1F2RI

Nmr structure of the heterodimeric complex between cad domains of cad and icad
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MELSRGASAPDPDDVRPLKPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWTYNDSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the heterodimeric complex between CAD domains of CAD and ICAD.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords CASPASE-ACTIVATED DNASE
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f2rI00
1MHHE 1K50A 1FCLA 1PGXA 1P7EA 1JMLA 1EM7A 1HZ6A 1F2RI 2KACA 3FILB 2IGHA 2PW9A 1XF5L 2KN4A 2OEDA 1F2RC 2GI9A 1QKZA 2LHEA 1MI0A 4IOIE 4WH4A 1PGAA 2JZPA 1UWXA 3GB1A 3MP9A 3UI3A 1IGCA 2ON8A 1FD6A 4KGTA 2KQ4X 2RPVA 2IGGA 4HJGE 2KWDA 1FCCC 2JWUA 4OZAA 3V3XA 2JXTA 2JU6X 2QSDA 1KH0A 1IBXB 4GLSC 4OZCA 2N7JA 1IGDA 1MPEA 4HKZE 1PGBA 2K0PA 1K53A 5HG2A 4D2KA 1YNTE 5HHDG 4KGRA 1GB4A 1MVKA 2LHDA 2QMTA 2NMQA 2I38A 1XCTL 1MHXA 2RMMA 4KGSA 5HI1A 2PTLA 1Q10A 2N9KA 2N9LA 1ZXHA 2ONQA 2ZW1A 1K52A 1HEZE 5BMHA 2ZW0A 1GB1A 1IBXA 2PLPA 5BMGA 5HFYA 2LUMA 2IGDA 4IKGA 1K51A 4OZBA 2LGIA 2J52A 4MACA 2J53A 1P7FA 1HZ5A 2EELA 1C9FA 1XCQL 2KDMA 2JSVX 3FILA 1D4BA 5JXVA 1YMHE 2GB1A 5BMIA 2I2YA
chains in the Genus database with same CATH superfamily
1MHHE 1FCLA 4OVUA 3ZQ4A 4OHJA 4RGOS 2WX1A 2KQSA 1VCBA 1L0XB 3K9OB 2CHZA 2KN4A 4AS1A 2I1JA 1J8CA 2A5UA 3MTNB 3DVNV 1OQYA 3ZRCA 1RM6C 2J42A 3IBEA 3ZRFA 1JALA 2WWZA 1E8XA 3DVNU 3ECIA 4ZYNA 2BYEA 4A3PA 3PO0A 1UBIA 4DDID 3APCA 1V9JA 4HCPB 3NG0A 1I4PA 3TJPA 3TL5A 2BYFA 3QHTA 2J4XA 3DBLI 1BXTA 2DZJA 2PEAA 5DPRA 2RGFA 1ZPSA 3ZNZB 3NHEB 3U8ZA 3AE1B 1ET9A 2XK5A 1CZPA 1D5ZC 3OG5A 2K5PA 3NVVA 3I5JC 1YQBA 2RMMA 5HI1A 3KLSX 2AQ1B 1SE3A 4E3CA 3VUXA 4PK1A 4N58A 3PRMB 5D6JB 2KOXA 1DOIA 2I1KA 1WZ0A 1NYRA 2WDQB 2J52A 2PKOA 2WP9B 3FKYA 3HVDA 1XEEA 1VZ6A 2GB1A 2DX5B 4BBNC 4RCOA 1JMLA 1L4ZB 3FC4A 1EM7A 4HCNB 2IGHA 4MEMA 3BIID 3ZIMA 3KVFB 4K3CA 4WQOB 2OJRA 2MBBB 4FHKA 3MJWA 2MRPA 4LNIA 2KDEB 2VRRB 3MP9A 5G5GA 1E7UA 2QC8A 4B0MA 1FRRA 3B9JA 4KGTA 3N20C 4ZDVA 4HPPA 1GC6A 3PHXB 4W9FA 1TTNA 2KWDA 4GB9A 2TSSA 3ZNID 1XQQA 1IBXB 2IO2B 1WGGA 2KZRA 1CMXB 2FUHB 2RDGA 3MFGA 2RR9A 4GDLB 4F8CB 1STEA 2D5GA 4UDUC 3X0WA 3DHHC 1B9RA 1E90A 4ZRIA 2J0MA 1V6EA 3Q69A 2INPE 4XE0A 2JXXA 2RSUA 4A3OA 3R3MA 2D07B 2LUMA 1P0RA 4WJQA 1M4VA 3VXWA 3PS6A 1UH6A 3CF6E 5E6PA 2V3PA 3DWGC 1F52A 2MP2A 4RGNA 5AUIA 2L00B 4GMVA 3VTWA 2NVUI 1YMHE 1GG3A 2MX2A 2CHXA 2BB5A 1P9DU 2GRIA 1ROEA 2KJ6A 2NR2A 3HM6X 4FHJA 3GS2A 1L0YB 4ARCA 4YTNB 2WXRA 1QLBB 4KV2A 1Q1OA 2L76A 1SE2A 2KKCA 4M0WA 1FEHA 1TIFA 4IG7B 2HTHA 4PS3A 2UWQA 4KSKC 1YQ4B 3BK2A 3QC8B 1WXAA 3M3JA 1VDVA 1UZXB 4YXDB 2LVPA 4II2B 1JROA 4NAWA 1C79A 4MT5A 1E7VA 1ZE3D 2KO3A 1TY0A 4GLSC 4DBGA 3GE8C 2KWUB 1LM8B 4P7IA 1SIFA 1C76A 4G0NB 5HHDG 3RUIB 1UGJA 4XYCA 2K39A 3LYYA 5AZGA 4GOCA 2KJRA 1B1ZA 2E3TA 2PTLA 1QILA 3OJ4B 1GB1A 1KFYB 1J19A 3DBHI 2Z59B 2LVQA 1AN8A 4NJCA 4L23A 3APDA 3T8MA 2AL3A 4XWTA 3QQ8B 3N1YC 5LNK1 2DBYA 2C7HA 1NI2A 1D5MC 3QX1A 1SE9A 3A9KB 1XCQL 2GBMA 2JT4B 4G11A 2E6XA 5BMIA 3MC8A 2BTEA 4IM0A 1CQVA 3W9CB 2G4DB 4NQKE 1WI0A 1MJDA 3H9DA 3FILB 2KLGA 2JZ3B 1RFKA 3Q8EA 4AQ7A 2BWES 2IJ0A 2C9WB 1D6EC 2DLBA 3ZVVA 4WURA 4WH4A 4K7UA 4KZ0A 4HDOA 1KLUD 5FKAC 2RD0A 3LB8C 1UWXA 3IVFA 3OJ3A 2MSED 3RNGC 5JHAA 2IDYA 3LXFA 2KDBA 4FA6A 3NZ3A 4GU2A 3Q8BA 3SFDB 2KDIA 3PSEB 4JGHB 2D3GA 3HK0A 2D3AA 4BAXA 3AM9A 2LVOA 1WXSA 2INNE 3HVZA 1V8CA 4C56C 4M8MA 2GBKA 2WXJA 2JRHA 4FADA 4LNFA 2PPHA 3PTFC 3L13A 2ZNVC 1DOYA 1Z2MA 1UD7A 1HXYD 1WGRA 3KW5B 2GBJA 1JQ4A 1G6JA 2LJ5A 1WX8A 2C5LC 1L6UA 1WJ6A 1RWSA 2KHWB 3VQIA 4M8NA 3P4QB 4EZKA 5C23A 2ZNVB 1ZXIA 3SU8X 4WAFA 4YSXB 2WU5B 2LGDA 3ONSA 3A1QA 4MACA 4S17A 3H7PB 4ZOHC 2XNAC 3AE8B 2J53A 2WXKA 3IT4B 2V0GA 5JH5C 1T0RC 5GMVA 3PLUA 1V81A 4KDIC 3PPAA 1FNVA 3N30A 4J3OD 3DPDA 3ZLZA 2MHJA 1WR6E 3P4PB 1SBBB 3AEBB 1E8ZA 4NAMA 4A6QA 3M62B 1P98A 3KQ4A 4Q2JA 4BKSA 1FXIA 1SJHD 1C4CA 1N62A 4HKQA 3VTVA 1MI0A 1VR9A 2D11A 2M4NA 5D94A 2KYWA 2JZPA 2JZZA 3QJZA 3QAQA 1EU4A 1N63A 3ZTCA 3KYCD 1FPYA 3Q8AA 4DQOC 1NYQA 1NBFC 2LRUA 3ZXRA 4BZAA 2DHZA 3RI7C 2W54A 2QSDA 1KH0A 1WE7A 2LWPA 1UELA 1LXDA 3PT2B 2N7JA 2KQ7A 4AUQC 3VR9B 2LZ6A 3VFKA 1PGBA 5DCNA 3BYYB 1J7AA 4MM3B 3B0AA 4PT5A 4IC7B 3W5UB 2LHDA 3KH0A 1QOFA 4MGKE 2L0FA 4MGZE 5H92C 2WDTB 1TS4A 2PE9A 5CTRC 2KK8A 4K7WA 4N9F4 3RZFA 1SE4A 2BQQA 4JLCA 1UF0A 3RZWC 4RFBA 1E5WA 3AN1A 1I4QA 3AE7B 1MG4A 2NBVB 3AE9B 1XLOA 1E0ZA 2JYEA 5EDSA 3PRPB 1T3QA 5FK9C 2M1MA 1SEBD 5CHFA 2JQRB 3LDZE 5H8YE 1C77A 4OZBA 1K8RB 3KWVA 3RNEC 1NDDA 4LDTD 3WAMA 1WRDB 1F0ZA 1EWYC 3HUIA 4NJ6A 4TSSA 2WS3B 4MGIE 5IP4D 1WE6A 5J17A 2KFKA 1TZOA 3U4EG 3BK1A 5FR3A 3C19A 2IBIB 4WQMA 3UIPB 3V61A 4DHJD 1WY8A 3AEAB 3N1XC 3R8BA 1XF5L 1WGKA 3VVWB 3BYTB 1F2RC 2WNMA 4P1BC 1EWCA 2N9PC 4K7SA 1UNSA 1L2NA 3JSVB 4WAAA 3WAOA 1EF1A 3C0RB 1GC7A 4NNJB 4BKGA 1IYFA 3B1LX 4L1BA 1WF9A 3EGRA 3Q8FA 2ZCCA 2CJNA 3AU4A 3CSFA 3U52E 1X1MA 3P4RB 1EO6A 3RFZB 3Q8CA 1WMHB 3N32A 2LASA 1WXVA 1GOZA 2M19A 3JSVA 3H1UA 1N60A 2X38A 1ZP0B 3AB5A 2KD0A 3AEGB 3PREA 4H2AA 3PZDA 2LGYA 2QMTA 1T0QC 4BFRA 4KZCA 3BVMA 4BOSC 