1F2OA

Crystal structure of the streptomyces griseus aminopeptidase complexed with l-leucine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of Streptomyces griseus aminopeptidase with amino acid reaction products and their implications toward a catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE
total genus 107
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1f2oA00
3BHXA 3KZWA 3PRTA 3PB6X 2NYQA 2RFHA 4R6TA 2QJ8A 3SI0A 2C6PA 1JQGA 1XRYA 3TX8A 3L2NA 4P4EA 2PRQA 3PB7X 3B2YA 3GB0A 4OC0A 1Y7EA 4R76A 1PCAA 1F2OA 2QVPA 1LAPA 4FAIA 5HVGA 2HC9A 4KSIA 3MRUA 4IHMA 4NGSA 1YLOA 4MCQA 3SI2A 4OMEA 3HLPA 2EK8A 3RAMA 4MHNA 1CPXA 4AXVA 4OIDA 4OIWA 4P6YA 4O23A 3KASA 4JYWA 1TF8A 2PJ9A 2CF4A 3RZAA 4EWTA 2CTBA 1CP6A 4PXEA 3IEHA 1Z2LA 2F8HA 5LYLA 2Q4ZA 4NFRA 2PJ0A 3IJ3A 2PCUA 3BI0A 4B6ZA 1IY7A 4MXUA 3KR4A 4Q7AA 2JBKA 2PJ8A 2GU2A 5IB9A 1R3NA 2PJ6A 4X3RA 4MRIA 4NJQA 2CIJA 2PJAA 2ZOFA 2AFWA 1LFWA 3K9TA 1AMPA 2ZENA 3K2KA 3GLJA 2PJ7A 5LRJA 4ZX9A 3S9MA 1YW6A 2PJ4A 3BI1A 1YSJA 3NH4A 3WC6A 4NGRA 5F09A 3HUVA 2PIZA 2ABZA 3IFEA 1Y0RA 1TF9A 4GM5A 1TXRA 4DUKA 2C1CA 4G1PA 3FMCA 5LYDA 4F8ZA 4NGMA 3N5FA 3PEIA 1VHEA 4X8IA 3IWWA 2AFZA 4ZX8A 5LRKA 5JM6A 2V8GA 1BLLE 2ZEEA 2AFMA 1CX8A 1XMBA 3JRUA 4PPZA 2PJ3A 2ZEGA 1ZLHA 5K8PA 4P4DA 5CBMA 2PIYA 3NH8A 2BOAA 4JZ0A 3B3TA 3CDXA 3D7GA 1GYTA 2EK9A 5DS0A 3FH4A 4OC1A 3D7HA 5HXDA 4UIAA 3RBUA 3PB8X 2XEIA 4UIBA 5LRGA 1LOKA 1TKJA 3B7IA 3V38A 4A38A 3FJUA 2ZELA 4WJBA 1DE4C 2I3CA 2IMOA 3H8EA 3ISZA 3B3CA 4OC2A 4PXBA 4FUUA 2F7VA 2JEWA 4OC5A 2O53A 4A37A 4K3NA 1ARLA 1F2PA 3KQZA 3V7ZA 4R7MA 2QYVA 4Z65A 3KGQA 1CG2A 5J1QA 4IK2A 3SJFA 4MCRA 3SJEA 1PYTB 3WC5A 3PBEA 1YMEA 3D67A 4UEZA 2WZNA 3SI1A 3KR5A 4MHYA 1TKHA 4F9UA 2V77A 1VGYA 4A94A 4P4BA 1IGBA 1ZG9A 2CTCA 5ELYA 3S9LA 2IJZA 2AFOA 7CPAA 4P4FA 4OC3A 1EE3P 4IAVA 3NA6A 2ZEOA 4MCSA 3GUXA 1AYEA 1M4LA 5D29A 4PXDA 4TNUA 3NFZA 3WT4A 4DJLA 3KL9A 4OP4A 4ZY0A 4ZY1A 2PJ5A 2Q43A 2WYRA 2NSMA 3NH5A 3B3SA 2XEFA 4PQAA 2J9AA 2ZEHA 4MHPA 3CPXA 4TWEA 1KWMA 4A39A 2AFXA 3IIBA 4EFDA 3D68A 4MCPA 3IO1A 3I1UA 1QQ9A 1YW4A 5HVFA 2PJ1A 2PVVA 4P4JA 1R43A 1Y0YA 6CPAA 4EMEA 4LQGA 4NGTA 1BPMA 1QMUA 1ZG8A 2BO9A 2Q51A 1LCPA 4YWYA 1DTDA 1RTQA 3KI9A 4MMOA 1H8LA 5LYIA 5HVHA 3PBBA 4UEEA 2C6CA 3PFEA 1FT7A 2PJ2A 4PXCA 2FVGA 3B3VA 3FVLA 5K8MA 3D66A 4NGNA 3FECA 5CPAA 1XBUA 2ANPA 3B3WA 5LYFA 1XFOA 4ONWA 1Q7LA 1VHOA 5JGFA 1VIXA 3TC8A 5I4MA 3WC7A 4OKOA 3DLJA 4P44A 1CBXA 2ZEPA 1HEEA 3IC1A 2V8VA 3SJXA 2PJCA 4UEFA 2GLJA 3CT9A 1CPSA 2VL1A 1BAVA 3D7DA 4P45A 3B35A 1Z5RA 3FF3A 4UF4A 3MN8A 5K8OA 2XEGA 1NSAA 2ZEDA 1TKFA 2AFSA 1ELLP 4WWVA 2HB6A 3SJGA 3S9NA 1UWYA 1XJOA 1HDQA 2IQ6A 2EWBA 4ZYQA 3D4UA 1ZLIA 2PJBA 2OOTA 4H2KA 5D8NA 4OC4A 3FX6A 3VARA 3LMSA 4X2TA 3PFOA 1BPNA 1LAMA 4FWUA 2ZEFA 4NGPA 4P4IA 3T8WA 1LANA 4MHZA 1OBRA 4ZI6A 3KQXA 4FBEA 1ZG7A 2PE3A 3BXMA 3QNVA 3CPAA 2GREA 4DYOA 2OR4A 4R8FA 2GLFA 2DEAA 5K8NA 3H8FA 2ZEMA 2O4HA 2BCOA 2RB7A 4NJRA 1F57A 3LWUA 2XEJA 2ZOGA 3DGVA 1Z8LA 1ELMP 3H8GA 3VH9A 4YU9A 3FEDA 1ARMA 1HDUA 3KHXA 4BD9A 4ZY2A 1CP7A 2V8HA 2AFUA 3VATA 3PB9X 5JH9A 5THWA 4NGQA 4W9YA 2PVWA 2POKA 2G9DA 4RUHA 3PB4X 1FNOA 2JBJA 3ISXA 3KHZA 2C6GA 4P10A 4CPAA 8CPAA 3D7FA 3WABA 2V8DA 4F9VA 3FEEA
chains in the Genus database with same CATH superfamily
