1F2PA

Crystal structure of the streptomyces griseus aminopeptidase complexed with l-phenylalanine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
277
structure length
274
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETERSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Interactions of Streptomyces griseus aminopeptidase with amino acid reaction products and their implications toward a catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
total genus 106
structure length 274
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1f2pA00
2G9DA 4OC2A 4YU9A 3B3CA 2ANPA 3KZWA 2BO9A 1XMBA 1UWYA 2FVGA 4MHPA 3K9TA 3ISXA 5HVHA 1F2OA 2IMOA 1ZLIA 1QMUA 1ZG8A 1XJOA 7CPAA 2ZOFA 4MCRA 2O4HA 3BHXA 3L2NA 1Z8LA 2PJ8A 4OP4A 1M4LA 1TF8A 4ZX8A 2EK9A 3BI1A 3MN8A 1ELMP 1JQGA 3PB8X 3WABA 2PIZA 1LFWA 2V8HA 3B7IA 2POKA 3V7ZA 4B6ZA 3KHZA 1OBRA 2VL1A 3B3WA 4OIWA 3WC6A 2AFZA 2OR4A 3FH4A 4DJLA 3D7GA 2AFSA 1XRYA 4P4EA 3NH5A 3WC7A 4R6TA 2V8GA 2NYQA 1HDUA 1ZG9A 2XEFA 4LQGA 4MCQA 5ELYA 2ZEDA 1TF9A 1LAMA 1ARLA 1XFOA 1R43A 4MMOA 3S9NA 5D29A 2ZEOA 1AYEA 3FEEA 3WT4A 2PJ7A 1LCPA 2AFMA 4WWVA 4CPAA 4EMEA 5LYDA 4ZY0A 2IQ6A 2ZEMA 4JYWA 4FUUA 3NH8A 1F57A 3LWUA 4P4BA 4MCPA 3B3VA 1VHOA 3PB4X 3KQZA 5LRJA 3SJXA 2PE3A 4MHNA 2V8VA 1FT7A 1QQ9A 4F8ZA 3PB9X 4IHMA 4FBEA 4PXCA 2C6GA 4F9VA 3IJ3A 3GB0A 4NJQA 5D8NA 2C6PA 4P4FA 1CBXA 5CPAA 2QVPA 3KI9A 3PFEA 3KR4A 2JEWA 4FWUA 2EK8A 3IC1A 1GYTA 3PBBA 2DEAA 4X3RA 1IGBA 3GLJA 2AFWA 2OOTA 4P10A 3B3SA 2PJ1A 2WZNA 4ONWA 2PRQA 3PB6X 3IIBA 4F9UA 6CPAA 3ISZA 5LYLA 3H8EA 4OMEA 5K8PA 3QNVA 2XEJA 4R8FA 4DUKA 4TWEA 2ZENA 4PXDA 2ZOGA 5HXDA 1TKJA 3D4UA 2O53A 3RBUA 2BCOA 2C6CA 5K8MA 2HB6A 3IO1A 1TXRA 3MRUA 3FX6A 2RFHA 1CG2A 3B35A 3FMCA 1Y7EA 3FJUA 1TKHA 2CF4A 2WYRA 5JM6A 3NA6A 4Q7AA 4UEFA 4X2TA 4PQAA 3SI0A 4A38A 1VHEA 3CDXA 2AFUA 1ARMA 1RTQA 2F8HA 1ELLP 1Z5RA 4NGNA 4TNUA 4MCSA 4A37A 1CPSA 3SJGA 1VGYA 2Q43A 2PJ6A 3GUXA 2V8DA 2PJ4A 5CBMA 3RZAA 4UEEA 3S9MA 3VH9A 2XEGA 1TKFA 3JRUA 3N5FA 4P45A 1PYTB 4PPZA 3NFZA 1BAVA 5LRKA 1CX8A 4MRIA 4GM5A 2PJ3A 3D68A 3I1UA 4PXBA 4UEZA 3LMSA 3HLPA 3S9LA 1ZLHA 4UIAA 4ZY1A 2HC9A 3IWWA 2ZEGA 3IEHA 5THWA 4P4DA 4ZI6A 3CPAA 2PJ2A 3PBEA 3HUVA 1LAPA 1HDQA 4IK2A 4OC1A 1NSAA 4H2KA 2PIYA 4ZX9A 4MHZA 2JBJA 1BPNA 3KL9A 2ZEHA 4NGMA 4ZYQA 5JH9A 2Q51A 2IJZA 4R7MA 8CPAA 4W9YA 4EWTA 4OC0A 5DS0A 4UF4A 2BOAA 3D7HA 3D66A 3SJFA 2XEIA 1Y0RA 2AFOA 1YMEA 3CT9A 5F09A 4ZY2A 2PJ5A 2V77A 2I3CA 3KGQA 2PJAA 1FNOA 3PEIA 3PFOA 1BLLE 5HVGA 3FECA 1YW4A 4UIBA 4P44A 3FVLA 3D67A 5HVFA 2GLJA 4X8IA 4MXUA 1DE4C 2ABZA 5J1QA 1CP6A 2PJCA 3KQXA 3SI2A 3DLJA 1LOKA 3NH4A 4R76A 2JBKA 4OIDA 3BXMA 3PB7X 5LYFA 4NGRA 2J9AA 3KASA 3WC5A 2PJ0A 4G1PA 3VATA 1H8LA 3BI0A 3TC8A 1PCAA 4OC5A 4PXEA 1VIXA 2Q4ZA 1CP7A 2F7VA 3FF3A 2ZEEA 2QYVA 3IFEA 5I4MA 2GU2A 4NFRA 5IB9A 1ZG7A 4P6YA 1HEEA 4Z65A 2ZEFA 3VARA 4EFDA 5LYIA 4RUHA 3TX8A 5K8NA 3RAMA 1CPXA 1KWMA 4IAVA 1LANA 4JZ0A 2PCUA 4NGPA 3SI1A 3FEDA 2NSMA 1IY7A 1YLOA 2PJBA 2PVVA 4NJRA 1BPMA 1DTDA 2QJ8A 3T8WA 1XBUA 2PVWA 3KR5A 4A39A 3H8GA 2CTBA 2C1CA 3KHXA 2RB7A 5LRGA 2CIJA 4P4IA 4NGSA 3B2YA 4BD9A 1EE3P 3D7FA 2EWBA 1R3NA 4MHYA 4WJBA 4OC3A 2GREA 1Q7LA 5JGFA 4O23A 1Y0YA 5K8OA 4AXVA 3CPXA 4NGQA 2GLFA 4P4JA 4OC4A 1YW6A 2PJ9A 2CTCA 3D7DA 2ZEPA 4A94A 1AMPA 4FAIA 3PRTA 3SJEA 3V38A 3H8FA 4K3NA 2ZELA 1YSJA 1F2PA 3K2KA 4DYOA 3DGVA 3B3TA 4NGTA 4KSIA 1Z2LA 2AFXA 4OKOA 4YWYA
chains in the Genus database with same CATH superfamily
