1F2PA

Crystal structure of the streptomyces griseus aminopeptidase complexed with l-phenylalanine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
277
structure length
274
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETERSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of Streptomyces griseus aminopeptidase with amino acid reaction products and their implications toward a catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE
total genus 106
structure length 274
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1f2pA00
2ZELA 4OMEA 5F09A 4Z65A 2Q4ZA 3B3SA 2XEGA 2C6PA 5LYIA 4RUHA 3WC7A 3D7HA 2QJ8A 1F2PA 4A38A 5LYDA 3FX6A 2NSMA 5D29A 4MMOA 1PYTB 3SI1A 1YSJA 2HC9A 3WT4A 3PBEA 3FMCA 4P4JA 3RZAA 4MHZA 4DYOA 3K9TA 2PJ3A 2ZENA 3VARA 4NJQA 5HVFA 5LRKA 1ZG7A 5LRJA 1H8LA 1GYTA 3IEHA 8CPAA 1TKJA 2JBJA 4EWTA 4EMEA 4UEZA 3CPAA 4OP4A 5K8MA 2XEFA 1YW4A 4X2TA 3D67A 1F2OA 1BPNA 3KR4A 4W9YA 3LMSA 1DE4C 4OC2A 4F9UA 4B6ZA 1ELLP 2QVPA 1HDUA 1XJOA 3KQXA 3NA6A 2ZOGA 1KWMA 2PJ9A 2GLFA 3N5FA 1TF8A 3GUXA 3PBBA 3DLJA 4F8ZA 3WABA 1LAMA 4ZY1A 3ISZA 4F9VA 4MCSA 4A94A 1RTQA 1YMEA 4TWEA 4ZX8A 3PFEA 3H8EA 2WYRA 4ZY0A 4X3RA 2ZEEA 1ZLHA 4PPZA 4FAIA 3D66A 1HEEA 4NGMA 1TF9A 3FEDA 1EE3P 1FNOA 2ZEHA 2CTBA 4FBEA 4GM5A 2IJZA 3B7IA 4LQGA 5J1QA 3PB6X 2PJ5A 3S9MA 1ELMP 2GLJA 1OBRA 5HXDA 3T8WA 2POKA 3NH8A 4H2KA 4Q7AA 1CP7A 2AFMA 1CPXA 2ZEPA 1CP6A 4YWYA 5JH9A 7CPAA 3TX8A 3SI2A 3GLJA 4P4FA 1AYEA 4YU9A 2VL1A 4P45A 5D8NA 3NH4A 1HDQA 2CF4A 3NFZA 1CX8A 3KR5A 4P10A 1Q7LA 4NGTA 3TC8A 2PJ6A 4OKOA 5K8NA 3CDXA 5ELYA 3HUVA 3B3CA 1ZLIA 2AFSA 4PXBA 5HVHA 4OC1A 2PJ7A 4ZX9A 1LFWA 1IY7A 1PCAA 2PVWA 1IGBA 2BO9A 2O4HA 1ARMA 4PXDA 3D68A 4FUUA 1CG2A 2GREA 4A37A 1XBUA 3KHZA 1LAPA 2ANPA 2C6CA 3HLPA 4R8FA 2EWBA 3RAMA 3DGVA 3MN8A 4NJRA 1JQGA 4OC3A 1TKHA 2AFZA 3D7FA 2IMOA 5CPAA 2I3CA 2ZEDA 4P6YA 4ZYQA 3KL9A 1XRYA 3KI9A 1ZG8A 2ABZA 1VHEA 1NSAA 5IB9A 1M4LA 3QNVA 2PE3A 1VIXA 4PXEA 1XMBA 3SJGA 3H8GA 2AFOA 2BCOA 4P4BA 4P44A 4OC4A 5JM6A 4R6TA 3IIBA 3S9NA 2ZEGA 4FWUA 3PB9X 4JYWA 3FJUA 1Z2LA 4R7MA 2PJ0A 2QYVA 1UWYA 2OR4A 3NH5A 2RB7A 2WZNA 2ZEMA 4MCQA 4DUKA 4MHPA 1BAVA 1Z8LA 2PIZA 3B3TA 4OIWA 4AXVA 3FF3A 3IFEA 6CPAA 2GU2A 2PJ1A 4G1PA 2PIYA 3CPXA 3RBUA 4WJBA 5K8PA 4IHMA 2CTCA 3IJ3A 4OIDA 4R76A 2ZOFA 5LRGA 2HB6A 4PXCA 3B35A 5I4MA 2AFUA 4NGNA 3PB7X 2NYQA 4KSIA 1AMPA 1Y0YA 4NGPA 2C1CA 4NGRA 1R3NA 2XEJA 2O53A 3SJFA 1F57A 4IAVA 5LYFA 3FVLA 3KHXA 1VHOA 1ZG9A 3SJEA 4A39A 2V77A 3D7GA 3WC6A 4DJLA 1LANA 4UIAA 3BI0A 2EK8A 3B3WA 4OC0A 1QQ9A 3MRUA 4ONWA 2PCUA 3KASA 2PRQA 4TNUA 3PB4X 3VH9A 3FH4A 3PFOA 2PJBA 1TKFA 5DS0A 2V8DA 5LYLA 3D4UA 1R43A 3K2KA 5JGFA 3FEEA 4CPAA 3I1UA 4NGQA 3KQZA 2BOAA 2CIJA 4UIBA 2IQ6A 4ZY2A 2PJCA 4MRIA 1Y7EA 2PJ4A 2PVVA 4K3NA 4NFRA 2JEWA 2FVGA 5CBMA 3IO1A 3JRUA 3WC5A 4WWVA 2Q51A 4MXUA 2ZEOA 2AFWA 4MCPA 4P4EA 1BPMA 3L2NA 1FT7A 2PJ8A 2PJAA 4NGSA 3D7DA 4JZ0A 3PB8X 5K8OA 3BHXA 3H8FA 1YW6A 3IWWA 1QMUA 4P4DA 3CT9A 3S9LA 2JBKA 2V8GA 3IC1A 1CBXA 3GB0A 1VGYA 4ZI6A 4P4IA 2J9AA 1YLOA 2F8HA 3SI0A 3VATA 3V7ZA 4OC5A 3B2YA 3V38A 4UEEA 4PQAA 2ZEFA 2EK9A 1DTDA 4MHYA 1BLLE 3KZWA 4IK2A 2F7VA 1ARLA 1Z5RA 2PJ2A 4EFDA 4O23A 4MCRA 3FECA 3KGQA 4BD9A 3PEIA 4UF4A 2C6GA 1TXRA 1LCPA 1LOKA 3LWUA 4UEFA 2OOTA 3B3VA 1Y0RA 5THWA 2G9DA 2AFXA 1CPSA 2V8HA 3ISXA 2RFHA 2XEIA 4MHNA 3SJXA 3BXMA 1XFOA 2Q43A 2V8VA 3BI1A 3PRTA 2DEAA 4X8IA 5HVGA
chains in the Genus database with same CATH superfamily
