1F2PA

Crystal structure of the streptomyces griseus aminopeptidase complexed with l-phenylalanine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
277
structure length
274
Chain Sequence
b'APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETERSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Interactions of Streptomyces griseus aminopeptidase with amino acid reaction products and their implications toward a catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
total genus 106
structure length 274
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2000-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1f2pA00
1Z5RA 2RB7A 1R43A 4TWEA 2AFUA 4AXVA 1ZLHA 3PFOA 3VATA 4NGPA 1F2PA 1ZLIA 3BI1A 1FNOA 4UF4A 3HLPA 4IHMA 4FWUA 2ZEFA 5LRJA 1ZG8A 4UIAA 1TF9A 1Z2LA 3PRTA 4NGSA 1FT7A 3ISXA 1ELMP 3N5FA 1CG2A 1YSJA 1HDUA 2PVVA 4DJLA 4B6ZA 4R8FA 4P4IA 4X8IA 5IB9A 2ZEEA 4OC0A 4FBEA 3S9NA 2PRQA 3H8GA 2ZEOA 1NSAA 2ZEDA 2O4HA 1DE4C 3V38A 2QVPA 4DYOA 4ZY2A 2PE3A 3BXMA 2AFXA 3TC8A 1QMUA 4MHZA 2VL1A 1XJOA 2PJCA 5I4MA 5LRGA 3RZAA 1HDQA 3ISZA 3D7HA 3DLJA 5HVHA 4BD9A 4Q7AA 1ZG7A 2PJ1A 2I3CA 3IWWA 3SI0A 4EFDA 4UEZA 1TKFA 2GREA 1BPNA 4MMOA 4ZI6A 4ZX8A 3IEHA 4MHPA 1Y7EA 3SJFA 1VHEA 2V8DA 1PYTB 2OR4A 4UEFA 3SI1A 1TF8A 4P6YA 5F09A 3KHXA 3FX6A 4WJBA 4YU9A 3IJ3A 1KWMA 3B3VA 4H2KA 3FVLA 2PJAA 5LYIA 1UWYA 2PJBA 3KI9A 3PB9X 1AYEA 4P4FA 3WC7A 4NFRA 2OOTA 4OIWA 5LRKA 2BO9A 1CX8A 2BOAA 2Q51A 2C1CA 4X3RA 4A94A 1LOKA 3PBBA 4NGQA 5J1QA 2PJ2A 1XRYA 3JRUA 3FJUA 1LANA 2F7VA 2RFHA 4OKOA 1IY7A 1GYTA 5THWA 5HVGA 4MXUA 3SJXA 3NH8A 1RTQA 3D66A 1CPXA 2IJZA 4NGNA 1M4LA 2PJ5A 1XBUA 3H8FA 1Q7LA 3D7DA 2PIYA 1CP6A 3S9MA 3HUVA 3PBEA 4OC5A 2WYRA 3NH4A 5LYFA 4MCQA 2Q4ZA 1VGYA 1QQ9A 4X2TA 4NGRA 4PPZA 1Y0RA 4P45A 4R6TA 2AFWA 3B35A 2JBJA 1EE3P 1YW4A 5ELYA 4F8ZA 3WT4A 3KASA 4MCPA 2PVWA 2GLJA 4OC4A 3FF3A 5K8PA 2NSMA 4PXDA 2J9AA 3D7GA 4K3NA 4KSIA 3B2YA 3KHZA 1CP7A 5K8OA 5LYDA 4MRIA 2XEIA 3KQZA 1PCAA 4MHYA 4ZX9A 4OC1A 3D68A 1R3NA 2GLFA 2ABZA 3RBUA 1Z8LA 3K2KA 2EWBA 3RAMA 2PCUA 4OC2A 2QYVA 3NFZA 2BCOA 5K8MA 5D29A 1DTDA 2PJ4A 4WWVA 2O53A 1Y0YA 4MCRA 4IK2A 4PQAA 4CPAA 1YW6A 3KR5A 2ZENA 4DUKA 3B3WA 5HXDA 3PB7X 5HVFA 4LQGA 3CT9A 1TXRA 2CIJA 4JZ0A 3H8EA 5JH9A 1BAVA 4F9VA 1HEEA 2CTBA 4OMEA 3FEEA 2V8VA 3PFEA 2V77A 2Q43A 5CPAA 2AFOA 4MHNA 2ZELA 4ZY1A 1ZG9A 3PB4X 3KGQA 3LWUA 4P4JA 3LMSA 4RUHA 3KL9A 2CF4A 3CPAA 4NJQA 4F9UA 3IC1A 5JM6A 1ELLP 3SJGA 3B3TA 2WZNA 3VARA 2GU2A 4NGTA 4ONWA 2C6GA 3K9TA 3KZWA 3CPXA 1BLLE 2HB6A 2G9DA 2F8HA 3KR4A 1VHOA 7CPAA 1F2OA 2POKA 2PJ6A 1LAPA 4P4DA 3GLJA 2JEWA 4ZY0A 3T8WA 4ZYQA 2JBKA 4PXBA 1IGBA 1BPMA 2PIZA 3SJEA 2EK8A 3IO1A 1YMEA 2AFSA 3WC5A 3GB0A 4A39A 3FH4A 4OIDA 2EK9A 2PJ7A 2IQ6A 2PJ9A 3CDXA 2PJ3A 3V7ZA 8CPAA 4JYWA 3PB6X 3MRUA 5D8NA 4YWYA 1OBRA 1JQGA 4O23A 1AMPA 2AFMA 2C6CA 3D7FA 4P10A 1ARMA 4MCSA 2ZEMA 3I1UA 2HC9A 2ZEPA 4UEEA 1LAMA 1LCPA 3IIBA 3VH9A 5LYLA 1ARLA 5DS0A 2C6PA 2QJ8A 2ZOFA 1LFWA 3D4UA 3WC6A 4W9YA 6CPAA 4EMEA 4P44A 4OC3A 4PXEA 4G1PA 2NYQA 3MN8A 2DEAA 4UIBA 3NA6A 4P4BA 4A38A 3S9LA 3NH5A 3PEIA 4Z65A 2XEFA 4R76A 3DGVA 2ZEGA 2ZEHA 3FEDA 3B7IA 4A37A 3B3CA 3L2NA 3FECA 1F57A 1TKHA 2ZOGA 4OP4A 2PJ8A 4EWTA 2FVGA 4PXCA 4TNUA 1YLOA 2XEJA 4FAIA 3GUXA 1XFOA 2V8GA 4GM5A 3D67A 3FMCA 1CPSA 2PJ0A 4P4EA 3WABA 3KQXA 4R7MA 1VIXA 1CBXA 3PB8X 2V8HA 2AFZA 3SI2A 2CTCA 1H8LA 3B3SA 4FUUA 5K8NA 2IMOA 3BHXA 2XEGA 3IFEA 2ANPA 5JGFA 4NGMA 5CBMA 1XMBA 4IAVA 1TKJA 4NJRA 3BI0A 3QNVA 3TX8A
chains in the Genus database with same CATH superfamily