4UWIA 2G9DA 2DPTA 4KOWA 4OC2A 4M3SA 2FIWA 4YU9A 3B3CA 2YNCC 1YX0A 4CAVA 2YNCA 2B58A 5KTCA 2ANPA 2GIVA 3KZWA 2BO9A 3A9LA 4H6ZA 1XMBA 4CRYB 1UWYA 2FVGA 4MHPA 2HV2A 3DNSA 3K9TA 1Z4EA 4R9MA 3ISXA 3T90A 2GANA 5HVHA 4MFPA 2B4DA 1F2OA 2IMOA 4EVYA 1ZLIA 1QMUA 3JTKA 4UFWA 1ZG8A 1XJOA 7CPAA 3DDDA 2ZOFA 4B10A 5E96A 1Z4RA 4MCRA 2JDCA 2YNDA 2O4HA 3BHXA 3L2NA 3R95A 1Z8LA 2HQYA 2PJ8A 4OP4A 5C88A 1M4LA 2BL1A 5IB0A 4GXHA 4UCMA 1Z8TA 4R3LA 5GCNA 3ZZIA 1TF8A 1IU8A 4ZX8A 2EK9A 3BI1A 2FSRA 2VZZA 3D3SA 3DR6A 2FXFA 3MN8A 3FNCA 4KSAA 4PK3A 1ELMP 2VQYA 4B5PA 2VZYA 3IU2A 4M85A 1JQGA 1S7FA 1JWQA 2B5GB 2DF5A 3PB8X 4KLVA 4MY3A 1XIXA 3WABA 4A95A 5KTDA 2PIZA 1I21A 1LFWA 5ISVA 2V8HA 1QSNA 5EMIA 3B7IA 2FE7A 2POKA 3V7ZA 1ZO0A 1KUXA 3R1KA 4XNHC 4XPDB 3KHZA 4B6ZA 1OBRA 2VL1A 3B3WA 4OIWA 3WC6A 4RN7A 3RYOA 4KOXA 4UCNA 2AFZA 2OR4A 3FH4A 4DJLA 3BLNA 3D7GA 2AFSA 1Y9KA 4KVOE 1XRYA 4P4EA 2Z10A 1YVKA 3GYAA 3NH5A 2PR1A 2V8GA 3C26A 2NYQA 4QVTA 1IOIA 4R6TA 3S6GA 4YFJA 1HDUA 1ZG9A 2XEFA 1QSMA 2Z0ZA 4LQGA 3TO6A 4MCQA 2JLMA 4MFJA 5ELYA 2ZEDA 1TF9A 1LAMA 4C7IA 1B87A 4JLYA 3BJ7A 1ARLA 1XFOA 1N71A 4FD6A 1R43A 5HMNA 2VEZA 3FYNA 4MMOA 3S9NA 2ATRA 3EO4A 1WWZA 5AG4A 4K30A 5D29A 3FRMA 2ZEOA 1AYEA 1MJBA 1M4DA 3FEEA 3WT4A 4C2XA 3LD2A 4F6AA 3EXNA 1NMTA 3SHPA 2PJ7A 1LCPA 3SXOA 1Q2YA 2AFMA 4WWVA 3WC7A 1MJAA 4MFQA 4CGPA 4Y49C 4AB7A 4CPAA 4EMEA 5LYDA 4ZY0A 3NE8A 2IQ6A 2ARHA 2ZEMA 4FUUA 4JYWA 4B11A 3NH8A 1CM0A 1F57A 3LWUA 4P4BA 5CNPA 4MCPA 3GIUA 3B3VA 4QB9A 3VWEA 1VHOA 1AUGA 5HH1A 3PB4X 3KQZA 5LRJA 3SJXA 2VBQA 4UBRA 2PE3A 5F46A 4MHNA 3TFYA 3TT2A 2V8VA 1FT7A 1QQ9A 4CAXA 4CGLA 1R57A 4F8ZA 3E0KA 3PB9X 4IHMA 4FBEA 2EUIA 4JJXA 4PXCA 2OZGA 1YK3A 2H5MA 2C6GA 4F9VA 3IJ3A 2BUEA 2HUZA 3GB0A 4IUSA 4NJQA 1Q2DA 5D8NA 3TOAA 2C6PA 3TO9A 4B14A 3QAHA 4P4FA 5AG5A 1PUAA 1CBXA 2BEIA 5CPAA 4R57A 2QVPA 4CYPA 3KI9A 2B5GA 3FXTA 3PFEA 1Z8XA 2JEWA 2C27A 3KR4A 1OZPA 5AG7A 4CAWA 4FWUA 2EK8A 3IC1A 1I1DA 4AVAA 4CYNA 1GYTA 1A2ZA 4DNCA 3PBBA 2DEAA 4X3RA 1IGBA 4A33A 3GLJA 4XPDC 2AFWA 2OOTA 3R9GA 4P10A 3B3SA 2PJ1A 2WZNA 2A4NA 4ONWA 2PRQA 3PB6X 2QECA 3D2PA 1NSLA 3IIBA 3FBUA 3T9YA 4F9UA 1IICA 6CPAA 3ISZA 5IV0A 2ZW5A 2B3UA 3D2MA 2OH1A 5LYLA 1YVOA 4KORA 2R7HA 2FCKA 3V8IA 2D4PA 1GHEA 3H8EA 1M4GA 4OMEA 5K8PA 2Z3LA 4AVBA 5KTAA 3QNVA 2XEJA 1XMTA 5G21A 4R8FA 4DUKA 3PZJA 4TWEA 2ZENA 4PXDA 2ZOGA 4II9A 2WPWA 4YGOA 5HXDA 1MK4A 1TKJA 3D4UA 2O53A 3RBUA 2BCOA 3NE7A 2C6CA 2CXAA 5K8MA 2HB6A 2QIRA 3IO1A 2CNMA 1TXRA 1XE4A 2J8RA 4CRZB 3MRUA 3FX6A 4CYQA 1S7NA 2RFHA 1CG2A 3B35A 4F0XA 3FMCA 1P0HA 1Y7EA 2DXQA 3FJUA 1TKHA 2CF4A 1KUVA 2WYRA 5JM6A 3NA6A 4KOYA 4Q7AA 4UEFA 3LACA 4CGNA 4X2TA 2F5IA 4PQAA 2ZW4A 2Z3KA 3K9UA 5DWNA 3SI0A 3GKRA 4A38A 5I0CA 5IX3A 1VHEA 3H4QA 4HNYB 1P4NA 3CDXA 3EFAA 2AFUA 2PRBA 3S6KA 2PQ8A 1ARMA 1RTQA 2F8HA 1ELLP 1Z5RA 4NGNA 4TNUA 4MCSA 2Q0YA 1S60A 4A37A 2Z11A 5H84A 1CPSA 4ZGYB 3H5ZA 3LODA 3SJGA 5A28A 4B13A 1QSTA 1IB1E 1VGYA 2Q43A 4MI4A 4U9YA 4PV6A 1XOVA 3G3SA 1RXTA 3VWDA 1IOFA 2PJ6A 3GUXA 2V8DA 3QAYA 2PJ4A 4KUAA 5CBMA 4A32A 3RZAA 3CZXA 4UEEA 5AG6A 3S9MA 4PSWA 2XEGA 3VH9A 1TKFA 3JRUA 2OZHA 5AGEA 3N5FA 5FVJA 1V0CA 2X7BA 4UWJA 4P45A 4QUSA 1PYTB 1YR0A 4IF5A 4PPZA 3NFZA 5JQ4A 2ODFA 1BAVA 2P6GA 5LRKA 4AG9A 1CX8A 2G3AA 4MRIA 3KKWA 2Z3MA 4GM5A 1U6MA 4OAEA 2PJ3A 3D68A 3I1UA 4PXBA 4UEZA 4E0AA 3LMSA 4JXQA 2Q4YA 2D4OA 3HLPA 3S9LA 1FY7A 3CXSA 1IYLA 1ZLHA 4UIAA 3F5BA 4ZY1A 2HC9A 3IWWA 2REEA 4JWPA 4L89A 3D8PA 5J8CA 4FD7A 3RNZA 1YQEA 4R87A 3QB8A 2ZEGA 3IEHA 4LX9A 4M6HA 5THWA 2ZXVA 4P4DA 4A31A 4ZI6A 2Q44A 3CPAA 2PJ2A 4M6IA 1CJWA 2K5TA 3PBEA 4B5PB 3HUVA 2P6FA 4F0YA 1LAPA 4NF1A 2NMTA 3R9EA 1HDQA 1UFHA 1QSRA 4IK2A 2Y0MA 4OC1A 2P6EA 2Z3OA 1NSAA 3IGRA 3SXNA 4H2KA 2PIYA 3IU1A 4L8AA 5EC4A 2AE6A 4M6GA 1WK4A 4XPKA 1TIQA 4ZX9A 2ZW6A 3PP9A 1M4IA 2OB0A 4MHZA 4J3GA 2J8MA 4CYOA 4C2ZA 2JBJA 1BPNA 2OZUA 4UCPA 1M44A 2PDOA 2ZEHA 2EO8A 3KL9A 4H6UA 4NGMA 4PK2A 4ZYQA 2P0WA 5J8FA 5JH9A 2YNEA 4U9ZA 4ZBGA 2Q51A 1J4JA 2IJZA 2AJ6A 4UFVA 2B3VA 4R7MA 2R98A 4W9YA 8CPAA 4EWTA 4OC0A 5DS0A 2OU2A 4UF4A 3TOBA 2BOAA 4U5YA 3BJ8A 3D7HA 3D66A 3SJFA 2XEIA 1S5KA 2ZPAA 1Y0RA 2AFOA 1YMEA 3CT9A 1Y7RA 4ZY2A 4CGOA 5F09A 2PJ5A 2V77A 3TTHA 1IYKA 2B4BA 4MY0A 3I3GA 5F47A 1XEBA 2I3CA 3KGQA 3B8GA 2PJAA 1FNOA 3PEIA 4E8OA 3PFOA 4HPSA 5F49A 1BLLE 5HVGA 3FECA 1YW4A 