2ZELA 3P2FA 4OMEA 3R95A 5F09A 3FB3A 2GE3A 4YRHA 4Z65A 4R3LA 2Q4ZA 3B3SA 2XEGA 2C6PA 2Z3PA 1KZFA 5AGEA 5LYIA 4RUHA 4UFWA 1YR0A 5BWAB 3WC7A 2BL1A 3D7HA 2QJ8A 1F2PA 4I49A 1M4DA 2Q0YA 1RO5A 4A38A 5LYDA 3FX6A 3QAHA 5IB0A 2NSMA 1YX0A 2DF5A 2YGWA 1Y9WA 4RI1A 5IX3A 3DNSA 5D29A 4MMOA 1YQEA 4QVTA 3R96A 1Y7RA 1PYTB 3SI1A 1FY7A 1YSJA 2HC9A 3WT4A 3PBEA 4CYNA 2CNMA 4JJXA 3FMCA 4MY3A 4P4JA 3RZAA 3TO6A 3A9LA 4XPLA 4KUBA 2PRBA 4MHZA 4DYOA 3K9TA 2CNTA 2PJ3A 2ZENA 1QSTA 3QB8A 4Q36A 4UA3A 3F5BA 3VARA 4NJQA 5HVFA 5LRKA 1ZG7A 4QUSA 5LRJA 1H8LA 1GYTA 3IEHA 8CPAA 1TKJA 3JTKA 4NXYA 4JXRA 3T9YA 2JBJA 4EWTA 4EMEA 1R57A 5E96A 3ZZIA 2DXQA 1Z8TA 1PU9A 1K4JA 5EC4A 3IWGA 4UEZA 4CAXA 3CPAA 3D2PA 5HMNA 1NE9A 4Y49C 4L8AA 4OP4A 1X12A 2ZXVA 3H4QA 5JPHA 5K8MA 5AG6A 2XEFA 3F8KA 1YW4A 4X2TA 3VWEA 3D67A 3IU1A 3WR7A 3R9FA 2AE6A 1Z4RA 4GXHA 3TCVA 1F2OA 5G20A 4B13A 1BPNA 1U6MA 2HQYA 1J4JA 1KUYA 3KR4A 4W9YA 3LMSA 5A28A 1DE4C 2ZPAA 3P2HA 4MJ8A 4OC2A 4F9UA 4B6ZA 3EY5A 1ELLP 5F47A 2QVPA 1HDUA 1VHSA 1XJOA 4R9MA 4K30A 3KQXA 4Q38A 1WK4A 1ON0A 3NA6A 2ZOGA 4H89A 2PC1A 4FD4A 1KWMA 1IOFA 3PP9A 5F48A 2PJ9A 3NE8A 3SXNA 2GLFA 4DNCA 2PDOA 3N5FA 4AVBA 4F0XA 1TF8A 1Y9KA 2ODFA 3GUXA 4OADA 3PBBA 3DLJA 1V0CA 2FL4A 2YNCC 4MFKA 4UBRA 3VWDA 2OZHA 3WABA 4F8ZA 2A4NA 1LAMA 4KSFA 2OH1A 4ZY1A 3TE4A 3ISZA 4F9VA 4MCSA 2Y0MA 4A94A 3DR8A 2WPXA 3GIUA 1RTQA 4E2AA 1YMEA 2Z3MA 4TWEA 4ZX8A 4A33A 2B3VA 1S60A 1BO4A 4C2ZA 5AG4A 3PFEA 3H8EA 2WYRA 4ZY0A 4X3RA 1MK4A 2ZEEA 2KCWA 3S6GA 3B8GA 4CAFA 1IYLA 1ZLHA 4PPZA 4GS4A 4UWJA 3D66A 1HEEA 4FAIA 4KOWA 5G1ZA 4KSAA 4NGMA 2QIRA 3N7ZA 1TF9A 4MFPA 1YLEA 4PK2A 3FEDA 4MI4A 1EE3P 4B5OA 1FNOA 2ZEHA 3JUWA 2FCKA 2CTBA 2VXKA 4FBEA 4MHDA 2B5GB 4GM5A 3EC4A 2IJZA 3B7IA 1QSNA 1P4NA 3PB6X 4LQGA 5J1QA 4A95A 2PJ5A 4NCZA 1IICA 3S9MA 1ELMP 5J8CA 2GLJA 2B58A 4CGLA 5ISVA 1OBRA 4E0AA 5HXDA 2FIAA 3T8WA 2POKA 3NH8A 4H2KA 4Q7AA 4U9ZA 2Q04A 2Z3OA 1CP7A 1S7FA 1Z9UA 2D4OA 2REEA 4PSWA 2AFMA 1CPXA 2ZEPA 1CP6A 2BEIA 4YWYA 1Q2CA 3SHPA 7CPAA 2FS5A 2K5TA 3NE7A 3SI2A 3TX8A 2ZW5A 1S7KA 1YK3A 3GLJA 4OAEA 5DWNA 4AG7A 4C2XA 4P4FA 3CXQA 1AYEA 4YU9A 2VL1A 4P45A 5D8NA 1UFHA 5H86A 3NH4A 4E8OA 1Z8XA 1HDQA 2CF4A 3NFZA 1CX8A 1IB1E 3DSBA 1MJAA 3UY5A 3KR5A 4P10A 1Q7LA 2JDCA 4NGTA 5KTAA 4YFJA 2JDDA 2PJ6A 4NEXA 4OKOA 3S6HA 3TC8A 5K8NA 2B5GA 4CRYB 3CDXA 4PK3A 5ELYA 2PSWA 3HUVA 3TTHA 3B3CA 1ZLIA 2GFQA 2AFSA 2ATRA 4PXBA 3R9GA 4CGNA 4OC1A 4UFVA 3LACA 5HVHA 2PJ7A 2P6GA 4ZX9A 1LFWA 3GYAA 3IWEA 4ZGYB 2VZYA 5KTCA 1IY7A 1PCAA 3E0KA 5HH1A 2PVWA 1IGBA 1YGHA 2BO9A 1I21A 3W6SA 5JH9A 2O4HA 4Y49B 1ARMA 2CXAA 4QC6A 1QSOA 2R1IA 3D68A 4FUUA 4PXDA 4YGOA 1CG2A 2GREA 4A37A 4B5PA 1XBUA 4RS2A 3KHZA 1LAPA 2ANPA 4R87A 1XEBA 3PZJA 2C6CA 3HLPA 2GANA 2Z11A 4QBJA 2G3AA 2VEZA 4R8FA 2EWBA 3RAMA 4A30A 2F5IA 3DGVA 4FD6A 4JLYA 3MN8A 1VKCA 4NJRA 1JQGA 4J3GA 4KVXA 1TKHA 3OWCA 4OC3A 4A31A 2AFZA 2FT0A 1I12A 3D7FA 2FE7A 4JXQA 2C27A 2IMOA 4X5KA 5CPAA 2I3CA 2Q7BA 2ZEDA 4P6YA 4HNWB 4ZYQA 3KL9A 1XRYA 4B14A 2ZW6A 1YVKA 2OU2A 3KI9A 2WUUA 1ZG8A 1Q2DA 1TIQA 2EO8A 2ABZA 1VHEA 1IU8A 2J8MA 2P0WA 4PSXA 5FVJA 5IV0A 1NSAA 4L89A 5IB9A 2RC4A 1M4LA 3G3SA 1M4GA 3QNVA 2Q4YA 2PE3A 3LD2A 3PGPA 3RYOA 1VIXA 4XPKA 4U5YA 4PXEA 1XMBA 3SJGA 3H8GA 4M6HA 2FIWA 4PV6A 1YREA 2AFOA 3ZJ0A 4C2YA 3TO7A 2BCOA 2JLMA 2O28A 4P44A 4P4BA 4OC4A 4AVCA 4CGOA 5JM6A 1S5KA 2VQYA 4R6TA 3FXTA 4KOYA 4C7HA 3IIBA 4CGPA 5J8FA 3S9NA 2ZEGA 3FNCA 4KVME 1NSLA 1IYKA 1P0HA 3GKRA 4FWUA 1IOIA 3PB9X 3FJUA 1Z2LA 4JYWA 4R7MA 2PJ0A 3BLNA 4KOSA 2QYVA 1UWYA 2BSWA 2B4DA 2OR4A 3NH5A 4F6AA 3FIXA 3C26A 5F46A 2RB7A 5AG7A 4XPDC 5I0CA 2WZNA 2ZEMA 3S6KA 4MCQA 4DUKA 4XNHB 2IL4A 4MHPA 4CYPA 1BAVA 1XE4A 4U9YA 1MJBA 1Z8LA 2PIZA 3B3TA 1JWQA 4HNXB 4OIWA 3RNZA 4F0YA 5H84A 4AXVA 4MBUA 2VZZA 2OZUA 3FF3A 3IFEA 6CPAA 2GU2A 2PJ1A 4G1PA 2PIYA 2HV2A 3CPXA 3TT2A 3RBUA 4WJBA 1QSMA 3H5ZA 5K8PA 4IHMA 5EBVA 1I1DA 4LX9A 2CTCA 3G8WA 1B87A 1M1DA 3IJ3A 3TO9A 1A2ZA 1CJWA 1XF8A 2Z3KA 2REFA 4OIDA 4R76A 1MJ9A 2ZOFA 5LRGA 2HB6A 4PXCA 3D8PA 1S7LA 2FSRA 3FYNA 4OLLA 2YNCA 1M44A 3D3SA 4HPSA 1M4IA 3B35A 4AVAA 3CZXA 5I4MA 2AFUA 4NGNA 1QSRA 3PB7X 4A2ZA 2VI7A 2HUZA 2NYQA 1KUVA 4KSIA 3TFYA 2ZW4A 4II9A 4C68A 1AMPA 1Y0YA 2GIVA 3KKWA 4NGPA 2C1CA 4NGRA 1RXTA 2PR1A 1R3NA 4CYOA 4IUSA 2XEJA 4NSQA 4HNYB 3IU2A 2O53A 2JEVA 1XMTA 3EFAA 1S3ZA 3SJFA 