1Z5RA 2RB7A 2Z3NA 4ZGYB 4B5PA 3UY5A 1ON0A 1R43A 4TWEA 2CNMA 2AFUA 3R9EA 2FT0A 4AXVA 2ZW7A 1ZLHA 3PFOA 3VATA 4NGPA 1F2PA 3B8GA 2NMTA 4UWJA 1ZLIA 2Q44A 1FNOA 3BI1A 4UF4A 3HLPA 2YGWA 3IWEA 2PDOA 4IHMA 2Z11A 4FWUA 4A30A 2ZEFA 4M6IA 1ZG8A 5EBVA 5LRJA 2DPSA 4RI1A 4UIAA 1Z8XA 5EMIA 1CM0A 1TF9A 1Z2LA 3PRTA 4NGSA 1FT7A 5KTAA 1NE9A 1B87A 3ISXA 1ELMP 3N5FA 4NXYA 4Q38A 4AVAA 3GYAA 1CG2A 4LQ6A 4C7HA 1YSJA 4CYPA 4II9A 4UBRA 1KUYA 4F6AA 1X12A 1HDUA 3QAYA 2PVVA 5GCNA 4DJLA 4M6HA 4R8FA 1M44A 2AJ6A 4K30A 3V8IA 4B6ZA 4P4IA 4CAFA 2H5MA 4X8IA 5IB9A 2ZEEA 4OLLA 4B12A 2Q7SA 5IX3A 2KCWA 4OC0A 4KORA 3D3SA 4FBEA 3S9NA 4NEXA 2PRQA 2Z3MA 1AUGA 3H8GA 2P6GA 2Z3OA 4KVXA 5A27A 2WSAA 5JPHA 2ZEOA 4E2AA 1OZPA 1QSNA 5F48A 5KTDA 1B6BA 4MJ8A 1NSAA 2ZEDA 4IF5A 2O4HA 4UFVA 3TO7A 2CNSA 2G0BA 3QB8A 4JJXA 4X5KA 1DE4C 3V38A 4CRYB 4XNHC 2QVPA 4GXHA 4DYOA 4ZY2A 2PE3A 3BXMA 1BOBA 1Z9UA 4ZBGA 1Z8TA 4B11A 1XOVA 2B5GB 5IV0A 2K5TA 2IL4A 1S5KA 2AFXA 1NMTA 1I12A 1QMUA 4MHZA 3TC8A 2VL1A 1XJOA 4JXQA 4C2ZA 2PJCA 3G8WA 5I4MA 2ATRA 3PZJA 4L89A 5KTCA 3MGDA 5LRGA 5G21A 3RZAA 1HDQA 2R7HA 3ISZA 3D7HA 4M3SA 3DLJA 5HVHA 4BD9A 2JEVA 4Q7AA 3W6SA 1ZG7A 2PJ1A 2OH1A 4MFKA 2I3CA 1IOFA 3IWWA 3SI0A 2OZGA 5H84A 4EFDA 1V0CA 5AG6A 4UEZA 3W91A 2X7BA 1TKFA 3C26A 1WWZA 2R8VA 2GIVA 2FCKA 1BPNA 2GREA 4MMOA 5E96A 1QSMA 4ZI6A 3S6KA 3TFYA 1YVOA 2Q7BA 3OWCA 4ZX8A 1I1DA 3IEHA 4MHPA 1Y7EA 2PR8A 3R1KA 3IWGA 3SJFA 1VHEA 1IU8A 4KOXA 2V8DA 4KOVA 1PYTB 2OR4A 4UEFA 3SI1A 1TF8A 2G3AA 2B3UA 3JUWA 5IB0A 3N7ZA 4P6YA 1Z4RA 5F09A 4MFJA 4R3KA 3TO9A 4A2ZA 3KHXA 4CRZB 3R95A 4XPLA 3FX6A 4WJBA 4YU9A 3IJ3A 5HH1A 4C68A 4CGPA 1KWMA 3B3VA 4MFPA 4FD5A 2FL4A 2J8MA 4H2KA 3NE7A 3FVLA 2PJAA 1S7KA 5LYIA 3H5ZA 1UWYA 3D2PA 2PJBA 2EVNA 3KI9A 3PB9X 4JD6A 2PSWA 4ONUA 1AYEA 1IYLA 4P4FA 3WC7A 4NFRA 4U5YA 4OIWA 2OOTA 5LRKA 2GFQA 2BO9A 4R57A 1CX8A 2BOAA 4AG9A 2BUEA 1I21A 4YFJA 2Q51A 4LUAA 5AGEA 2B4DA 2C1CA 4X3RA 2GANA 3P2FA 4A94A 1LOKA 3PBBA 4NGQA 5J1QA 1QSOA 2R98A 2PJ2A 1XRYA 1Q2CA 3FJUA 3JRUA 4CAVA 4F0YA 1LANA 2F7VA 2RFHA 3I3GA 3I9SA 4EVYA 2FIWA 4OKOA 3SHPA 1IY7A 4PK2A 1YQEA 1XEBA 4CGLA 1GYTA 1ZO0A 4KOUA 2BEIA 5THWA 1FY7A 4M6GA 5HVGA 5J8CA 4MXUA 3D8PA 3S6GA 2P6FA 3EFAA 2HV2A 3SJXA 3GKRA 3NH8A 4RS2A 1RTQA 2OB0A 3D66A 1CPXA 4M85A 2IJZA 4C7IA 2WPXA 2VBQA 3F5BA 4C2XA 1Y9KA 1BO4A 4NGNA 1M4LA 5G20A 2PJ5A 4R3LA 5AG7A 1XBUA 3H8FA 3H4QA 3G3SA 1Q7LA 3D7DA 2PIYA 3EO4A 1CP6A 4CGOA 3S9MA 3HUVA 3PBEA 1XMTA 2OZUA 4FD7A 4KS9A 4OC5A 5BWAB 2WYRA 3NH4A 4UCPA 4MCQA 5LYFA 3CXSA 2Q4ZA 1VGYA 1QQ9A 3E0KA 4X2TA 4NGRA 3ZJ0A 4PPZA 1M4DA 2VEZA 4B13A 3TOBA 1VKCA 4KOSA 5F46A 4YGOA 1Y0RA 4P45A 5J8FA 4R6TA 2AFWA 3B35A 2D4OA 2JBJA 4BBHA 3S6FA 3IU2A 1EE3P 1YW4A 5ELYA 4BINA 3WT4A 3KASA 4FD4A 4F8ZA 1Z4EA 1K4JA 4MCPA 2PVWA 2GLJA 4OC4A 2BSWA 1PUAA 2BL1A 2JDCA 2ZW6A 3FF3A 3EY5A 3IGRA 4U9ZA 2NSMA 4MBUA 5K8PA 4PXDA 2J9AA 3D7GA 1U6MA 4K3NA 4KSIA 3B2YA 3KHZA 4KUAA 1CP7A 3CXQA 3PP9A 4L8AA 1YX0A 2B58A 3LODA 4XPDC 4MRIA 5LYDA 1IICA 5K8OA 2XEIA 3KQZA 1PCAA 2AE6A 4MHYA 4QVTA 4UCNA 4ZX9A 4OC1A 1YLEA 1R3NA 2FXFA 3D68A 3R9FA 3ZZIA 2GLFA 2ABZA 3FB3A 3RBUA 4FD6A 3CXPA 1A2ZA 1Z8LA 3K2KA 2EWBA 3T9YA 4NF1A 3DR8A 4KLWA 1WK4A 3W6XA 3RAMA 2PCUA 4LX9A 4OC2A 2FE7A 3F8KA 3K9UA 3LD2A 2Y0MA 2QYVA 3NFZA 1KUVA 2BCOA 4R9MA 5K8MA 2HQYA 3FYNA 5D29A 5AG5A 4JLYA 3WR7A 2B4BA 1DTDA 2PJ4A 2VI7A 2FSRA 4PSXA 2O53A 4WWVA 1Y0YA 4MCRA 4IK2A 4PQAA 4CPAA 4A31A 4KVME 1YW6A 3F0AA 3KR5A 2DF5A 2ZENA 4A32A 3FXTA 4H6ZA 4AVCA 4DUKA 2PR1A 3B3WA 3QAHA 2B5GA 5HXDA 3EC4A 3PB7X 2EO8A 2PRBA 1P4NA 4Y49B 5HVFA 4CYOA 4LQGA 3CT9A 1TXRA 2CIJA 4JZ0A 3H8EA 2Q4VA 1LRZA 3RO0A 5JH9A 1BAVA 4F9VA 1HEEA 5I0CA 2CTBA 4OMEA 3FEEA 1QSRA 4CYNA 3TCVA 2V8VA 4YRHA 1MJAA 4XPKA 5C82A 2JLMA 2B3VA 2C27A 5JQ4A 3PFEA 4DNCA 2V77A 3LACA 3TE4A 2Q43A 4UFWA 3FNCA 5CPAA 2QIRA 2RC4A 2AFOA 4MHNA 2ZELA 1UFHA 4PV6A 4ZY1A 3FIXA 3TTHA 4BMHA 4KLVA 1ZG9A 4HNYB 2D4PA 3PB4X 3KGQA 5G1ZA 3LWUA 1M1DA 2Z10A 2ZW5A 1M4IA 3LMSA 2P6EA 4GS4A 4P4JA 1IYKA 1Q2YA 4KOTA 3KL9A 4RUHA 3EXNA 4A33A 2CF4A 3CPAA 4B5PB 1TIQA 4NJQA 4F9UA 3IC1A 5JM6A 1ELLP 4B10A 2VZYA 1X10A 4CAXA 1SQHA 4H6UA 4MFZA 3SJGA 1L0CA 1R57A 3B3TA 2WZNA 3BJ7A 4HPSA 2GU2A 2EBJA 2QMLA 4MFQA 2PC1A 4NGTA 4ONWA 3VARA 2C6GA 3K9TA 3KZWA 5F47A 