4HNWB 1X10A 4UIBA 4A30A 4P44A 3FVLA 4MFLA 1S3ZA 3DSBA 3D67A 3DR8A 4RI1A 3CXPA 4Y49B 2GLJA 4UA3A 4X8IA 2FS5A 3MGDA 4GS4A 3I9SA 4MXUA 1DE4C 1B6BA 2ABZA 2REFA 5J1QA 1CP6A 2PJCA 3KQXA 4PSXA 2Q4VA 3SI2A 3DLJA 1M1DA 1S7KA 3F0AA 3R96A 1Y9WA 1LOKA 4NCZA 4MFZA 1LRZA 3F8KA 1KUYA 2GFQA 2PR8A 4QBJA 2J8NA 2EVNA 3NH4A 1ON0A 4R76A 4BBHA 2JBKA 4HNXB 4JXRA 4OIDA 3BXMA 1PU9A 1X12A 2YGWA 3PB7X 4E2AA 5LYFA 4NGRA 2J9AA 2WUUA 4OADA 4CAEA 2EBJA 3KASA 4C7HA 4KOSA 3WC5A 5F48A 2PJ0A 4G1PA 4LUAA 1H8LA 2WSAA 2I79A 3VATA 2JDDA 3BI0A 3GY9A 1KZFA 4H89A 4KUBA 3TC8A 3UY5A 4B12A 1K4JA 1PCAA 2GE3A 4OC5A 4KVXA 1Q2CA 2IL4A 4PXEA 1VIXA 2G0BA 3R9FA 5G22A 4AVCA 1SQHA 1Z8WA 1XF8A 4X5KA 2Q4ZA 2CNSA 2FIAA 2CNTA 4NXYA 1CP7A 2DPSA 2F7VA 3FF3A 5BWAB 2ZEEA 2QYVA 2R8VA 4KOTA 3IFEA 2KCWA 2GU2A 2G3TA 4FD5A 4RS2A 5I4MA 2FT0A 4KS9A 5A27A 1MJ9A 4NFRA 3CXQA 5IB9A 1ZG7A 4P6YA 4OLLA 4CGMA 1HEEA 4Z65A 2ZEFA 3TE4A 3VARA 4EFDA 1YREA 5LYIA 1Z9UA 4RUHA 4KZTA 2CY2A 4KVME 3TX8A 3OWCA 5K8NA 3RAMA 1CPXA 2WPXA 1KWMA 4IAVA 4UFXA 1LANA 2BSWA 3W6SA 3EY5A 4JZ0A 4YRHA 2O28A 2PCUA 2B4DB 4KOUA 4NGPA 3SI1A 4CAFA 3FIXA 3P2FA 4ONUA 5DWMA 2PSWA 3ZJ0A 2VI7A 3FEDA 4HKFA 2NSMA 1IY7A 1S7LA 1YLOA 2PJBA 1YLEA 2PVVA 3S6HA 4NJRA 3G8WA 2JEVA 1BPMA 3IWGA 3WR7A 1DTDA 2QJ8A 1I12A 1BOBA 3T8WA 1XBUA 1YGHA 2PVWA 2R1IA 3KR5A 4I49A 5EBVA 4A2ZA 3H8GA 4A39A 3JVNA 5H86A 3IWEA 3S6FA 2CTBA 2C1CA 4JD6A 3JUWA 3KHXA 4C68A 2PC1A 4R3KA 2RB7A 5LRGA 2CIJA 4P4IA 4NGSA 4QC6A 4FD4A 2Q04A 3TCVA 5C82A 4KOVA 1NE9A 1IIDA 3B2YA 4BD9A 4XNHB 1EE3P 3D7FA 1QSOA 2EWBA 1R3NA 4MHYA 5JPHA 4WJBA 4OC3A 2GREA 1Q7LA 3RO0A 4C2YA 5JGFA 2VXKA 4NEXA 4O23A 3TO7A 5G1ZA 2QMLA 4MHDA 3W91A 1Y0YA 1L0CA 4NSQA 5K8OA 1VHSA 4MJ8A 4AXVA 5HVFA 3CPXA 4NGQA 4XPLA 2GLFA 4P4JA 4OC4A 1YW6A 2I00A 2Z3NA 4KLWA 2PJ9A 4ORFA 2Q7BA 4Q38A 2CTCA 3D7DA 2FL4A 2ZEPA 4A94A 1AMPA 2Q7SA 4FAIA 3PRTA 3SJEA 1VKCA 3FB3A 5G20A 3V38A 4B5OA 4BINA 3W6XA 3H8FA 2ZW7A 4K3NA 2Z3PA 2ZELA 3N7ZA 3EC4A 1RO5A 1BO4A 3P2HA 4KSFA 1YSJA 3PGPA 4MBUA 4CS0B 1F2PA 4Q36A 3K2KA 4DYOA 3DGVA 4MFKA 4AG7A 3B3TA 4NGTA 4LQ6A 4BMHA 4KSIA 1Z2LA 2AFXA 2RC4A 4OKOA 4YWYA
chains in the Genus database with same CATH topology
2G9DA 4OC2A 4YU9A 3B3CA 2ANPA 3KZWA 2BO9A 1XMBA 1UWYA 2FVGA 4MHPA 3K9TA 3ISXA 5HVHA 1F2OA 2IMOA 1ZLIA 1QMUA 1ZG8A 1XJOA 7CPAA 2ZOFA 4MCRA 2O4HA 3BHXA 3L2NA 1Z8LA 2PJ8A 4OP4A 1M4LA 1TF8A 4ZX8A 2EK9A 3BI1A 3MN8A 1ELMP 1JQGA 3PB8X 3WABA 2PIZA 1LFWA 2V8HA 3B7IA 2POKA 3V7ZA 4B6ZA 3KHZA 1OBRA 2VL1A 3B3WA 4OIWA 3WC6A 2AFZA 2OR4A 3FH4A 4DJLA 3D7GA 2AFSA 1XRYA 4P4EA 3NH5A 3WC7A 4R6TA 2V8GA 2NYQA 1HDUA 1ZG9A 2XEFA 4LQGA 4MCQA 5ELYA 2ZEDA 1TF9A 1LAMA 1ARLA 1XFOA 1R43A 4MMOA 3S9NA 5D29A 2ZEOA 1AYEA 3FEEA 3WT4A 2PJ7A 1LCPA 2AFMA 4WWVA 4CPAA 4EMEA 5LYDA 4ZY0A 2IQ6A 2ZEMA 4JYWA 4FUUA 3NH8A 1F57A 3LWUA 4P4BA 4MCPA 3B3VA 1VHOA 3PB4X 3KQZA 5LRJA 3SJXA 2PE3A 4MHNA 2V8VA 1FT7A 1QQ9A 4F8ZA 3PB9X 4IHMA 4FBEA 4PXCA 2C6GA 4F9VA 3IJ3A 3GB0A 4NJQA 5D8NA 2C6PA 4P4FA 1CBXA 5CPAA 2QVPA 3KI9A 3PFEA 3KR4A 2JEWA 4FWUA 2EK8A 3IC1A 1GYTA 3PBBA 2DEAA 4X3RA 1IGBA 3GLJA 2AFWA 2OOTA 4P10A 3B3SA 2PJ1A 2WZNA 4ONWA 2PRQA 3PB6X 3IIBA 4F9UA 6CPAA 3ISZA 5LYLA 3H8EA 4OMEA 5K8PA 3QNVA 2XEJA 4R8FA 4DUKA 4TWEA 2ZENA 4PXDA 2ZOGA 5HXDA 1TKJA 3D4UA 2O53A 3RBUA 2BCOA 2C6CA 5K8MA 2HB6A 3IO1A 1TXRA 3MRUA 3FX6A 2RFHA 1CG2A 3B35A 3FMCA 1Y7EA 3FJUA 1TKHA 2CF4A 2WYRA 5JM6A 3NA6A 4Q7AA 4UEFA 4X2TA 4PQAA 3SI0A 4A38A 1VHEA 3CDXA 2AFUA 1ARMA 1RTQA 2F8HA 1ELLP 1Z5RA 4NGNA 4TNUA 4MCSA 4A37A 1CPSA 3SJGA 1VGYA 2Q43A 2PJ6A 3GUXA 2V8DA 2PJ4A 5CBMA 3RZAA 4UEEA 3S9MA 3VH9A 2XEGA 1TKFA 3JRUA 3N5FA 4P45A 1PYTB 4PPZA 3NFZA 1BAVA 5LRKA 1CX8A 4MRIA 4GM5A 2PJ3A 3D68A 3I1UA 4PXBA 4UEZA 3LMSA 3HLPA 3S9LA 1ZLHA 4UIAA 4ZY1A 2HC9A 3IWWA 2ZEGA 3IEHA 5THWA 4P4DA 4ZI6A 3CPAA 2PJ2A 3PBEA 3HUVA 1LAPA 1HDQA 4IK2A 4OC1A 1NSAA 4H2KA 2PIYA 4ZX9A 4MHZA 2JBJA 1BPNA 3KL9A 