4LUAA 3BHXA 4M6HA 1L0CA 2Z0ZA 1XIXA 3KZWA 3PRTA 3R96A 4CS0B 4C2XA 3PB6X 2NYQA 2RFHA 4R6TA 2QJ8A 3SI0A 2I79A 2C6PA 4BBHA 4KOUA 1JQGA 5C88A 1IU8A 1XRYA 3TX8A 2CXAA 4A95A 3L2NA 4H6UA 4P4EA 4R9MA 2J8RA 2CNTA 3P2FA 4H6ZA 1JWQA 2PRQA 2FSRA 2Z3PA 4Q36A 3PB7X 4CRZB 3B2YA 3GB0A 4OC0A 1WK4A 1Y7EA 1SQHA 4R76A 2ZPAA 2KCWA 3PZJA 1PCAA 3D3SA 2B3UA 1F2OA 4B12A 1QSNA 2QVPA 1LAPA 4FAIA 5HVGA 3UY5A 2HC9A 4KORA 4KSIA 4A31A 1IB1E 3FYNA 3MRUA 4IHMA 2FE7A 3RO0A 5C82A 3W91A 4QB9A 2G0BA 1S60A 1QSRA 4NGSA 1YLOA 4MCQA 3SI2A 4OMEA 2DPTA 4RS2A 4U9YA 4XNHC 4B5PA 1S3ZA 3HLPA 2EK8A 3RAMA 4MHNA 2ARHA 1CPXA 4AXVA 4OIDA 3TO7A 1ON0A 4KSAA 4OIWA 4M85A 4P6YA 4O23A 3KASA 4CGNA 4JYWA 4KOYA 4C2ZA 4R57A 1TF8A 4BINA 2PJ9A 4E2AA 4M3SA 4UBRA 2CF4A 5H86A 3RZAA 2Q44A 2B5GB 2EUIA 2GFQA 2CTBA 4EWTA 1CP6A 1PU9A 4PXEA 3IEHA 1Z2LA 2OH1A 2F8HA 4CAEA 3S6GA 4UCMA 4ZBGA 5LYLA 2EO8A 3T9YA 2B58A 4UFXA 2ZW5A 2VZZA 2D4PA 2Q4ZA 3SHPA 4NFRA 3FXTA 3R95A 3TOAA 1Q2YA 2PJ0A 3IJ3A 4AVBA 2HQYA 3I9SA 3TFYA 5HMNA 4A2ZA 2A4NA 3G3SA 2PCUA 3BI0A 4A30A 1I1DA 1M4IA 4B6ZA 4MFQA 1B87A 5E96A 1IY7A 2R98A 1MJ9A 4MXUA 1IIDA 4KOWA 3KR4A 4CGOA 4Q7AA 2JBKA 2PJ8A 2GU2A 4OAEA 5IB9A 4B14A 1R3NA 4E0AA 2PJ6A 1Z4RA 1IOFA 4X3RA 4MRIA 5H84A 3VWDA 4NJQA 2CIJA 4CAVA 3D2MA 5BWAB 2PJAA 2ZOFA 2AFWA 2WPXA 1MK4A 1LFWA 3K9TA 1AMPA 4KVOE 3JUWA 2ZENA 3K2KA 1YVOA 3GLJA 5JPHA 2Z3LA 2YGWA 4YFJA 4XNHB 3SXOA 4C7IA 3S6FA 2PJ7A 3W6SA 4CYOA 5A27A 4M6GA 5LRJA 4ZX9A 3S9MA 1M1DA 1YW6A 2PJ4A 3BI1A 2DPSA 3PGPA 3TO6A 1YSJA 1XEBA 2WUUA 2VQYA 2EBJA 2J8MA 4II9A 3NH4A 1NE9A 3WC6A 4NGRA 5F09A 4UCNA 4U5YA 3HUVA 1Z4EA 2PIZA 2OZGA 2ABZA 1IICA 2JDCA 3GIUA 3IFEA 3TOBA 5G22A 2GIVA 1Y0RA 3QAHA 1S7NA 1TF9A 4GM5A 4DNCA 3FNCA 1TXRA 2GE3A 4KSFA 4Y49B 3R9EA 4DUKA 2C1CA 4G1PA 3FMCA 4QUSA 4KS9A 2IL4A 3F5BA 5LYDA 4F8ZA 4NGMA 3N5FA 2NMTA 2OZHA 3PEIA 2AE6A 1VHEA 2Z3NA 4X8IA 1Z8XA 5G21A 3IWWA 2AFZA 4ZX8A 4CAFA 4QBJA 5LRKA 2VBQA 2V8GA 2BL1A 5JM6A 1BLLE 1A2ZA 2ZEEA 5F46A 2AFMA 1CX8A 1XMBA 3D2PA 3JRUA 4PPZA 4AVCA 2OU2A 2PJ3A 2ZEGA 3BJ7A 2PR1A 1ZLHA 4RN7A 2ATRA 2Z10A 1P0HA 5K8PA 1RO5A 4P4DA 5IV0A 1OZPA 5CBMA 2PIYA 3NH8A 3DR8A 3EY5A 2BOAA 4M6IA 3DNSA 3B3TA 3CDXA 3CZXA 1GYTA 3D7GA 1I21A 4JZ0A 1LRZA 3TTHA 2EK9A 5DS0A 3FH4A 4OADA 4OC1A 2HV2A 3D7HA 3GY9A 4KOXA 2YNCC 5HXDA 3NE8A 2I00A 4LQ6A 2K5TA 3DR6A 1YVKA 4UIAA 3RBUA 4ZGYB 3PB8X 4CGLA 2XEIA 1GHEA 4UIBA 1LOKA 1TKJA 3B7IA 2PDOA 3IGRA 5LRGA 3V38A 4A38A 3FJUA 5G1ZA 1KUXA 5HH1A 2J8NA 2ZELA 1Q2DA 4WJBA 1DE4C 3IWGA 1IYLA 4FD7A 4HNWB 3TE4A 2I3CA 4FD5A 2IMOA 5DWMA 3TO9A 3H8EA 3FBUA 3ISZA 5F48A 3B3CA 1KUVA 2R8VA 1VHSA 4OC2A 4PXBA 1M44A 4FUUA 5EC4A 3S6HA 5FVJA 4KVXA 4ORFA 4HNXB 2F7VA 2JEWA 4E8OA 4OC5A 2O53A 2BEIA 1BO4A 4LX9A 4A37A 4K3NA 1S5KA 5IB0A 1I12A 1ARLA 1F2PA 2Z11A 2QMLA 3KQZA 2OZUA 3V7ZA 4R7MA 2HUZA 1M4DA 2QYVA 4KZTA 4UWIA 4Z65A 3H4QA 3KGQA 1CG2A 5J1QA 2QECA 1UFHA 4IK2A 3RNZA 3SJFA 4B11A 1MJBA 2G3AA 3IWEA 4MCRA 3SJEA 4B5PB 5KTCA 1PYTB 3H5ZA 2P6FA 3G8WA 3R9FA 3WC5A 3F0AA 3PBEA 4JXRA 1YMEA 3D67A 4R87A 2WZNA 4UEZA 3SI1A 3KR5A 5AG4A 4CYQA 4MHYA 1TKHA 4F9UA 2V77A 4AB7A 2BSWA 1VGYA 1YLEA 2PSWA 3EFAA 4P4BA 1IGBA 1Z8WA 1ZG9A 4A94A 4F0YA 2CTCA 2ZXVA 5ELYA 2IJZA 3S9LA 2AFOA 4NXYA 3DSBA 1V0CA 4C7HA 7CPAA 5F49A 4OC3A 1EE3P 4P4FA 4IAVA 3NA6A 5AG5A 2ZEOA 2D4OA 3IU2A 2B5GA 4MCSA 4UCPA 4XPKA 4UFVA 1XOVA 2Z3OA 5AG7A 3GUXA 1AYEA 1M4LA 5D29A 3I3GA 4PXDA 1AUGA 2O28A 4TNUA 3NFZA 4KLVA 3WT4A 4DJLA 4HKFA 3KL9A 4OP4A 4CGPA 1YGHA 4ZY0A 4ZY1A 2PJ5A 2PRBA 2JDDA 4H89A 2VXKA 4KUBA 2Q43A 2WYRA 2NSMA 3E0KA 3NH5A 4B10A 2Q4VA 3B3SA 2XEFA 1PUAA 2ZW7A 4PQAA 2ZW4A 1P4NA 2OB0A 2B4DB 3R1KA 2J9AA 2ZEHA 3SXNA 4MHPA 5GCNA 5EBVA 3W6XA 4FD4A 1KUYA 1WWZA 3CPXA 4TWEA 4XPLA 2WSAA 3C26A 1KWMA 5ISVA 1YK3A 2Q0YA 2YNCA 2RC4A 2AFXA 4A39A 4C2YA 3IIBA 4EFDA 4PK3A 1J4JA 3FIXA 4UWJA 4EVYA 3D68A 3BJ8A 4MCPA 4KOSA 3IO1A 3CXPA 1BOBA 4X5KA 2PQ8A 3I1UA 1QQ9A 1YW4A 5HVFA 2PJ1A 3K9UA 3GYAA 4K30A 2PVVA 4P4JA 1R43A 1Y0YA 6CPAA 3EO4A 4MFZA 3R9GA 4EMEA 4NCZA 3EXNA 4LQGA 4NGTA 3DDDA 1BPMA 2EVNA 4JXQA 1QMUA 1ZG8A 2G3TA 1QSMA 4FD6A 2BO9A 2FCKA 2Q04A 2Q7SA 4A32A 2DXQA 3LACA 4JJXA 1N71A 4MY3A 2Q51A 1LCPA 4RI1A 1DTDA 4JLYA 4YWYA 4B13A 4CGMA 5KTDA 1RTQA 2FT0A 3KI9A 3KKWA 4MHDA 4MMOA 3T90A 1H8LA 2Q4YA 3VWEA 5LYIA 5HVHA 3ZJ0A 3PBBA 4UEEA 2Z3KA 4IF5A 1S7FA 2ODFA 2VI7A 2C6CA 3PFEA 1FT7A 3QAYA 2B4BA 3JVNA 2PJ2A 2JLMA 1B6BA 4MY0A 4PXCA 4R3LA 3ZZIA 4J3GA 5G20A 3OWCA 2FVGA 3RYOA 3B3VA 4JD6A 1NMTA 