  2JEV A;  4JXQ A;  2B3U A;  4TNU A;  3D8P A;  4UIB A;  1CP6 A;  3D66 A;  4IK2 A;  4KOX A;  4R3K A;  5K8O A;  1RXT A;  4CYN A;  1IIC A;  1XMT A;  1QSO A;  3IFE A;  3CZX A;  3NH8 A;  3TC8 A;  4CGL A;  2O28 A;  4A33 A;  1CG2 A;  2KCW A;  4EVY A;  1U6M A;  1QQ9 A;  1YME A;  3D2P A;  1B87 A;  2O4H A;  3UY5 A;  1UWY A;  2PC1 A;  4ZI6 A;  3F5B A;  3CPX A;  4K3N A;  4NGQ A;  3S6G A;  1VHE A;  2GLF A;  2REE A;  1QSR A;  4OID A;  4Y49 C;  3T90 A;  1VKC A;  2C6C A;  1IGB A;  2VBQ A;  4R7M A;  3ISX A;  4R6T A;  5J8F A;  4X5K A;  4AVC A;  1XMB A;  3I3G A;  4NXY A;  4P4I A;  4B14 A;  3KR5 A;  4BIN A;  3D2M A;  4MY3 A;  4NEX A;  4MFK A;  2PJ6 A;  4P6Y A;  2C1C A;  1HEE A;  2C6P A;  4BMH A;  5K8M A;  2F8H A;  2X7B A;  1Z8W A;  4MHN A;  1P0H A;  5IV0 A;  3KL9 A;  4OC5 A;  1S3Z A;  3BHX A;  4C7H A;  4KUB A;  3B8G A;  4NJR A;  4UWJ A;  4OAE A;  5EC4 A;  2G3T A;  1DTD A;  2HC9 A;  2ZEN A;  3CXS A;  3K9T A;  3R9F A;  3GY9 A;  1ZG8 A;  2VEZ A;  5LRK A;  2CF4 A;  4DNC A;  5C82 A;  3DR8 A;  3FIX A;  3IWW A;  4MHD A;  2AFS A;  1NMT A;  1ZG9 A;  2V8V A;  3TT2 A;  4H6Z A;  2CNT A;  5JGF A;  3CXP A;  2ODF A;  3SI1 A;  3FB3 A;  4B5O A;  1R57 A;  4A95 A;  4DUK A;  4R57 A;  4JYW A;  2PR8 A;  1QST A;  2PQ8 A;  1PUA A;  1F2P A;  2Q4V A;  2RB7 A;  2Q7S A;  4NF1 A;  4EWT A;  4B6Z A;  2PIY A;  1Z8X A;  2NSM A;  3H4Q A;  4U9Y A;  4E0A A;  3PB8 X;  2EUI A;  3B3S A;  4MXU A;  4PK3 A;  1H8L A;  3GKR A;  2A4N A;  5EMI A;  1IY7 A;  3QAH A;  3G3S A;  4MFP A;  5F48 A;  1K4J A;  2F5I A;  3BJ8 A;  2FSR A;  2Z3O A;  3FMC A;  4NGT A;  2PJ1 A;  3MRU A;  4Y49 B;  3PFE A;  4A37 A;  4KOT A;  4UA3 A;  2PSW A;  1OZP A;  2JBJ A;  4FWU A;  5G1Z A;  4UCM A;  1HDQ A;  2P6F A;  2JDD A;  4MMO A;  4X2T A;  4ZY1 A;  1KZF A;  4Q7A A;  1Z2L A;  3H8E A;  1Q2C A;  1S7F A;  1YR0 A;  2R98 A;  3TX8 A;  1WWZ A;  5KTA A;  3S9L A;  7CPA A;  1FY7 A;  5AG4 A;  4AB7 A;  2GE3 A;  4RN7 A;  2PJ7 A;  5DS0 A;  1KUX A;  3TFY A;  4UEF A;  2FT0 A;  2H5M A;  4XNH C;  2BSW A;  4CAX A;  1QMU A;  1IB1 E;  4UWI A;  1UFH A;  5EBV A;  2EK8 A;  4JWP A;  3RYO A;  1LFW A;  3K2K A;  5A28 A;  4L8A A;  5I0C A;  3GYA A;  1YGH A;  2ZEF A;  4R8F A;  4ZY2 A;  5LRG A;  1CP7 A;  4IF5 A;  4O23 A;  2ZED A;  4BD9 A;  5HXD A;  4UCN A;  3SXN A;  3D7D A;  3PB7 X;  5F09 A;  3SI2 A;  4HKF