2ZEHA 4NGMA 4ZYQA 5JH9A 2Q51A 2IJZA 4R7MA 8CPAA 4W9YA 4EWTA 4OC0A 5DS0A 4UF4A 2BOAA 3D7HA 3D66A 3SJFA 2XEIA 1Y0RA 2AFOA 1YMEA 3CT9A 5F09A 4ZY2A 2PJ5A 2V77A 2I3CA 3KGQA 2PJAA 1FNOA 3PEIA 3PFOA 1BLLE 5HVGA 3FECA 1YW4A 4UIBA 4P44A 3FVLA 3D67A 5HVFA 2GLJA 4X8IA 4MXUA 1DE4C 2ABZA 5J1QA 1CP6A 2PJCA 3KQXA 3SI2A 3DLJA 1LOKA 3NH4A 4R76A 2JBKA 4OIDA 3BXMA 3PB7X 5LYFA 4NGRA 2J9AA 3KASA 3WC5A 2PJ0A 4G1PA 3VATA 1H8LA 3BI0A 3TC8A 1PCAA 4OC5A 4PXEA 1VIXA 2Q4ZA 1CP7A 2F7VA 3FF3A 2ZEEA 2QYVA 3IFEA 5I4MA 2GU2A 4NFRA 5IB9A 1ZG7A 4P6YA 1HEEA 4Z65A 2ZEFA 3VARA 4EFDA 5LYIA 4RUHA 3TX8A 5K8NA 3RAMA 1CPXA 1KWMA 4IAVA 1LANA 4JZ0A 2PCUA 4NGPA 3SI1A 3FEDA 2NSMA 1IY7A 1YLOA 2PJBA 2PVVA 4NJRA 1BPMA 1DTDA 2QJ8A 3T8WA 1XBUA 2PVWA 3KR5A 4A39A 3H8GA 2CTBA 2C1CA 3KHXA 2RB7A 5LRGA 2CIJA 4P4IA 4NGSA 3B2YA 4BD9A 1EE3P 3D7FA 2EWBA 1R3NA 4MHYA 4WJBA 4OC3A 2GREA 1Q7LA 5JGFA 4O23A 1Y0YA 5K8OA 4AXVA 3CPXA 4NGQA 2GLFA 4P4JA 4OC4A 1YW6A 2PJ9A 2CTCA 3D7DA 2ZEPA 4A94A 1AMPA 4FAIA 3PRTA 3SJEA 3V38A 3H8FA 4K3NA 2ZELA 1YSJA 1F2PA 3K2KA 4DYOA 3DGVA 3B3TA 4NGTA 4KSIA 1Z2LA 2AFXA 4OKOA 4YWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G9D A;  4OC2 A;  4YU9 A;  3B3C A;  2ANP A;  3KZW A;  2BO9 A;  1XMB A;  1UWY A;  2FVG A;  4MHP A;  3K9T A;  3ISX A;  5HVH A;  1F2O A;  2IMO A;  1ZLI A;  1QMU A;  1ZG8 A;  1XJO A;  7CPA A;  2ZOF A;  4MCR A;  2O4H A;  3BHX A;  3L2N A;  1Z8L A;  2PJ8 A;  4OP4 A;  1M4L A;  1TF8 A;  4ZX8 A;  2EK9 A;  3BI1 A;  3MN8 A;  1ELM P;  1JQG A;  3PB8 X;  3WAB A;  2PIZ A;  1LFW A;  2V8H A;  3B7I A;  2POK A;  3V7Z A;  4B6Z A;  3KHZ A;  1OBR A;  2VL1 A;  3B3W A;  4OIW A;  3WC6 A;  2AFZ A;  2OR4 A;  3FH4 A;  4DJL A;  3D7G A;  2AFS A;  1XRY A;  4P4E A;  3NH5 A;  3WC7 A;  4R6T A;  2V8G A;  2NYQ A;  1HDU A;  1ZG9 A;  2XEF A;  4LQG A;  4MCQ A;  5ELY A;  2ZED A;  1TF9 A;  1LAM A;  1ARL A;  1XFO A;  1R43 A;  4MMO A;  3S9N A;  5D29 A;  2ZEO A;  1AYE A;  3FEE A;  3WT4 A;  2PJ7 A;  1LCP A;  2AFM A;  4WWV A;  4CPA A;  4EME A;  5LYD A;  4ZY0 A;  2IQ6 A;  2ZEM A;  4JYW A;  4FUU A;  3NH8 A;  1F57 A;  3LWU A;  4P4B A;  4MCP A;  3B3V A;  1VHO A;  3PB4 X;  3KQZ A;  5LRJ A;  3SJX A;  2PE3 A;  4MHN A;  2V8V A;  1FT7 A;  1QQ9 A;  4F8Z A;  3PB9 X;  4IHM A;  4FBE A;  4PXC A;  2C6G A;  4F9V A;  3IJ3 A;  3GB0 A;  4NJQ A;  5D8N A;  2C6P A;  4P4F A;  1CBX A;  5CPA A;  2QVP A;  3KI9 A;  3PFE A;  3KR4 A;  2JEW A;  4FWU A;  2EK8 A;  3IC1 A;  1GYT A;  3PBB A;  2DEA A;  4X3R A;  1IGB A;  3GLJ A;  2AFW A;  2OOT A;  4P10 A;  3B3S A;  2PJ1 A;  2WZN A;  4ONW A;  2PRQ A;  3PB6 X;  3IIB A;  4F9U A;  6CPA A;  3ISZ A;  5LYL A;  3H8E A;  4OME A;  5K8P A;  3QNV A;  2XEJ A;  4R8F A;  4DUK A;  4TWE A;  2ZEN A;  4PXD A;  2ZOG A;  5HXD A;  1TKJ A;  3D4U A;  2O53 A;  3RBU A;  2BCO A;  2C6C A;  5K8M A;  2HB6 A;  3IO1 A;  1TXR A;  3MRU A;  3FX6 A;  2RFH A;  1CG2 A;  3B35 A;  3FMC A;  1Y7E A;  3FJU A;  1TKH A;  2CF4 A;  2WYR A;  5JM6 A;  3NA6 A;  4Q7A A;  4UEF A;  4X2T A;  4PQA A;  3SI0 A;  4A38 A;  1VHE A;  3CDX A;  2AFU A;  1ARM A;  1RTQ A;  2F8H A;  1ELL P;  1Z5R A;  4NGN A;  4TNU A;  4MCS A;  4A37 A;  1CPS A;  3SJG A;  1VGY A;  2Q43 A;  2PJ6 A;  3GUX A;  2V8D A;  2PJ4 A;  5CBM A;  3RZA A;  4UEE A;  3S9M A;  3VH9 A;  2XEG A;  1TKF A;  3JRU A;  3N5F A;  4P45 A;  1PYT B;  4PPZ A;  3NFZ A;  1BAV A;  5LRK A;  1CX8 A;  4MRI A;  4GM5 A;  2PJ3 A;  3D68 A;  3I1U A;  4PXB A;  4UEZ A;  3LMS A;  3HLP A;  3S9L A;  1ZLH A;  4UIA A;  4ZY1 A;  2HC9 A;  3IWW A;  2ZEG A;  3IEH A;  5THW A;  4P4D A;  4ZI6 A;  3CPA A;  2PJ2 A;  3PBE A;  3HUV A;  1LAP A;  1HDQ A;  4IK2 A;  4OC1 A;  1NSA A;  4H2K A;  2PIY A;  4ZX9 A;  4MHZ A;  2JBJ A;  1BPN A;  3KL9 A;  2ZEH A;  4NGM A;  4ZYQ A;  5JH9 A;  2Q51 A;  2IJZ A;  4R7M A;  8CPA A;  4W9Y A;  4EWT A;  4OC0 A;  5DS0 A;  4UF4 A;  2BOA A;  3D7H A;  3D66 A;  3SJF A;  2XEI