2WYQA 4F1SA 3AH7A 3P42A 4GSWA 3L4PA 3WANA 2K3UA 1QOGA 1BT0A 5IA7A 4C7YA 4YSYB 3W1SA 3AE6B 3QIJA 2KC2A 3VHTC 3Q3NC 3IXSA 1WGYA 1WSPA 3B2GA 2MEKA 1I4XA 4JWUC 4E71A 1JRUA 3V05A 3PHWB 5C1ZA 2WXPA 2FNJB 2BWFA 1P1AA 4RGTA 3S2AA 2DYBA 4KVGB 2MQJA 2AEHA 2C60A 2IO3B 3NVZA 3PLVA 1WX9A 1HTOA 2C7NB 1PQSA 3ZJUA 3IT6B 2CHWA 5AZFA 2M0AA 2WGSA 1UWMA 2LHEA 2W82A 2INDC 1WRIA 2KC1A 5CX3A 3A9KA 4A55A 1Y56A 1YOVB 2WXGA 3APFA 4P16A 3UI3A 3OWEB 2IZVB 4XZ4A 3NZUA 4URKA 4MJSA 1S3SG 2RPVA 3BWUD 5JHBA 4HJGE 2LUEA 2V4LA 3EFCA 5BO4B 4ZRJA 4OVZA 4GN1A 2LD9A 1E8WA 4AJYB 2O2VB 3QCAA 4WJNA 4HXDA 2MA9B 4HKZE 1KOTA 1C4AA 2N7EA 3EUB2 3P4SB 4FJZA 4ZHOA 4I6NB 2BVCA 2YVCA 3AULA 2WHIA 2JVCA 3VDZA 2G4SA 3I9V1 2YLMA 2LXCA 1I7HA 1QT9A 3Q14C 4X57B 4ICVA 2V3NA 2N9LA 1WJUA 1N61A 1HEZE 2K1FA 2GBRA 2OJWA 2PVGC 4WJPA 1RLFA 1C78A 4ZRPA 1AWDA 1PDXA 2G1EA 4ASWC 3QARA 4NPNA 2NBWB 4JPSA 1V5OA 3UGBB 2DZMA 2ZVNA 4LJPB 3MJ5A 4AOFA 2MJ3A 4HJKA 4RM8A 3PZ8A 4WWPA 4HDQA 2WU2B 2BYVE 4LDTB 3ZDMC 1U4AA 3KUCB 3A9JB 2KAJA 2I2YA 2MBOA 2KX3A 1V1PA 2LGXA 5KHOA 3AXCA 3IAS1 1WWTA 1OEYJ 3T9LA 2KLCA 4IM2A 2OEDA 1JWAD 2MP2B 4ANVA 4QAYA 1IPGA 1R4NB 4YL8A 2X8XX 3PGEA 2N0SB 4M0WB 4W9EA 4DDGD 2BGFA 4FULA 1FD6A 2AX5A 1C1YB 3NS1A 4HVBA 3AMZA 3E56A 4N59A 3DWMA 2N1WA 3NJTA 5J2RA 1PYWD 3TSSA 1WXQA 4RF1A 2JXTA 4O1NA 2JU6X 4J6IA 3AE4B 5AUKA 1KLVA 3Q6BA 4KDLB 3RNFC 5D3DA 3TIXA 1QF6A 1SXTA 4K1RB 1DGJA 4ZYSA 2WXNA 2K0PA 2LEKA 4D2KA 1WM3A 2FAZA 4IDIA 4KGRA 5L83A 1J7BA 2L1AA 3UIOB 2M56B 3TEZA 4LLGM 4DHJB 4ICUA 4IWQA 2KMAA 3ZJVA 5E6JA 5EE9A 1ZUD2 2FCMA 3I63C 2PLPA 1YIWA 5CHWA 2UU7A 4XDCA 4GDLA 3CSTA 3TUOA 4MM3A 1SF0A 1V5TA 2R2QA 2W9NA 4AJWA 1L0VB 3QK0A 3EFUA 2KVRA 1GPXA 2VH2A 1NVID 2MJDA 4MSQB 3NVWA 3X23A 2M17A 3DVGX 3VUWA 4EEWA 5LXIB 1UGMA 1LFDA 2K25A 5BYQA 1I35A 5D7GA 3H7PA 4IOIE 2L52A 4NQLB 1MG8A 3GB1A 1WJ4A 2ON8A 3RNAC 3JW0X 4K3BA 1WH3A 1D3ZA 2KQ4X 3PRZA 4DWFA 1WR1A 1WIAA 4EE2A 4HRSA 1HE8A 2BB6A 1QZEA 3V3XA 2OOBB 1WYWB 3VH3B 2ZJDA 3ML9A 5IO9A 5EE3A 4FXCA 1E7PB 1VD2A 2Z8LA 3AE3B 4HROA 1SB3C 2CS4A 1N6ZA 2JF5A 2WXFA 3GZNB 1YNTE 1R4NI 2Q5WD 4DXAB 4W9DA 4YT0B 3DQVA 5LXHA 2KFJA 1ZKHA 3GZNI 2IY1B 2JX5A 4HPLB 2UYZB 1Q10A 2N9KA 4EOYA 4C4VA 2PJHA 1K52A 1FNUA 1GAQB 3MC0B 2C7MB 1IBXA 4ACFA 5AEKB 1L6VA 3WA0A 4LNOA 4WJOA 1JWBD 4CHKA 1F1HA 4IKGA 3RULA 2KNBA 1NI3A 2WXQA 4EKUA 1WYGA 3OAWA 1OFFA 1XXGA 3VRAB 3FILA 3ML8A 4A9AA 1OGWA 1FRDA 3ZYYX 4HWIB 1CK1A 1XLPA 1DYQA 2EMSA 1JCKB 4DXFA 3WAPA 2N4FA 1HZ6A 2VH1A 4F7ZA 4YWGG 1V97A 2L7RA 2NTSA 4W9GA 4MDKE 3UINB 2GI9A 4W9CA 2G45B 4EUTA 2IO1B 4US9A 1IGCA 4BKTA 2IY0B 3ABVB 5T8IA 1T6BX 2BBCA 1V2YA 4S0RA 1D5XC 4N6EB 4TUUA 2KANA 2H89B 4OZAA 2KWCA 4EZJA 3M63B 1UUPA 1FXTB 2EKIA 3TCAA 1N5WA 1I42A 4OZCA 3KUZA 4BVUC 4XDDA 2L83A 1Q0WB 3RNCC 1ET6A 2MH7A 3L16A 2N9XA 1XT9B 3IG3A 2XEWA 4R3DA 1TT5B 1HTQA 1HA5A 2HE7A 2BS4B 1ACCA 3KYDD 2D10A 2FCSA 1RFAA 3V62A 2DZKA 3TBLD 5TR5A 2CJOA 2W3RA 4USAA 2L05A 3T3NA 2NCNA 1TBEA 1WM2A 2KX0A 2L0TA 3Q3JA 3BVZA 4CO7A 3SHQA 2L32A 2O6VD 2NTTA 2LJIA 1HZ5A 2WXOA 4MELA 2Y5BB 4FJYA 3L08A 3A9JA 1V1OA 3N1ZC 3A33B 1M94A 1TGZB 3AECB 3NVYA 4P1CC 1BUIC 3BZDB 2LI5A 1P7EA 4GGQA 2Y5CA 1F2RI 5BYRA 1KRHA 4A8XC 1WMHA 2PMVA 3QA8A 4RH6A 1P3QU 2XK5B 3H6NA 3R2IA 3KWLA 3A4RA 4ARIA 2MLBA 3K9PB 3VR8B 1E9MA 3HIZA 4US8A 2KTFA 4ZRQA 5IOIA 4YTPB 2LGSA 3AU5A 5TSSA 3ZKJC 4FJVB 1GNUA 1GJZA 3URYA 3H7SA 2JY6A 4HEA1 4PS7A 2DWQA 2ICIA 2JWZA 2K8BA 1YN4A 2AQ3B 1AYFA 4W9JA 2R61A 1PUTA 1F77A 3BINA 2H88B 1YX5B 2AYOB 4I6LB 1FFVA 2M8SA 2NMQA 2QEJC 3B08A 3DBLB 3L0WB 5CHVC 1TS2A 4LNNA 1XCTL 2QHOA 3IAM1 1FO4A 2CR5A 2J0JA 3V6EB 4E74A 1RAXA 2KTRB 4P6VF 2FE8A 1SGHA 4LNKA 5G55A 4BKSD 2O2VA 2VZKD 2IGDA 1R7SA 1UBQA 4WIPA 4C7ZA 1TS5A 4WWOA 2N1VA 2LFIA 3B2FA 4ZHPA 2QCZA 3TEXA 2L3ZA 4AP4C 5JXVA 1ISNA 1YQ3B 3DVGY 2ZVOA 2QDFA 2Y5PA 2GOWA 3HHMA 3DHGC 3GP7A 2V9HA 3AEDB 5D2MB 1FMAD 5EE0A 5JZEB 2HJ1A 1PGAA 3A1QB 4G3XB 1V86A 2GBNA 2BPSA 1YJIA 1GUAB 2N7DA 2WDVB 4KKJA 4GDKB 2M0XA 2QILA 2BW2A 2A4ZA 2JRIB 1DOXA 2JWUA 4OW0A 1LQBA 3DBHB 4JIOU 5J18A 4KIKA 2WXIA 2AWTA 1JWSD 3L54A 3QWZB 2MBEA 3SR6A 4XC2A 2RPQA 3R66C 1K53A 3Q3MC 2YEPB 2B3AA 4JWSC 2J7QB 4JQWC 4YSZB 1GB4A 3N3KB 3RD2A 5IN7A 1L4DB 2KMCA 2BF8B 1FM0D 1E8YA 3JVZX 3ZUNA 2QJLA 2DENB 4HK2A 4DHZB 1EU3A 2N9EB 2XN9C 4C80A 3P63A 2KT7A 5DPTA 4IWOA 3R2TA 2OHFA 2RDHA 3ZGZA 3R7RA 3TMPB 2HTME 2MBHA 4JL9A 4RMAA 3DBSA 5LLIA 1KLGD 2ZZPB 3AV8A 2KDMA 4IUMB 4II3B 3FAHA 3RPFC 3NY5A 3Q3FA 3UQAA 2WLBA 4KSLC 4TMAB 2L8JA 2PVOD 1PGXA 1NEKB 3ZW3A 4WWNA 1OQQA 2KXJA 2Y3AA 2PW9A 3PVLA 4ANWA 1SJED 4GDKA 3NUHB 4LK0M 2FBWB 1TKEA 1KJTA 2K9XA 1KM7A 4MH8A 1R4MB 2XBBC 2BT6A 3SEBA 3U2SC 1JWMD 1TZ1A 5C3JB 3DDCB 1AARA 2ZCBA 4W9LA 1XLQA 1T5XD 3O65B 4K81A 4KX6B 4ANUA 1TY2A 1T0SC 2D3BA 4LJOB 3VUYA 3GE3C 4ZRKA 1QOAA 2JUOA 5IKCM 1PFDA 1WJNA 3AI5A 1RYJA 4A20A 4GIVA 3RN9C 2BS3B 1EUVB 3RMKC 2NPTA 4WWMA 4MH0E 5KHQA 2WDRB 3MHSD 2FIDA 3TEWA 2SEBD 1ZDVA 3JYUA 4JE3B 3HRDD 2I38A 1MHXA 4KGSA 2LRWA 3EECA 1ZGUB 1TS3A 2CU3A 3RCZA 2WX0A 4FLHA 2PIAA 1JWUD 2FIFA 1NENB 2NPTB 1YX6B 1XLNA 3RYTA 1ZW7A 4TKNA 1P7FA 4NAWB 2DAJA 2DAFA 4B9KA 3P1MA 3SFEB 2GMIC 