3CPXA 2OZHA 1BLLE 1RO5A 2HB6A 2Z0ZA 2REFA 2DPTA 3TT2A 4HNWB 2G9DA 2F8HA 2J8RA 3KR4A 1VHOA 5HMNA 7CPAA 1F2OA 1IB1E 2CXAA 2POKA 2Z3KA 2PJ6A 4XNHB 1LAPA 4P4DA 3RYOA 4CGMA 1YR0A 3GLJA 2FS5A 2Q4YA 2JEWA 5EC4A 5H86A 4ZY0A 3T8WA 4ZYQA 2REEA 2JBKA 1KUXA 1S7LA 4PXBA 1IGBA 4Y49C 1BPMA 2PIZA 1JWQA 2Q0YA 4KSAA 3SJEA 2EK8A 1Y7RA 1YMEA 2AFSA 2YNCC 3IO1A 2VQYA 3WC5A 5AG4A 1VHSA 3GB0A 4JWPA 4A39A 2I00A 5DWMA 3FH4A 2WUUA 4PSWA 3NE8A 3A9LA 4HNXB 4QB9A 4OIDA 4KUBA 2EK9A 2PJ7A 4J3GA 1PU9A 2IQ6A 4F0XA 4MI4A 2PJ9A 5ISVA 3CDXA 2PJ3A 3VWDA 3V7ZA 8CPAA 4JYWA 2YNEA 1S3ZA 5FVJA 4I49A 3PB6X 4HKFA 1IIDA 1GHEA 3MRUA 4QUSA 2R1IA 1J4JA 5D8NA 4YWYA 1OBRA 3GIUA 3D2MA 1JQGA 1MK4A 2ZW4A 2PQ8A 4O23A 1AMPA 1Q2DA 1Z8WA 2AFMA 3T90A 2J8NA 2O28A 2OU2A 2C6CA 3D7FA 3DSBA 4P10A 1ARMA 4MCSA 2A4NA 2ZEMA 2ARHA 4RN7A 4QC6A 3I1UA 2HC9A 2ZEPA 4UCMA 2I79A 2EUIA 3CZXA 4UEEA 1LAMA 1LCPA 1RXTA 3IIBA 4UFXA 4AB7A 3VH9A 5LYLA 3BLNA 1ARLA 3KKWA 4KOWA 2CNTA 4MFLA 2P0WA 5DS0A 2C6PA 3R96A 3DNSA 4QBJA 2QJ8A 2ZOFA 4CAWA 3JVNA 1LFWA 3D4UA 3WC6A 1KZFA 4W9YA 6CPAA 1YREA 4EMEA 4P44A 4OC3A 4PK3A 5A28A 2Q04A 4CYQA 3FRMA 1IOIA 1S7FA 3P2HA 1YGHA 2ZXVA 2HUZA 4NSQA 1N71A 3PGPA 1XE4A 4G1PA 2NYQA 4JXRA 4PXEA 3MN8A 4AG7A 2DXQA 4E0AA 2DEAA 4UIBA 3SXOA 3NA6A 4P4BA 4CS0B 1XIXA 4CGNA 4H89A 3GY9A 4A38A 3S9LA 4CAEA 3DR6A 3TOAA 3SXNA 4A95A 2VXKA 5DWNA 4E8OA 2YNDA 3BJ8A 3NH5A 4KOYA 3PEIA 3DDDA 4ORFA 2XEFA 4Z65A 4R76A 3DGVA 5F49A 2ZEGA 4C2YA 3S6HA 2ZEHA 3FEDA 3FBUA 2ODFA 3B7IA 4KZTA 4A37A 3B3CA 4R87A 3L2NA 3FECA 2Z3PA 4KVOE 1F57A 1TKHA 2ZOGA 4OP4A 2PJ8A 4EWTA 1S7NA 2WPWA 2FVGA 4PXCA 1P0HA 4TNUA 2JDDA 1YLOA 1QSTA 2XEJA 4FAIA 3GUXA 2B4DB 1XFOA 4MHDA 2V8GA 4UWIA 1YVKA 4GM5A 4B14A 2ZPAA 1M4GA 4OAEA 2YNCA 3D67A 3FMCA 1CPSA 4OADA 2PJ0A 2QECA 4P4EA 3VWEA 2CY2A 2GE3A 4MY3A 3WABA 3KQXA 2VZZA 5C88A 4R7MA 5G22A 4AVBA 3RNZA 1VIXA 1CBXA 3PB8X 3TO6A 3R9GA 4NCZA 2V8HA 2AFZA 3SI2A 2CTCA 2Z3LA 1H8LA 4B5OA 3B3SA 4FUUA 1CJWA 5K8NA 2G3TA 2IMOA 2XEGA 3BHXA 3IFEA 4IUSA 4Q36A 1MJ9A 2ANPA 5JGFA 3JTKA 4NGMA 5CBMA 1XMBA 2FIAA 1XF8A 4KSFA 4UA3A 4IAVA 4U9YA 1NSLA 1TKJA 1S60A 1Y9WA 4NJRA 3BI0A 1MJBA 3QNVA 2F5IA 4XPDB 3IU1A 5CNPA 3TX8A 4MY0A 1YK3A
chains in the Genus database with same CATH topology
1Z5RA 2RB7A 1R43A 4TWEA 2AFUA 4AXVA 1ZLHA 3PFOA 3VATA 4NGPA 1F2PA 1ZLIA 3BI1A 1FNOA 4UF4A 3HLPA 4IHMA 4FWUA 2ZEFA 5LRJA 1ZG8A 4UIAA 1TF9A 1Z2LA 3PRTA 4NGSA 1FT7A 3ISXA 1ELMP 3N5FA 1CG2A 1YSJA 1HDUA 2PVVA 4DJLA 4B6ZA 4R8FA 4P4IA 4X8IA 5IB9A 2ZEEA 4OC0A 4FBEA 3S9NA 2PRQA 3H8GA 2ZEOA 1NSAA 2ZEDA 2O4HA 1DE4C 3V38A 2QVPA 4DYOA 4ZY2A 2PE3A 3BXMA 2AFXA 3TC8A 1QMUA 4MHZA 2VL1A 1XJOA 2PJCA 5I4MA 5LRGA 3RZAA 1HDQA 3ISZA 3D7HA 3DLJA 5HVHA 4BD9A 4Q7AA 1ZG7A 2PJ1A 2I3CA 3IWWA 3SI0A 4EFDA 4UEZA 1TKFA 2GREA 1BPNA 4MMOA 4ZI6A 4ZX8A 3IEHA 4MHPA 1Y7EA 3SJFA 1VHEA 2V8DA 1PYTB 2OR4A 4UEFA 3SI1A 1TF8A 4P6YA 5F09A 3KHXA 3FX6A 4WJBA 4YU9A 3IJ3A 1KWMA 3B3VA 4H2KA 3FVLA 2PJAA 5LYIA 1UWYA 2PJBA 3KI9A 3PB9X 1AYEA 4P4FA 3WC7A 4NFRA 2OOTA 4OIWA 5LRKA 2BO9A 1CX8A 2BOAA 2Q51A 2C1CA 4X3RA 4A94A 1LOKA 3PBBA 4NGQA 5J1QA 2PJ2A 1XRYA 3JRUA 3FJUA 1LANA 2F7VA 2RFHA 4OKOA 1IY7A 1GYTA 5THWA 5HVGA 4MXUA 3SJXA 3NH8A 1RTQA 3D66A 1CPXA 2IJZA 4NGNA 1M4LA 2PJ5A 1XBUA 3H8FA 1Q7LA 3D7DA 2PIYA 1CP6A 3S9MA 3HUVA 3PBEA 4OC5A 2WYRA 3NH4A 5LYFA 4MCQA 2Q4ZA 1VGYA 1QQ9A 4X2TA 4NGRA 4PPZA 1Y0RA 4P45A 4R6TA 2AFWA 3B35A 2JBJA 1EE3P 1YW4A 5ELYA 4F8ZA 3WT4A 3KASA 4MCPA 2PVWA 2GLJA 4OC4A 3FF3A 5K8PA 2NSMA 4PXDA 2J9AA 3D7GA 4K3NA 4KSIA 3B2YA 3KHZA 1CP7A 5K8OA 5LYDA 4MRIA 2XEIA 3KQZA 1PCAA 4MHYA 4ZX9A 4OC1A 3D68A 1R3NA 2GLFA 2ABZA 3RBUA 1Z8LA 3K2KA 2EWBA 3RAMA 2PCUA 4OC2A 2QYVA 3NFZA 2BCOA 5K8MA 5D29A 1DTDA 2PJ4A 4WWVA 2O53A 1Y0YA 4MCRA 4IK2A 4PQAA 4CPAA 1YW6A 3KR5A 2ZENA 4DUKA 3B3WA 5HXDA 3PB7X 5HVFA 4LQGA 3CT9A 1TXRA 2CIJA 4JZ0A 3H8EA 5JH9A 1BAVA 4F9VA 1HEEA 2CTBA 4OMEA 3FEEA 2V8VA 3PFEA 2V77A 