A;  1Y0R A;  2AFO A;  1YME A;  3CT9 A;  5F09 A;  4ZY2 A;  2PJ5 A;  2V77 A;  2I3C A;  3KGQ A;  2PJA A;  1FNO A;  3PEI A;  3PFO A;  1BLL E;  5HVG A;  3FEC A;  1YW4 A;  4UIB A;  4P44 A;  3FVL A;  3D67 A;  5HVF A;  2GLJ A;  4X8I A;  4MXU A;  1DE4 C;  2ABZ A;  5J1Q A;  1CP6 A;  2PJC A;  3KQX A;  3SI2 A;  3DLJ A;  1LOK A;  3NH4 A;  4R76 A;  2JBK A;  4OID A;  3BXM A;  3PB7 X;  5LYF A;  4NGR A;  2J9A A;  3KAS A;  3WC5 A;  2PJ0 A;  4G1P A;  3VAT A;  1H8L A;  3BI0 A;  3TC8 A;  1PCA A;  4OC5 A;  4PXE A;  1VIX A;  2Q4Z A;  1CP7 A;  2F7V A;  3FF3 A;  2ZEE A;  2QYV A;  3IFE A;  5I4M A;  2GU2 A;  4NFR A;  5IB9 A;  1ZG7 A;  4P6Y A;  1HEE A;  4Z65 A;  2ZEF A;  3VAR A;  4EFD A;  5LYI A;  4RUH A;  3TX8 A;  5K8N A;  3RAM A;  1CPX A;  1KWM A;  4IAV A;  1LAN A;  4JZ0 A;  2PCU A;  4NGP A;  3SI1 A;  3FED A;  2NSM A;  1IY7 A;  1YLO A;  2PJB A;  2PVV A;  4NJR A;  1BPM A;  1DTD A;  2QJ8 A;  3T8W A;  1XBU A;  2PVW A;  3KR5 A;  4A39 A;  3H8G A;  2CTB A;  2C1C A;  3KHX A;  2RB7 A;  5LRG A;  2CIJ A;  4P4I A;  4NGS A;  3B2Y A;  4BD9 A;  1EE3 P;  3D7F A;  2EWB A;  1R3N A;  4MHY A;  4WJB A;  4OC3 A;  2GRE A;  1Q7L A;  5JGF A;  4O23 A;  1Y0Y A;  5K8O A;  4AXV A;  3CPX A;  4NGQ A;  2GLF A;  4P4J A;  4OC4 A;  1YW6 A;  2PJ9 A;  2CTC A;  3D7D A;  2ZEP A;  4A94 A;  1AMP A;  4FAI A;  3PRT A;  3SJE A;  3V38 A;  3H8F A;  4K3N A;  2ZEL A;  1YSJ A;  1F2P A;  3K2K A;  4DYO A;  3DGV A;  3B3T A;  4NGT A;  4KSI A;  1Z2L A;  2AFX A;  4OKO A;  4YWY A; 
#chains in the Genus database with same CATH topology
 4UWI A;  2G9D A;  2DPT A;  4KOW A;  4OC2 A;  4M3S A;  2FIW A;  4YU9 A;  3B3C A;  2YNC C;  1YX0 A;  4CAV A;  2YNC A;  2B58 A;  5KTC A;  2ANP A;  2GIV A;  3KZW A;  2BO9 A;  3A9L A;  4H6Z A;  1XMB A;  4CRY B;  1UWY A;  2FVG A;  4MHP A;  2HV2 A;  3DNS A;  3K9T A;  1Z4E A;  4R9M A;  3ISX A;  3T90 A;  2GAN A;  5HVH A;  4MFP A;  2B4D A;  1F2O A;  2IMO A;  4EVY A;  1ZLI A;  1QMU A;  3JTK A;  4UFW A;  1ZG8 A;  1XJO A;  7CPA A;  3DDD A;  2ZOF A;  4B10 A;  5E96 A;  1Z4R A;  4MCR A;  2JDC A;  2YND A;  2O4H A;  3BHX A;  3L2N A;  3R95 A;  1Z8L A;  2HQY A;  2PJ8 A;  4OP4 A;  5C88 A;  1M4L A;  2BL1 A;  5IB0 A;  4GXH A;  4UCM A;  1Z8T A;  4R3L A;  5GCN A;  3ZZI A;  1TF8 A;  1IU8 A;  4ZX8 A;  2EK9 A;  3BI1 A;  2FSR A;  2VZZ A;  3D3S A;  3DR6 A;  2FXF A;  3MN8 A;  3FNC A;  4KSA A;  4PK3 A;  1ELM P;  2VQY A;  4B5P A;  2VZY A;  3IU2 A;  4M85 A;  1JQG A;  1S7F A;  1JWQ A;  2B5G B;  2DF5 A;  3PB8 X;  4KLV A;  4MY3 A;  1XIX A;  3WAB A;  4A95 A;  5KTD A;  2PIZ A;  1I21 A;  1LFW A;  5ISV A;  2V8H A;  1QSN A;  5EMI A;  3B7I A;  2FE7 A;  2POK A;  3V7Z A;  1ZO0 A;  1KUX A;  3R1K A;  4XNH C;  4XPD B;  3KHZ A;  4B6Z A;  1OBR A;  2VL1 A;  3B3W A;  4OIW A;  3WC6 A;  4RN7 A;  3RYO A;  4KOX A;  4UCN A;  2AFZ A;  2OR4 A;  3FH4 A;  4DJL A;  3BLN A;  3D7G A;  2AFS A;  1Y9K A;  4KVO E;  1XRY A;  4P4E A;  2Z10 A;  1YVK A;  3GYA A;  3NH5 A;  2PR1 A;  2V8G A;  3C26 A;  2NYQ A;  4QVT A;  1IOI A;  4R6T A;  3S6G A;  4YFJ A;  1HDU A;  1ZG9 A;  2XEF A;  1QSM A;  2Z0Z A;  4LQG A;  3TO6 A;  4MCQ A;  2JLM A;  4MFJ A;  5ELY A;  2ZED A;  1TF9 A;  1LAM A;  4C7I A;  1B87 A;  4JLY A;  3BJ7 A;  1ARL A;  1XFO A;  1N71 A;  4FD6 A;  1R43 A;  5HMN A;  2VEZ A;  3FYN A;  4MMO A;  3S9N A;  2ATR A;  3EO4 A;  1WWZ A;  5AG4 A;  4K30 A;  5D29 A;  3FRM A;  2ZEO A;  1AYE A;  1MJB A;  1M4D A;  3FEE A;  3WT4 A;  4C2X A;  3LD2 A;  4F6A A;  3EXN A;  1NMT A;  3SHP A;  2PJ7 A;  1LCP A;  3SXO A;  1Q2Y A;  2AFM A;  4WWV A;  3WC7 A;  1MJA A;  4MFQ A;  4CGP A;  4Y49 C;  4AB7 A;  4CPA A;  4EME A;  5LYD A;  4ZY0 A;  3NE8 A;  2IQ6 A;  2ARH A;  2ZEM A;  4FUU A;  4JYW A;  4B11 A;  3NH8 A;  1CM0 A;  1F57 A;  3LWU A;  4P4B A;  5CNP A;  4MCP A;  3GIU A;  3B3V A;  4QB9 A;  3VWE A;  1VHO A;  1AUG A;  5HH1 A;  3PB4 X;  3KQZ A;  5LRJ A;  3SJX A;  