4NF1A 4XPDB 1F57A 4IAVA 1GHEA 5C88A 2R8VA 5LYFA 1IIDA 3FVLA 4UCNA 3KHXA 3D2MA 1VHOA 4MY0A 4B10A 1XOVA 3IGRA 1ZG9A 3SJEA 4A39A 5DWMA 2V77A 3D7GA 3WC6A 4M6GA 4DJLA 2Z3NA 4CAEA 1LANA 2DPTA 2EBJA 5CNPA 4UIAA 3BJ8A 4KOUA 3BI0A 2EK8A 4JWPA 4M6IA 3B3WA 4OC0A 2BUEA 2WPWA 4UFXA 1KUXA 3EO4A 1QQ9A 3MRUA 2CY2A 4R57A 3EXNA 4KLVA 2Z10A 4LQ6A 4ONWA 2CNSA 2P6FA 3I9SA 1SQHA 3V8IA 1XIXA 2PCUA 2Z3LA 3KASA 2OB0A 2R7HA 2PRQA 2OZGA 4TNUA 3PB4X 4FD5A 3VH9A 3FH4A 5KTDA 3PFOA 1LRZA 3DDDA 5EMIA 3FRMA 2PJBA 4B12A 1TKFA 4LUAA 4ONUA 1YVOA 5DS0A 4BBHA 2V8DA 5LYLA 4KOVA 2ZW7A 3D4UA 1R43A 1L0CA 4KOTA 4RN7A 1X10A 3K2KA 5JGFA 2PR8A 3FEEA 2G0BA 5GCNA 1B6BA 2NMTA 2VBQA 3I1UA 4NGQA 4CPAA 2H5MA 3KQZA 3W6XA 4KLWA 2X7BA 4FD7A 2BOAA 4CYQA 2CIJA 4UIBA 2IQ6A 4UCPA 2PJCA 4UWIA 1Z4EA 1Y7EA 4MRIA 4ZY2A 3R9EA 4KUAA 4CGMA 2PJ4A 4BINA 3TOAA 2PVVA 4K3NA 4NFRA 2JEWA 2J8RA 2FVGA 5CBMA 3IO1A 3JRUA 1WWZA 4H6ZA 3WC5A 4WWVA 3DR6A 1Z8WA 2Q51A 3K9UA 4MXUA 4EVYA 2YNDA 2ZEOA 2AFWA 4MCPA 4P4EA 1BPMA 2B3UA 4CAVA 3L2NA 1FT7A 2J8NA 2PJ8A 2PJAA 4QB9A 4XNHC 1AUGA 4NGSA 3GY9A 4A32A 3D7DA 4JZ0A 3CXSA 3RO0A 3PB8X 5K8OA 3F0AA 3BHXA 3H8FA 3JVNA 4B11A 1YW6A 2EUIA 2B4DB 2Q44A 3IWWA 4CRZB 5JQ4A 4CAWA 4MFJA 1N71A 1QMUA 3LODA 3CT9A 4P4DA 3W91A 4MFQA 4ORFA 3S9LA 4UCMA 2JBKA 2ARHA 2V8GA 3IC1A 4HKFA 1CBXA 4MFLA 4KVOE 3GB0A 1VGYA 5C82A 4AB7A 4ZI6A 4P4IA 3MGDA 2J9AA 1YLOA 3BJ7A 2F8HA 4M3SA 3SI0A 1S7NA 1ZO0A 2WSAA 2YNEA 3VATA 3V7ZA 4AG9A 2QECA 4OC5A 2EVNA 3B2YA 2DPSA 3V38A 4UEEA 2QMLA 4PQAA 2ZEFA 2EK9A 1CM0A 2PQ8A 5AG5A 4BMHA 1DTDA 4MHYA 4B5PB 1BLLE 3KZWA 4IK2A 4JD6A 4ZBGA 2F7VA 1ARLA 4KZTA 5F49A 5G21A 3CXPA 1NMTA 4M85A 1Z5RA 2PJ2A 4IF5A 4H6UA 4KOXA 4EFDA 2Q7SA 1Q2YA 4O23A 2D4PA 3FBUA 4MCRA 3FECA 3KGQA 4BD9A 3SXOA 3PEIA 2Q4VA 2R98A 2C6GA 1TXRA 1LCPA 3I3GA 1LOKA 3R1KA 2B4BA 4UF4A 4C7IA 1OZPA 3LWUA 4UEFA 1BOBA 2Z0ZA 4KORA 2OOTA 3B3VA 1PUAA 1Y0RA 5THWA 5A27A 2G9DA 4MFZA 2AFXA 1CPSA 2V8HA 3ISXA 2G3TA 2RFHA 2XEIA 4MHNA 2AJ6A 3SJXA 3BXMA 4R3KA 2I79A 1XFOA 2Q43A 4KS9A 2V8VA 5G22A 3BI1A 3PRTA 2I00A 4CS0B 2P6EA 2DEAA 4X8IA 3QAYA 5HVGA 3TOBA 3S6FA 3T90A 2FXFA
chains in the Genus database with same CATH topology
2ZELA 4OMEA 5F09A 4Z65A 2Q4ZA 3B3SA 2XEGA 2C6PA 5LYIA 4RUHA 3WC7A 3D7HA 2QJ8A 1F2PA 4A38A 5LYDA 3FX6A 2NSMA 5D29A 4MMOA 1PYTB 3SI1A 1YSJA 2HC9A 3WT4A 3PBEA 3FMCA 4P4JA 3RZAA 4MHZA 4DYOA 3K9TA 2PJ3A 2ZENA 3VARA 4NJQA 5HVFA 5LRKA 1ZG7A 5LRJA 1H8LA 1GYTA 3IEHA 8CPAA 1TKJA 2JBJA 4EWTA 4EMEA 4UEZA 3CPAA 4OP4A 5K8MA 2XEFA 1YW4A 4X2TA 3D67A 1F2OA 1BPNA 3KR4A 4W9YA 3LMSA 1DE4C 4OC2A 4F9UA 4B6ZA 1ELLP 2QVPA 1HDUA 1XJOA 3KQXA 3NA6A 2ZOGA 1KWMA 2PJ9A 2GLFA 3N5FA 1TF8A 3GUXA 3PBBA 3DLJA 4F8ZA 3WABA 1LAMA 4ZY1A 3ISZA 4F9VA 4MCSA 4A94A 1RTQA 1YMEA 4TWEA 4ZX8A 3PFEA 3H8EA 2WYRA 4ZY0A 4X3RA 2ZEEA 1ZLHA 4PPZA 4FAIA 3D66A 1HEEA 4NGMA 1TF9A 3FEDA 1EE3P 1FNOA 2ZEHA 2CTBA 4FBEA 4GM5A 2IJZA 3B7IA 4LQGA 5J1QA 3PB6X 2PJ5A 3S9MA 1ELMP 2GLJA 1OBRA 5HXDA 3T8WA 2POKA 3NH8A 4H2KA 4Q7AA 1CP7A 2AFMA 1CPXA 2ZEPA 1CP6A 4YWYA 5JH9A 7CPAA 3TX8A 3SI2A 3GLJA 4P4FA 1AYEA 4YU9A 2VL1A 4P45A 5D8NA 3NH4A 1HDQA 2CF4A 3NFZA 1CX8A 3KR5A 4P10A 1Q7LA 4NGTA 3TC8A 2PJ6A 4OKOA 5K8NA 3CDXA 5ELYA 3HUVA 3B3CA 1ZLIA 2AFSA 4PXBA 5HVHA 4OC1A 2PJ7A 4ZX9A 1LFWA 1IY7A 1PCAA 2PVWA 1IGBA 2BO9A 2O4HA 1ARMA 4PXDA 3D68A 4FUUA 1CG2A 2GREA 4A37A 1XBUA 3KHZA 1LAPA 2ANPA 2C6CA 3HLPA 4R8FA 2EWBA 3RAMA 3DGVA 3MN8A 4NJRA 1JQGA 4OC3A 1TKHA 2AFZA 3D7FA 2IMOA 5CPAA 2I3CA 2ZEDA 4P6YA 4ZYQA 3KL9A 1XRYA 3KI9A 1ZG8A 2ABZA 1VHEA 1NSAA 5IB9A 1M4LA 3QNVA 2PE3A 1VIXA 4PXEA 1XMBA 3SJGA 3H8GA 2AFOA 2BCOA 4P4BA 4P44A 4OC4A 5JM6A 4R6TA 3IIBA 3S9NA 2ZEGA 4FWUA 3PB9X 4JYWA 3FJUA 1Z2LA 4R7MA 2PJ0A 2QYVA 1UWYA 2OR4A 3NH5A 2RB7A 2WZNA 2ZEMA 4MCQA 4DUKA 4MHPA 1BAVA 1Z8LA 2PIZA 3B3TA 4OIWA 4AXVA 3FF3A 3IFEA 6CPAA 2GU2A 2PJ1A 4G1PA 2PIYA 3CPXA 3RBUA 4WJBA 5K8PA 4IHMA 2CTCA 3IJ3A 4OIDA 