A;  1LCP A;  5BWA B;  1XE4 A;  2HUZ A;  2Z3K A;  3TO9 A;  1Z5R A;  2PJA A;  2VI7 A;  2C6G A;  2BO9 A;  2GFQ A;  2Q7B A;  1I21 A;  2PE3 A;  2BEI A;  2J8R A;  3TTH A;  5AG7 A;  4F8Z A;  1BAV A;  2DPS A;  2CY2 A;  4M6I A;  4R87 A;  5D29 A;  4CGP A;  4FAI A;  1OBR A;  2CIJ A;  4M85 A;  3SJG A;  1ON0 A;  2PJ9 A;  3WR7 A;  1XFO A;  3DR6 A;  4CYQ A;  4C2Z A;  3D3S A;  1F57 A;  3KR4 A;  1M4L A;  2ZW6 A;  3PFO A;  1IU8 A;  4C2Y A;  3R96 A;  4OLL A;  5CPA A;  2FCK A;  2JLM A;  2I79 A;  2CXA A;  4PXE A;  2AFM A;  4F9U A;  3KQZ A;  2WPX A;  3VWD A;  2AFX A;  1RO5 A;  4Z65 A;  1CPS A;  2ZEL A;  4MRI A;  4PPZ A;  3RBU A;  4QUS A;  1Y7R A;  1JQG A;  1PU9 A;  1YVK A;  2FVG A;  4IHM A;  5FVJ A;  3V7Z A;  5J1Q A;  4ORF A;  3TO7 A;  1YLE A;  1LAP A;  3SJF A;  4MHY A;  3P2F A;  4JLY A;  4M6H A;  3V38 A;  2HQY A;  1KUV A;  3ZJ0 A;  4CGN A;  2OB0 A;  3V8I A;  3CDX A;  2PCU A;  2F7V A;  4EFD A;  4FD7 A;  2AE6 A;  4G1P A;  4OC0 A;  3S6F A;  3QB8 A;  1TKH A;  4NGN A;  1CM0 A;  1PCA A;  2ZEP A;  3TOA A;  4ZGY B;  1YW4 A;  2PR1 A;  3E0K A;  4C68 A;  4CGM A;  5IB0 A;  3RNZ A;  4A32 A;  3GB0 A;  2YGW A;  2P0W A;  4NCZ A;  1EE3 P;  2XEG A;  2IL4 A;  2PDO A;  2Z3N A;  5KTD A;  4RUH A;  1M4G A;  4CAF A;  2IJZ A;  2PJC A;  3PBE A;  5HVG A;  1TIQ A;  1LOK A;  2PJ3 A;  3MGD A;  4KOR A;  1GYT A;  2VZZ A;  1CX8 A;  2ZEH A;  4OIW A;  4XNH B;  1XJO A;  4W9Y A;  5H84 A;  2QEC A;  3CPA A;  4MFJ A;  5DWN A;  5HVH A;  4H89 A;  3GIU A;  4KUA A;  2J8M A;  3K9U A;  4LQG A;  2QVP A;  3HLP A;  3PBB A;  4XPL A;  5ELY A;  1SQH A;  2ZEO A;  1S7N A;  4F6A A;  4OAD A;  2YNE A;  2DF5 A;  1YSJ A;  3JUW A;  4UFW A;  2OOT A;  3W6X A;  1Y0Y A;  2ZPA A;  2QYV A;  5K8P A;  3FED A;  4UEE A;  1S7L A;  6CPA A;  2I00 A;  2OZU A;  3GLJ A;  2RFH A;  1RTQ A;  2ZW7 A;  4EME A;  4U9Z A;  5D8N A;  3DDD A;  2CTB A;  4CRY B;  3R9G A;  3WAB A;  4CAV A;  4E2A A;  2CNM A;  4JZ0 A;  3R9E A;  1ELL P;  1XF8 A;  4PSX A;  4YGO A;  4ZBG A;  3T9Y A;  2VZY A;  3WT4 A;  3VAR A;  3BI1 A;  5J8C A;  4KOW A;  3R1K A;  3I1U A;  2YND A;  2G3A A;  2Y0M A;  3PP9 A;  3KI9 A;  5E96 A;  1S5K A;  2Z10 A;  4P4B A;  3FJU A;  5HMN A;  3FVL A;  2Z0Z A;  5HH1 A;  5JH9 A;  3NE7 A;  2WSA A;  5K8N A;  4MHP A;  5LYF A;  4R9M A;  4UCP A;  2Q0Y A;  4KSF A;  1Z8T A;  2JEW A;  1CJW A;  