2VBQ A;  4UBR A;  2PE3 A;  5F46 A;  4MHN A;  3TFY A;  3TT2 A;  2V8V A;  1FT7 A;  1QQ9 A;  4CAX A;  4CGL A;  1R57 A;  4F8Z A;  3E0K A;  3PB9 X;  4IHM A;  4FBE A;  2EUI A;  4JJX A;  4PXC A;  2OZG A;  1YK3 A;  2H5M A;  2C6G A;  4F9V A;  3IJ3 A;  2BUE A;  2HUZ A;  3GB0 A;  4IUS A;  4NJQ A;  1Q2D A;  5D8N A;  3TOA A;  2C6P A;  3TO9 A;  4B14 A;  3QAH A;  4P4F A;  5AG5 A;  1PUA A;  1CBX A;  2BEI A;  5CPA A;  4R57 A;  2QVP A;  4CYP A;  3KI9 A;  2B5G A;  3FXT A;  3PFE A;  1Z8X A;  2JEW A;  2C27 A;  3KR4 A;  1OZP A;  5AG7 A;  4CAW A;  4FWU A;  2EK8 A;  3IC1 A;  1I1D A;  4AVA A;  4CYN A;  1GYT A;  1A2Z A;  4DNC A;  3PBB A;  2DEA A;  4X3R A;  1IGB A;  4A33 A;  3GLJ A;  4XPD C;  2AFW A;  2OOT A;  3R9G A;  4P10 A;  3B3S A;  2PJ1 A;  2WZN A;  2A4N A;  4ONW A;  2PRQ A;  3PB6 X;  2QEC A;  3D2P A;  1NSL A;  3IIB A;  3FBU A;  3T9Y A;  4F9U A;  1IIC A;  6CPA A;  3ISZ A;  5IV0 A;  2ZW5 A;  2B3U A;  3D2M A;  2OH1 A;  5LYL A;  1YVO A;  4KOR A;  2R7H A;  2FCK A;  3V8I A;  2D4P A;  1GHE A;  3H8E A;  1M4G A;  4OME A;  5K8P A;  2Z3L A;  4AVB A;  5KTA A;  3QNV A;  2XEJ A;  1XMT A;  5G21 A;  4R8F A;  4DUK A;  3PZJ A;  4TWE A;  2ZEN A;  4PXD A;  2ZOG A;  4II9 A;  2WPW A;  4YGO A;  5HXD A;  1MK4 A;  1TKJ A;  3D4U A;  2O53 A;  3RBU A;  2BCO A;  3NE7 A;  2C6C A;  2CXA A;  5K8M A;  2HB6 A;  2QIR A;  3IO1 A;  2CNM A;  1TXR A;  1XE4 A;  2J8R A;  4CRZ B;  3MRU A;  3FX6 A;  4CYQ A;  1S7N A;  2RFH A;  1CG2 A;  3B35 A;  4F0X A;  3FMC A;  1P0H A;  1Y7E A;  2DXQ A;  3FJU A;  1TKH A;  2CF4 A;  1KUV A;  2WYR A;  5JM6 A;  3NA6 A;  4KOY A;  4Q7A A;  4UEF A;  3LAC A;  4CGN A;  4X2T A;  2F5I A;  4PQA A;  2ZW4 A;  2Z3K A;  3K9U A;  5DWN A;  3SI0 A;  3GKR A;  4A38 A;  5I0C A;  5IX3 A;  1VHE A;  3H4Q A;  4HNY B;  1P4N A;  3CDX A;  3EFA A;  2AFU A;  2PRB A;  3S6K A;  2PQ8 A;  1ARM A;  1RTQ A;  2F8H A;  1ELL P;  1Z5R A;  4NGN A;  4TNU A;  4MCS A;  2Q0Y A;  1S60 A;  4A37 A;  2Z11 A;  5H84 A;  1CPS A;  4ZGY B;  3H5Z A;  3LOD A;  3SJG A;  5A28 A;  4B13 A;  1QST A;  1IB1 E;  1VGY A;  2Q43 A;  4MI4 A;  4U9Y A;  4PV6 A;  1XOV A;  3G3S A;  1RXT A;  3VWD A;  1IOF A;  2PJ6 A;  3GUX A;  2V8D A;  3QAY A;  2PJ4 A;  4KUA A;  5CBM A;  4A32 A;  3RZA A;  3CZX A;  4UEE A;  5AG6 A;  3S9M A;  4PSW A;  2XEG A;  3VH9 A;  1TKF A;  3JRU A;  2OZH A;  5AGE A;  3N5F A;  5FVJ A;  1V0C A;  2X7B A;  4UWJ A;  4P45 A;  4QUS A;  1PYT B;  1YR0 A;  4IF5 A;  4PPZ A;  3NFZ A;  5JQ4 A;  2ODF A;  1BAV A;  2P6G A;  5LRK A;  4AG9 A;  1CX8 A;  2G3A A;  4MRI A;  3KKW A;  2Z3M A;  4GM5 A;  1U6M A;  4OAE A;  2PJ3 A;  3D68 A;  3I1U A;  4PXB A;  4UEZ A;  4E0A A;  3LMS A;  4JXQ A;  2Q4Y A;  2D4O A;  3HLP A;  3S9L A;  1FY7 A;  3CXS A;  1IYL A;  1ZLH A;  4UIA A;  3F5B A;  4ZY1 A;  2HC9 A;  3IWW A;  2REE A;  4JWP A;  4L89 A;  3D8P A;  5J8C A;  4FD7 A;  3RNZ A;  1YQE A;  4R87 A;  3QB8 A;  2ZEG A;  3IEH A;  4LX9 A;  4M6H A;  5THW A;  2ZXV A;  4P4D A;  4A31 A;  4ZI6 A;  2Q44 A;  3CPA A;  2PJ2 A;  4M6I A;  1CJW A;  2K5T A;  3PBE A;  4B5P B;  3HUV A;  2P6F A;  4F0Y A;  1LAP A;  4NF1 A;  2NMT A;  3R9E A;  1HDQ A;  1UFH A;  1QSR A;  4IK2 A;  2Y0M A;  4OC1 A;  2P6E A;  2Z3O A;  1NSA A;  3IGR A;  3SXN A;  4H2K A;  2PIY A;  3IU1 A;  4L8A A;  5EC4 A;  2AE6 A;  4M6G A;  1WK4 A;  4XPK A;  1TIQ A;  4ZX9 A;  2ZW6 A;  3PP9 A;  1M4I A;  2OB0 A;  4MHZ A;  4J3G A;  2J8M A;  4CYO A;  4C2Z A;  2JBJ A;  1BPN A;  2OZU A;  4UCP A;  1M44 A;  2PDO A;  2ZEH A;  2EO8 A;  3KL9 A;  4H6U A;  4NGM A;  4PK2 A;  4ZYQ A;  2P0W A;  5J8F A;  5JH9 A;  2YNE A;  4U9Z A;  4ZBG A;  2Q51 A;  1J4J A;  2IJZ A;  2AJ6 A;  4UFV A;  2B3V A;  4R7M A;  2R98 A;  4W9Y A;  8CPA A;  4EWT A;  4OC0 A;  5DS0 A;  2OU2 A;  4UF4 A;  3TOB A;  2BOA A;  4U5Y A;  3BJ8 A;  3D7H A;  3D66 A;  3SJF A;  2XEI A;  1S5K A;  2ZPA A;  1Y0R A;  2AFO A;  1YME A;  3CT9 A;  1Y7R A;  