4MFJA 3FVLA 5K8MA 3D66A 3IU1A 2DF5A 4NGNA 4CYPA 1R57A 3FECA 2PC1A 5CPAA 1X10A 1XBUA 2FS5A 2ANPA 2FL4A 3B3WA 4KLWA 5LYFA 1XMTA 4HNYB 1XFOA 4ONWA 1Q7LA 1KZFA 1XF8A 1VHOA 2H5MA 4KOTA 1K4JA 2Z3MA 3QB8A 1ZO0A 5F47A 5JGFA 1X12A 1VIXA 3TC8A 5I4MA 5KTAA 3WC7A 2REFA 3LODA 4OKOA 2GANA 3DLJA 1YX0A 1MJAA 2C27A 4P44A 1S7LA 3B8GA 4UA3A 1CBXA 2ZEPA 1HEEA 3IC1A 4PSWA 4PSXA 2V8VA 3SJXA 4CAWA 2PJCA 4UEFA 5EMIA 4IUSA 4PV6A 2B4DA 4MFKA 2GLJA 3JTKA 1FY7A 2WPWA 1TIQA 3CT9A 1Q2CA 2VEZA 1CPSA 2R7HA 3BLNA 4Q38A 2FIAA 4MI4A 1NSLA 2VL1A 1BAVA 3D7DA 4P45A 1IYKA 4MJ8A 3B35A 1Z5RA 2P6EA 4F0XA 2X7BA 4JWPA 3FF3A 4UF4A 3MN8A 3D8PA 5K8OA 5J8CA 1CM0A 2XEGA 1NSAA 2ZEDA 4UFWA 1TKFA 3MGDA 4A33A 4CAXA 2AFSA 1ELLP 4AVAA 2CNMA 4WWVA 2HB6A 3S6KA 3SJGA 3CXSA 3S9NA 4PK2A 1UWYA 1XJOA 1HDQA 4KVME 2JEVA 4AG7A 1Z9UA 5AGEA 2IQ6A 2EWBA 2YNEA 2CY2A 2REEA 4ZYQA 4MFLA 4QVTA 2YNDA 3D4UA 1ZLIA 4NEXA 1RXTA 1Y7RA 2PJBA 4H2KA 2OOTA 5D8NA 4XPDB 3NE7A 4OC4A 4XPDC 3FX6A 3VARA 3LMSA 4X2TA 1U6MA 3PFOA 1BPNA 1LAMA 2QIRA 2ZEFA 4FWUA 3A9LA 3EC4A 4NGPA 4P4IA 1Z8TA 1QSTA 1S7KA 4YGOA 3T8WA 1LANA 4MHZA 1OBRA 4ZI6A 4GS4A 1Y9WA 4I49A 3KQXA 4FBEA 1ZG7A 5I0CA 4NF1A 3FB3A 2PE3A 3BXMA 1M4GA 3QNVA 3CPAA 2Q7BA 2GREA 4Y49C 4F6AA 3LD2A 4CYNA 1XE4A 4L89A 2OR4A 4MFPA 4DYOA 4R8FA 4OLLA 2GLFA 5IX3A 2DEAA 2P0WA 3PP9A 1YR0A 2PR8A 2CNSA 5K8NA 3F8KA 2Y0MA 3H8FA 2BUEA 2ZEMA 5J8FA 4U9ZA 2VZYA 3TT2A 2O4HA 4KUAA 2BCOA 2RB7A 2AJ6A 4NJRA 1F57A 1VKCA 5AG6A 3LWUA 2XEJA 4CRYB 2ZOGA 3DGVA 2P6GA 4L8AA 4YRHA 1Z8LA 5JQ4A 5A28A 1ELMP 4B5OA 3V8IA 5DWNA 3H8GA 3VH9A 4YU9A 1QSOA 2F5IA 3GKRA 3FEDA 1ARMA 2R1IA 4MBUA 1HDUA 3KHXA 4BD9A 4ZY2A 3CXQA 3N7ZA 4QC6A 1CP7A 2V8HA 4BMHA 5CNPA 2AFUA 3VATA 4HPSA 2FIWA 1CJWA 3PB9X 4NSQA 3TCVA 5JH9A 2FXFA 3P2HA 5THWA 4NGQA 1YREA 4W9YA 1Y9KA 4C68A 4KOVA 2PVWA 2POKA 2G9DA 4AG9A 4RUHA 3PB4X 4R3KA 2JBJA 1FNOA 1YQEA 2B3VA 3ISXA 1IOIA 2C6GA 3KHZA 4GXHA 4P10A 4CPAA 8CPAA 3WR7A 3D7FA 3FRMA 3WABA 2V8DA 2ZW6A 4F9VA 4ONUA 3FEEA
chains in the Genus database with same CATH topology
3BHXA 3KZWA 3PRTA 3PB6X 2NYQA 2RFHA 4R6TA 2QJ8A 3SI0A 2C6PA 1JQGA 1XRYA 3TX8A 3L2NA 4P4EA 2PRQA 3PB7X 3B2YA 3GB0A 4OC0A 1Y7EA 4R76A 1PCAA 1F2OA 2QVPA 1LAPA 4FAIA 5HVGA 2HC9A 4KSIA 3MRUA 4IHMA 4NGSA 1YLOA 4MCQA 3SI2A 4OMEA 3HLPA 2EK8A 3RAMA 4MHNA 1CPXA 4AXVA 4OIDA 4OIWA 4P6YA 4O23A 3KASA 4JYWA 1TF8A 2PJ9A 2CF4A 3RZAA 4EWTA 2CTBA 1CP6A 4PXEA 3IEHA 1Z2LA 2F8HA 5LYLA 2Q4ZA 4NFRA 2PJ0A 3IJ3A 2PCUA 3BI0A 4B6ZA 1IY7A 4MXUA 3KR4A 4Q7AA 2JBKA 2PJ8A 2GU2A 5IB9A 1R3NA 2PJ6A 4X3RA 4MRIA 4NJQA 2CIJA 2PJAA 2ZOFA 2AFWA 1LFWA 3K9TA 1AMPA 2ZENA 3K2KA 3GLJA 2PJ7A 5LRJA 4ZX9A 3S9MA 1YW6A 2PJ4A 3BI1A 1YSJA 3NH4A 3WC6A 4NGRA 5F09A 3HUVA 2PIZA 2ABZA 3IFEA 1Y0RA 1TF9A 4GM5A 1TXRA 4DUKA 2C1CA 4G1PA 3FMCA 5LYDA 4F8ZA 4NGMA 3N5FA 3PEIA 1VHEA 4X8IA 3IWWA 2AFZA 4ZX8A 5LRKA 5JM6A 2V8GA 1BLLE 2ZEEA 2AFMA 1CX8A 1XMBA 3JRUA 4PPZA 2PJ3A 2ZEGA 1ZLHA 5K8PA 4P4DA 5CBMA 2PIYA 3NH8A 2BOAA 4JZ0A 3B3TA 3CDXA 3D7GA 1GYTA 2EK9A 5DS0A 3FH4A 4OC1A 3D7HA 5HXDA 4UIAA 3RBUA 3PB8X 2XEIA 4UIBA 5LRGA 1LOKA 1TKJA 3B7IA 3V38A 4A38A 3FJUA 2ZELA 4WJBA 1DE4C 2I3CA 2IMOA 3H8EA 3ISZA 3B3CA 4OC2A 4PXBA 4FUUA 2F7VA 2JEWA 4OC5A 2O53A 4A37A 4K3NA 1ARLA 1F2PA 3KQZA 3V7ZA 4R7MA 2QYVA 4Z65A 3KGQA 1CG2A 5J1QA 4IK2A 3SJFA 4MCRA 3SJEA 1PYTB 3WC5A 3PBEA 1YMEA 3D67A 4UEZA 2WZNA 3SI1A 3KR5A 4MHYA 1TKHA 4F9UA 2V77A 1VGYA 4A94A 4P4BA 1IGBA 1ZG9A 2CTCA 5ELYA 3S9LA 2IJZA 2AFOA 7CPAA 4P4FA 4OC3A 1EE3P 4IAVA 3NA6A 2ZEOA 4MCSA 3GUXA 1AYEA 1M4LA 5D29A 4PXDA 4TNUA 3NFZA 3WT4A 4DJLA 3KL9A 4OP4A 4ZY0A 4ZY1A 2PJ5A 2Q43A 2WYRA 2NSMA 3NH5A 3B3SA 2XEFA 4PQAA 2J9AA 2ZEHA 4MHPA 3CPXA 4TWEA 1KWMA 4A39A 2AFXA 3IIBA 4EFDA 3D68A 4MCPA 3IO1A 3I1UA 1QQ9A 1YW4A 5HVFA 2PJ1A 2PVVA 4P4JA 1R43A 1Y0YA 6CPAA 4EMEA 4LQGA 4NGTA 1BPMA 1QMUA 1ZG8A 2BO9A 2Q51A 1LCPA 4YWYA 1DTDA 1RTQA 3KI9A 4MMOA 