3AE2B 2JSVX 4XGAB 4ITKA 2BS2B 2K6DB 1AW7A 1SSNA 1BMLC 4B0EA 2FCNA 1K50A 1LGRA 2DZIA 3NS8A 3SDLC 4TV3A 3NRZA 3AEFB 2LMCA 3N9YC 4C00A 1YJ1A 1F9JA 3VH4B 3ENEA 3NZSA 1QQRA 1I4HA 3ZO5B 1N5XA 4TQ0A 1RRBA 2IPKD 2NBUA 4MGYE 5E6NA 4LTUA 3HM3A 3AE5B 2K22A 1OEYA 4JX1C 3L17A 1FCCC 2AL6A 2VZKB 1Q5WB 4C4VB 2W3SA 1A5RA 4CYEA 3T3OA 1WZ3A 1WFYA 5AZHA 2GLSA 2CKHB 1V80A 1VRAB 4AWJA 1IGDA 3DHIC 1EF5A 4FN2A 4IM3A 5DPWA 2MBQA 1IP9A 1JW9D 1WXMA 4W9IA 2W55A 1MVKA 1TYGB 1R4MI 2KMMA 4G50A 3AEEB 1YJJA 2Z0EB 3ALBA 3RT3B 2ZEQA 4M00A 2REXA 1OQRA 4RNAA 2ONQA 2MCNB 5BMHA 2ZW0A 4NY0A 2O6VA 1FIQA 4A90A 1Z5SB 5HFYA 2Z0DB 2V1YA 2RDBC 3CWIA 1WGDA 2WXMA 4XWWA 5C2TB 2NS5A 4B95A 1ZOYB 3MC9A 2LGIA 2ZPYA 2ASQA 1TKYA 2WXHA 1C9FA 2ACZB 2J0KA 4BBNF 3DBRB 1D4BA 1TKGA 3Q2AC 5D3IB 4B6WA 4RF0A 1T0YA 4RGMA 3VTUA 2QIEB 4TQ1A 1SIJA 2B76B 3IHPC 3DCGA 2K8HA 3NOBA 4W9HA 2BYTA 1A70A 2R2OA 3KUDB 1FNWA 2WXLA 4XX5A 3ZNGC 3V6CB 5EE1A 4HPMB 1FXAA 4DK5A 5IAAC 2MWSB 3ZTDA 1YN3A 3UQBA 1YN5A 4LCDE 3O13A 5DPSA 3ZDTA 2IGGA 4L2YA 1V49A 3H8HA 3R7QA 3PZ7A 2V4IB 3EA6A 3A4SC 1VLBA 1TJEA 3I3TB 2YEPF 4REZA 1MFWA 3WALA 2EKEC 5HKHA 1J7CA 1MPEA 5HG2A 2D3CA 5E6OA 4NZLB 3UF8A 3EC8A 2O6VB 1I4RA 1OTRB 4OVVA 4DHZE 4M01A 2SAKA 3U7DA 1H8CA 3W2DA 1WX7A 3DOWA 3M95A 4DXGA 1ENFA 3WIMA 5BMGA 1KF6B 4PYUA 1QOBA 2EMTA 2MJEA 2FCQA 4NJ7A 3P2BA 3WCQA 2KN5A 1K51A 2DYMA 2AQ2B 3VRBB 1XD3B 2KVZA 3LJ3A 1J0GA 4M02A 1Y8RC 3PV1A 4GXBA 3W1SC 2K8CA 2MW5A 3RNBC 3U30A 1C3TA 2KDFB 4KIKB 2KACA 3BVGA 1V1PB 1IUEA 1JRPA 2CU1A 2BKRB 3ZJTA 5G5HA 1CJEA 2WQYB 3D32A 1QKZA 3GOEA 2LXAA 4CQNA 1LO5D 1ZDXA 2D2QA 2DNFA 1E6EB 3ZNHB 2KWVB 3ETRA 1I4GA 3CMMB 5BYSA 2G9HD 3I57A 3DBRI 4KKIA 2HD5B 2PE6B 1XO3A 3C8YA 2IO0B 3ZXVA 2FUG1 2KJHB 4I6PA 2BKFA 2KTRA 2JYTA 1VJKA 2V3SA 5I4DA 1VZ7A 3Q3OC 4BOZB 4EZLA 1E10A 4HLEA 1FFUA 3TEYA 1S1QB 2G3QB 2HDEA 5G2NA 3VAWA 2JPHA 4IWPA 3CIRB 3EHVA 1C4PA 3SD5A 3E9SA 4ANXA 3W1YA 1YD8U 1ZXHA 2ZW1A 1KTKA 1H4RA 2K6QA 5L95C 5GXGB 2INCC 2ZPNA 4MJSB 1L7YA 4RM9A 2KFKB 2HJ8A 4W9KA 1ESFA 3IFWB 4FBJB 3L10B 4IW0A 5FR6A 1L5PA 4EFOA 2IYDB 3V60A 5MPOA 3BY4B 2DYOA 3OLMD 2EELA 3W5VB 1WGHA 3MHZA 3U7ZA 1HQRD 4PS8A 3J9CA 1VZ8A 4PYZA 4MSMB 4YTMB
chains in the Genus database with same CATH topology
2MJDA 1MHHE 3P4PB 1FCLA 2PVOD 1PGXA 1NEKB 1SBBB 3AEBB 1OQQA 3NVWA 4NAMA 3ZQ4A 4OHJA 4RGOS 4A6QA 1L0XB 2PW9A 2Y3AA 3KQ4A 4Q2JA 1FXIA 1SJED 5BYQA 2KN4A 3NUHB 4AS1A 1SJHD 1C4CA 4LK0M 1N62A 2FBWB 1TKEA 5D7GA 4HKQA 1MI0A 2K9XA 1VR9A 4IOIE 2L52A 4MH8A 2JZPA 1RM6C 3GB1A 2J42A 2BT6A 1EU4A 2ON8A 3SEBA 3U2SC 1JWMD 1JALA 5C3JB 2KQ4X 1N63A 1XLQA 1T5XD 3Q8AA 4EE2A 4KX6B 4HRSA 2BB6A 3V3XA 1TY2A 3PO0A 4DQOC 1NYQA 1QOAA 5EE3A 4FXCA 1E7PB 2W54A 2QSDA 1KH0A 2Z8LA 1I4PA 2N7JA 1PFDA 3AE3B 4HROA 3VR9B 1SB3C 1RYJA 2J4XA 1BXTA 1PGBA 3BYYB 1J7AA 2BS3B 2WXFA 4MM3B 4PT5A 1YNTE 2Q5WD 1ZPSA 4WWMA 2WDRB 3AE1B 3W5UB 2LHDA 1ET9A 1QOFA 3TEWA 1CZPA 1D5ZC 2SEBD 4YT0B 1ZDVA 5H92C 2K5PA 1TS4A 4JE3B 3NVVA 3HRDD 2I38A 2JX5A 1MHXA 2RMMA 4KGSA 5HI1A 1Q10A 2AQ1B 1SE3A 2N9KA 3KLSX 1K52A 1FNUA 1GAQB 1SE4A 4N58A 3MC0B 1IBXA 4RFBA 3AN1A 1I4QA 1L6VA 1TS3A 2CU3A 3AE7B 3AE9B 1XLOA 1E0ZA 1JWBD 2JYEA 2PIAA 1JWUD 1DOIA 4IKGA 1NENB 1T3QA 5FK9C 1SEBD 2JQRB 1NYRA 2WDQB 5H8YE 1C77A 4OZBA 1NI3A 2WXQA 1XLNA 2J52A 2PKOA 3KWVA 1WYGA 1P7FA 4NAWB 1OFFA 2WP9B 1F0ZA 1XXGA 1EWYC 3VRAB 3P1MA 3HUIA 3SFEB 3AE2B 2JSVX 3FILA 3HVDA 4A9AA 4ITKA 4TSSA 2BS2B 2WS3B 1XEEA 1FRDA 1VZ6A 3ZYYX 1AW7A 1CK1A 1SSNA 1BMLC 1TZOA 2GB1A 4B0EA 3U4EG 3BK1A 1XLPA 1DYQA 1K50A 5FR3A 1JCKB 4WQMA 4DXFA 4RCOA 3NRZA 1JMLA 1L4ZB 3AEFB 3FC4A 1EM7A 1HZ6A 3AEAB 2LMCA 2IGHA 3R8BA 3BIID 1XF5L 4YWGG 1WGKA 3N9YC 1V97A 3BYTB 1F2RC 2NTSA 2WNMA 1EWCA 2GI9A 1UNSA 1QQRA 1I4HA 3MP9A 1N5XA 4US9A 1IGCA 5G5GA 4TQ0A 3ABVB 5T8IA 2IPKD 4B0MA 1FRRA 3B9JA 4KGTA 1T6BX 2BBCA 1D5XC 4LTUA 4L1BA 4N6EB 3AE5B 3EGRA 2K22A 3Q8FA 2KWDA 1FCCC 2VZKB 2H89B 2TSSA 4JX1C 2CJNA 4OZAA 2W3SA 1UUPA 3U52E 3T3OA 3P4RB 3RFZB 3Q8CA 2EKIA 1IBXB 1N5WA 1VRAB 4OZCA 1GOZA 2M19A 1IGDA 4XDDA 2L83A 1N60A 2MH7A 1ET6A 2X38A 1ZP0B 2RDGA 3AB5A 1JW9D 4R3DA 3AEGB 3MFGA 2W55A 1MVKA 1HA5A 1TYGB 4GDLB 4H2AA 2QMTA 1STEA 2D5GA 2KMMA 2BS4B 4UDUC 3BVMA 1ACCA 1YJJA 3AEEB 1B9RA 3AH7A 3P42A 1OQRA 3L4PA 4RNAA 2ONQA 5BMHA 2K3UA 2ZW0A 1QOGA 3Q69A 2INPE 2CJOA 4XE0A 2W3RA 4USAA 1FIQA 4A90A 4C7YA 5HFYA 4YSYB 3W1SA 2LUMA 3AE6B 3T3NA 3CWIA 2WXMA 4XWWA 3IXSA 3BVZA 5C2TB 1WSPA 3B2GA 2MEKA 1M4VA 1ZOYB 2LGIA 2L32A 1I4XA 4JWUC 1TKYA 3V05A 2NTTA 2V3PA 2WXHA 2LJIA 1HZ5A 2WXOA 3DWGC 1C9FA 2ACZB 2WXPA 4RGNA 5AUIA 1D4BA 1TKGA 1V1OA 4RGTA 1YMHE 5D3IB 4RF0A 2BB5A 3AECB 4RGMA 3NVYA 2QIEB 1BUIC 3BZDB 1P7EA 2GRIA 1ROEA 4TQ1A 1SIJA 2B76B 3GS2A 1L0YB 3NVZA 2Y5CA 4ARCA 4YTNB 2WXRA 1QLBB 2BYTA 1F2RI 5BYRA 1KRHA 1A70A 3ZJUA 4A8XC 3IT6B 1SE2A 1FNWA 2WXLA 2M0AA 2PMVA 1FEHA 4M0WA 4RH6A 1UWMA 5EE1A 2LHEA 2W82A 1WRIA 1FXAA 4A55A 1Y56A 3R2IA 1YN3A 3KWLA 1YQ4B 2WXGA 3UI3A 4P16A 1YN5A 4ARIA 3BK2A 3OWEB 3O13A 3VR8B 1E9MA 4US8A 1VDVA 4YXDB 4ZRQA 2RPVA 1JROA 3BWUD 2IGGA 4L2YA 4HJGE 4YTPB 3H8HA 5TSSA 1C79A 4MT5A 3PZ7A 1ZE3D 3URYA 2V4IB 3EA6A 4OVZA 4HEA1 2DWQA 1TY0A 