4ZY2 A;  4CGO A;  5F09 A;  2PJ5 A;  2V77 A;  3TTH A;  1IYK A;  2B4B A;  4MY0 A;  3I3G A;  5F47 A;  1XEB A;  2I3C A;  3KGQ A;  3B8G A;  2PJA A;  1FNO A;  3PEI A;  4E8O A;  3PFO A;  4HPS A;  5F49 A;  1BLL E;  5HVG A;  3FEC A;  1YW4 A;  4HNW B;  1X10 A;  4UIB A;  4A30 A;  4P44 A;  3FVL A;  4MFL A;  1S3Z A;  3DSB A;  3D67 A;  3DR8 A;  4RI1 A;  3CXP A;  4Y49 B;  2GLJ A;  4UA3 A;  4X8I A;  2FS5 A;  3MGD A;  4GS4 A;  3I9S A;  4MXU A;  1DE4 C;  1B6B A;  2ABZ A;  2REF A;  5J1Q A;  1CP6 A;  2PJC A;  3KQX A;  4PSX A;  2Q4V A;  3SI2 A;  3DLJ A;  1M1D A;  1S7K A;  3F0A A;  3R96 A;  1Y9W A;  1LOK A;  4NCZ A;  4MFZ A;  1LRZ A;  3F8K A;  1KUY A;  2GFQ A;  2PR8 A;  4QBJ A;  2J8N A;  2EVN A;  3NH4 A;  1ON0 A;  4R76 A;  4BBH A;  2JBK A;  4HNX B;  4JXR A;  4OID A;  3BXM A;  1PU9 A;  1X12 A;  2YGW A;  3PB7 X;  4E2A A;  5LYF A;  4NGR A;  2J9A A;  2WUU A;  4OAD A;  4CAE A;  2EBJ A;  3KAS A;  4C7H A;  4KOS A;  3WC5 A;  5F48 A;  2PJ0 A;  4G1P A;  4LUA A;  1H8L A;  2WSA A;  2I79 A;  3VAT A;  2JDD A;  3BI0 A;  3GY9 A;  1KZF A;  4H89 A;  4KUB A;  3TC8 A;  3UY5 A;  4B12 A;  1K4J A;  1PCA A;  2GE3 A;  4OC5 A;  4KVX A;  1Q2C A;  2IL4 A;  4PXE A;  1VIX A;  2G0B A;  3R9F A;  5G22 A;  4AVC A;  1SQH A;  1Z8W A;  1XF8 A;  4X5K A;  2Q4Z A;  2CNS A;  2FIA A;  2CNT A;  4NXY A;  1CP7 A;  2DPS A;  2F7V A;  3FF3 A;  5BWA B;  2ZEE A;  2QYV A;  2R8V A;  4KOT A;  3IFE A;  2KCW A;  2GU2 A;  2G3T A;  4FD5 A;  4RS2 A;  5I4M A;  2FT0 A;  4KS9 A;  5A27 A;  1MJ9 A;  4NFR A;  3CXQ A;  5IB9 A;  1ZG7 A;  4P6Y A;  4OLL A;  4CGM A;  1HEE A;  4Z65 A;  2ZEF A;  3TE4 A;  3VAR A;  4EFD A;  1YRE A;  5LYI A;  1Z9U A;  4RUH A;  4KZT A;  2CY2 A;  4KVM E;  3TX8 A;  3OWC A;  5K8N A;  3RAM A;  1CPX A;  2WPX A;  1KWM A;  4IAV A;  4UFX A;  1LAN A;  2BSW A;  3W6S A;  3EY5 A;  4JZ0 A;  4YRH A;  2O28 A;  2PCU A;  2B4D B;  4KOU A;  4NGP A;  3SI1 A;  4CAF A;  3FIX A;  3P2F A;  4ONU A;  5DWM A;  2PSW A;  3ZJ0 A;  2VI7 A;  3FED A;  4HKF A;  2NSM A;  1IY7 A;  1S7L A;  1YLO A;  2PJB A;  1YLE A;  2PVV A;  3S6H A;  4NJR A;  3G8W A;  2JEV A;  1BPM A;  3IWG A;  3WR7 A;  1DTD A;  2QJ8 A;  1I12 A;  1BOB A;  3T8W A;  1XBU A;  1YGH A;  2PVW A;  2R1I A;  3KR5 A;  4I49 A;  5EBV A;  4A2Z A;  3H8G A;  4A39 A;  3JVN A;  5H86 A;  3IWE A;  3S6F A;  2CTB A;  2C1C A;  4JD6 A;  3JUW A;  3KHX A;  4C68 A;  2PC1 A;  4R3K A;  2RB7 A;  5LRG A;  2CIJ A;  4P4I A;  4NGS A;  4QC6 A;  4FD4 A;  2Q04 A;  3TCV A;  5C82 A;  4KOV A;  1NE9 A;  1IID A;  3B2Y A;  4BD9 A;  4XNH B;  1EE3 P;  3D7F A;  1QSO A;  2EWB A;  1R3N A;  4MHY A;  5JPH A;  4WJB A;  4OC3 A;  2GRE A;  1Q7L A;  3RO0 A;  4C2Y A;  5JGF A;  2VXK A;  4NEX A;  4O23 A;  3TO7 A;  5G1Z A;  2QML A;  4MHD A;  3W91 A;  1Y0Y A;  1L0C A;  4NSQ A;  5K8O A;  1VHS A;  4MJ8 A;  4AXV A;  5HVF A;  3CPX A;  4NGQ A;  4XPL A;  2GLF A;  4P4J A;  4OC4 A;  1YW6 A;  2I00 A;  2Z3N A;  4KLW A;  2PJ9 A;  4ORF A;  2Q7B A;  4Q38 A;  2CTC A;  3D7D A;  2FL4 A;  2ZEP A;  4A94 A;  1AMP A;  2Q7S A;  4FAI A;  3PRT A;  3SJE A;  1VKC A;  3FB3 A;  5G20 A;  3V38 A;  4B5O A;  4BIN A;  3W6X A;  3H8F A;  2ZW7 A;  4K3N A;  2Z3P A;  2ZEL A;  3N7Z A;  3EC4 A;  1RO5 A;  1BO4 A;  3P2H A;  4KSF A;  1YSJ A;  3PGP A;  4MBU A;  4CS0 B;  1F2P A;  4Q36 A;  3K2K A;  4DYO A;  3DGV A;  4MFK A;  4AG7 A;  3B3T A;  4NGT A;  4LQ6 A;  4BMH A;  4KSI A;  1Z2L A;  2AFX A;  2RC4 A;  4OKO A;  4YWY A; 
#chains in the Genus database with same CATH homology