2B5G A;  4DYO A;  3F8K A;  2CTC A;  3BXM A;  4P45 A;  3FBU A;  5ISV A;  2R8V A;  1XBU A;  3FF3 A;  5LYD A;  3TOB A;  3B3V A;  3S9M A;  4AG7 A;  2B4B A;  2VQY A;  4P10 A;  4QB9 A;  5JPH A;  4UFV A;  2DXQ A;  2PJ5 A;  2PJ4 A;  3PZJ A;  1R43 A;  3EO4 A;  2G9D A;  1YW6 A;  4I49 A;  2AJ6 A;  2PVV A;  5AG5 A;  4OC2 A;  4OC3 A;  4C2X A;  2VL1 A; 
#chains in the Genus database with same CATH homology
 1BPM A;  1BLL E;  2POK A;  4OC0 A;  4ONW A;  3B3W A;  3S9N A;  3D7H A;  2PJB A;  4FBE A;  4ZX9 A;  1CPX A;  2WZN A;  2PVW A;  3VH9 A;  4IAV A;  1NSA A;  2XEJ A;  5THW A;  2PJ0 A;  3B3C A;  4AXV A;  2PIZ A;  4A94 A;  2JBK A;  1DE4 C;  1ARM A;  4F9V A;  4A39 A;  3PB4 X;  1YLO A;  1R3N A;  1TKJ A;  3ISZ A;  5LRJ A;  4X3R A;  4OC1 A;  2EK9 A;  3IO1 A;  4NFR A;  2ZEM A;  4ZX8 A;  2I3C A;  1PYT B;  3KHX A;  1LAM A;  2HB6 A;  2AFU A;  2IMO A;  3FX6 A;  2GRE A;  3HUV A;  2J9A A;  3VAT A;  3IC1 A;  2V8D A;  3B3T A;  2AFZ A;  3DGV A;  3NH4 A;  5LYI A;  4NGR A;  1KWM A;  1AYE A;  1AMP A;  2ZEG A;  2PJ2 A;  3SI0 A;  3D67 A;  4ZYQ A;  4OME A;  1Z8L A;  4UIA A;  3WC6 A;  2Q43 A;  3FH4 A;  1VHO A;  4UEZ A;  4CPA A;  3PEI A;  3FEC A;  5IB9 A;  2ABZ A;  3PRT A;  1TKF A;  5JM6 A;  4OKO A;  4ZY0 A;  4X8I A;  4YWY A;  4MCR A;  3KAS A;  2ZEE A;  4P4F A;  4P44 A;  3H8F A;  1FNO A;  2OR4 A;  4YU9 A;  4R76 A;  1FT7 A;  2GLJ A;  4A38 A;  4NGS A;  1CBX A;  2ANP A;  2BOA A;  4OP4 A;  2NYQ A;  4P4D A;  4OC4 A;  4NGM A;  4PXC A;  4TWE A;  1VIX A;  2PRQ A;  4PQA A;  1ZG7 A;  2Q51 A;  1F2O A;  3SJE A;  2BCO A;  3D4U A;  3NA6 A;  3WC7 A;  3D7G A;  1Y7E A;  3DLJ A;  2AFW A;  3LWU A;  2AFO A;  3H8G A;  1BPN A;  1ARL A;  3CT9 A;  2PJ8 A;  3IIB A;  1ZLI A;  1TF8 A;  2XEF A;  3NFZ A;  4NJQ A;  3SJX A;  3D68 A;  3RZA A;  2V77 A;  4KSI A;  2WYR A;  4P4J A;  1Y0R A;  2ZOG A;  4PXD A;  3IEH A;  4GM5 A;  3PB9 X;  2ZOF A;  5CBM A;  1Q7L A;  1ZLH A;  2V8H A;  2QJ8 A;  4MCS A;  3WC5 A;  3B2Y A;  3JRU A;  3L2N A;  4UF4 A;  4DJL A;  2Q4Z A;  2V8G A;  8CPA A;  3LMS A;  4NGP A;  4H2K A;  3IJ3 A;  3KQX A;  4PXB A;  3QNV A;  3GUX A;  4MCP A;  1HDU A;  3RAM A;  1TXR A;  1LAN A;  3NH5 A;  1TF9 A;  4WJB A;  5HVF A;  3KHZ A;  1ELM P;  2IQ6 A;  3PB6 X;  3BI0 A;  3B7I A;  4FUU A;  2GU2 A;  3D7F A;  4MCQ A;  3MN8 A;  3N5F A;  2O53 A;  3KZW A;  2XEI A;  