1VLBA 1TJEA 2ICIA 4GLSC 2YEPF 4REZA 1YN4A 2AQ3B 1J7CA 1MPEA 4HKZE 1AYFA 1C4AA 2R61A 1PUTA 3EUB2 3P4SB 5HG2A 1C76A 1F77A 2H88B 5HHDG 4ZHOA 4NZLB 1UGJA 1FFVA 1I4RA 2NMQA 2QEJC 3I9V1 3LYYA 1TS2A 1B1ZA 1I7HA 1XCTL 2E3TA 1QT9A 2SAKA 2V3NA 3W2DA 2PTLA 2N9LA 1N61A 1HEZE 3IAM1 1FO4A 1QILA 1GB1A 1KFYB 4P6VF 1AN8A 2FE8A 2PVGC 4NJCA 1ENFA 4DXGA 5BMGA 1KF6B 1QOBA 2MJEA 4L23A 1C78A 4ZRPA 1AWDA 1PDXA 4XWTA 2G1EA 2VZKD 2IGDA 3WCQA 4JPSA 5LNK1 2DBYA 1R7SA 1K51A 4WIPA 2DYMA 2AQ2B 4C7ZA 1D5MC 3VRBB 1TS5A 2LFIA 3B2FA 3MJ5A 4ZHPA 2MJ3A 1XCQL 3PZ8A 3TEXA 2WU2B 5JXVA 1YQ3B 2E6XA 2KAJA 5BMIA 2I2YA 2Y5PA 2BTEA 1V1PA 1CQVA 3W9CB 3IAS1 1WWTA 2KACA 3BVGA 3FILB 3GP7A 1V1PB 1RFKA 3AEDB 1IUEA 1FMAD 1JRPA 5EE0A 2OEDA 3Q8EA 4AQ7A 1JWAD 3ZJTA 5G5HA 1CJEA 2WQYB 2IJ0A 1QKZA 1D6EC 2DLBA 4CQNA 4WURA 4WH4A 1PGAA 5FKAC 1KLUD 1LO5D 1ZDXA 3LB8C 1UWXA 2N0SB 1E6EB 1YJIA 1FD6A 2AX5A 2IDYA 3LXFA 3ETRA 1I4GA 3NZ3A 3NS1A 5BYSA 2WDVB 3AMZA 3Q8BA 2G9HD 3E56A 4GDKB 4KKJA 2QILA 3I57A 4N59A 3SFDB 3DWMA 4KKIA 2BW2A 1DOXA 2JWUA 1PYWD 4OW0A 3TSSA 1WXQA 2JXTA 4RF1A 4O1NA 2WXIA 2JU6X 3AE4B 1XO3A 3C8YA 5AUKA 1JWSD 2FUG1 3AM9A 2INNE 3SR6A 2JYTA 5D3DA 1VJKA 3HVZA 1V8CA 4C56C 5I4DA 1QF6A 1VZ7A 1E10A 1SXTA 1DGJA 2WXJA 4ZYSA 2WXNA 1FFUA 2K0PA 1K53A 2LEKA 4D2KA 3TEYA 4IDIA 2YEPB 4JWSC 4KGRA 2HDEA 1DOYA 1J7BA 4YSZB 1GB4A 2L1AA 2M56B 3TEZA 1L4DB 4LLGM 1HXYD 3CIRB 1JQ4A 1FM0D 1C4PA 3ZJVA 2QJLA 3E9SA 5E6JA 1ZXHA 2ZW1A 5EE9A 1KTKA 1ZUD2 1L6UA 5GXGB 1RWSA 1EU3A 3VQIA 2PLPA 2XN9C 4C80A 3P63A 3P4QB 4XDCA 3TUOA 1ESFA 3R2TA 1ZXIA 2OHFA 2RDHA 4WAFA 4YSXB 3ZGZA 1SF0A 2WU5B 2HTME 1L5PA 4ZOHC 4MACA 1KLGD 2XNAC 3AE8B 2J53A 2WXKA 3IT4B 5MPOA 2V0GA 2DYOA 3AV8A 2EELA 3W5VB 2KDMA 1L0VB 3MHZA 3U7ZA 1FNVA 1HQRD 3FAHA 3RPFC 3J9CA 4J3OD 1GPXA 1VZ8A 2WLBA 4YTMB 1NVID 4TMAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHH E;  1K50 A;  1FCL A;  1PGX A;  1P7E A;  1JML A;  1EM7 A;  1HZ6 A;  1F2R I;  2KAC A;  3FIL B;  2IGH A;  2PW9 A;  1XF5 L;  2KN4 A;  2OED A;  1F2R C;  2GI9 A;  1QKZ A;  2LHE A;  1MI0 A;  4IOI E;  4WH4 A;  1PGA A;  2JZP A;  1UWX A;  3GB1 A;  3MP9 A;  3UI3 A;  1IGC A;  2ON8 A;  1FD6 A;  4KGT A;  2KQ4 X;  2RPV A;  2IGG A;  4HJG E;  2KWD A;  1FCC C;  2JWU A;  4OZA A;  3V3X A;  2JXT A;  2JU6 X;  2QSD A;  1KH0 A;  1IBX B;  4GLS C;  4OZC A;  2N7J A;  1IGD A;  1MPE A;  4HKZ E;  1PGB A;  2K0P A;  1K53 A;  5HG2 A;  4D2K A;  1YNT E;  5HHD G;  4KGR A;  1GB4 A;  1MVK A;  2LHD A;  2QMT A;  2NMQ A;  2I38 A;  1XCT L;  1MHX A;  2RMM A;  4KGS A;  5HI1 A;  2PTL A;  1Q10 A;  2N9K A;  2N9L A;  1ZXH A;  2ONQ A;  2ZW1 A;  1K52 A;  1HEZ E;  5BMH A;  2ZW0 A;  1GB1 A;  1IBX A;  2PLP A;  5BMG A;  5HFY A;  2LUM A;  2IGD A;  4IKG A;  1K51 A;  4OZB A;  2LGI A;  2J52 A;  4MAC A;  2J53 A;  1P7F A;  1HZ5 A;  2EEL A;  1C9F A;  1XCQ L;  2KDM A;  2JSV X;  3FIL A;  1D4B A;  5JXV A;  1YMH E;  2GB1 A;  5BMI A;  2I2Y A; 
#chains in the Genus database with same CATH topology
 1MHH E;  1FCL A;  4OVU A;  3ZQ4 A;  4OHJ A;  4RGO S;  2WX1 A;  2KQS A;  1VCB A;  1L0X B;  3K9O B;  2CHZ A;  2KN4 A;  4AS1 A;  2I1J A;  1J8C A;  2A5U A;  3MTN B;  3DVN V;  1OQY A;  3ZRC A;  1RM6 C;  2J42 A;  3IBE A;  3ZRF A;  1JAL A;  2WWZ A;  1E8X A;  3DVN U;  3ECI A;  4ZYN A;  2BYE A;  4A3P A;  3PO0 A;  1UBI A;  4DDI D;  3APC A;  1V9J A;  4HCP B;  3NG0 A;  1I4P A;  3TJP A;  3TL5 A;  2BYF A;  3QHT A;  2J4X A;  3DBL I;  1BXT A;  2DZJ A;  2PEA A;  5DPR A;  2RGF A;  1ZPS A;  3ZNZ B;  3NHE B;  3U8Z A;  3AE1 B;  1ET9 A;  2XK5 A;  1CZP A;  1D5Z C;  3OG5 A;  2K5P A;  3NVV A;  3I5J C;  1YQB A;  2RMM A;  5HI1 A;  3KLS X;  2AQ1 B;  1SE3 A;  4E3C A;  3VUX A;  4PK1 A;  4N58 A;  3PRM B;  5D6J B;  2KOX A;  1DOI A;  2I1K A;  1WZ0 A;  1NYR A;  2WDQ B;  2J52 A;  2PKO A;  2WP9 B;  3FKY A;  3HVD A;  1XEE A;  1VZ6 A;  2GB1 A;  2DX5 B;  4BBN C;  4RCO A;  1JML A;  1L4Z B;  3FC4 A;  1EM7 A;  4HCN B;  2IGH A;  4MEM A;  3BII D;  3ZIM A;  3KVF B;  4K3C A;  4WQO B;  2OJR A;  2MBB B;  4FHK A;  3MJW A;  2MRP A;  4LNI A;  2KDE B;  2VRR B;  3MP9 A;  5G5G A;  1E7U A;  2QC8 A;  4B0M A;  1FRR A;  3B9J A;  4KGT A;  3N20 C;  4ZDV A;  4HPP A;  1GC6 A;  3PHX B;  4W9F A;  1TTN A;  2KWD A;  4GB9 A;  2TSS A;  3ZNI D;  1XQQ A;  1IBX B;  2IO2 B;  1WGG A;  2KZR A;  1CMX B;  2FUH B;  2RDG A;  3MFG A;  2RR9 A;  4GDL B;  4F8C B;  1STE A;  2D5G A;  4UDU C;  3X0W A;  3DHH C;  1B9R A;  1E90 A;  4ZRI A;  2J0M A;  1V6E A;  3Q69 A;  2INP E;  4XE0 A;  2JXX A;  2RSU A;  4A3O A;  3R3M A;  2D07 B;  2LUM A;  1P0R A;  4WJQ A;  1M4V A;  3VXW A;  3PS6 A;  1UH6 A;  3CF6 E;  5E6P A;  2V3P A;  3DWG C;  1F52 A;  2MP2 A;  4RGN A;  5AUI A;  2L00 B;  4GMV A;  3VTW A;  2NVU I;  1YMH E;  1GG3 A;  2MX2 A;  2CHX A;  2BB5 A;  1P9D U;  2GRI A;  1ROE A;  2KJ6 A;  2NR2 A;  3HM6 X;  4FHJ A;  3GS2 A;  1L0Y B;  4ARC A;  4YTN B;  2WXR A;  1QLB B;  4KV2 A;  1Q1O A;  2L76 A;  1SE2 A;  2KKC A;  4M0W A;  1FEH A;  1TIF A;  4IG7 B;  2HTH A;  4PS3 A;  2UWQ A;  4KSK C;  1YQ4 B;  3BK2 A;  3QC8 B;  1WXA A;  3M3J A;  1VDV A;  1UZX B;  4YXD B;  2LVP A;  4II2 B;  