2Q43A 5CPAA 2AFOA 4MHNA 2ZELA 4ZY1A 1ZG9A 3PB4X 3KGQA 3LWUA 4P4JA 3LMSA 4RUHA 3KL9A 2CF4A 3CPAA 4NJQA 4F9UA 3IC1A 5JM6A 1ELLP 3SJGA 3B3TA 2WZNA 3VARA 2GU2A 4NGTA 4ONWA 2C6GA 3K9TA 3KZWA 3CPXA 1BLLE 2HB6A 2G9DA 2F8HA 3KR4A 1VHOA 7CPAA 1F2OA 2POKA 2PJ6A 1LAPA 4P4DA 3GLJA 2JEWA 4ZY0A 3T8WA 4ZYQA 2JBKA 4PXBA 1IGBA 1BPMA 2PIZA 3SJEA 2EK8A 3IO1A 1YMEA 2AFSA 3WC5A 3GB0A 4A39A 3FH4A 4OIDA 2EK9A 2PJ7A 2IQ6A 2PJ9A 3CDXA 2PJ3A 3V7ZA 8CPAA 4JYWA 3PB6X 3MRUA 5D8NA 4YWYA 1OBRA 1JQGA 4O23A 1AMPA 2AFMA 2C6CA 3D7FA 4P10A 1ARMA 4MCSA 2ZEMA 3I1UA 2HC9A 2ZEPA 4UEEA 1LAMA 1LCPA 3IIBA 3VH9A 5LYLA 1ARLA 5DS0A 2C6PA 2QJ8A 2ZOFA 1LFWA 3D4UA 3WC6A 4W9YA 6CPAA 4EMEA 4P44A 4OC3A 4PXEA 4G1PA 2NYQA 3MN8A 2DEAA 4UIBA 3NA6A 4P4BA 4A38A 3S9LA 3NH5A 3PEIA 4Z65A 2XEFA 4R76A 3DGVA 2ZEGA 2ZEHA 3FEDA 3B7IA 4A37A 3B3CA 3L2NA 3FECA 1F57A 1TKHA 2ZOGA 4OP4A 2PJ8A 4EWTA 2FVGA 4PXCA 4TNUA 1YLOA 2XEJA 4FAIA 3GUXA 1XFOA 2V8GA 4GM5A 3D67A 3FMCA 1CPSA 2PJ0A 4P4EA 3WABA 3KQXA 4R7MA 1VIXA 1CBXA 3PB8X 2V8HA 2AFZA 3SI2A 2CTCA 1H8LA 3B3SA 4FUUA 5K8NA 2IMOA 3BHXA 2XEGA 3IFEA 2ANPA 5JGFA 4NGMA 5CBMA 1XMBA 4IAVA 1TKJA 4NJRA 3BI0A 3QNVA 3TX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5R A;  2RB7 A;  1R43 A;  4TWE A;  2AFU A;  4AXV A;  1ZLH A;  3PFO A;  3VAT A;  4NGP A;  1F2P A;  1ZLI A;  3BI1 A;  1FNO A;  4UF4 A;  3HLP A;  4IHM A;  4FWU A;  2ZEF A;  5LRJ A;  1ZG8 A;  4UIA A;  1TF9 A;  1Z2L A;  3PRT A;  4NGS A;  1FT7 A;  3ISX A;  1ELM P;  3N5F A;  1CG2 A;  1YSJ A;  1HDU A;  2PVV A;  4DJL A;  4B6Z A;  4R8F A;  4P4I A;  4X8I A;  5IB9 A;  2ZEE A;  4OC0 A;  4FBE A;  3S9N A;  2PRQ A;  3H8G A;  2ZEO A;  1NSA A;  2ZED A;  2O4H A;  1DE4 C;  3V38 A;  2QVP A;  4DYO A;  4ZY2 A;  2PE3 A;  3BXM A;  2AFX A;  3TC8 A;  1QMU A;  4MHZ A;  2VL1 A;  1XJO A;  2PJC A;  5I4M A;  5LRG A;  3RZA A;  1HDQ A;  3ISZ A;  3D7H A;  3DLJ A;  5HVH A;  4BD9 A;  4Q7A A;  1ZG7 A;  2PJ1 A;  2I3C A;  3IWW A;  3SI0 A;  4EFD A;  4UEZ A;  1TKF A;  2GRE A;  1BPN A;  4MMO A;  4ZI6 A;  4ZX8 A;  3IEH A;  4MHP A;  1Y7E A;  3SJF A;  1VHE A;  2V8D A;  1PYT B;  2OR4 A;  4UEF A;  3SI1 A;  1TF8 A;  4P6Y A;  5F09 A;  3KHX A;  3FX6 A;  4WJB A;  4YU9 A;  3IJ3 A;  1KWM A;  3B3V A;  4H2K A;  3FVL A;  2PJA A;  5LYI A;  1UWY A;  2PJB A;  3KI9 A;  3PB9 X;  1AYE A;  4P4F A;  3WC7 A;  4NFR A;  2OOT A;  4OIW A;  5LRK A;  2BO9 A;  1CX8 A;  2BOA A;  2Q51 A;  2C1C A;  4X3R A;  4A94 A;  1LOK A;  3PBB A;  4NGQ A;  5J1Q A;  2PJ2 A;  1XRY A;  3JRU A;  3FJU A;  1LAN A;  2F7V A;  2RFH A;  4OKO A;  1IY7 A;  1GYT A;  5THW A;  5HVG A;  4MXU A;  3SJX A;  3NH8 A;  1RTQ A;  3D66 A;  1CPX A;  2IJZ A;  4NGN A;  1M4L A;  2PJ5 A;  1XBU A;  3H8F A;  1Q7L A;  3D7D A;  2PIY A;  1CP6 A;  3S9M A;  3HUV A;  3PBE A;  4OC5 A;  2WYR A;  3NH4 A;  5LYF A;  4MCQ A;  2Q4Z A;  1VGY A;  1QQ9 A;  4X2T A;  4NGR A;  4PPZ A;  1Y0R A;  4P45 A;  4R6T A;  2AFW A;  3B35 A;  2JBJ A;  1EE3 P;  1YW4 A;  5ELY A;  4F8Z A;  3WT4 A;  3KAS A;  4MCP A;  2PVW A;  2GLJ A;  4OC4 A;  3FF3 A;  5K8P A;  2NSM A;  4PXD A;  2J9A A;  3D7G A;  4K3N A;  4KSI A;  3B2Y A;  3KHZ A;  1CP7 A;  5K8O A;  5LYD A;  4MRI A;  2XEI A;  3KQZ A;  1PCA A;  4MHY A;  4ZX9 A;  4OC1 A;  3D68 A;  1R3N A;  2GLF A;  2ABZ A;  3RBU A;  1Z8L A;  3K2K A;  2EWB A;  3RAM A;  2PCU A;  4OC2 A;  2QYV A;  3NFZ A;  2BCO A;  5K8M A;  5D29 A;  1DTD A;  2PJ4 A;  4WWV A;  2O53 A;  1Y0Y A;  4MCR A;  4IK2 A;  4PQA A;  4CPA A;  1YW6 A;  3KR5 A;  2ZEN A;  4DUK A;  3B3W A;  5HXD A;  3PB7 X;  5HVF A;  4LQG A;  3CT9 A;  1TXR A;  2CIJ A;  4JZ0 A;  3H8E A;  5JH9 A;  1BAV A;  4F9V A;  1HEE A;  2CTB A;  4OME A;  3FEE A;  2V8V A;  3PFE A;  2V77 A;  2Q43 A;  5CPA A;  2AFO A;  4MHN A;  2ZEL A;  4ZY1 A;  1ZG9 A;  3PB4 X;  3KGQ A;  3LWU A;  4P4J A;  3LMS A;  4RUH A;  3KL9 A;  2CF4 A;  3CPA A;  4NJQ A;  4F9U A;  3IC1 A;  5JM6 A;  1ELL P;  3SJG