4R76A 2ZOFA 5LRGA 2HB6A 4PXCA 3B35A 5I4MA 2AFUA 4NGNA 3PB7X 2NYQA 4KSIA 1AMPA 1Y0YA 4NGPA 2C1CA 4NGRA 1R3NA 2XEJA 2O53A 3SJFA 1F57A 4IAVA 5LYFA 3FVLA 3KHXA 1VHOA 1ZG9A 3SJEA 4A39A 2V77A 3D7GA 3WC6A 4DJLA 1LANA 4UIAA 3BI0A 2EK8A 3B3WA 4OC0A 1QQ9A 3MRUA 4ONWA 2PCUA 3KASA 2PRQA 4TNUA 3PB4X 3VH9A 3FH4A 3PFOA 2PJBA 1TKFA 5DS0A 2V8DA 5LYLA 3D4UA 1R43A 3K2KA 5JGFA 3FEEA 4CPAA 3I1UA 4NGQA 3KQZA 2BOAA 2CIJA 4UIBA 2IQ6A 4ZY2A 2PJCA 4MRIA 1Y7EA 2PJ4A 2PVVA 4K3NA 4NFRA 2JEWA 2FVGA 5CBMA 3IO1A 3JRUA 3WC5A 4WWVA 2Q51A 4MXUA 2ZEOA 2AFWA 4MCPA 4P4EA 1BPMA 3L2NA 1FT7A 2PJ8A 2PJAA 4NGSA 3D7DA 4JZ0A 3PB8X 5K8OA 3BHXA 3H8FA 1YW6A 3IWWA 1QMUA 4P4DA 3CT9A 3S9LA 2JBKA 2V8GA 3IC1A 1CBXA 3GB0A 1VGYA 4ZI6A 4P4IA 2J9AA 1YLOA 2F8HA 3SI0A 3VATA 3V7ZA 4OC5A 3B2YA 3V38A 4UEEA 4PQAA 2ZEFA 2EK9A 1DTDA 4MHYA 1BLLE 3KZWA 4IK2A 2F7VA 1ARLA 1Z5RA 2PJ2A 4EFDA 4O23A 4MCRA 3FECA 3KGQA 4BD9A 3PEIA 4UF4A 2C6GA 1TXRA 1LCPA 1LOKA 3LWUA 4UEFA 2OOTA 3B3VA 1Y0RA 5THWA 2G9DA 2AFXA 1CPSA 2V8HA 3ISXA 2RFHA 2XEIA 4MHNA 3SJXA 3BXMA 1XFOA 2Q43A 2V8VA 3BI1A 3PRTA 2DEAA 4X8IA 5HVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEL A;  4OME A;  5F09 A;  4Z65 A;  2Q4Z A;  3B3S A;  2XEG A;  2C6P A;  5LYI A;  4RUH A;  3WC7 A;  3D7H A;  2QJ8 A;  1F2P A;  4A38 A;  5LYD A;  3FX6 A;  2NSM A;  5D29 A;  4MMO A;  1PYT B;  3SI1 A;  1YSJ A;  2HC9 A;  3WT4 A;  3PBE A;  3FMC A;  4P4J A;  3RZA A;  4MHZ A;  4DYO A;  3K9T A;  2PJ3 A;  2ZEN A;  3VAR A;  4NJQ A;  5HVF A;  5LRK A;  1ZG7 A;  5LRJ A;  1H8L A;  1GYT A;  3IEH A;  8CPA A;  1TKJ A;  2JBJ A;  4EWT A;  4EME A;  4UEZ A;  3CPA A;  4OP4 A;  5K8M A;  2XEF A;  1YW4 A;  4X2T A;  3D67 A;  1F2O A;  1BPN A;  3KR4 A;  4W9Y A;  3LMS A;  1DE4 C;  4OC2 A;  4F9U A;  4B6Z A;  1ELL P;  2QVP A;  1HDU A;  1XJO A;  3KQX A;  3NA6 A;  2ZOG A;  1KWM A;  2PJ9 A;  2GLF A;  3N5F A;  1TF8 A;  3GUX A;  3PBB A;  3DLJ A;  4F8Z A;  3WAB A;  1LAM A;  4ZY1 A;  3ISZ A;  4F9V A;  4MCS A;  4A94 A;  1RTQ A;  1YME A;  4TWE A;  4ZX8 A;  3PFE A;  3H8E A;  2WYR A;  4ZY0 A;  4X3R A;  2ZEE A;  1ZLH A;  4PPZ A;  4FAI A;  3D66 A;  1HEE A;  4NGM A;  1TF9 A;  3FED A;  1EE3 P;  1FNO A;  2ZEH A;  2CTB A;  4FBE A;  4GM5 A;  2IJZ A;  3B7I A;  4LQG A;  5J1Q A;  3PB6 X;  2PJ5 A;  3S9M A;  1ELM P;  2GLJ A;  1OBR A;  5HXD A;  3T8W A;  2POK A;  3NH8 A;  4H2K A;  4Q7A A;  1CP7 A;  2AFM A;  1CPX A;  2ZEP A;  1CP6 A;  4YWY A;  5JH9 A;  7CPA A;  3TX8 A;  3SI2 A;  3GLJ A;  4P4F A;  1AYE A;  4YU9 A;  2VL1 A;  4P45 A;  5D8N A;  3NH4 A;  1HDQ A;  2CF4 A;  3NFZ A;  1CX8 A;  3KR5 A;  4P10 A;  1Q7L A;  4NGT A;  3TC8 A;  2PJ6 A;  4OKO A;  5K8N A;  3CDX A;  5ELY A;  3HUV A;  3B3C A;  1ZLI A;  2AFS A;  4PXB A;  5HVH A;  4OC1 A;  2PJ7 A;  4ZX9 A;  1LFW A;  1IY7 A;  1PCA A;  2PVW A;  1IGB A;  2BO9 A;  2O4H A;  1ARM A;  4PXD A;  3D68 A;  4FUU A;  1CG2 A;  2GRE A;  4A37 A;  1XBU A;  3KHZ A;  1LAP A;  2ANP A;  2C6C A;  3HLP A;  4R8F A;  2EWB A;  3RAM A;  3DGV A;  3MN8 A;  4NJR A;  1JQG A;  4OC3 A;  1TKH A;  2AFZ A;  3D7F A;  2IMO A;  5CPA A;  2I3C A;  2ZED A;  4P6Y A;  4ZYQ A;  3KL9 A;  1XRY A;  3KI9 A;  1ZG8 A;  2ABZ A;  1VHE A;  1NSA A;  5IB9 A;  1M4L A;  3QNV A;  2PE3 A;  1VIX A;  4PXE A;  1XMB A;  3SJG A;  3H8G A;  2AFO A;  2BCO A;  4P4B A;  4P44 A;  4OC4 A;  5JM6 A;  4R6T A;  3IIB A;  3S9N A;  2ZEG A;  4FWU A;  3PB9 X;  4JYW A;  3FJU A;  1Z2L A;  4R7M A;  2PJ0 A;  2QYV A;  1UWY A;  2OR4 A;  3NH5 A;  2RB7 A;  2WZN A;  2ZEM A;  4MCQ A;  4DUK A;  4MHP A;  1BAV A;  1Z8L A;  2PIZ A;  3B3T A;  4OIW A;  4AXV A;  3FF3 A;  3IFE A;  6CPA A;  2GU2 A;  2PJ1 A;  4G1P A;  2PIY A;  3CPX A;  3RBU A;  4WJB A;  5K8P A;  4IHM A;  2CTC A;  3IJ3 A;  4OID A;  4R76 A;  2ZOF A;  5LRG A;  2HB6 A;  4PXC A;  3B35 A;  5I4M A;  2AFU A;  4NGN A;  3PB7 X;  2NYQ A;  4KSI A;  1AMP A;  1Y0Y A;  4NGP A;  2C1C A;  4NGR