1H8LA 5LYIA 5HVHA 3PBBA 4UEEA 2C6CA 3PFEA 1FT7A 2PJ2A 4PXCA 2FVGA 3B3VA 3FVLA 5K8MA 3D66A 4NGNA 3FECA 5CPAA 1XBUA 2ANPA 3B3WA 5LYFA 1XFOA 4ONWA 1Q7LA 1VHOA 5JGFA 1VIXA 3TC8A 5I4MA 3WC7A 4OKOA 3DLJA 4P44A 1CBXA 2ZEPA 1HEEA 3IC1A 2V8VA 3SJXA 2PJCA 4UEFA 2GLJA 3CT9A 1CPSA 2VL1A 1BAVA 3D7DA 4P45A 3B35A 1Z5RA 3FF3A 4UF4A 3MN8A 5K8OA 2XEGA 1NSAA 2ZEDA 1TKFA 2AFSA 1ELLP 4WWVA 2HB6A 3SJGA 3S9NA 1UWYA 1XJOA 1HDQA 2IQ6A 2EWBA 4ZYQA 3D4UA 1ZLIA 2PJBA 2OOTA 4H2KA 5D8NA 4OC4A 3FX6A 3VARA 3LMSA 4X2TA 3PFOA 1BPNA 1LAMA 4FWUA 2ZEFA 4NGPA 4P4IA 3T8WA 1LANA 4MHZA 1OBRA 4ZI6A 3KQXA 4FBEA 1ZG7A 2PE3A 3BXMA 3QNVA 3CPAA 2GREA 4DYOA 2OR4A 4R8FA 2GLFA 2DEAA 5K8NA 3H8FA 2ZEMA 2O4HA 2BCOA 2RB7A 4NJRA 1F57A 3LWUA 2XEJA 2ZOGA 3DGVA 1Z8LA 1ELMP 3H8GA 3VH9A 4YU9A 3FEDA 1ARMA 1HDUA 3KHXA 4BD9A 4ZY2A 1CP7A 2V8HA 2AFUA 3VATA 3PB9X 5JH9A 5THWA 4NGQA 4W9YA 2PVWA 2POKA 2G9DA 4RUHA 3PB4X 1FNOA 2JBJA 3ISXA 3KHZA 2C6GA 4P10A 4CPAA 8CPAA 3D7FA 3WABA 2V8DA 4F9VA 3FEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHX A;  3KZW A;  3PRT A;  3PB6 X;  2NYQ A;  2RFH A;  4R6T A;  2QJ8 A;  3SI0 A;  2C6P A;  1JQG A;  1XRY A;  3TX8 A;  3L2N A;  4P4E A;  2PRQ A;  3PB7 X;  3B2Y A;  3GB0 A;  4OC0 A;  1Y7E A;  4R76 A;  1PCA A;  1F2O A;  2QVP A;  1LAP A;  4FAI A;  5HVG A;  2HC9 A;  4KSI A;  3MRU A;  4IHM A;  4NGS A;  1YLO A;  4MCQ A;  3SI2 A;  4OME A;  3HLP A;  2EK8 A;  3RAM A;  4MHN A;  1CPX A;  4AXV A;  4OID A;  4OIW A;  4P6Y A;  4O23 A;  3KAS A;  4JYW A;  1TF8 A;  2PJ9 A;  2CF4 A;  3RZA A;  4EWT A;  2CTB A;  1CP6 A;  4PXE A;  3IEH A;  1Z2L A;  2F8H A;  5LYL A;  2Q4Z A;  4NFR A;  2PJ0 A;  3IJ3 A;  2PCU A;  3BI0 A;  4B6Z A;  1IY7 A;  4MXU A;  3KR4 A;  4Q7A A;  2JBK A;  2PJ8 A;  2GU2 A;  5IB9 A;  1R3N A;  2PJ6 A;  4X3R A;  4MRI A;  4NJQ A;  2CIJ A;  2PJA A;  2ZOF A;  2AFW A;  1LFW A;  3K9T A;  1AMP A;  2ZEN A;  3K2K A;  3GLJ A;  2PJ7 A;  5LRJ A;  4ZX9 A;  3S9M A;  1YW6 A;  2PJ4 A;  3BI1 A;  1YSJ A;  3NH4 A;  3WC6 A;  4NGR A;  5F09 A;  3HUV A;  2PIZ A;  2ABZ A;  3IFE A;  1Y0R A;  1TF9 A;  4GM5 A;  1TXR A;  4DUK A;  2C1C A;  4G1P A;  3FMC A;  5LYD A;  4F8Z A;  4NGM A;  3N5F A;  3PEI A;  1VHE A;  4X8I A;  3IWW A;  2AFZ A;  4ZX8 A;  5LRK A;  5JM6 A;  2V8G A;  1BLL E;  2ZEE A;  2AFM A;  1CX8 A;  1XMB A;  3JRU A;  4PPZ A;  2PJ3 A;  2ZEG A;  1ZLH A;  5K8P A;  4P4D A;  5CBM A;  2PIY A;  3NH8 A;  2BOA A;  4JZ0 A;  3B3T A;  3CDX A;  3D7G A;  1GYT A;  2EK9 A;  5DS0 A;  3FH4 A;  4OC1 A;  3D7H A;  5HXD A;  4UIA A;  3RBU A;  3PB8 X;  2XEI A;  4UIB A;  5LRG A;  1LOK A;  1TKJ A;  3B7I A;  3V38 A;  4A38 A;  3FJU A;  2ZEL A;  4WJB A;  1DE4 C;  2I3C A;  2IMO A;  3H8E A;  3ISZ A;  3B3C A;  4OC2 A;  4PXB A;  4FUU A;  2F7V A;  2JEW A;  4OC5 A;  2O53 A;  4A37 A;  4K3N A;  1ARL A;  1F2P A;  3KQZ A;  3V7Z A;  4R7M A;  2QYV A;  4Z65 A;  3KGQ A;  1CG2 A;  5J1Q A;  4IK2 A;  3SJF A;  4MCR A;  3SJE A;  1PYT B;  3WC5 A;  3PBE A;  1YME A;  3D67 A;  4UEZ A;  2WZN A;  3SI1 A;  3KR5 A;  4MHY A;  1TKH A;  4F9U A;  2V77 A;  1VGY A;  4A94 A;  4P4B A;  1IGB A;  1ZG9 A;  2CTC A;  5ELY A;  3S9L A;  2IJZ A;  2AFO A;  7CPA A;  4P4F A;  4OC3 A;  1EE3 P;  4IAV A;  3NA6 A;  2ZEO A;  4MCS A;  3GUX A;  1AYE A;  1M4L A;  5D29 A;  4PXD A;  4TNU A;  3NFZ A;  3WT4 A;  4DJL A;  3KL9 A;  4OP4 A;  4ZY0 A;  4ZY1 A;  2PJ5 A;  2Q43 A;  2WYR A;  2NSM A;  3NH5 A;  3B3S A;  2XEF A;  4PQA A;  2J9A A;  2ZEH A;  4MHP A;  3CPX A;  4TWE A;  1KWM A;  4A39 A;  2AFX A;  3IIB A;  4EFD A;  3D68 A;  4MCP A;  3IO1 A;  3I1U A;  1QQ9 A;  1YW4 A;  5HVF A;  2PJ1 A;  2PVV A;  4P4J A;  1R43 A;  1Y0Y A;  6CPA A;  4EME A;  4LQG A;  4NGT A;  1BPM A;  1QMU A;  1ZG8 A;  2BO9 A;  2Q51 A;  1LCP A;  4YWY A;  1DTD A;  1RTQ A;  3KI9 A;  4MMO A;  1H8L A;  5LYI A;  5HVH A;  3PBB A;  4UEE A;  2C6C A;  3PFE A;  1FT7 A;  2PJ2 