1JRO A;  4NAW A;  1C79 A;  4MT5 A;  1E7V A;  1ZE3 D;  2KO3 A;  1TY0 A;  4GLS C;  4DBG A;  3GE8 C;  2KWU B;  1LM8 B;  4P7I A;  1SIF A;  1C76 A;  4G0N B;  5HHD G;  3RUI B;  1UGJ A;  4XYC A;  2K39 A;  3LYY A;  5AZG A;  4GOC A;  2KJR A;  1B1Z A;  2E3T A;  2PTL A;  1QIL A;  3OJ4 B;  1GB1 A;  1KFY B;  1J19 A;  3DBH I;  2Z59 B;  2LVQ A;  1AN8 A;  4NJC A;  4L23 A;  3APD A;  3T8M A;  2AL3 A;  4XWT A;  3QQ8 B;  3N1Y C;  5LNK 1;  2DBY A;  2C7H A;  1NI2 A;  1D5M C;  3QX1 A;  1SE9 A;  3A9K B;  1XCQ L;  2GBM A;  2JT4 B;  4G11 A;  2E6X A;  5BMI A;  3MC8 A;  2BTE A;  4IM0 A;  1CQV A;  3W9C B;  2G4D B;  4NQK E;  1WI0 A;  1MJD A;  3H9D A;  3FIL B;  2KLG A;  2JZ3 B;  1RFK A;  3Q8E A;  4AQ7 A;  2BWE S;  2IJ0 A;  2C9W B;  1D6E C;  2DLB A;  3ZVV A;  4WUR A;  4WH4 A;  4K7U A;  4KZ0 A;  4HDO A;  1KLU D;  5FKA C;  2RD0 A;  3LB8 C;  1UWX A;  3IVF A;  3OJ3 A;  2MSE D;  3RNG C;  5JHA A;  2IDY A;  3LXF A;  2KDB A;  4FA6 A;  3NZ3 A;  4GU2 A;  3Q8B A;  3SFD B;  2KDI A;  3PSE B;  4JGH B;  2D3G A;  3HK0 A;  2D3A A;  4BAX A;  3AM9 A;  2LVO A;  1WXS A;  2INN E;  3HVZ A;  1V8C A;  4C56 C;  4M8M A;  2GBK A;  2WXJ A;  2JRH A;  4FAD A;  4LNF A;  2PPH A;  3PTF C;  3L13 A;  2ZNV C;  1DOY A;  1Z2M A;  1UD7 A;  1HXY D;  1WGR A;  3KW5 B;  2GBJ A;  1JQ4 A;  1G6J A;  2LJ5 A;  1WX8 A;  2C5L C;  1L6U A;  1WJ6 A;  1RWS A;  2KHW B;  3VQI A;  4M8N A;  3P4Q B;  4EZK A;  5C23 A;  2ZNV B;  1ZXI A;  3SU8 X;  4WAF A;  4YSX B;  2WU5 B;  2LGD A;  3ONS A;  3A1Q A;  4MAC A;  4S17 A;  3H7P B;  4ZOH C;  2XNA C;  3AE8 B;  2J53 A;  2WXK A;  3IT4 B;  2V0G A;  5JH5 C;  1T0R C;  5GMV A;  3PLU A;  1V81 A;  4KDI C;  3PPA A;  1FNV A;  3N30 A;  4J3O D;  3DPD A;  3ZLZ A;  2MHJ A;  1WR6 E;  3P4P B;  1SBB B;  3AEB B;  1E8Z A;  4NAM A;  4A6Q A;  3M62 B;  1P98 A;  3KQ4 A;  4Q2J A;  4BKS A;  1FXI A;  1SJH D;  1C4C A;  1N62 A;  4HKQ A;  3VTV A;  1MI0 A;  1VR9 A;  2D11 A;  2M4N A;  5D94 A;  2KYW A;  2JZP A;  2JZZ A;  3QJZ A;  3QAQ A;  1EU4 A;  1N63 A;  3ZTC A;  3KYC D;  1FPY A;  3Q8A A;  4DQO C;  1NYQ A;  1NBF C;  2LRU A;  3ZXR A;  4BZA A;  2DHZ A;  3RI7 C;  2W54 A;  2QSD A;  1KH0 A;  1WE7 A;  2LWP A;  1UEL A;  1LXD A;  3PT2 B;  2N7J A;  2KQ7 A;  4AUQ C;  3VR9 B;  2LZ6 A;  3VFK A;  1PGB A;  5DCN A;  3BYY B;  1J7A A;  4MM3 B;  3B0A A;  4PT5 A;  4IC7 B;  3W5U B;  2LHD A;  3KH0 A;  1QOF A;  4MGK E;  2L0F A;  4MGZ E;  5H92 C;  2WDT B;  1TS4 A;  2PE9 A;  5CTR C;  2KK8 A;  4K7W A;  4N9F 4;  3RZF A;  1SE4 A;  2BQQ A;  4JLC A;  1UF0 A;  3RZW C;  4RFB A;  1E5W A;  3AN1 A;  1I4Q A;  3AE7 B;  1MG4 A;  2NBV B;  3AE9 B;  1XLO A;  1E0Z A;  2JYE A;  5EDS A;  3PRP B;  1T3Q A;  5FK9 C;  2M1M A;  1SEB D;  5CHF A;  2JQR B;  3LDZ E;  5H8Y E;  1C77 A;  4OZB A;  1K8R B;  3KWV A;  3RNE C;  1NDD A;  4LDT D;  3WAM A;  1WRD B;  1F0Z A;  1EWY C;  3HUI A;  4NJ6 A;  4TSS A;  2WS3 B;  4MGI E;  5IP4 D;  1WE6 A;  5J17 A;  2KFK A;  1TZO A;  3U4E G;  3BK1 A;  5FR3 A;  3C19 A;  2IBI B;  4WQM A;  3UIP B;  3V61 A;  4DHJ D;  1WY8 A;  3AEA B;  3N1X C;  3R8B A;  1XF5 L;  1WGK A;  3VVW B;  3BYT B;  1F2R C;  2WNM A;  4P1B C;  1EWC A;  2N9P C;  4K7S A;  1UNS A;  1L2N A;  3JSV B;  4WAA A;  3WAO A;  1EF1 A;  3C0R B;  1GC7 A;  4NNJ B;  4BKG A;  1IYF A;  3B1L X;  4L1B A;  1WF9 A;  3EGR A;  3Q8F A;  2ZCC A;  2CJN A;  3AU4 A;  3CSF A;  3U52 E;  1X1M A;  3P4R B;  1EO6 A;  3RFZ B;  3Q8C A;  1WMH B;  3N32 A;  2LAS A;  1WXV A;  1GOZ A;  2M19 A;  3JSV A;  3H1U A;  1N60 A;  2X38 A;  1ZP0 B;  3AB5 A;  2KD0 A;  3AEG B;  3PRE A;  4H2A A;  3PZD A;  2LGY A;  2QMT A;  1T0Q C;  4BFR A;  4KZC A;  3BVM A;  4BOS C;  2WYQ A;  4F1S A;  3AH7 A;  3P42 A;  4GSW A;  3L4P A;  3WAN A;  2K3U A;  1QOG A;  1BT0 A;  5IA7 A;  4C7Y A;  4YSY B;  3W1S A;  3AE6 B;  3QIJ A;  2KC2 A;  3VHT C;  3Q3N C;  3IXS A;  1WGY A;  1WSP A;  3B2G A;  2MEK A;  1I4X A;  4JWU C;  4E71 A;  1JRU A;  3V05 A;  3PHW B;  5C1Z A;  2WXP A;  2FNJ B;  2BWF A;  1P1A A;  4RGT A;  3S2A A;  2DYB A;  4KVG B;  2MQJ A;  2AEH A;  2C60 A;  2IO3 B;  3NVZ A;  3PLV A;  1WX9 A;  1HTO A;  2C7N B;  1PQS A;  3ZJU A;  3IT6 B;  2CHW A;  5AZF A;  2M0A A;  2WGS A;  1UWM A;  2LHE A;  2W82 A;  2IND C;  1WRI A;  2KC1 A;  5CX3 A;  3A9K A;  4A55 A;  1Y56 A;  1YOV B;  2WXG A;  3APF A;  4P16 A;  3UI3 A;  3OWE B;  2IZV B;  4XZ4 A;  3NZU A;  4URK A;  4MJS A;  1S3S G;  2RPV A;  3BWU D;  5JHB A;  4HJG E;  2LUE A;  2V4L A;  3EFC A;  5BO4 B;  4ZRJ A;  4OVZ A;  4GN1 A;  2LD9 A;  1E8W A;  4AJY B;  2O2V B;  3QCA A;  4WJN A;  4HXD A;  2MA9 B;  4HKZ E;  1KOT A;  1C4A A;  2N7E A;  3EUB 2;  3P4S B;  4FJZ A;  4ZHO A;  4I6N B;  2BVC A;  2YVC A;  3AUL A;  2WHI A;  2JVC A;  3VDZ A;  2G4S A;  3I9V 1;  2YLM A;  2LXC A;  1I7H A;  1QT9 A;  3Q14 C;  4X57 B;  4ICV A;  2V3N A;  2N9L A;  1WJU A;  1N61 A;  1HEZ E;  2K1F A;  2GBR A;  2OJW A;  2PVG C;  4WJP A;  1RLF A;  1C78 A;  4ZRP A;  1AWD A;  1PDX A;  2G1E A;  4ASW C;  3QAR A;  4NPN A;  2NBW B;  4JPS A;  1V5O A;  3UGB B;  2DZM A;  2ZVN A;  4LJP B;  3MJ5 A;  4AOF A;  2MJ3 A;  4HJK A;  4RM8 A;  3PZ8 A;  4WWP A;  4HDQ A;  2WU2 