A;  1R3N A;  2XEJ A;  2O53 A;  3SJF A;  1F57 A;  4IAV A;  5LYF A;  3FVL A;  3KHX A;  1VHO A;  1ZG9 A;  3SJE A;  4A39 A;  2V77 A;  3D7G A;  3WC6 A;  4DJL A;  1LAN A;  4UIA A;  3BI0 A;  2EK8 A;  3B3W A;  4OC0 A;  1QQ9 A;  3MRU A;  4ONW A;  2PCU A;  3KAS A;  2PRQ A;  4TNU A;  3PB4 X;  3VH9 A;  3FH4 A;  3PFO A;  2PJB A;  1TKF A;  5DS0 A;  2V8D A;  5LYL A;  3D4U A;  1R43 A;  3K2K A;  5JGF A;  3FEE A;  4CPA A;  3I1U A;  4NGQ A;  3KQZ A;  2BOA A;  2CIJ A;  4UIB A;  2IQ6 A;  4ZY2 A;  2PJC A;  4MRI A;  1Y7E A;  2PJ4 A;  2PVV A;  4K3N A;  4NFR A;  2JEW A;  2FVG A;  5CBM A;  3IO1 A;  3JRU A;  3WC5 A;  4WWV A;  2Q51 A;  4MXU A;  2ZEO A;  2AFW A;  4MCP A;  4P4E A;  1BPM A;  3L2N A;  1FT7 A;  2PJ8 A;  2PJA A;  4NGS A;  3D7D A;  4JZ0 A;  3PB8 X;  5K8O A;  3BHX A;  3H8F A;  1YW6 A;  3IWW A;  1QMU A;  4P4D A;  3CT9 A;  3S9L A;  2JBK A;  2V8G A;  3IC1 A;  1CBX A;  3GB0 A;  1VGY A;  4ZI6 A;  4P4I A;  2J9A A;  1YLO A;  2F8H A;  3SI0 A;  3VAT A;  3V7Z A;  4OC5 A;  3B2Y A;  3V38 A;  4UEE A;  4PQA A;  2ZEF A;  2EK9 A;  1DTD A;  4MHY A;  1BLL E;  3KZW A;  4IK2 A;  2F7V A;  1ARL A;  1Z5R A;  2PJ2 A;  4EFD A;  4O23 A;  4MCR A;  3FEC A;  3KGQ A;  4BD9 A;  3PEI A;  4UF4 A;  2C6G A;  1TXR A;  1LCP A;  1LOK A;  3LWU A;  4UEF A;  2OOT A;  3B3V A;  1Y0R A;  5THW A;  2G9D A;  2AFX A;  1CPS A;  2V8H A;  3ISX A;  2RFH A;  2XEI A;  4MHN A;  3SJX A;  3BXM A;  1XFO A;  2Q43 A;  2V8V A;  3BI1 A;  3PRT A;  2DEA A;  4X8I A;  5HVG A; 
#chains in the Genus database with same CATH topology
 2ZEL A;  3P2F A;  4OME A;  3R95 A;  5F09 A;  3FB3 A;  2GE3 A;  4YRH A;  4Z65 A;  4R3L A;  2Q4Z A;  3B3S A;  2XEG A;  2C6P A;  2Z3P A;  1KZF A;  5AGE A;  5LYI A;  4RUH A;  4UFW A;  1YR0 A;  5BWA B;  3WC7 A;  2BL1 A;  3D7H A;  2QJ8 A;  1F2P A;  4I49 A;  1M4D A;  2Q0Y A;  1RO5 A;  4A38 A;  5LYD A;  3FX6 A;  3QAH A;  5IB0 A;  2NSM A;  1YX0 A;  2DF5 A;  2YGW A;  1Y9W A;  4RI1 A;  5IX3 A;  3DNS A;  5D29 A;  4MMO A;  1YQE A;  4QVT A;  3R96 A;  1Y7R A;  1PYT B;  3SI1 A;  1FY7 A;  1YSJ A;  2HC9 A;  3WT4 A;  3PBE A;  4CYN A;  2CNM A;  4JJX A;  3FMC A;  4MY3 A;  4P4J A;  3RZA A;  3TO6 A;  3A9L A;  4XPL A;  4KUB A;  2PRB A;  4MHZ A;  4DYO A;  3K9T A;  2CNT A;  2PJ3 A;  2ZEN A;  1QST A;  3QB8 A;  4Q36 A;  4UA3 A;  3F5B A;  3VAR A;  4NJQ A;  5HVF A;  5LRK A;  1ZG7 A;  4QUS A;  5LRJ A;  1H8L A;  1GYT A;  3IEH A;  8CPA A;  1TKJ A;  3JTK A;  4NXY A;  4JXR A;  3T9Y A;  2JBJ A;  4EWT A;  4EME A;  1R57 A;  5E96 A;  3ZZI A;  2DXQ A;  1Z8T A;  1PU9 A;  1K4J A;  5EC4 A;  3IWG A;  4UEZ A;  4CAX A;  3CPA A;  3D2P A;  5HMN A;  1NE9 A;  4Y49 C;  4L8A A;  4OP4 A;  1X12 A;  2ZXV A;  3H4Q A;  5JPH A;  5K8M A;  5AG6 A;  2XEF A;  3F8K A;  1YW4 A;  4X2T A;  3VWE A;  3D67 A;  3IU1 A;  3WR7 A;  3R9F A;  2AE6 A;  1Z4R A;  4GXH A;  3TCV A;  1F2O A;  5G20 A;  4B13 A;  1BPN A;  1U6M A;  2HQY A;  1J4J A;  1KUY A;  3KR4 A;  4W9Y A;  3LMS A;  5A28 A;  1DE4 C;  2ZPA A;  3P2H A;  4MJ8 A;  4OC2 A;  4F9U A;  4B6Z A;  3EY5 A;  1ELL P;  5F47 A;  2QVP A;  1HDU A;  1VHS A;  1XJO A;  4R9M A;  4K30 A;  3KQX A;  4Q38 A;  1WK4 A;  1ON0 A;  3NA6 A;  2ZOG A;  4H89 A;  2PC1 A;  4FD4 A;  1KWM A;  1IOF A;  3PP9 A;  5F48 A;  2PJ9 A;  3NE8 A;  3SXN A;  2GLF A;  4DNC A;  2PDO A;  3N5F A;  4AVB A;  4F0X A;  1TF8 A;  1Y9K A;  2ODF A;  3GUX A;  4OAD A;  3PBB A;  3DLJ A;  1V0C A;  2FL4 A;  2YNC C;  4MFK A;  4UBR A;  3VWD A;  2OZH A;  3WAB A;  4F8Z A;  2A4N A;  1LAM A;  4KSF A;  2OH1 A;  4ZY1 A;  3TE4 A;  3ISZ A;  4F9V A;  4MCS A;  2Y0M A;  4A94 A;  3DR8 A;  2WPX A;  3GIU A;  1RTQ A;  4E2A A;  1YME A;  2Z3M A;  4TWE A;  4ZX8 A;  4A33 A;  2B3V A;  1S60 A;  1BO4 A;  4C2Z A;  5AG4 A;  3PFE A;  3H8E A;  2WYR A;  4ZY0 A;  4X3R A;  1MK4 A;  2ZEE A;  2KCW A;  3S6G A;  3B8G A;  4CAF A;  1IYL A;  1ZLH A;  4PPZ A;  4GS4 A;  4UWJ A;  3D66 