A;  4PXC A;  2FVG A;  3B3V A;  3FVL A;  5K8M A;  3D66 A;  4NGN A;  3FEC A;  5CPA A;  1XBU A;  2ANP A;  3B3W A;  5LYF A;  1XFO A;  4ONW A;  1Q7L A;  1VHO A;  5JGF A;  1VIX A;  3TC8 A;  5I4M A;  3WC7 A;  4OKO A;  3DLJ A;  4P44 A;  1CBX A;  2ZEP A;  1HEE A;  3IC1 A;  2V8V A;  3SJX A;  2PJC A;  4UEF A;  2GLJ A;  3CT9 A;  1CPS A;  2VL1 A;  1BAV A;  3D7D A;  4P45 A;  3B35 A;  1Z5R A;  3FF3 A;  4UF4 A;  3MN8 A;  5K8O A;  2XEG A;  1NSA A;  2ZED A;  1TKF A;  2AFS A;  1ELL P;  4WWV A;  2HB6 A;  3SJG A;  3S9N A;  1UWY A;  1XJO A;  1HDQ A;  2IQ6 A;  2EWB A;  4ZYQ A;  3D4U A;  1ZLI A;  2PJB A;  2OOT A;  4H2K A;  5D8N A;  4OC4 A;  3FX6 A;  3VAR A;  3LMS A;  4X2T A;  3PFO A;  1BPN A;  1LAM A;  4FWU A;  2ZEF A;  4NGP A;  4P4I A;  3T8W A;  1LAN A;  4MHZ A;  1OBR A;  4ZI6 A;  3KQX A;  4FBE A;  1ZG7 A;  2PE3 A;  3BXM A;  3QNV A;  3CPA A;  2GRE A;  4DYO A;  2OR4 A;  4R8F A;  2GLF A;  2DEA A;  5K8N A;  3H8F A;  2ZEM A;  2O4H A;  2BCO A;  2RB7 A;  4NJR A;  1F57 A;  3LWU A;  2XEJ A;  2ZOG A;  3DGV A;  1Z8L A;  1ELM P;  3H8G A;  3VH9 A;  4YU9 A;  3FED A;  1ARM A;  1HDU A;  3KHX A;  4BD9 A;  4ZY2 A;  1CP7 A;  2V8H A;  2AFU A;  3VAT A;  3PB9 X;  5JH9 A;  5THW A;  4NGQ A;  4W9Y A;  2PVW A;  2POK A;  2G9D A;  4RUH A;  3PB4 X;  1FNO A;  2JBJ A;  3ISX A;  3KHZ A;  2C6G A;  4P10 A;  4CPA A;  8CPA A;  3D7F A;  3WAB A;  2V8D A;  4F9V A;  3FEE A; 
#chains in the Genus database with same CATH topology
 4LUA A;  3BHX A;  4M6H A;  1L0C A;  2Z0Z A;  1XIX A;  3KZW A;  3PRT A;  3R96 A;  4CS0 B;  4C2X A;  3PB6 X;  2NYQ A;  2RFH A;  4R6T A;  2QJ8 A;  3SI0 A;  2I79 A;  2C6P A;  4BBH A;  4KOU A;  1JQG A;  5C88 A;  1IU8 A;  1XRY A;  3TX8 A;  2CXA A;  4A95 A;  3L2N A;  4H6U A;  4P4E A;  4R9M A;  2J8R A;  2CNT A;  3P2F A;  4H6Z A;  1JWQ A;  2PRQ A;  2FSR A;  2Z3P A;  4Q36 A;  3PB7 X;  4CRZ B;  3B2Y A;  3GB0 A;  4OC0 A;  1WK4 A;  1Y7E A;  1SQH A;  4R76 A;  2ZPA A;  2KCW A;  3PZJ A;  1PCA A;  3D3S A;  2B3U A;  1F2O A;  4B12 A;  1QSN A;  2QVP A;  1LAP A;  4FAI A;  5HVG A;  3UY5 A;  2HC9 A;  4KOR A;  4KSI A;  4A31 A;  1IB1 E;  3FYN A;  3MRU A;  4IHM A;  2FE7 A;  3RO0 A;  5C82 A;  3W91 A;  4QB9 A;  2G0B A;  1S60 A;  1QSR A;  4NGS A;  1YLO A;  4MCQ A;  3SI2 A;  4OME A;  2DPT A;  4RS2 A;  4U9Y A;  4XNH C;  4B5P A;  1S3Z A;  3HLP A;  2EK8 A;  3RAM A;  4MHN A;  2ARH A;  1CPX A;  4AXV A;  4OID A;  3TO7 A;  1ON0 A;  4KSA A;  4OIW A;  4M85 A;  4P6Y A;  4O23 A;  3KAS A;  4CGN A;  4JYW A;  4KOY A;  4C2Z A;  4R57 A;  1TF8 A;  4BIN A;  2PJ9 A;  4E2A A;  4M3S A;  4UBR A;  2CF4 A;  5H86 A;  3RZA A;  2Q44 A;  2B5G B;  2EUI A;  2GFQ A;  2CTB A;  4EWT A;  1CP6 A;  1PU9 A;  4PXE A;  3IEH A;  1Z2L A;  2OH1 A;  2F8H A;  4CAE A;  3S6G A;  4UCM A;  4ZBG A;  5LYL A;  2EO8 A;  3T9Y A;  2B58 A;  4UFX A;  2ZW5 A;  2VZZ A;  2D4P A;  2Q4Z A;  3SHP A;  4NFR A;  3FXT A;  3R95 A;  3TOA A;  1Q2Y A;  2PJ0 A;  3IJ3 A;  4AVB A;  2HQY A;  3I9S A;  3TFY A;  5HMN A;  4A2Z A;  2A4N A;  3G3S A;  2PCU A;  3BI0 A;  4A30 A;  1I1D A;  1M4I A;  4B6Z A;  4MFQ A;  1B87 A;  5E96 A;  1IY7 A;  2R98 A;  1MJ9 A;  4MXU A;  1IID A;  4KOW A;  3KR4 A;  4CGO A;  4Q7A A;  2JBK A;  2PJ8 A;  2GU2 A;  4OAE A;  5IB9 A;  4B14 A;  1R3N A;  4E0A A;  2PJ6 A;  1Z4R A;  1IOF A;  4X3R A;  4MRI A;  5H84 A;  3VWD A;  4NJQ A;  2CIJ A;  4CAV A;  3D2M A;  5BWA B;  2PJA A;  2ZOF A;  2AFW A;  2WPX A;  1MK4 A;  1LFW A;  3K9T A;  1AMP A;  4KVO E;  3JUW A;  2ZEN A;  3K2K A;  1YVO A;  3GLJ A;  5JPH A;  2Z3L A;  2YGW A;  4YFJ A;  4XNH B;  3SXO A;  4C7I A;  3S6F A;  2PJ7 A;  3W6S A;  4CYO A;  5A27 A;  4M6G A;  5LRJ A;  4ZX9 A;  3S9M A;  1M1D A;  1YW6 A;  2PJ4 A;  3BI1 A;  2DPS A;  3PGP A;  3TO6 A;  1YSJ A;  1XEB A;  2WUU A;  2VQY A;  2EBJ A;  2J8M A;  4II9 A;  3NH4 A;  1NE9 A;  3WC6 A;  4NGR A;  5F09 A;  4UCN A;  4U5Y