A;  3B3T A;  2WZN A;  3VAR A;  2GU2 A;  4NGT A;  4ONW A;  2C6G A;  3K9T A;  3KZW A;  3CPX A;  1BLL E;  2HB6 A;  2G9D A;  2F8H A;  3KR4 A;  1VHO A;  7CPA A;  1F2O A;  2POK A;  2PJ6 A;  1LAP A;  4P4D A;  3GLJ A;  2JEW A;  4ZY0 A;  3T8W A;  4ZYQ A;  2JBK A;  4PXB A;  1IGB A;  1BPM A;  2PIZ A;  3SJE A;  2EK8 A;  3IO1 A;  1YME A;  2AFS A;  3WC5 A;  3GB0 A;  4A39 A;  3FH4 A;  4OID A;  2EK9 A;  2PJ7 A;  2IQ6 A;  2PJ9 A;  3CDX A;  2PJ3 A;  3V7Z A;  8CPA A;  4JYW A;  3PB6 X;  3MRU A;  5D8N A;  4YWY A;  1OBR A;  1JQG A;  4O23 A;  1AMP A;  2AFM A;  2C6C A;  3D7F A;  4P10 A;  1ARM A;  4MCS A;  2ZEM A;  3I1U A;  2HC9 A;  2ZEP A;  4UEE A;  1LAM A;  1LCP A;  3IIB A;  3VH9 A;  5LYL A;  1ARL A;  5DS0 A;  2C6P A;  2QJ8 A;  2ZOF A;  1LFW A;  3D4U A;  3WC6 A;  4W9Y A;  6CPA A;  4EME A;  4P44 A;  4OC3 A;  4PXE A;  4G1P A;  2NYQ A;  3MN8 A;  2DEA A;  4UIB A;  3NA6 A;  4P4B A;  4A38 A;  3S9L A;  3NH5 A;  3PEI A;  4Z65 A;  2XEF A;  4R76 A;  3DGV A;  2ZEG A;  2ZEH A;  3FED A;  3B7I A;  4A37 A;  3B3C A;  3L2N A;  3FEC A;  1F57 A;  1TKH A;  2ZOG A;  4OP4 A;  2PJ8 A;  4EWT A;  2FVG A;  4PXC A;  4TNU A;  1YLO A;  2XEJ A;  4FAI A;  3GUX A;  1XFO A;  2V8G A;  4GM5 A;  3D67 A;  3FMC A;  1CPS A;  2PJ0 A;  4P4E A;  3WAB A;  3KQX A;  4R7M A;  1VIX A;  1CBX A;  3PB8 X;  2V8H A;  2AFZ A;  3SI2 A;  2CTC A;  1H8L A;  3B3S A;  4FUU A;  5K8N A;  2IMO A;  3BHX A;  2XEG A;  3IFE A;  2ANP A;  5JGF A;  4NGM A;  5CBM A;  1XMB A;  4IAV A;  1TKJ A;  4NJR A;  3BI0 A;  3QNV A;  3TX8 A; 
#chains in the Genus database with same CATH topology
 1Z5R A;  2RB7 A;  2Z3N A;  4ZGY B;  4B5P A;  3UY5 A;  1ON0 A;  1R43 A;  4TWE A;  2CNM A;  2AFU A;  3R9E A;  2FT0 A;  4AXV A;  2ZW7 A;  1ZLH A;  3PFO A;  3VAT A;  4NGP A;  1F2P A;  3B8G A;  2NMT A;  4UWJ A;  1ZLI A;  2Q44 A;  1FNO A;  3BI1 A;  4UF4 A;  3HLP A;  2YGW A;  3IWE A;  2PDO A;  4IHM A;  2Z11 A;  4FWU A;  4A30 A;  2ZEF A;  4M6I A;  1ZG8 A;  5EBV A;  5LRJ A;  2DPS A;  4RI1 A;  4UIA A;  1Z8X A;  5EMI A;  1CM0 A;  1TF9 A;  1Z2L A;  3PRT A;  4NGS A;  1FT7 A;  5KTA A;  1NE9 A;  1B87 A;  3ISX A;  1ELM P;  3N5F A;  4NXY A;  4Q38 A;  4AVA A;  3GYA A;  1CG2 A;  4LQ6 A;  4C7H A;  1YSJ A;  4CYP A;  4II9 A;  4UBR A;  1KUY A;  4F6A A;  1X12 A;  1HDU A;  3QAY A;  2PVV A;  5GCN A;  4DJL A;  4M6H A;  4R8F A;  1M44 A;  2AJ6 A;  4K30 A;  3V8I A;  4B6Z A;  4P4I A;  4CAF A;  2H5M A;  4X8I A;  5IB9 A;  2ZEE A;  4OLL A;  4B12 A;  2Q7S A;  5IX3 A;  2KCW A;  4OC0 A;  4KOR A;  3D3S A;  4FBE A;  3S9N A;  4NEX A;  2PRQ A;  2Z3M A;  1AUG A;  3H8G A;  2P6G A;  2Z3O A;  4KVX A;  5A27 A;  2WSA A;  5JPH A;  2ZEO A;  4E2A A;  1OZP A;  1QSN A;  5F48 A;  5KTD A;  1B6B A;  4MJ8 A;  1NSA A;  2ZED A;  4IF5 A;  2O4H A;  4UFV A;  3TO7 A;  2CNS A;  2G0B A;  3QB8 A;  4JJX A;  4X5K A;  1DE4 C;  3V38 A;  4CRY B;  4XNH C;  2QVP A;  4GXH A;  4DYO A;  4ZY2 A;  2PE3 A;  3BXM A;  1BOB A;  1Z9U A;  4ZBG A;  1Z8T A;  4B11 A;  1XOV A;  2B5G B;  5IV0 A;  2K5T A;  2IL4 A;  1S5K A;  2AFX A;  1NMT A;  1I12 A;  1QMU A;  4MHZ A;  3TC8 A;  2VL1 A;  1XJO A;  4JXQ A;  4C2Z A;  2PJC A;  3G8W A;  5I4M A;  2ATR A;  3PZJ A;  4L89 A;  5KTC A;  3MGD A;  5LRG A;  5G21 A;  3RZA A;  1HDQ A;  2R7H A;  3ISZ A;  3D7H A;  4M3S A;  3DLJ A;  5HVH A;  4BD9 A;  2JEV A;  4Q7A A;  3W6S A;  1ZG7 A;  2PJ1 A;  2OH1 A;  4MFK A;  2I3C A;  1IOF A;  3IWW A;  3SI0 A;  2OZG A;  5H84 A;  4EFD A;  1V0C A;  5AG6 A;  4UEZ A;  3W91 A;  2X7B A;  1TKF A;  3C26 A;  1WWZ A;  2R8V A;  2GIV A;  2FCK A;  1BPN A;  2GRE A;  4MMO A;  5E96 A;  1QSM A;  4ZI6 A;  3S6K A;  3TFY A;  1YVO A;  2Q7B A;  3OWC A;  4ZX8 A;  1I1D A;  3IEH A;  4MHP A;  1Y7E A;  2PR8 A;  3R1K A;  3IWG A;  3SJF A;  1VHE A;  1IU8 A;  4KOX A;  2V8D A;  4KOV A;  1PYT B;  2OR4 A;  4UEF A;  3SI1 A;  1TF8 A;  2G3A A;  2B3U A;  3JUW A;  5IB0 A;  3N7Z A;  4P6Y