A;  1HEE A;  4FAI A;  4KOW A;  5G1Z A;  4KSA A;  4NGM A;  2QIR A;  3N7Z A;  1TF9 A;  4MFP A;  1YLE A;  4PK2 A;  3FED A;  4MI4 A;  1EE3 P;  4B5O A;  1FNO A;  2ZEH A;  3JUW A;  2FCK A;  2CTB A;  2VXK A;  4FBE A;  4MHD A;  2B5G B;  4GM5 A;  3EC4 A;  2IJZ A;  3B7I A;  1QSN A;  1P4N A;  3PB6 X;  4LQG A;  5J1Q A;  4A95 A;  2PJ5 A;  4NCZ A;  1IIC A;  3S9M A;  1ELM P;  5J8C A;  2GLJ A;  2B58 A;  4CGL A;  5ISV A;  1OBR A;  4E0A A;  5HXD A;  2FIA A;  3T8W A;  2POK A;  3NH8 A;  4H2K A;  4Q7A A;  4U9Z A;  2Q04 A;  2Z3O A;  1CP7 A;  1S7F A;  1Z9U A;  2D4O A;  2REE A;  4PSW A;  2AFM A;  1CPX A;  2ZEP A;  1CP6 A;  2BEI A;  4YWY A;  1Q2C A;  3SHP A;  7CPA A;  2FS5 A;  2K5T A;  3NE7 A;  3SI2 A;  3TX8 A;  2ZW5 A;  1S7K A;  1YK3 A;  3GLJ A;  4OAE A;  5DWN A;  4AG7 A;  4C2X A;  4P4F A;  3CXQ A;  1AYE A;  4YU9 A;  2VL1 A;  4P45 A;  5D8N A;  1UFH A;  5H86 A;  3NH4 A;  4E8O A;  1Z8X A;  1HDQ A;  2CF4 A;  3NFZ A;  1CX8 A;  1IB1 E;  3DSB A;  1MJA A;  3UY5 A;  3KR5 A;  4P10 A;  1Q7L A;  2JDC A;  4NGT A;  5KTA A;  4YFJ A;  2JDD A;  2PJ6 A;  4NEX A;  4OKO A;  3S6H A;  3TC8 A;  5K8N A;  2B5G A;  4CRY B;  3CDX A;  4PK3 A;  5ELY A;  2PSW A;  3HUV A;  3TTH A;  3B3C A;  1ZLI A;  2GFQ A;  2AFS A;  2ATR A;  4PXB A;  3R9G A;  4CGN A;  4OC1 A;  4UFV A;  3LAC A;  5HVH A;  2PJ7 A;  2P6G A;  4ZX9 A;  1LFW A;  3GYA A;  3IWE A;  4ZGY B;  2VZY A;  5KTC A;  1IY7 A;  1PCA A;  3E0K A;  5HH1 A;  2PVW A;  1IGB A;  1YGH A;  2BO9 A;  1I21 A;  3W6S A;  5JH9 A;  2O4H A;  4Y49 B;  1ARM A;  2CXA A;  4QC6 A;  1QSO A;  2R1I A;  3D68 A;  4FUU A;  4PXD A;  4YGO A;  1CG2 A;  2GRE A;  4A37 A;  4B5P A;  1XBU A;  4RS2 A;  3KHZ A;  1LAP A;  2ANP A;  4R87 A;  1XEB A;  3PZJ A;  2C6C A;  3HLP A;  2GAN A;  2Z11 A;  4QBJ A;  2G3A A;  2VEZ A;  4R8F A;  2EWB A;  3RAM A;  4A30 A;  2F5I A;  3DGV A;  4FD6 A;  4JLY A;  3MN8 A;  1VKC A;  4NJR A;  1JQG A;  4J3G A;  4KVX A;  1TKH A;  3OWC A;  4OC3 A;  4A31 A;  2AFZ A;  2FT0 A;  1I12 A;  3D7F A;  2FE7 A;  4JXQ A;  2C27 A;  2IMO A;  4X5K A;  5CPA A;  2I3C A;  2Q7B A;  2ZED A;  4P6Y A;  4HNW B;  4ZYQ A;  3KL9 A;  1XRY A;  4B14 A;  2ZW6 A;  1YVK A;  2OU2 A;  3KI9 A;  2WUU A;  1ZG8 A;  1Q2D A;  1TIQ A;  2EO8 A;  2ABZ A;  1VHE A;  1IU8 A;  2J8M A;  2P0W A;  4PSX A;  5FVJ A;  5IV0 A;  1NSA A;  4L89 A;  5IB9 A;  2RC4 A;  1M4L A;  3G3S A;  1M4G A;  3QNV A;  2Q4Y A;  2PE3 A;  3LD2 A;  3PGP A;  3RYO A;  1VIX A;  4XPK A;  4U5Y A;  4PXE A;  1XMB A;  3SJG A;  3H8G A;  4M6H A;  2FIW A;  4PV6 A;  1YRE A;  2AFO A;  3ZJ0 A;  4C2Y A;  3TO7 A;  2BCO A;  2JLM A;  2O28 A;  4P44 A;  4P4B A;  4OC4 A;  4AVC A;  4CGO A;  5JM6 A;  1S5K A;  2VQY A;  4R6T A;  3FXT A;  4KOY A;  4C7H A;  3IIB A;  4CGP A;  5J8F A;  3S9N A;  2ZEG A;  3FNC A;  4KVM E;  1NSL A;  1IYK A;  1P0H A;  3GKR A;  4FWU A;  1IOI A;  3PB9 X;  3FJU A;  1Z2L A;  4JYW A;  4R7M A;  2PJ0 A;  3BLN A;  4KOS A;  2QYV A;  1UWY A;  2BSW A;  2B4D A;  2OR4 A;  3NH5 A;  4F6A A;  3FIX A;  3C26 A;  5F46 A;  2RB7 A;  5AG7 A;  4XPD C;  5I0C A;  2WZN A;  2ZEM A;  3S6K A;  4MCQ A;  4DUK A;  4XNH B;  2IL4 A;  4MHP A;  4CYP A;  1BAV A;  1XE4 A;  4U9Y A;  1MJB A;  1Z8L A;  2PIZ A;  3B3T A;  1JWQ A;  4HNX B;  4OIW A;  3RNZ A;  4F0Y A;  5H84 A;  4AXV A;  4MBU A;  2VZZ A;  2OZU A;  3FF3 A;  3IFE A;  6CPA A;  2GU2 A;  2PJ1 A;  4G1P A;  2PIY A;  2HV2 A;  3CPX A;  3TT2 A;  3RBU A;  4WJB A;  1QSM A;  3H5Z A;  5K8P A;  4IHM A;  5EBV A;  1I1D A;  4LX9 A;  2CTC A;  3G8W A;  1B87 A;  1M1D A;  3IJ3 A;  3TO9 A;  1A2Z A;  1CJW A;  1XF8 A;  2Z3K A;  2REF A;  4OID A;  4R76 A;  1MJ9 A;  2ZOF A;  5LRG A;  2HB6 A;  4PXC A;  3D8P A;  1S7L A;  2FSR A;  3FYN A;  4OLL A;  2YNC A;  1M44 A;  3D3S A;  4HPS A;  1M4I A;  3B35 A;  4AVA A;  3CZX A;  5I4M A;  2AFU A;  4NGN A;  1QSR A;  3PB7 X;  4A2Z A;  2VI7 A;  2HUZ A;  2NYQ A;  1KUV A;  4KSI