 2G9D A;  4OC2 A;  4YU9 A;  3B3C A;  2ANP A;  3KZW A;  2BO9 A;  1XMB A;  1UWY A;  2FVG A;  4MHP A;  3K9T A;  3ISX A;  5HVH A;  1F2O A;  2IMO A;  1ZLI A;  1QMU A;  1ZG8 A;  1XJO A;  7CPA A;  2ZOF A;  4MCR A;  2O4H A;  3BHX A;  3L2N A;  1Z8L A;  2PJ8 A;  4OP4 A;  1M4L A;  1TF8 A;  4ZX8 A;  2EK9 A;  3BI1 A;  3MN8 A;  1ELM P;  1JQG A;  3PB8 X;  3WAB A;  2PIZ A;  1LFW A;  2V8H A;  3B7I A;  2POK A;  3V7Z A;  4B6Z A;  3KHZ A;  1OBR A;  2VL1 A;  3B3W A;  4OIW A;  3WC6 A;  2AFZ A;  2OR4 A;  3FH4 A;  4DJL A;  3D7G A;  2AFS A;  1XRY A;  4P4E A;  3NH5 A;  3WC7 A;  4R6T A;  2V8G A;  2NYQ A;  1HDU A;  1ZG9 A;  2XEF A;  4LQG A;  4MCQ A;  5ELY A;  2ZED A;  1TF9 A;  1LAM A;  1ARL A;  1XFO A;  1R43 A;  4MMO A;  3S9N A;  5D29 A;  2ZEO A;  1AYE A;  3FEE A;  3WT4 A;  2PJ7 A;  1LCP A;  2AFM A;  4WWV A;  4CPA A;  4EME A;  5LYD A;  4ZY0 A;  2IQ6 A;  2ZEM A;  4JYW A;  4FUU A;  3NH8 A;  1F57 A;  3LWU A;  4P4B A;  4MCP A;  3B3V A;  1VHO A;  3PB4 X;  3KQZ A;  5LRJ A;  3SJX A;  2PE3 A;  4MHN A;  2V8V A;  1FT7 A;  1QQ9 A;  4F8Z A;  3PB9 X;  4IHM A;  4FBE A;  4PXC A;  2C6G A;  4F9V A;  3IJ3 A;  3GB0 A;  4NJQ A;  5D8N A;  2C6P A;  4P4F A;  1CBX A;  5CPA A;  2QVP A;  3KI9 A;  3PFE A;  3KR4 A;  2JEW A;  4FWU A;  2EK8 A;  3IC1 A;  1GYT A;  3PBB A;  2DEA A;  4X3R A;  1IGB A;  3GLJ A;  2AFW A;  2OOT A;  4P10 A;  3B3S A;  2PJ1 A;  2WZN A;  4ONW A;  2PRQ A;  3PB6 X;  3IIB A;  4F9U A;  6CPA A;  3ISZ A;  5LYL A;  3H8E A;  4OME A;  5K8P A;  3QNV A;  2XEJ A;  4R8F A;  4DUK A;  4TWE A;  2ZEN A;  4PXD A;  2ZOG A;  5HXD A;  1TKJ A;  3D4U A;  2O53 A;  3RBU A;  2BCO A;  2C6C A;  5K8M A;  2HB6 A;  3IO1 A;  1TXR A;  3MRU A;  3FX6 A;  2RFH A;  1CG2 A;  3B35 A;  3FMC A;  1Y7E A;  3FJU A;  1TKH A;  2CF4 A;  2WYR A;  5JM6 A;  3NA6 A;  4Q7A A;  4UEF A;  4X2T A;  4PQA A;  3SI0 A;  4A38 A;  1VHE A;  3CDX A;  2AFU A;  1ARM A;  1RTQ A;  2F8H A;  1ELL P;  1Z5R A;  4NGN A;  4TNU A;  4MCS A;  4A37 A;  1CPS A;  3SJG A;  1VGY A;  2Q43 A;  2PJ6 A;  3GUX A;  2V8D A;  2PJ4 A;  5CBM A;  3RZA A;  4UEE A;  3S9M A;  3VH9 A;  2XEG A;  1TKF A;  3JRU A;  3N5F A;  4P45 A;  1PYT B;  4PPZ A;  3NFZ A;  1BAV A;  5LRK A;  1CX8 A;  4MRI A;  4GM5 A;  2PJ3 A;  3D68 A;  3I1U A;  4PXB A;  4UEZ A;  3LMS A;  3HLP A;  3S9L A;  1ZLH A;  4UIA A;  4ZY1 A;  2HC9 A;  3IWW A;  2ZEG A;  3IEH A;  5THW A;  4P4D A;  4ZI6 A;  3CPA A;  2PJ2 A;  3PBE A;  3HUV A;  1LAP A;  1HDQ A;  4IK2 A;  4OC1 A;  1NSA A;  4H2K A;  2PIY A;  4ZX9 A;  4MHZ A;  2JBJ A;  1BPN A;  3KL9 A;  2ZEH A;  4NGM A;  4ZYQ A;  5JH9 A;  2Q51 A;  2IJZ A;  4R7M A;  8CPA A;  4W9Y A;  4EWT A;  4OC0 A;  5DS0 A;  4UF4 A;  2BOA A;  3D7H A;  3D66 A;  3SJF A;  2XEI A;  1Y0R A;  2AFO A;  1YME A;  3CT9 A;  5F09 A;  4ZY2 A;  2PJ5 A;  2V77 A;  2I3C A;  3KGQ A;  2PJA A;  1FNO A;  3PEI A;  3PFO A;  1BLL E;  5HVG A;  3FEC A;  1YW4 A;  4UIB A;  4P44 A;  3FVL A;  3D67 A;  5HVF A;  2GLJ A;  4X8I A;  4MXU A;  1DE4 C;  2ABZ A;  5J1Q A;  1CP6 A;  2PJC A;  3KQX A;  3SI2 A;  3DLJ A;  1LOK A;  3NH4 A;  4R76 A;  2JBK A;  4OID A;  3BXM A;  3PB7 X;  5LYF A;  4NGR A;  2J9A A;  3KAS A;  3WC5 A;  2PJ0 A;  4G1P A;  3VAT A;  1H8L A;  3BI0 A;  3TC8 A;  1PCA A;  4OC5 A;  4PXE A;  1VIX A;  2Q4Z A;  1CP7 A;  2F7V A;  3FF3 A;  2ZEE A;  2QYV A;  3IFE A;  5I4M A;  2GU2 A;  4NFR A;  5IB9 A;  1ZG7 A;  4P6Y A;  1HEE A;  4Z65 A;  2ZEF A;  3VAR A;  4EFD A;  5LYI A;  4RUH A;  3TX8 A;  5K8N A;  3RAM A;  1CPX A;  1KWM A;  4IAV A;  1LAN A;  4JZ0 A;  2PCU A;  4NGP A;  3SI1 A;  3FED A;  2NSM A;  1IY7 A;  1YLO A;  2PJB A;  2PVV A;  4NJR A;  1BPM A;  1DTD A;  2QJ8 A;  3T8W A;  1XBU A;  2PVW A;  3KR5 A;  4A39 A;  3H8G A;  2CTB A;  2C1C A;  3KHX A;  2RB7 A;  5LRG A;  2CIJ A;  4P4I A;  4NGS A;  3B2Y A;  4BD9 A;  1EE3 P;  3D7F A;  2EWB A;  1R3N A;  4MHY A;  4WJB A;  4OC3 A;  2GRE A;  1Q7L A;  5JGF A;  4O23 A;  1Y0Y A;  5K8O A;  4AXV A;  3CPX A;  4NGQ A;  2GLF A;  4P4J A;  4OC4 A;  1YW6 A;  2PJ9 A;  2CTC A;  3D7D A;  2ZEP A;  4A94 A;  1AMP A;  4FAI A;  3PRT A;  3SJE A;  3V38 A;  3H8F A;  4K3N A;  2ZEL A;  1YSJ A;  1F2P A;  3K2K A;  4DYO A;  3DGV A;  3B3T A;  4NGT A;  4KSI A;  1Z2L A;  2AFX A;  4OKO A;  4YWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...