A;  1Z4R A;  5F09 A;  4MFJ A;  4R3K A;  3TO9 A;  4A2Z A;  3KHX A;  4CRZ B;  3R95 A;  4XPL A;  3FX6 A;  4WJB A;  4YU9 A;  3IJ3 A;  5HH1 A;  4C68 A;  4CGP A;  1KWM A;  3B3V A;  4MFP A;  4FD5 A;  2FL4 A;  2J8M A;  4H2K A;  3NE7 A;  3FVL A;  2PJA A;  1S7K A;  5LYI A;  3H5Z A;  1UWY A;  3D2P A;  2PJB A;  2EVN A;  3KI9 A;  3PB9 X;  4JD6 A;  2PSW A;  4ONU A;  1AYE A;  1IYL A;  4P4F A;  3WC7 A;  4NFR A;  4U5Y A;  4OIW A;  2OOT A;  5LRK A;  2GFQ A;  2BO9 A;  4R57 A;  1CX8 A;  2BOA A;  4AG9 A;  2BUE A;  1I21 A;  4YFJ A;  2Q51 A;  4LUA A;  5AGE A;  2B4D A;  2C1C A;  4X3R A;  2GAN A;  3P2F A;  4A94 A;  1LOK A;  3PBB A;  4NGQ A;  5J1Q A;  1QSO A;  2R98 A;  2PJ2 A;  1XRY A;  1Q2C A;  3FJU A;  3JRU A;  4CAV A;  4F0Y A;  1LAN A;  2F7V A;  2RFH A;  3I3G A;  3I9S A;  4EVY A;  2FIW A;  4OKO A;  3SHP A;  1IY7 A;  4PK2 A;  1YQE A;  1XEB A;  4CGL A;  1GYT A;  1ZO0 A;  4KOU A;  2BEI A;  5THW A;  1FY7 A;  4M6G A;  5HVG A;  5J8C A;  4MXU A;  3D8P A;  3S6G A;  2P6F A;  3EFA A;  2HV2 A;  3SJX A;  3GKR A;  3NH8 A;  4RS2 A;  1RTQ A;  2OB0 A;  3D66 A;  1CPX A;  4M85 A;  2IJZ A;  4C7I A;  2WPX A;  2VBQ A;  3F5B A;  4C2X A;  1Y9K A;  1BO4 A;  4NGN A;  1M4L A;  5G20 A;  2PJ5 A;  4R3L A;  5AG7 A;  1XBU A;  3H8F A;  3H4Q A;  3G3S A;  1Q7L A;  3D7D A;  2PIY A;  3EO4 A;  1CP6 A;  4CGO A;  3S9M A;  3HUV A;  3PBE A;  1XMT A;  2OZU A;  4FD7 A;  4KS9 A;  4OC5 A;  5BWA B;  2WYR A;  3NH4 A;  4UCP A;  4MCQ A;  5LYF A;  3CXS A;  2Q4Z A;  1VGY A;  1QQ9 A;  3E0K A;  4X2T A;  4NGR A;  3ZJ0 A;  4PPZ A;  1M4D A;  2VEZ A;  4B13 A;  3TOB A;  1VKC A;  4KOS A;  5F46 A;  4YGO A;  1Y0R A;  4P45 A;  5J8F A;  4R6T A;  2AFW A;  3B35 A;  2D4O A;  2JBJ A;  4BBH A;  3S6F A;  3IU2 A;  1EE3 P;  1YW4 A;  5ELY A;  4BIN A;  3WT4 A;  3KAS A;  4FD4 A;  4F8Z A;  1Z4E A;  1K4J A;  4MCP A;  2PVW A;  2GLJ A;  4OC4 A;  2BSW A;  1PUA A;  2BL1 A;  2JDC A;  2ZW6 A;  3FF3 A;  3EY5 A;  3IGR A;  4U9Z A;  2NSM A;  4MBU A;  5K8P A;  4PXD A;  2J9A A;  3D7G A;  1U6M A;  4K3N A;  4KSI A;  3B2Y A;  3KHZ A;  4KUA A;  1CP7 A;  3CXQ A;  3PP9 A;  4L8A A;  1YX0 A;  2B58 A;  3LOD A;  4XPD C;  4MRI A;  5LYD A;  1IIC A;  5K8O A;  2XEI A;  3KQZ A;  1PCA A;  2AE6 A;  4MHY A;  4QVT A;  4UCN A;  4ZX9 A;  4OC1 A;  1YLE A;  1R3N A;  2FXF A;  3D68 A;  3R9F A;  3ZZI A;  2GLF A;  2ABZ A;  3FB3 A;  3RBU A;  4FD6 A;  3CXP A;  1A2Z A;  1Z8L A;  3K2K A;  2EWB A;  3T9Y A;  4NF1 A;  3DR8 A;  4KLW A;  1WK4 A;  3W6X A;  3RAM A;  2PCU A;  4LX9 A;  4OC2 A;  2FE7 A;  3F8K A;  3K9U A;  3LD2 A;  2Y0M A;  2QYV A;  3NFZ A;  1KUV A;  2BCO A;  4R9M A;  5K8M A;  2HQY A;  3FYN A;  5D29 A;  5AG5 A;  4JLY A;  3WR7 A;  2B4B A;  1DTD A;  2PJ4 A;  2VI7 A;  2FSR A;  4PSX A;  2O53 A;  4WWV A;  1Y0Y A;  4MCR A;  4IK2 A;  4PQA A;  4CPA A;  4A31 A;  4KVM E;  1YW6 A;  3F0A A;  3KR5 A;  2DF5 A;  2ZEN A;  4A32 A;  3FXT A;  4H6Z A;  4AVC A;  4DUK A;  2PR1 A;  3B3W A;  3QAH A;  2B5G A;  5HXD A;  3EC4 A;  3PB7 X;  2EO8 A;  2PRB A;  1P4N A;  4Y49 B;  5HVF A;  4CYO A;  4LQG A;  3CT9 A;  1TXR A;  2CIJ A;  4JZ0 A;  3H8E A;  2Q4V A;  1LRZ A;  3RO0 A;  5JH9 A;  1BAV A;  4F9V A;  1HEE A;  5I0C A;  2CTB A;  4OME A;  3FEE A;  1QSR A;  4CYN A;  3TCV A;  2V8V A;  4YRH A;  1MJA A;  4XPK A;  5C82 A;  2JLM A;  2B3V A;  2C27 A;  5JQ4 A;  3PFE A;  4DNC A;  2V77 A;  3LAC A;  3TE4 A;  2Q43 A;  4UFW A;  3FNC A;  5CPA A;  2QIR A;  2RC4 A;  2AFO A;  4MHN A;  2ZEL A;  1UFH A;  4PV6 A;  4ZY1 A;  3FIX A;  3TTH A;  4BMH A;  4KLV A;  1ZG9 A;  4HNY B;  2D4P A;  3PB4 X;  3KGQ A;  5G1Z A;  3LWU A;  1M1D A;  2Z10 A;  2ZW5 A;  1M4I A;  3LMS A;  2P6E A;  4GS4 A;  4P4J A;  1IYK A;  1Q2Y A;  4KOT A;  3KL9 A;  4RUH A;  3EXN A;  4A33 A;  2CF4 A;  3CPA A;  4B5P B;  1TIQ A;  4NJQ A;  4F9U A;  3IC1 A;  5JM6 A;  1ELL P;  4B10 A;  2VZY A;  1X10 A;  4CAX A;  1SQH A;  4H6U A;  4MFZ A;  3SJG A;  