A;  3TFY A;  2ZW4 A;  4II9 A;  4C68 A;  1AMP A;  1Y0Y A;  2GIV A;  3KKW A;  4NGP A;  2C1C A;  4NGR A;  1RXT A;  2PR1 A;  1R3N A;  4CYO A;  4IUS A;  2XEJ A;  4NSQ A;  4HNY B;  3IU2 A;  2O53 A;  2JEV A;  1XMT A;  3EFA A;  1S3Z A;  3SJF A;  4NF1 A;  4XPD B;  1F57 A;  4IAV A;  1GHE A;  5C88 A;  2R8V A;  5LYF A;  1IID A;  3FVL A;  4UCN A;  3KHX A;  3D2M A;  1VHO A;  4MY0 A;  4B10 A;  1XOV A;  3IGR A;  1ZG9 A;  3SJE A;  4A39 A;  5DWM A;  2V77 A;  3D7G A;  3WC6 A;  4M6G A;  4DJL A;  2Z3N A;  4CAE A;  1LAN A;  2DPT A;  2EBJ A;  5CNP A;  4UIA A;  3BJ8 A;  4KOU A;  3BI0 A;  2EK8 A;  4JWP A;  4M6I A;  3B3W A;  4OC0 A;  2BUE A;  2WPW A;  4UFX A;  1KUX A;  3EO4 A;  1QQ9 A;  3MRU A;  2CY2 A;  4R57 A;  3EXN A;  4KLV A;  2Z10 A;  4LQ6 A;  4ONW A;  2CNS A;  2P6F A;  3I9S A;  1SQH A;  3V8I A;  1XIX A;  2PCU A;  2Z3L A;  3KAS A;  2OB0 A;  2R7H A;  2PRQ A;  2OZG A;  4TNU A;  3PB4 X;  4FD5 A;  3VH9 A;  3FH4 A;  5KTD A;  3PFO A;  1LRZ A;  3DDD A;  5EMI A;  3FRM A;  2PJB A;  4B12 A;  1TKF A;  4LUA A;  4ONU A;  1YVO A;  5DS0 A;  4BBH A;  2V8D A;  5LYL A;  4KOV A;  2ZW7 A;  3D4U A;  1R43 A;  1L0C A;  4KOT A;  4RN7 A;  1X10 A;  3K2K A;  5JGF A;  2PR8 A;  3FEE A;  2G0B A;  5GCN A;  1B6B A;  2NMT A;  2VBQ A;  3I1U A;  4NGQ A;  4CPA A;  2H5M A;  3KQZ A;  3W6X A;  4KLW A;  2X7B A;  4FD7 A;  2BOA A;  4CYQ A;  2CIJ A;  4UIB A;  2IQ6 A;  4UCP A;  2PJC A;  4UWI A;  1Z4E A;  1Y7E A;  4MRI A;  4ZY2 A;  3R9E A;  4KUA A;  4CGM A;  2PJ4 A;  4BIN A;  3TOA A;  2PVV A;  4K3N A;  4NFR A;  2JEW A;  2J8R A;  2FVG A;  5CBM A;  3IO1 A;  3JRU A;  1WWZ A;  4H6Z A;  3WC5 A;  4WWV A;  3DR6 A;  1Z8W A;  2Q51 A;  3K9U A;  4MXU A;  4EVY A;  2YND A;  2ZEO A;  2AFW A;  4MCP A;  4P4E A;  1BPM A;  2B3U A;  4CAV A;  3L2N A;  1FT7 A;  2J8N A;  2PJ8 A;  2PJA A;  4QB9 A;  4XNH C;  1AUG A;  4NGS A;  3GY9 A;  4A32 A;  3D7D A;  4JZ0 A;  3CXS A;  3RO0 A;  3PB8 X;  5K8O A;  3F0A A;  3BHX A;  3H8F A;  3JVN A;  4B11 A;  1YW6 A;  2EUI A;  2B4D B;  2Q44 A;  3IWW A;  4CRZ B;  5JQ4 A;  4CAW A;  4MFJ A;  1N71 A;  1QMU A;  3LOD A;  3CT9 A;  4P4D A;  3W91 A;  4MFQ A;  4ORF A;  3S9L A;  4UCM A;  2JBK A;  2ARH A;  2V8G A;  3IC1 A;  4HKF A;  1CBX A;  4MFL A;  4KVO E;  3GB0 A;  1VGY A;  5C82 A;  4AB7 A;  4ZI6 A;  4P4I A;  3MGD A;  2J9A A;  1YLO A;  3BJ7 A;  2F8H A;  4M3S A;  3SI0 A;  1S7N A;  1ZO0 A;  2WSA A;  2YNE A;  3VAT A;  3V7Z A;  4AG9 A;  2QEC A;  4OC5 A;  2EVN A;  3B2Y A;  2DPS A;  3V38 A;  4UEE A;  2QML A;  4PQA A;  2ZEF A;  2EK9 A;  1CM0 A;  2PQ8 A;  5AG5 A;  4BMH A;  1DTD A;  4MHY A;  4B5P B;  1BLL E;  3KZW A;  4IK2 A;  4JD6 A;  4ZBG A;  2F7V A;  1ARL A;  4KZT A;  5F49 A;  5G21 A;  3CXP A;  1NMT A;  4M85 A;  1Z5R A;  2PJ2 A;  4IF5 A;  4H6U A;  4KOX A;  4EFD A;  2Q7S A;  1Q2Y A;  4O23 A;  2D4P A;  3FBU A;  4MCR A;  3FEC A;  3KGQ A;  4BD9 A;  3SXO A;  3PEI A;  2Q4V A;  2R98 A;  2C6G A;  1TXR A;  1LCP A;  3I3G A;  1LOK A;  3R1K A;  2B4B A;  4UF4 A;  4C7I A;  1OZP A;  3LWU A;  4UEF A;  1BOB A;  2Z0Z A;  4KOR A;  2OOT A;  3B3V A;  1PUA A;  1Y0R A;  5THW A;  5A27 A;  2G9D A;  4MFZ A;  2AFX A;  1CPS A;  2V8H A;  3ISX A;  2G3T A;  2RFH A;  2XEI A;  4MHN A;  2AJ6 A;  3SJX A;  3BXM A;  4R3K A;  2I79 A;  1XFO A;  2Q43 A;  4KS9 A;  2V8V A;  5G22 A;  3BI1 A;  3PRT A;  2I00 A;  4CS0 B;  2P6E A;  2DEA A;  4X8I A;  3QAY A;  5HVG A;  3TOB A;  3S6F A;  3T90 A;  2FXF A; 
#chains in the Genus database with same CATH homology