4P4E A;  3T8W A;  1VGY A;  2EWB A;  3FEE A;  4MHZ A;  5I4M A;  4WWV A;  3KGQ A;  5LYL A;  2DEA A;  3B35 A;  1XRY A;  4TNU A;  4UIB A;  1CP6 A;  3D66 A;  4IK2 A;  5K8O A;  3IFE A;  3NH8 A;  3TC8 A;  1CG2 A;  1QQ9 A;  1YME A;  2O4H A;  1UWY A;  4ZI6 A;  3CPX A;  4K3N A;  4NGQ A;  1VHE A;  2GLF A;  4OID A;  2C6C A;  1IGB A;  4R7M A;  3ISX A;  4R6T A;  1XMB A;  4P4I A;  3KR5 A;  2PJ6 A;  4P6Y A;  2C1C A;  1HEE A;  2C6P A;  5K8M A;  2F8H A;  4MHN A;  3KL9 A;  4OC5 A;  3BHX A;  4NJR A;  1DTD A;  2HC9 A;  2ZEN A;  3K9T A;  1ZG8 A;  5LRK A;  2CF4 A;  3IWW A;  2AFS A;  2V8V A;  1ZG9 A;  5JGF A;  3SI1 A;  4DUK A;  4JYW A;  2RB7 A;  1F2P A;  4EWT A;  4B6Z A;  2PIY A;  2NSM A;  3PB8 X;  3B3S A;  4MXU A;  1H8L A;  1IY7 A;  3FMC A;  4NGT A;  2PJ1 A;  3MRU A;  3PFE A;  4A37 A;  2JBJ A;  4FWU A;  1HDQ A;  4MMO A;  4X2T A;  4ZY1 A;  4Q7A A;  1Z2L A;  3H8E A;  3TX8 A;  3S9L A;  7CPA A;  2PJ7 A;  5DS0 A;  4UEF A;  1QMU A;  2EK8 A;  1LFW A;  3K2K A;  2ZEF A;  4R8F A;  4ZY2 A;  5LRG A;  1CP7 A;  4O23 A;  4BD9 A;  2ZED A;  5HXD A;  3D7D A;  3PB7 X;  5F09 A;  3SI2 A;  1LCP A;  1Z5R A;  2PJA A;  2C6G A;  2BO9 A;  2PE3 A;  4F8Z A;  1BAV A;  5D29 A;  4FAI A;  1OBR A;  2CIJ A;  3SJG A;  2PJ9 A;  1XFO A;  1F57 A;  3KR4 A;  1M4L A;  3PFO A;  5CPA A;  4PXE A;  2AFM A;  4F9U A;  3KQZ A;  4Z65 A;  2AFX A;  1CPS A;  2ZEL A;  4MRI A;  4PPZ A;  3RBU A;  2FVG A;  1JQG A;  4IHM A;  3V7Z A;  5J1Q A;  1LAP A;  3SJF A;  4MHY A;  3V38 A;  3CDX A;  2PCU A;  2F7V A;  4EFD A;  4G1P A;  4NGN A;  1TKH A;  1PCA A;  2ZEP A;  1YW4 A;  3GB0 A;  1EE3 P;  2XEG A;  4RUH A;  2IJZ A;  2PJC A;  3PBE A;  5HVG A;  1LOK A;  2PJ3 A;  1GYT A;  1CX8 A;  2ZEH A;  4OIW A;  1XJO A;  4W9Y A;  3CPA A;  5HVH A;  4LQG A;  2QVP A;  3HLP A;  3PBB A;  5ELY A;  2ZEO A;  1YSJ A;  2OOT A;  5K8P A;  1Y0Y A;  2QYV A;  3FED A;  4UEE A;  6CPA A;  3GLJ A;  2RFH A;  1RTQ A;  4EME A;  5D8N A;  2CTB A;  3WAB A;  4JZ0 A;  1ELL P;  3WT4 A;  3VAR A;  3BI1 A;  3I1U A;  3KI9 A;  4P4B A;  3FJU A;  3FVL A;  5JH9 A;  5K8N A;  4MHP A;  5LYF A;  2JEW A;  4DYO A;  4P45 A;  2CTC A;  3BXM A;  1XBU A;  3FF3 A;  5LYD A;  3B3V A;  3S9M A;  4P10 A;  2PJ5 A;  2PJ4 A;  1R43 A;  2G9D A;  1YW6 A;  2PVV A;  4OC2 A;  4OC3 A;  2VL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...