1L0C A;  1R57 A;  3B3T A;  2WZN A;  3BJ7 A;  4HPS A;  2GU2 A;  2EBJ A;  2QML A;  4MFQ A;  2PC1 A;  4NGT A;  4ONW A;  3VAR A;  2C6G A;  3K9T A;  3KZW A;  5F47 A;  3CPX A;  2OZH A;  1BLL E;  1RO5 A;  2HB6 A;  2Z0Z A;  2REF A;  2DPT A;  3TT2 A;  4HNW B;  2G9D A;  2F8H A;  2J8R A;  3KR4 A;  1VHO A;  5HMN A;  7CPA A;  1F2O A;  1IB1 E;  2CXA A;  2POK A;  2Z3K A;  2PJ6 A;  4XNH B;  1LAP A;  4P4D A;  3RYO A;  4CGM A;  1YR0 A;  3GLJ A;  2FS5 A;  2Q4Y A;  2JEW A;  5EC4 A;  5H86 A;  4ZY0 A;  3T8W A;  4ZYQ A;  2REE A;  2JBK A;  1KUX A;  1S7L A;  4PXB A;  1IGB A;  4Y49 C;  1BPM A;  2PIZ A;  1JWQ A;  2Q0Y A;  4KSA A;  3SJE A;  2EK8 A;  1Y7R A;  1YME A;  2AFS A;  2YNC C;  3IO1 A;  2VQY A;  3WC5 A;  5AG4 A;  1VHS A;  3GB0 A;  4JWP A;  4A39 A;  2I00 A;  5DWM A;  3FH4 A;  2WUU A;  4PSW A;  3NE8 A;  3A9L A;  4HNX B;  4QB9 A;  4OID A;  4KUB A;  2EK9 A;  2PJ7 A;  4J3G A;  1PU9 A;  2IQ6 A;  4F0X A;  4MI4 A;  2PJ9 A;  5ISV A;  3CDX A;  2PJ3 A;  3VWD A;  3V7Z A;  8CPA A;  4JYW A;  2YNE A;  1S3Z A;  5FVJ A;  4I49 A;  3PB6 X;  4HKF A;  1IID A;  1GHE A;  3MRU A;  4QUS A;  2R1I A;  1J4J A;  5D8N A;  4YWY A;  1OBR A;  3GIU A;  3D2M A;  1JQG A;  1MK4 A;  2ZW4 A;  2PQ8 A;  4O23 A;  1AMP A;  1Q2D A;  1Z8W A;  2AFM A;  3T90 A;  2J8N A;  2O28 A;  2OU2 A;  2C6C A;  3D7F A;  3DSB A;  4P10 A;  1ARM A;  4MCS A;  2A4N A;  2ZEM A;  2ARH A;  4RN7 A;  4QC6 A;  3I1U A;  2HC9 A;  2ZEP A;  4UCM A;  2I79 A;  2EUI A;  3CZX A;  4UEE A;  1LAM A;  1LCP A;  1RXT A;  3IIB A;  4UFX A;  4AB7 A;  3VH9 A;  5LYL A;  3BLN A;  1ARL A;  3KKW A;  4KOW A;  2CNT A;  4MFL A;  2P0W A;  5DS0 A;  2C6P A;  3R96 A;  3DNS A;  4QBJ A;  2QJ8 A;  2ZOF A;  4CAW A;  3JVN A;  1LFW A;  3D4U A;  3WC6 A;  1KZF A;  4W9Y A;  6CPA A;  1YRE A;  4EME A;  4P44 A;  4OC3 A;  4PK3 A;  5A28 A;  2Q04 A;  4CYQ A;  3FRM A;  1IOI A;  1S7F A;  3P2H A;  1YGH A;  2ZXV A;  2HUZ A;  4NSQ A;  1N71 A;  3PGP A;  1XE4 A;  4G1P A;  2NYQ A;  4JXR A;  4PXE A;  3MN8 A;  4AG7 A;  2DXQ A;  4E0A A;  2DEA A;  4UIB A;  3SXO A;  3NA6 A;  4P4B A;  4CS0 B;  1XIX A;  4CGN A;  4H89 A;  3GY9 A;  4A38 A;  3S9L A;  4CAE A;  3DR6 A;  3TOA A;  3SXN A;  4A95 A;  2VXK A;  5DWN A;  4E8O A;  2YND A;  3BJ8 A;  3NH5 A;  4KOY A;  3PEI A;  3DDD A;  4ORF A;  2XEF A;  4Z65 A;  4R76 A;  3DGV A;  5F49 A;  2ZEG A;  4C2Y A;  3S6H A;  2ZEH A;  3FED A;  3FBU A;  2ODF A;  3B7I A;  4KZT A;  4A37 A;  3B3C A;  4R87 A;  3L2N A;  3FEC A;  2Z3P A;  4KVO E;  1F57 A;  1TKH A;  2ZOG A;  4OP4 A;  2PJ8 A;  4EWT A;  1S7N A;  2WPW A;  2FVG A;  4PXC A;  1P0H A;  4TNU A;  2JDD A;  1YLO A;  1QST A;  2XEJ A;  4FAI A;  3GUX A;  2B4D B;  1XFO A;  4MHD A;  2V8G A;  4UWI A;  1YVK A;  4GM5 A;  4B14 A;  2ZPA A;  1M4G A;  4OAE A;  2YNC A;  3D67 A;  3FMC A;  1CPS A;  4OAD A;  2PJ0 A;  2QEC A;  4P4E A;  3VWE A;  2CY2 A;  2GE3 A;  4MY3 A;  3WAB A;  3KQX A;  2VZZ A;  5C88 A;  4R7M A;  5G22 A;  4AVB A;  3RNZ A;  1VIX A;  1CBX A;  3PB8 X;  3TO6 A;  3R9G A;  4NCZ A;  2V8H A;  2AFZ A;  3SI2 A;  2CTC A;  2Z3L A;  1H8L A;  4B5O A;  3B3S A;  4FUU A;  1CJW A;  5K8N A;  2G3T A;  2IMO A;  2XEG A;  3BHX A;  3IFE A;  4IUS A;  4Q36 A;  1MJ9 A;  2ANP A;  5JGF A;  3JTK A;  4NGM A;  5CBM A;  1XMB A;  2FIA A;  1XF8 A;  4KSF A;  4UA3 A;  4IAV A;  4U9Y A;  1NSL A;  1TKJ A;  1S60 A;  1Y9W A;  4NJR A;  3BI0 A;  1MJB A;  3QNV A;  2F5I A;  4XPD B;  3IU1 A;  5CNP A;  3TX8 A;  4MY0 A;  1YK3 A; 
#chains in the Genus database with same CATH homology