A;  3HUV A;  1Z4E A;  2PIZ A;  2OZG A;  2ABZ A;  1IIC A;  2JDC A;  3GIU A;  3IFE A;  3TOB A;  5G22 A;  2GIV A;  1Y0R A;  3QAH A;  1S7N A;  1TF9 A;  4GM5 A;  4DNC A;  3FNC A;  1TXR A;  2GE3 A;  4KSF A;  4Y49 B;  3R9E A;  4DUK A;  2C1C A;  4G1P A;  3FMC A;  4QUS A;  4KS9 A;  2IL4 A;  3F5B A;  5LYD A;  4F8Z A;  4NGM A;  3N5F A;  2NMT A;  2OZH A;  3PEI A;  2AE6 A;  1VHE A;  2Z3N A;  4X8I A;  1Z8X A;  5G21 A;  3IWW A;  2AFZ A;  4ZX8 A;  4CAF A;  4QBJ A;  5LRK A;  2VBQ A;  2V8G A;  2BL1 A;  5JM6 A;  1BLL E;  1A2Z A;  2ZEE A;  5F46 A;  2AFM A;  1CX8 A;  1XMB A;  3D2P A;  3JRU A;  4PPZ A;  4AVC A;  2OU2 A;  2PJ3 A;  2ZEG A;  3BJ7 A;  2PR1 A;  1ZLH A;  4RN7 A;  2ATR A;  2Z10 A;  1P0H A;  5K8P A;  1RO5 A;  4P4D A;  5IV0 A;  1OZP A;  5CBM A;  2PIY A;  3NH8 A;  3DR8 A;  3EY5 A;  2BOA A;  4M6I A;  3DNS A;  3B3T A;  3CDX A;  3CZX A;  1GYT A;  3D7G A;  1I21 A;  4JZ0 A;  1LRZ A;  3TTH A;  2EK9 A;  5DS0 A;  3FH4 A;  4OAD A;  4OC1 A;  2HV2 A;  3D7H A;  3GY9 A;  4KOX A;  2YNC C;  5HXD A;  3NE8 A;  2I00 A;  4LQ6 A;  2K5T A;  3DR6 A;  1YVK A;  4UIA A;  3RBU A;  4ZGY B;  3PB8 X;  4CGL A;  2XEI A;  1GHE A;  4UIB A;  1LOK A;  1TKJ A;  3B7I A;  2PDO A;  3IGR A;  5LRG A;  3V38 A;  4A38 A;  3FJU A;  5G1Z A;  1KUX A;  5HH1 A;  2J8N A;  2ZEL A;  1Q2D A;  4WJB A;  1DE4 C;  3IWG A;  1IYL A;  4FD7 A;  4HNW B;  3TE4 A;  2I3C A;  4FD5 A;  2IMO A;  5DWM A;  3TO9 A;  3H8E A;  3FBU A;  3ISZ A;  5F48 A;  3B3C A;  1KUV A;  2R8V A;  1VHS A;  4OC2 A;  4PXB A;  1M44 A;  4FUU A;  5EC4 A;  3S6H A;  5FVJ A;  4KVX A;  4ORF A;  4HNX B;  2F7V A;  2JEW A;  4E8O A;  4OC5 A;  2O53 A;  2BEI A;  1BO4 A;  4LX9 A;  4A37 A;  4K3N A;  1S5K A;  5IB0 A;  1I12 A;  1ARL A;  1F2P A;  2Z11 A;  2QML A;  3KQZ A;  2OZU A;  3V7Z A;  4R7M A;  2HUZ A;  1M4D A;  2QYV A;  4KZT A;  4UWI A;  4Z65 A;  3H4Q A;  3KGQ A;  1CG2 A;  5J1Q A;  2QEC A;  1UFH A;  4IK2 A;  3RNZ A;  3SJF A;  4B11 A;  1MJB A;  2G3A A;  3IWE A;  4MCR A;  3SJE A;  4B5P B;  5KTC A;  1PYT B;  3H5Z A;  2P6F A;  3G8W A;  3R9F A;  3WC5 A;  3F0A A;  3PBE A;  4JXR A;  1YME A;  3D67 A;  4R87 A;  2WZN A;  4UEZ A;  3SI1 A;  3KR5 A;  5AG4 A;  4CYQ A;  4MHY A;  1TKH A;  4F9U A;  2V77 A;  4AB7 A;  2BSW A;  1VGY A;  1YLE A;  2PSW A;  3EFA A;  4P4B A;  1IGB A;  1Z8W A;  1ZG9 A;  4A94 A;  4F0Y A;  2CTC A;  2ZXV A;  5ELY A;  2IJZ A;  3S9L A;  2AFO A;  4NXY A;  3DSB A;  1V0C A;  4C7H A;  7CPA A;  5F49 A;  4OC3 A;  1EE3 P;  4P4F A;  4IAV A;  3NA6 A;  5AG5 A;  2ZEO A;  2D4O A;  3IU2 A;  2B5G A;  4MCS A;  4UCP A;  4XPK A;  4UFV A;  1XOV A;  2Z3O A;  5AG7 A;  3GUX A;  1AYE A;  1M4L A;  5D29 A;  3I3G A;  4PXD A;  1AUG A;  2O28 A;  4TNU A;  3NFZ A;  4KLV A;  3WT4 A;  4DJL A;  4HKF A;  3KL9 A;  4OP4 A;  4CGP A;  1YGH A;  4ZY0 A;  4ZY1 A;  2PJ5 A;  2PRB A;  2JDD A;  4H89 A;  2VXK A;  4KUB A;  2Q43 A;  2WYR A;  2NSM A;  3E0K A;  3NH5 A;  4B10 A;  2Q4V A;  3B3S A;  2XEF A;  1PUA A;  2ZW7 A;  4PQA A;  2ZW4 A;  1P4N A;  2OB0 A;  2B4D B;  3R1K A;  2J9A A;  2ZEH A;  3SXN A;  4MHP A;  5GCN A;  5EBV A;  3W6X A;  4FD4 A;  1KUY A;  1WWZ A;  3CPX A;  4TWE A;  4XPL A;  2WSA A;  3C26 A;  1KWM A;  5ISV A;  1YK3 A;  2Q0Y A;  2YNC A;  2RC4 A;  2AFX A;  4A39 A;  4C2Y A;  3IIB A;  4EFD A;  4PK3 A;  1J4J A;  3FIX A;  4UWJ A;  4EVY A;  3D68 A;  3BJ8 A;  4MCP A;  4KOS A;  3IO1 A;  3CXP A;  1BOB A;  4X5K A;  2PQ8 A;  3I1U A;  1QQ9 A;  1YW4 A;  5HVF A;  2PJ1 A;  3K9U A;  3GYA A;  4K30 A;  2PVV A;  4P4J A;  1R43 A;  1Y0Y A;  6CPA A;  3EO4 A;  4MFZ A;  3R9G A;  4EME A;  4NCZ A;  3EXN A;  4LQG A;  4NGT A;  3DDD A;  1BPM A;  2EVN A;  4JXQ A;  1QMU A;  1ZG8 A;  2G3T A;  1QSM A;  4FD6 A;  2BO9 A;  2FCK A;  2Q04 A;  2Q7S A;  4A32 A;  2DXQ A;  3LAC A;  4JJX A;  1N71 A;  4MY3 A;  2Q51 A;  1LCP A;  4RI1 A;  1DTD A;  4JLY A;  4YWY A;  4B13 A;  