B;  2BYV E;  4LDT B;  3ZDM C;  1U4A A;  3KUC B;  3A9J B;  2KAJ A;  2I2Y A;  2MBO A;  2KX3 A;  1V1P A;  2LGX A;  5KHO A;  3AXC A;  3IAS 1;  1WWT A;  1OEY J;  3T9L A;  2KLC A;  4IM2 A;  2OED A;  1JWA D;  2MP2 B;  4ANV A;  4QAY A;  1IPG A;  1R4N B;  4YL8 A;  2X8X X;  3PGE A;  2N0S B;  4M0W B;  4W9E A;  4DDG D;  2BGF A;  4FUL A;  1FD6 A;  2AX5 A;  1C1Y B;  3NS1 A;  4HVB A;  3AMZ A;  3E56 A;  4N59 A;  3DWM A;  2N1W A;  3NJT A;  5J2R A;  1PYW D;  3TSS A;  1WXQ A;  4RF1 A;  2JXT A;  4O1N A;  2JU6 X;  4J6I A;  3AE4 B;  5AUK A;  1KLV A;  3Q6B A;  4KDL B;  3RNF C;  5D3D A;  3TIX A;  1QF6 A;  1SXT A;  4K1R B;  1DGJ A;  4ZYS A;  2WXN A;  2K0P A;  2LEK A;  4D2K A;  1WM3 A;  2FAZ A;  4IDI A;  4KGR A;  5L83 A;  1J7B A;  2L1A A;  3UIO B;  2M56 B;  3TEZ A;  4LLG M;  4DHJ B;  4ICU A;  4IWQ A;  2KMA A;  3ZJV A;  5E6J A;  5EE9 A;  1ZUD 2;  2FCM A;  3I63 C;  2PLP A;  1YIW A;  5CHW A;  2UU7 A;  4XDC A;  4GDL A;  3CST A;  3TUO A;  4MM3 A;  1SF0 A;  1V5T A;  2R2Q A;  2W9N A;  4AJW A;  1L0V B;  3QK0 A;  3EFU A;  2KVR A;  1GPX A;  2VH2 A;  1NVI D;  2MJD A;  4MSQ B;  3NVW A;  3X23 A;  2M17 A;  3DVG X;  3VUW A;  4EEW A;  5LXI B;  1UGM A;  1LFD A;  2K25 A;  5BYQ A;  1I35 A;  5D7G A;  3H7P A;  4IOI E;  2L52 A;  4NQL B;  1MG8 A;  3GB1 A;  1WJ4 A;  2ON8 A;  3RNA C;  3JW0 X;  4K3B A;  1WH3 A;  1D3Z A;  2KQ4 X;  3PRZ A;  4DWF A;  1WR1 A;  1WIA A;  4EE2 A;  4HRS A;  1HE8 A;  2BB6 A;  1QZE A;  3V3X A;  2OOB B;  1WYW B;  3VH3 B;  2ZJD A;  3ML9 A;  5IO9 A;  5EE3 A;  4FXC A;  1E7P B;  1VD2 A;  2Z8L A;  3AE3 B;  4HRO A;  1SB3 C;  2CS4 A;  1N6Z A;  2JF5 A;  2WXF A;  3GZN B;  1YNT E;  1R4N I;  2Q5W D;  4DXA B;  4W9D A;  4YT0 B;  3DQV A;  5LXH A;  2KFJ A;  1ZKH A;  3GZN I;  2IY1 B;  2JX5 A;  4HPL B;  2UYZ B;  1Q10 A;  2N9K A;  4EOY A;  4C4V A;  2PJH A;  1K52 A;  1FNU A;  1GAQ B;  3MC0 B;  2C7M B;  1IBX A;  4ACF A;  5AEK B;  1L6V A;  3WA0 A;  4LNO A;  4WJO A;  1JWB D;  4CHK A;  1F1H A;  4IKG A;  3RUL A;  2KNB A;  1NI3 A;  2WXQ A;  4EKU A;  1WYG A;  3OAW A;  1OFF A;  1XXG A;  3VRA B;  3FIL A;  3ML8 A;  4A9A A;  1OGW A;  1FRD A;  3ZYY X;  4HWI B;  1CK1 A;  1XLP A;  1DYQ A;  2EMS A;  1JCK B;  4DXF A;  3WAP A;  2N4F A;  1HZ6 A;  2VH1 A;  4F7Z A;  4YWG G;  1V97 A;  2L7R A;  2NTS A;  4W9G A;  4MDK E;  3UIN B;  2GI9 A;  4W9C A;  2G45 B;  4EUT A;  2IO1 B;  4US9 A;  1IGC A;  4BKT A;  2IY0 B;  3ABV B;  5T8I A;  1T6B X;  2BBC A;  1V2Y A;  4S0R A;  1D5X C;  4N6E B;  4TUU A;  2KAN A;  2H89 B;  4OZA A;  2KWC A;  4EZJ A;  3M63 B;  1UUP A;  1FXT B;  2EKI A;  3TCA A;  1N5W A;  1I42 A;  4OZC A;  3KUZ A;  4BVU C;  4XDD A;  2L83 A;  1Q0W B;  3RNC C;  1ET6 A;  2MH7 A;  3L16 A;  2N9X A;  1XT9 B;  3IG3 A;  2XEW A;  4R3D A;  1TT5 B;  1HTQ A;  1HA5 A;  2HE7 A;  2BS4 B;  1ACC A;  3KYD D;  2D10 A;  2FCS A;  1RFA A;  3V62 A;  2DZK A;  3TBL D;  5TR5 A;  2CJO A;  2W3R A;  4USA A;  2L05 A;  3T3N A;  2NCN A;  1TBE A;  1WM2 A;  2KX0 A;  2L0T A;  3Q3J A;  3BVZ A;  4CO7 A;  3SHQ A;  2L32 A;  2O6V D;  2NTT A;  2LJI A;  1HZ5 A;  2WXO A;  4MEL A;  2Y5B B;  4FJY A;  3L08 A;  3A9J A;  1V1O A;  3N1Z C;  3A33 B;  1M94 A;  1TGZ B;  3AEC B;  3NVY A;  4P1C C;  1BUI C;  3BZD B;  2LI5 A;  1P7E A;  4GGQ A;  2Y5C A;  1F2R I;  5BYR A;  1KRH A;  4A8X C;  1WMH A;  2PMV A;  3QA8 A;  4RH6 A;  1P3Q U;  2XK5 B;  3H6N A;  3R2I A;  3KWL A;  3A4R A;  4ARI A;  2MLB A;  3K9P B;  3VR8 B;  1E9M A;  3HIZ A;  4US8 A;  2KTF A;  4ZRQ A;  5IOI A;  4YTP B;  2LGS A;  3AU5 A;  5TSS A;  3ZKJ C;  4FJV B;  1GNU A;  1GJZ A;  3URY A;  3H7S A;  2JY6 A;  4HEA 1;  4PS7 A;  2DWQ A;  2ICI A;  2JWZ A;  2K8B A;  1YN4 A;  2AQ3 B;  1AYF A;  4W9J A;  2R61 A;  1PUT A;  1F77 A;  3BIN A;  2H88 B;  1YX5 B;  2AYO B;  4I6L B;  1FFV A;  2M8S A;  2NMQ A;  2QEJ C;  3B08 A;  3DBL B;  3L0W B;  5CHV C;  1TS2 A;  4LNN A;  1XCT L;  2QHO A;  3IAM 1;  1FO4 A;  2CR5 A;  2J0J A;  3V6E B;  4E74 A;  1RAX A;  2KTR B;  4P6V F;  2FE8 A;  1SGH A;  4LNK A;  5G55 A;  4BKS D;  2O2V A;  2VZK D;  2IGD A;  1R7S A;  1UBQ A;  4WIP A;  4C7Z A;  1TS5 A;  4WWO A;  2N1V A;  2LFI A;  3B2F A;  4ZHP A;  2QCZ A;  3TEX A;  2L3Z A;  4AP4 C;  5JXV A;  1ISN A;  1YQ3 B;  3DVG Y;  2ZVO A;  2QDF A;  2Y5P A;  2GOW A;  3HHM A;  3DHG C;  3GP7 A;  2V9H A;  3AED B;  5D2M B;  1FMA D;  5EE0 A;  5JZE B;  2HJ1 A;  1PGA A;  3A1Q B;  4G3X B;  1V86 A;  2GBN A;  2BPS A;  1YJI A;  1GUA B;  2N7D A;  2WDV B;  4KKJ A;  4GDK B;  2M0X A;  2QIL A;  2BW2 A;  2A4Z A;  2JRI B;  1DOX A;  2JWU A;  4OW0 A;  1LQB A;  3DBH B;  4JIO U;  5J18 A;  4KIK A;  2WXI A;  2AWT A;  1JWS D;  3L54 A;  3QWZ B;  2MBE A;  3SR6 A;  4XC2 A;  2RPQ A;  3R66 C;  1K53 A;  3Q3M C;  2YEP B;  2B3A A;  4JWS C;  2J7Q B;  4JQW C;  4YSZ B;  1GB4 A;  3N3K B;  3RD2 A;  5IN7 A;  1L4D B;  2KMC A;  2BF8 B;  1FM0 D;  1E8Y A;  3JVZ X;  3ZUN A;  2QJL A;  2DEN B;  4HK2 A;  4DHZ B;  1EU3 A;  2N9E B;  2XN9 C;  4C80 A;  3P63 A;  2KT7 A;  5DPT A;  4IWO A;  3R2T A;  2OHF A;  2RDH A;  3ZGZ A;  3R7R A;  3TMP B;  2HTM E;  2MBH A;  4JL9 A;  4RMA A;  3DBS A;  5LLI A;  1KLG D;  2ZZP B;  