 2ZEL A;  4OME A;  5F09 A;  4Z65 A;  2Q4Z A;  3B3S A;  2XEG A;  2C6P A;  5LYI A;  4RUH A;  3WC7 A;  3D7H A;  2QJ8 A;  1F2P A;  4A38 A;  5LYD A;  3FX6 A;  2NSM A;  5D29 A;  4MMO A;  1PYT B;  3SI1 A;  1YSJ A;  2HC9 A;  3WT4 A;  3PBE A;  3FMC A;  4P4J A;  3RZA A;  4MHZ A;  4DYO A;  3K9T A;  2PJ3 A;  2ZEN A;  3VAR A;  4NJQ A;  5HVF A;  5LRK A;  1ZG7 A;  5LRJ A;  1H8L A;  1GYT A;  3IEH A;  8CPA A;  1TKJ A;  2JBJ A;  4EWT A;  4EME A;  4UEZ A;  3CPA A;  4OP4 A;  5K8M A;  2XEF A;  1YW4 A;  4X2T A;  3D67 A;  1F2O A;  1BPN A;  3KR4 A;  4W9Y A;  3LMS A;  1DE4 C;  4OC2 A;  4F9U A;  4B6Z A;  1ELL P;  2QVP A;  1HDU A;  1XJO A;  3KQX A;  3NA6 A;  2ZOG A;  1KWM A;  2PJ9 A;  2GLF A;  3N5F A;  1TF8 A;  3GUX A;  3PBB A;  3DLJ A;  4F8Z A;  3WAB A;  1LAM A;  4ZY1 A;  3ISZ A;  4F9V A;  4MCS A;  4A94 A;  1RTQ A;  1YME A;  4TWE A;  4ZX8 A;  3PFE A;  3H8E A;  2WYR A;  4ZY0 A;  4X3R A;  2ZEE A;  1ZLH A;  4PPZ A;  4FAI A;  3D66 A;  1HEE A;  4NGM A;  1TF9 A;  3FED A;  1EE3 P;  1FNO A;  2ZEH A;  2CTB A;  4FBE A;  4GM5 A;  2IJZ A;  3B7I A;  4LQG A;  5J1Q A;  3PB6 X;  2PJ5 A;  3S9M A;  1ELM P;  2GLJ A;  1OBR A;  5HXD A;  3T8W A;  2POK A;  3NH8 A;  4H2K A;  4Q7A A;  1CP7 A;  2AFM A;  1CPX A;  2ZEP A;  1CP6 A;  4YWY A;  5JH9 A;  7CPA A;  3TX8 A;  3SI2 A;  3GLJ A;  4P4F A;  1AYE A;  4YU9 A;  2VL1 A;  4P45 A;  5D8N A;  3NH4 A;  1HDQ A;  2CF4 A;  3NFZ A;  1CX8 A;  3KR5 A;  4P10 A;  1Q7L A;  4NGT A;  3TC8 A;  2PJ6 A;  4OKO A;  5K8N A;  3CDX A;  5ELY A;  3HUV A;  3B3C A;  1ZLI A;  2AFS A;  4PXB A;  5HVH A;  4OC1 A;  2PJ7 A;  4ZX9 A;  1LFW A;  1IY7 A;  1PCA A;  2PVW A;  1IGB A;  2BO9 A;  2O4H A;  1ARM A;  4PXD A;  3D68 A;  4FUU A;  1CG2 A;  2GRE A;  4A37 A;  1XBU A;  3KHZ A;  1LAP A;  2ANP A;  2C6C A;  3HLP A;  4R8F A;  2EWB A;  3RAM A;  3DGV A;  3MN8 A;  4NJR A;  1JQG A;  4OC3 A;  1TKH A;  2AFZ A;  3D7F A;  2IMO A;  5CPA A;  2I3C A;  2ZED A;  4P6Y A;  4ZYQ A;  3KL9 A;  1XRY A;  3KI9 A;  1ZG8 A;  2ABZ A;  1VHE A;  1NSA A;  5IB9 A;  1M4L A;  3QNV A;  2PE3 A;  1VIX A;  4PXE A;  1XMB A;  3SJG A;  3H8G A;  2AFO A;  2BCO A;  4P4B A;  4P44 A;  4OC4 A;  5JM6 A;  4R6T A;  3IIB A;  3S9N A;  2ZEG A;  4FWU A;  3PB9 X;  4JYW A;  3FJU A;  1Z2L A;  4R7M A;  2PJ0 A;  2QYV A;  1UWY A;  2OR4 A;  3NH5 A;  2RB7 A;  2WZN A;  2ZEM A;  4MCQ A;  4DUK A;  4MHP A;  1BAV A;  1Z8L A;  2PIZ A;  3B3T A;  4OIW A;  4AXV A;  3FF3 A;  3IFE A;  6CPA A;  2GU2 A;  2PJ1 A;  4G1P A;  2PIY A;  3CPX A;  3RBU A;  4WJB A;  5K8P A;  4IHM A;  2CTC A;  3IJ3 A;  4OID A;  4R76 A;  2ZOF A;  5LRG A;  2HB6 A;  4PXC A;  3B35 A;  5I4M A;  2AFU A;  4NGN A;  3PB7 X;  2NYQ A;  4KSI A;  1AMP A;  1Y0Y A;  4NGP A;  2C1C A;  4NGR A;  1R3N A;  2XEJ A;  2O53 A;  3SJF A;  1F57 A;  4IAV A;  5LYF A;  3FVL A;  3KHX A;  1VHO A;  1ZG9 A;  3SJE A;  4A39 A;  2V77 A;  3D7G A;  3WC6 A;  4DJL A;  1LAN A;  4UIA A;  3BI0 A;  2EK8 A;  3B3W A;  4OC0 A;  1QQ9 A;  3MRU A;  4ONW A;  2PCU A;  3KAS A;  2PRQ A;  4TNU A;  3PB4 X;  3VH9 A;  3FH4 A;  3PFO A;  2PJB A;  1TKF A;  5DS0 A;  2V8D A;  5LYL A;  3D4U A;  1R43 A;  3K2K A;  5JGF A;  3FEE A;  4CPA A;  3I1U A;  4NGQ A;  3KQZ A;  2BOA A;  2CIJ A;  4UIB A;  2IQ6 A;  4ZY2 A;  2PJC A;  4MRI A;  1Y7E A;  2PJ4 A;  2PVV A;  4K3N A;  4NFR A;  2JEW A;  2FVG A;  5CBM A;  3IO1 A;  3JRU A;  3WC5 A;  4WWV A;  2Q51 A;  4MXU A;  2ZEO A;  2AFW A;  4MCP A;  4P4E A;  1BPM A;  3L2N A;  1FT7 A;  2PJ8 A;  2PJA A;  4NGS A;  3D7D A;  4JZ0 A;  3PB8 X;  5K8O A;  3BHX A;  3H8F A;  1YW6 A;  3IWW A;  1QMU A;  4P4D A;  3CT9 A;  3S9L A;  2JBK A;  2V8G A;  3IC1 A;  1CBX A;  3GB0 A;  1VGY A;  4ZI6 A;  4P4I A;  2J9A A;  1YLO A;  2F8H A;  3SI0 A;  3VAT A;  3V7Z A;  4OC5 A;  3B2Y A;  3V38 A;  4UEE A;  4PQA A;  2ZEF A;  2EK9 A;  1DTD A;  4MHY A;  1BLL E;  3KZW A;  4IK2 A;  2F7V A;  1ARL A;  1Z5R A;  2PJ2 A;  4EFD A;  4O23 A;  4MCR A;  3FEC A;  3KGQ A;  4BD9 A;  3PEI A;  4UF4 A;  2C6G A;  1TXR A;  1LCP A;  1LOK A;  3LWU A;  4UEF A;  2OOT A;  3B3V A;  1Y0R A;  5THW A;  2G9D A;  2AFX A;  1CPS A;  2V8H A;  3ISX A;  2RFH A;  2XEI A;  4MHN A;  3SJX A;  3BXM A;  1XFO A;  2Q43 A;  2V8V A;  3BI1 A;  3PRT A;  2DEA A;  4X8I A;  5HVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...