4CGM A;  5KTD A;  1RTQ A;  2FT0 A;  3KI9 A;  3KKW A;  4MHD A;  4MMO A;  3T90 A;  1H8L A;  2Q4Y A;  3VWE A;  5LYI A;  5HVH A;  3ZJ0 A;  3PBB A;  4UEE A;  2Z3K A;  4IF5 A;  1S7F A;  2ODF A;  2VI7 A;  2C6C A;  3PFE A;  1FT7 A;  3QAY A;  2B4B A;  3JVN A;  2PJ2 A;  2JLM A;  1B6B A;  4MY0 A;  4PXC A;  4R3L A;  3ZZI A;  4J3G A;  5G20 A;  3OWC A;  2FVG A;  3RYO A;  3B3V A;  4JD6 A;  1NMT A;  4MFJ A;  3FVL A;  5K8M A;  3D66 A;  3IU1 A;  2DF5 A;  4NGN A;  4CYP A;  1R57 A;  3FEC A;  2PC1 A;  5CPA A;  1X10 A;  1XBU A;  2FS5 A;  2ANP A;  2FL4 A;  3B3W A;  4KLW A;  5LYF A;  1XMT A;  4HNY B;  1XFO A;  4ONW A;  1Q7L A;  1KZF A;  1XF8 A;  1VHO A;  2H5M A;  4KOT A;  1K4J A;  2Z3M A;  3QB8 A;  1ZO0 A;  5F47 A;  5JGF A;  1X12 A;  1VIX A;  3TC8 A;  5I4M A;  5KTA A;  3WC7 A;  2REF A;  3LOD A;  4OKO A;  2GAN A;  3DLJ A;  1YX0 A;  1MJA A;  2C27 A;  4P44 A;  1S7L A;  3B8G A;  4UA3 A;  1CBX A;  2ZEP A;  1HEE A;  3IC1 A;  4PSW A;  4PSX A;  2V8V A;  3SJX A;  4CAW A;  2PJC A;  4UEF A;  5EMI A;  4IUS A;  4PV6 A;  2B4D A;  4MFK A;  2GLJ A;  3JTK A;  1FY7 A;  2WPW A;  1TIQ A;  3CT9 A;  1Q2C A;  2VEZ A;  1CPS A;  2R7H A;  3BLN A;  4Q38 A;  2FIA A;  4MI4 A;  1NSL A;  2VL1 A;  1BAV A;  3D7D A;  4P45 A;  1IYK A;  4MJ8 A;  3B35 A;  1Z5R A;  2P6E A;  4F0X A;  2X7B A;  4JWP A;  3FF3 A;  4UF4 A;  3MN8 A;  3D8P A;  5K8O A;  5J8C A;  1CM0 A;  2XEG A;  1NSA A;  2ZED A;  4UFW A;  1TKF A;  3MGD A;  4A33 A;  4CAX A;  2AFS A;  1ELL P;  4AVA A;  2CNM A;  4WWV A;  2HB6 A;  3S6K A;  3SJG A;  3CXS A;  3S9N A;  4PK2 A;  1UWY A;  1XJO A;  1HDQ A;  4KVM E;  2JEV A;  4AG7 A;  1Z9U A;  5AGE A;  2IQ6 A;  2EWB A;  2YNE A;  2CY2 A;  2REE A;  4ZYQ A;  4MFL A;  4QVT A;  2YND A;  3D4U A;  1ZLI A;  4NEX A;  1RXT A;  1Y7R A;  2PJB A;  4H2K A;  2OOT A;  5D8N A;  4XPD B;  3NE7 A;  4OC4 A;  4XPD C;  3FX6 A;  3VAR A;  3LMS A;  4X2T A;  1U6M A;  3PFO A;  1BPN A;  1LAM A;  2QIR A;  2ZEF A;  4FWU A;  3A9L A;  3EC4 A;  4NGP A;  4P4I A;  1Z8T A;  1QST A;  1S7K A;  4YGO A;  3T8W A;  1LAN A;  4MHZ A;  1OBR A;  4ZI6 A;  4GS4 A;  1Y9W A;  4I49 A;  3KQX A;  4FBE A;  1ZG7 A;  5I0C A;  4NF1 A;  3FB3 A;  2PE3 A;  3BXM A;  1M4G A;  3QNV A;  3CPA A;  2Q7B A;  2GRE A;  4Y49 C;  4F6A A;  3LD2 A;  4CYN A;  1XE4 A;  4L89 A;  2OR4 A;  4MFP A;  4DYO A;  4R8F A;  4OLL A;  2GLF A;  5IX3 A;  2DEA A;  2P0W A;  3PP9 A;  1YR0 A;  2PR8 A;  2CNS A;  5K8N A;  3F8K A;  2Y0M A;  3H8F A;  2BUE A;  2ZEM A;  5J8F A;  4U9Z A;  2VZY A;  3TT2 A;  2O4H A;  4KUA A;  2BCO A;  2RB7 A;  2AJ6 A;  4NJR A;  1F57 A;  1VKC A;  5AG6 A;  3LWU A;  2XEJ A;  4CRY B;  2ZOG A;  3DGV A;  2P6G A;  4L8A A;  4YRH A;  1Z8L A;  5JQ4 A;  5A28 A;  1ELM P;  4B5O A;  3V8I A;  5DWN A;  3H8G A;  3VH9 A;  4YU9 A;  1QSO A;  2F5I A;  3GKR A;  3FED A;  1ARM A;  2R1I A;  4MBU A;  1HDU A;  3KHX A;  4BD9 A;  4ZY2 A;  3CXQ A;  3N7Z A;  4QC6 A;  1CP7 A;  2V8H A;  4BMH A;  5CNP A;  2AFU A;  3VAT A;  4HPS A;  2FIW A;  1CJW A;  3PB9 X;  4NSQ A;  3TCV A;  5JH9 A;  2FXF A;  3P2H A;  5THW A;  4NGQ A;  1YRE A;  4W9Y A;  1Y9K A;  4C68 A;  4KOV A;  2PVW A;  2POK A;  2G9D A;  4AG9 A;  4RUH A;  3PB4 X;  4R3K A;  2JBJ A;  1FNO A;  1YQE A;  2B3V A;  3ISX A;  1IOI A;  2C6G A;  3KHZ A;  4GXH A;  4P10 A;  4CPA A;  8CPA A;  3WR7 A;  3D7F A;  3FRM A;  3WAB A;  2V8D A;  2ZW6 A;  4F9V A;  4ONU A;  3FEE A; 
#chains in the Genus database with same CATH homology