3AV8 A;  2KDM A;  4IUM B;  4II3 B;  3FAH A;  3RPF C;  3NY5 A;  3Q3F A;  3UQA A;  2WLB A;  4KSL C;  4TMA B;  2L8J A;  2PVO D;  1PGX A;  1NEK B;  3ZW3 A;  4WWN A;  1OQQ A;  2KXJ A;  2Y3A A;  2PW9 A;  3PVL A;  4ANW A;  1SJE D;  4GDK A;  3NUH B;  4LK0 M;  2FBW B;  1TKE A;  1KJT A;  2K9X A;  1KM7 A;  4MH8 A;  1R4M B;  2XBB C;  2BT6 A;  3SEB A;  3U2S C;  1JWM D;  1TZ1 A;  5C3J B;  3DDC B;  1AAR A;  2ZCB A;  4W9L A;  1XLQ A;  1T5X D;  3O65 B;  4K81 A;  4KX6 B;  4ANU A;  1TY2 A;  1T0S C;  2D3B A;  4LJO B;  3VUY A;  3GE3 C;  4ZRK A;  1QOA A;  2JUO A;  5IKC M;  1PFD A;  1WJN A;  3AI5 A;  1RYJ A;  4A20 A;  4GIV A;  3RN9 C;  2BS3 B;  1EUV B;  3RMK C;  2NPT A;  4WWM A;  4MH0 E;  5KHQ A;  2WDR B;  3MHS D;  2FID A;  3TEW A;  2SEB D;  1ZDV A;  3JYU A;  4JE3 B;  3HRD D;  2I38 A;  1MHX A;  4KGS A;  2LRW A;  3EEC A;  1ZGU B;  1TS3 A;  2CU3 A;  3RCZ A;  2WX0 A;  4FLH A;  2PIA A;  1JWU D;  2FIF A;  1NEN B;  2NPT B;  1YX6 B;  1XLN A;  3RYT A;  1ZW7 A;  4TKN A;  1P7F A;  4NAW B;  2DAJ A;  2DAF A;  4B9K A;  3P1M A;  3SFE B;  2GMI C;  3AE2 B;  2JSV X;  4XGA B;  4ITK A;  2BS2 B;  2K6D B;  1AW7 A;  1SSN A;  1BML C;  4B0E A;  2FCN A;  1K50 A;  1LGR A;  2DZI A;  3NS8 A;  3SDL C;  4TV3 A;  3NRZ A;  3AEF B;  2LMC A;  3N9Y C;  4C00 A;  1YJ1 A;  1F9J A;  3VH4 B;  3ENE A;  3NZS A;  1QQR A;  1I4H A;  3ZO5 B;  1N5X A;  4TQ0 A;  1RRB A;  2IPK D;  2NBU A;  4MGY E;  5E6N A;  4LTU A;  3HM3 A;  3AE5 B;  2K22 A;  1OEY A;  4JX1 C;  3L17 A;  1FCC C;  2AL6 A;  2VZK B;  1Q5W B;  4C4V B;  2W3S A;  1A5R A;  4CYE A;  3T3O A;  1WZ3 A;  1WFY A;  5AZH A;  2GLS A;  2CKH B;  1V80 A;  1VRA B;  4AWJ A;  1IGD A;  3DHI C;  1EF5 A;  4FN2 A;  4IM3 A;  5DPW A;  2MBQ A;  1IP9 A;  1JW9 D;  1WXM A;  4W9I A;  2W55 A;  1MVK A;  1TYG B;  1R4M I;  2KMM A;  4G50 A;  3AEE B;  1YJJ A;  2Z0E B;  3ALB A;  3RT3 B;  2ZEQ A;  4M00 A;  2REX A;  1OQR A;  4RNA A;  2ONQ A;  2MCN B;  5BMH A;  2ZW0 A;  4NY0 A;  2O6V A;  1FIQ A;  4A90 A;  1Z5S B;  5HFY A;  2Z0D B;  2V1Y A;  2RDB C;  3CWI A;  1WGD A;  2WXM A;  4XWW A;  5C2T B;  2NS5 A;  4B95 A;  1ZOY B;  3MC9 A;  2LGI A;  2ZPY A;  2ASQ A;  1TKY A;  2WXH A;  1C9F A;  2ACZ B;  2J0K A;  4BBN F;  3DBR B;  1D4B A;  1TKG A;  3Q2A C;  5D3I B;  4B6W A;  4RF0 A;  1T0Y A;  4RGM A;  3VTU A;  2QIE B;  4TQ1 A;  1SIJ A;  2B76 B;  3IHP C;  3DCG A;  2K8H A;  3NOB A;  4W9H A;  2BYT A;  1A70 A;  2R2O A;  3KUD B;  1FNW A;  2WXL A;  4XX5 A;  3ZNG C;  3V6C B;  5EE1 A;  4HPM B;  1FXA A;  4DK5 A;  5IAA C;  2MWS B;  3ZTD A;  1YN3 A;  3UQB A;  1YN5 A;  4LCD E;  3O13 A;  5DPS A;  3ZDT A;  2IGG A;  4L2Y A;  1V49 A;  3H8H A;  3R7Q A;  3PZ7 A;  2V4I B;  3EA6 A;  3A4S C;  1VLB A;  1TJE A;  3I3T B;  2YEP F;  4REZ A;  1MFW A;  3WAL A;  2EKE C;  5HKH A;  1J7C A;  1MPE A;  5HG2 A;  2D3C A;  5E6O A;  4NZL B;  3UF8 A;  3EC8 A;  2O6V B;  1I4R A;  1OTR B;  4OVV A;  4DHZ E;  4M01 A;  2SAK A;  3U7D A;  1H8C A;  3W2D A;  1WX7 A;  3DOW A;  3M95 A;  4DXG A;  1ENF A;  3WIM A;  5BMG A;  1KF6 B;  4PYU A;  1QOB A;  2EMT A;  2MJE A;  2FCQ A;  4NJ7 A;  3P2B A;  3WCQ A;  2KN5 A;  1K51 A;  2DYM A;  2AQ2 B;  3VRB B;  1XD3 B;  2KVZ A;  3LJ3 A;  1J0G A;  4M02 A;  1Y8R C;  3PV1 A;  4GXB A;  3W1S C;  2K8C A;  2MW5 A;  3RNB C;  3U30 A;  1C3T A;  2KDF B;  4KIK B;  2KAC A;  3BVG A;  1V1P B;  1IUE A;  1JRP A;  2CU1 A;  2BKR B;  3ZJT A;  5G5H A;  1CJE A;  2WQY B;  3D32 A;  1QKZ A;  3GOE A;  2LXA A;  4CQN A;  1LO5 D;  1ZDX A;  2D2Q A;  2DNF A;  1E6E B;  3ZNH B;  2KWV B;  3ETR A;  1I4G A;  3CMM B;  5BYS A;  2G9H D;  3I57 A;  3DBR I;  4KKI A;  2HD5 B;  2PE6 B;  1XO3 A;  3C8Y A;  2IO0 B;  3ZXV A;  2FUG 1;  2KJH B;  4I6P A;  2BKF A;  2KTR A;  2JYT A;  1VJK A;  2V3S A;  5I4D A;  1VZ7 A;  3Q3O C;  4BOZ B;  4EZL A;  1E10 A;  4HLE A;  1FFU A;  3TEY A;  1S1Q B;  2G3Q B;  2HDE A;  5G2N A;  3VAW A;  2JPH A;  4IWP A;  3CIR B;  3EHV A;  1C4P A;  3SD5 A;  3E9S A;  4ANX A;  3W1Y A;  1YD8 U;  1ZXH A;  2ZW1 A;  1KTK A;  1H4R A;  2K6Q A;  5L95 C;  5GXG B;  2INC C;  2ZPN A;  4MJS B;  1L7Y A;  4RM9 A;  2KFK B;  2HJ8 A;  4W9K A;  1ESF A;  3IFW B;  4FBJ B;  3L10 B;  4IW0 A;  5FR6 A;  1L5P A;  4EFO A;  2IYD B;  3V60 A;  5MPO A;  3BY4 B;  2DYO A;  3OLM D;  2EEL A;  3W5V B;  1WGH A;  3MHZ A;  3U7Z A;  1HQR D;  4PS8 A;  3J9C A;  1VZ8 A;  4PYZ A;  4MSM B;  4YTM B; 
#chains in the Genus database with same CATH homology