 1Z5R A;  2RB7 A;  1R43 A;  4TWE A;  2AFU A;  4AXV A;  1ZLH A;  3PFO A;  3VAT A;  4NGP A;  1F2P A;  1ZLI A;  3BI1 A;  1FNO A;  4UF4 A;  3HLP A;  4IHM A;  4FWU A;  2ZEF A;  5LRJ A;  1ZG8 A;  4UIA A;  1TF9 A;  1Z2L A;  3PRT A;  4NGS A;  1FT7 A;  3ISX A;  1ELM P;  3N5F A;  1CG2 A;  1YSJ A;  1HDU A;  2PVV A;  4DJL A;  4B6Z A;  4R8F A;  4P4I A;  4X8I A;  5IB9 A;  2ZEE A;  4OC0 A;  4FBE A;  3S9N A;  2PRQ A;  3H8G A;  2ZEO A;  1NSA A;  2ZED A;  2O4H A;  1DE4 C;  3V38 A;  2QVP A;  4DYO A;  4ZY2 A;  2PE3 A;  3BXM A;  2AFX A;  3TC8 A;  1QMU A;  4MHZ A;  2VL1 A;  1XJO A;  2PJC A;  5I4M A;  5LRG A;  3RZA A;  1HDQ A;  3ISZ A;  3D7H A;  3DLJ A;  5HVH A;  4BD9 A;  4Q7A A;  1ZG7 A;  2PJ1 A;  2I3C A;  3IWW A;  3SI0 A;  4EFD A;  4UEZ A;  1TKF A;  2GRE A;  1BPN A;  4MMO A;  4ZI6 A;  4ZX8 A;  3IEH A;  4MHP A;  1Y7E A;  3SJF A;  1VHE A;  2V8D A;  1PYT B;  2OR4 A;  4UEF A;  3SI1 A;  1TF8 A;  4P6Y A;  5F09 A;  3KHX A;  3FX6 A;  4WJB A;  4YU9 A;  3IJ3 A;  1KWM A;  3B3V A;  4H2K A;  3FVL A;  2PJA A;  5LYI A;  1UWY A;  2PJB A;  3KI9 A;  3PB9 X;  1AYE A;  4P4F A;  3WC7 A;  4NFR A;  2OOT A;  4OIW A;  5LRK A;  2BO9 A;  1CX8 A;  2BOA A;  2Q51 A;  2C1C A;  4X3R A;  4A94 A;  1LOK A;  3PBB A;  4NGQ A;  5J1Q A;  2PJ2 A;  1XRY A;  3JRU A;  3FJU A;  1LAN A;  2F7V A;  2RFH A;  4OKO A;  1IY7 A;  1GYT A;  5THW A;  5HVG A;  4MXU A;  3SJX A;  3NH8 A;  1RTQ A;  3D66 A;  1CPX A;  2IJZ A;  4NGN A;  1M4L A;  2PJ5 A;  1XBU A;  3H8F A;  1Q7L A;  3D7D A;  2PIY A;  1CP6 A;  3S9M A;  3HUV A;  3PBE A;  4OC5 A;  2WYR A;  3NH4 A;  5LYF A;  4MCQ A;  2Q4Z A;  1VGY A;  1QQ9 A;  4X2T A;  4NGR A;  4PPZ A;  1Y0R A;  4P45 A;  4R6T A;  2AFW A;  3B35 A;  2JBJ A;  1EE3 P;  1YW4 A;  5ELY A;  4F8Z A;  3WT4 A;  3KAS A;  4MCP A;  2PVW A;  2GLJ A;  4OC4 A;  3FF3 A;  5K8P A;  2NSM A;  4PXD A;  2J9A A;  3D7G A;  4K3N A;  4KSI A;  3B2Y A;  3KHZ A;  1CP7 A;  5K8O A;  5LYD A;  4MRI A;  2XEI A;  3KQZ A;  1PCA A;  4MHY A;  4ZX9 A;  4OC1 A;  3D68 A;  1R3N A;  2GLF A;  2ABZ A;  3RBU A;  1Z8L A;  3K2K A;  2EWB A;  3RAM A;  2PCU A;  4OC2 A;  2QYV A;  3NFZ A;  2BCO A;  5K8M A;  5D29 A;  1DTD A;  2PJ4 A;  4WWV A;  2O53 A;  1Y0Y A;  4MCR A;  4IK2 A;  4PQA A;  4CPA A;  1YW6 A;  3KR5 A;  2ZEN A;  4DUK A;  3B3W A;  5HXD A;  3PB7 X;  5HVF A;  4LQG A;  3CT9 A;  1TXR A;  2CIJ A;  4JZ0 A;  3H8E A;  5JH9 A;  1BAV A;  4F9V A;  1HEE A;  2CTB A;  4OME A;  3FEE A;  2V8V A;  3PFE A;  2V77 A;  2Q43 A;  5CPA A;  2AFO A;  4MHN A;  2ZEL A;  4ZY1 A;  1ZG9 A;  3PB4 X;  3KGQ A;  3LWU A;  4P4J A;  3LMS A;  4RUH A;  3KL9 A;  2CF4 A;  3CPA A;  4NJQ A;  4F9U A;  3IC1 A;  5JM6 A;  1ELL P;  3SJG A;  3B3T A;  2WZN A;  3VAR A;  2GU2 A;  4NGT A;  4ONW A;  2C6G A;  3K9T A;  3KZW A;  3CPX A;  1BLL E;  2HB6 A;  2G9D A;  2F8H A;  3KR4 A;  1VHO A;  7CPA A;  1F2O A;  2POK A;  2PJ6 A;  1LAP A;  4P4D A;  3GLJ A;  2JEW A;  4ZY0 A;  3T8W A;  4ZYQ A;  2JBK A;  4PXB A;  1IGB A;  1BPM A;  2PIZ A;  3SJE A;  2EK8 A;  3IO1 A;  1YME A;  2AFS A;  3WC5 A;  3GB0 A;  4A39 A;  3FH4 A;  4OID A;  2EK9 A;  2PJ7 A;  2IQ6 A;  2PJ9 A;  3CDX A;  2PJ3 A;  3V7Z A;  8CPA A;  4JYW A;  3PB6 X;  3MRU A;  5D8N A;  4YWY A;  1OBR A;  1JQG A;  4O23 A;  1AMP A;  2AFM A;  2C6C A;  3D7F A;  4P10 A;  1ARM A;  4MCS A;  2ZEM A;  3I1U A;  2HC9 A;  2ZEP A;  4UEE A;  1LAM A;  1LCP A;  3IIB A;  3VH9 A;  5LYL A;  1ARL A;  5DS0 A;  2C6P A;  2QJ8 A;  2ZOF A;  1LFW A;  3D4U A;  3WC6 A;  4W9Y A;  6CPA A;  4EME A;  4P44 A;  4OC3 A;  4PXE A;  4G1P A;  2NYQ A;  3MN8 A;  2DEA A;  4UIB A;  3NA6 A;  4P4B A;  4A38 A;  3S9L A;  3NH5 A;  3PEI A;  4Z65 A;  2XEF A;  4R76 A;  3DGV A;  2ZEG A;  2ZEH A;  3FED A;  3B7I A;  4A37 A;  3B3C A;  3L2N A;  3FEC A;  1F57 A;  1TKH A;  2ZOG A;  4OP4 A;  2PJ8 A;  4EWT A;  2FVG A;  4PXC A;  4TNU A;  1YLO A;  2XEJ A;  4FAI A;  3GUX A;  1XFO A;  2V8G A;  4GM5 A;  3D67 A;  3FMC A;  1CPS A;  2PJ0 A;  4P4E A;  3WAB A;  3KQX A;  4R7M A;  1VIX A;  1CBX A;  3PB8 X;  2V8H A;  2AFZ A;  3SI2 A;  2CTC A;  1H8L A;  3B3S A;  4FUU A;  5K8N A;  2IMO A;  3BHX A;  2XEG A;  3IFE A;  2ANP A;  5JGF A;  4NGM A;  5CBM A;  1XMB A;  4IAV A;  1TKJ A;  4NJR A;  3BI0 A;  3QNV A;  3TX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...