 3BHX A;  3KZW A;  3PRT A;  3PB6 X;  2NYQ A;  2RFH A;  4R6T A;  2QJ8 A;  3SI0 A;  2C6P A;  1JQG A;  1XRY A;  3TX8 A;  3L2N A;  4P4E A;  2PRQ A;  3PB7 X;  3B2Y A;  3GB0 A;  4OC0 A;  1Y7E A;  4R76 A;  1PCA A;  1F2O A;  2QVP A;  1LAP A;  4FAI A;  5HVG A;  2HC9 A;  4KSI A;  3MRU A;  4IHM A;  4NGS A;  1YLO A;  4MCQ A;  3SI2 A;  4OME A;  3HLP A;  2EK8 A;  3RAM A;  4MHN A;  1CPX A;  4AXV A;  4OID A;  4OIW A;  4P6Y A;  4O23 A;  3KAS A;  4JYW A;  1TF8 A;  2PJ9 A;  2CF4 A;  3RZA A;  4EWT A;  2CTB A;  1CP6 A;  4PXE A;  3IEH A;  1Z2L A;  2F8H A;  5LYL A;  2Q4Z A;  4NFR A;  2PJ0 A;  3IJ3 A;  2PCU A;  3BI0 A;  4B6Z A;  1IY7 A;  4MXU A;  3KR4 A;  4Q7A A;  2JBK A;  2PJ8 A;  2GU2 A;  5IB9 A;  1R3N A;  2PJ6 A;  4X3R A;  4MRI A;  4NJQ A;  2CIJ A;  2PJA A;  2ZOF A;  2AFW A;  1LFW A;  3K9T A;  1AMP A;  2ZEN A;  3K2K A;  3GLJ A;  2PJ7 A;  5LRJ A;  4ZX9 A;  3S9M A;  1YW6 A;  2PJ4 A;  3BI1 A;  1YSJ A;  3NH4 A;  3WC6 A;  4NGR A;  5F09 A;  3HUV A;  2PIZ A;  2ABZ A;  3IFE A;  1Y0R A;  1TF9 A;  4GM5 A;  1TXR A;  4DUK A;  2C1C A;  4G1P A;  3FMC A;  5LYD A;  4F8Z A;  4NGM A;  3N5F A;  3PEI A;  1VHE A;  4X8I A;  3IWW A;  2AFZ A;  4ZX8 A;  5LRK A;  5JM6 A;  2V8G A;  1BLL E;  2ZEE A;  2AFM A;  1CX8 A;  1XMB A;  3JRU A;  4PPZ A;  2PJ3 A;  2ZEG A;  1ZLH A;  5K8P A;  4P4D A;  5CBM A;  2PIY A;  3NH8 A;  2BOA A;  4JZ0 A;  3B3T A;  3CDX A;  3D7G A;  1GYT A;  2EK9 A;  5DS0 A;  3FH4 A;  4OC1 A;  3D7H A;  5HXD A;  4UIA A;  3RBU A;  3PB8 X;  2XEI A;  4UIB A;  5LRG A;  1LOK A;  1TKJ A;  3B7I A;  3V38 A;  4A38 A;  3FJU A;  2ZEL A;  4WJB A;  1DE4 C;  2I3C A;  2IMO A;  3H8E A;  3ISZ A;  3B3C A;  4OC2 A;  4PXB A;  4FUU A;  2F7V A;  2JEW A;  4OC5 A;  2O53 A;  4A37 A;  4K3N A;  1ARL A;  1F2P A;  3KQZ A;  3V7Z A;  4R7M A;  2QYV A;  4Z65 A;  3KGQ A;  1CG2 A;  5J1Q A;  4IK2 A;  3SJF A;  4MCR A;  3SJE A;  1PYT B;  3WC5 A;  3PBE A;  1YME A;  3D67 A;  4UEZ A;  2WZN A;  3SI1 A;  3KR5 A;  4MHY A;  1TKH A;  4F9U A;  2V77 A;  1VGY A;  4A94 A;  4P4B A;  1IGB A;  1ZG9 A;  2CTC A;  5ELY A;  3S9L A;  2IJZ A;  2AFO A;  7CPA A;  4P4F A;  4OC3 A;  1EE3 P;  4IAV A;  3NA6 A;  2ZEO A;  4MCS A;  3GUX A;  1AYE A;  1M4L A;  5D29 A;  4PXD A;  4TNU A;  3NFZ A;  3WT4 A;  4DJL A;  3KL9 A;  4OP4 A;  4ZY0 A;  4ZY1 A;  2PJ5 A;  2Q43 A;  2WYR A;  2NSM A;  3NH5 A;  3B3S A;  2XEF A;  4PQA A;  2J9A A;  2ZEH A;  4MHP A;  3CPX A;  4TWE A;  1KWM A;  4A39 A;  2AFX A;  3IIB A;  4EFD A;  3D68 A;  4MCP A;  3IO1 A;  3I1U A;  1QQ9 A;  1YW4 A;  5HVF A;  2PJ1 A;  2PVV A;  4P4J A;  1R43 A;  1Y0Y A;  6CPA A;  4EME A;  4LQG A;  4NGT A;  1BPM A;  1QMU A;  1ZG8 A;  2BO9 A;  2Q51 A;  1LCP A;  4YWY A;  1DTD A;  1RTQ A;  3KI9 A;  4MMO A;  1H8L A;  5LYI A;  5HVH A;  3PBB A;  4UEE A;  2C6C A;  3PFE A;  1FT7 A;  2PJ2 A;  4PXC A;  2FVG A;  3B3V A;  3FVL A;  5K8M A;  3D66 A;  4NGN A;  3FEC A;  5CPA A;  1XBU A;  2ANP A;  3B3W A;  5LYF A;  1XFO A;  4ONW A;  1Q7L A;  1VHO A;  5JGF A;  1VIX A;  3TC8 A;  5I4M A;  3WC7 A;  4OKO A;  3DLJ A;  4P44 A;  1CBX A;  2ZEP A;  1HEE A;  3IC1 A;  2V8V A;  3SJX A;  2PJC A;  4UEF A;  2GLJ A;  3CT9 A;  1CPS A;  2VL1 A;  1BAV A;  3D7D A;  4P45 A;  3B35 A;  1Z5R A;  3FF3 A;  4UF4 A;  3MN8 A;  5K8O A;  2XEG A;  1NSA A;  2ZED A;  1TKF A;  2AFS A;  1ELL P;  4WWV A;  2HB6 A;  3SJG A;  3S9N A;  1UWY A;  1XJO A;  1HDQ A;  2IQ6 A;  2EWB A;  4ZYQ A;  3D4U A;  1ZLI A;  2PJB A;  2OOT A;  4H2K A;  5D8N A;  4OC4 A;  3FX6 A;  3VAR A;  3LMS A;  4X2T A;  3PFO A;  1BPN A;  1LAM A;  4FWU A;  2ZEF A;  4NGP A;  4P4I A;  3T8W A;  1LAN A;  4MHZ A;  1OBR A;  4ZI6 A;  3KQX A;  4FBE A;  1ZG7 A;  2PE3 A;  3BXM A;  3QNV A;  3CPA A;  2GRE A;  4DYO A;  2OR4 A;  4R8F A;  2GLF A;  2DEA A;  5K8N A;  3H8F A;  2ZEM A;  2O4H A;  2BCO A;  2RB7 A;  4NJR A;  1F57 A;  3LWU A;  2XEJ A;  2ZOG A;  3DGV A;  1Z8L A;  1ELM P;  3H8G A;  3VH9 A;  4YU9 A;  3FED A;  1ARM A;  1HDU A;  3KHX A;  4BD9 A;  4ZY2 A;  1CP7 A;  2V8H A;  2AFU A;  3VAT A;  3PB9 X;  5JH9 A;  5THW A;  4NGQ A;  4W9Y A;  2PVW A;  2POK A;  2G9D A;  4RUH A;  3PB4 X;  1FNO A;  2JBJ A;  3ISX A;  3KHZ A;  2C6G A;  4P10 A;  4CPA A;  8CPA A;  3D7F A;  3WAB A;  2V8D A;  4F9V A;  3FEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...