 2MJD A;  1MHH E;  3P4P B;  1FCL A;  2PVO D;  1PGX A;  1NEK B;  1SBB B;  3AEB B;  1OQQ A;  3NVW A;  4NAM A;  3ZQ4 A;  4OHJ A;  4RGO S;  4A6Q A;  1L0X B;  2PW9 A;  2Y3A A;  3KQ4 A;  4Q2J A;  1FXI A;  1SJE D;  5BYQ A;  2KN4 A;  3NUH B;  4AS1 A;  1SJH D;  1C4C A;  4LK0 M;  1N62 A;  2FBW B;  1TKE A;  5D7G A;  4HKQ A;  1MI0 A;  2K9X A;  1VR9 A;  4IOI E;  2L52 A;  4MH8 A;  2JZP A;  1RM6 C;  3GB1 A;  2J42 A;  2BT6 A;  1EU4 A;  2ON8 A;  3SEB A;  3U2S C;  1JWM D;  1JAL A;  5C3J B;  2KQ4 X;  1N63 A;  1XLQ A;  1T5X D;  3Q8A A;  4EE2 A;  4KX6 B;  4HRS A;  2BB6 A;  3V3X A;  1TY2 A;  3PO0 A;  4DQO C;  1NYQ A;  1QOA A;  5EE3 A;  4FXC A;  1E7P B;  2W54 A;  2QSD A;  1KH0 A;  2Z8L A;  1I4P A;  2N7J A;  1PFD A;  3AE3 B;  4HRO A;  3VR9 B;  1SB3 C;  1RYJ A;  2J4X A;  1BXT A;  1PGB A;  3BYY B;  1J7A A;  2BS3 B;  2WXF A;  4MM3 B;  4PT5 A;  1YNT E;  2Q5W D;  1ZPS A;  4WWM A;  2WDR B;  3AE1 B;  3W5U B;  2LHD A;  1ET9 A;  1QOF A;  3TEW A;  1CZP A;  1D5Z C;  2SEB D;  4YT0 B;  1ZDV A;  5H92 C;  2K5P A;  1TS4 A;  4JE3 B;  3NVV A;  3HRD D;  2I38 A;  2JX5 A;  1MHX A;  2RMM A;  4KGS A;  5HI1 A;  1Q10 A;  2AQ1 B;  1SE3 A;  2N9K A;  3KLS X;  1K52 A;  1FNU A;  1GAQ B;  1SE4 A;  4N58 A;  3MC0 B;  1IBX A;  4RFB A;  3AN1 A;  1I4Q A;  1L6V A;  1TS3 A;  2CU3 A;  3AE7 B;  3AE9 B;  1XLO A;  1E0Z A;  1JWB D;  2JYE A;  2PIA A;  1JWU D;  1DOI A;  4IKG A;  1NEN B;  1T3Q A;  5FK9 C;  1SEB D;  2JQR B;  1NYR A;  2WDQ B;  5H8Y E;  1C77 A;  4OZB A;  1NI3 A;  2WXQ A;  1XLN A;  2J52 A;  2PKO A;  3KWV A;  1WYG A;  1P7F A;  4NAW B;  1OFF A;  2WP9 B;  1F0Z A;  1XXG A;  1EWY C;  3VRA B;  3P1M A;  3HUI A;  3SFE B;  3AE2 B;  2JSV X;  3FIL A;  3HVD A;  4A9A A;  4ITK A;  4TSS A;  2BS2 B;  2WS3 B;  1XEE A;  1FRD A;  1VZ6 A;  3ZYY X;  1AW7 A;  1CK1 A;  1SSN A;  1BML C;  1TZO A;  2GB1 A;  4B0E A;  3U4E G;  3BK1 A;  1XLP A;  1DYQ A;  1K50 A;  5FR3 A;  1JCK B;  4WQM A;  4DXF A;  4RCO A;  3NRZ A;  1JML A;  1L4Z B;  3AEF B;  3FC4 A;  1EM7 A;  1HZ6 A;  3AEA B;  2LMC A;  2IGH A;  3R8B A;  3BII D;  1XF5 L;  4YWG G;  1WGK A;  3N9Y C;  1V97 A;  3BYT B;  1F2R C;  2NTS A;  2WNM A;  1EWC A;  2GI9 A;  1UNS A;  1QQR A;  1I4H A;  3MP9 A;  1N5X A;  4US9 A;  1IGC A;  5G5G A;  4TQ0 A;  3ABV B;  5T8I A;  2IPK D;  4B0M A;  1FRR A;  3B9J A;  4KGT A;  1T6B X;  2BBC A;  1D5X C;  4LTU A;  4L1B A;  4N6E B;  3AE5 B;  3EGR A;  2K22 A;  3Q8F A;  2KWD A;  1FCC C;  2VZK B;  2H89 B;  2TSS A;  4JX1 C;  2CJN A;  4OZA A;  2W3S A;  1UUP A;  3U52 E;  3T3O A;  3P4R B;  3RFZ B;  3Q8C A;  2EKI A;  1IBX B;  1N5W A;  1VRA B;  4OZC A;  1GOZ A;  2M19 A;  1IGD A;  4XDD A;  2L83 A;  1N60 A;  2MH7 A;  1ET6 A;  2X38 A;  1ZP0 B;  2RDG A;  3AB5 A;  1JW9 D;  4R3D A;  3AEG B;  3MFG A;  2W55 A;  1MVK A;  1HA5 A;  1TYG B;  4GDL B;  4H2A A;  2QMT A;  1STE A;  2D5G A;  2KMM A;  2BS4 B;  4UDU C;  3BVM A;  1ACC A;  1YJJ A;  3AEE B;  1B9R A;  3AH7 A;  3P42 A;  1OQR A;  3L4P A;  4RNA A;  2ONQ A;  5BMH A;  2K3U A;  2ZW0 A;  1QOG A;  3Q69 A;  2INP E;  2CJO A;  4XE0 A;  2W3R A;  4USA A;  1FIQ A;  4A90 A;  4C7Y A;  5HFY A;  4YSY B;  3W1S A;  2LUM A;  3AE6 B;  3T3N A;  3CWI A;  2WXM A;  4XWW A;  3IXS A;  3BVZ A;  5C2T B;  1WSP A;  3B2G A;  2MEK A;  1M4V A;  1ZOY B;  2LGI A;  2L32 A;  1I4X A;  4JWU C;  1TKY A;  3V05 A;  2NTT A;  2V3P A;  2WXH A;  2LJI A;  1HZ5 A;  2WXO A;  3DWG C;  1C9F A;  2ACZ B;  2WXP A;  4RGN A;  5AUI A;  1D4B A;  1TKG A;  1V1O A;  4RGT A;  1YMH E;  5D3I B;  4RF0 A;  2BB5 A;  3AEC B;  4RGM A;  3NVY A;  2QIE B;  1BUI C;  3BZD B;  1P7E A;  2GRI A;  1ROE A;  4TQ1 A;  1SIJ A;  2B76 B;  3GS2 A;  1L0Y B;  3NVZ A;  2Y5C A;  4ARC A;  4YTN B;  2WXR A;  1QLB B;  2BYT A;  1F2R I;  5BYR A;  1KRH A;  1A70 A;  3ZJU A;  4A8X C;  3IT6 B;  1SE2 A;  1FNW A;  2WXL A;  2M0A A;  2PMV A;  1FEH A;  4M0W A;  4RH6 A;  1UWM A;  5EE1 A;  2LHE A;  2W82 A;  1WRI A;  1FXA A;  4A55 A;  1Y56 A;  3R2I A;  1YN3 A;  3KWL A;  1YQ4 B;  2WXG A;  3UI3 A;  4P16 A;  1YN5 A;  4ARI A;  3BK2 A;  3OWE B;  3O13 A;  3VR8 B;  1E9M A;  4US8 A;  1VDV A;  4YXD B;  4ZRQ A;  2RPV A;  1JRO A;  3BWU D;  2IGG A;  4L2Y A;  4HJG E;  4YTP B;  3H8H A;  5TSS A;  1C79 A;  4MT5 A;  3PZ7 A;  1ZE3 D;  3URY A;  2V4I B;  3EA6 A;  4OVZ A;  4HEA 1;  2DWQ A;  1TY0 A;  1VLB A;  1TJE A;  2ICI A;  4GLS C;  2YEP F;  4REZ A;  1YN4 A;  2AQ3 B;  1J7C A;  1MPE A;  4HKZ E;  1AYF A;  1C4A A;  2R61 A;  1PUT A;  3EUB 2;  3P4S B;  5HG2 A;  1C76 A;  1F77 A;  2H88 B;  5HHD G;  4ZHO A;  4NZL B;  1UGJ A;  1FFV A;  1I4R A;  2NMQ A;  2QEJ C;  3I9V 1;  3LYY A;  1TS2 A;  1B1Z A;  1I7H A;  1XCT L;  2E3T A;  1QT9 A;  2SAK A;  2V3N A;  3W2D A;  2PTL A;  2N9L A;  1N61 A;  1HEZ E;  3IAM 1;  1FO4 A;  1QIL A;  1GB1 A;  1KFY B;  4P6V F;  1AN8 A;  2FE8 A;  2PVG C;  4NJC A;  1ENF A;  4DXG A;  5BMG A;  1KF6 B;  1QOB A;  2MJE A;  4L23 A;  1C78 A;  4ZRP A;  1AWD A;  1PDX A;  4XWT A;  2G1E A;  2VZK D;  2IGD A;  3WCQ A;  4JPS A;  5LNK 1;  2DBY A;  1R7S A;  1K51 A;  4WIP A;  2DYM A;  2AQ2 B;  4C7Z A;  1D5M C;  3VRB B;  1TS5 A;  2LFI A;  3B2F A;  3MJ5 A;  4ZHP A;  2MJ3 A;  1XCQ L;  3PZ8 A;  3TEX A;  2WU2 B;  5JXV A;  1YQ3 B;  2E6X A;  2KAJ A;  5BMI A;  2I2Y A;  2Y5P A;  2BTE A;  1V1P A;  1CQV A;  3W9C B;  3IAS 1;  1WWT A;  2KAC A;  3BVG A;  3FIL B;  3GP7 A;  1V1P B;  1RFK A;  3AED B;  1IUE A;  1FMA D;  1JRP A;  5EE0 A;  2OED A;  3Q8E A;  4AQ7 A;  1JWA D;  3ZJT A;  5G5H A;  1CJE A;  2WQY B;  2IJ0 A;  1QKZ A;  1D6E C;  2DLB A;  4CQN A;  4WUR A;  4WH4 A;  1PGA A;  5FKA C;  1KLU D;  1LO5 D;  1ZDX A;  3LB8 C;  1UWX A;  2N0S B;  1E6E B;  1YJI A;  1FD6 A;  2AX5 A;  2IDY A;  3LXF A;  3ETR A;  1I4G A;  3NZ3 A;  3NS1 A;  5BYS A;  2WDV B;  3AMZ A;  3Q8B A;  2G9H D;  3E56 A;  4GDK B;  4KKJ A;  2QIL A;  3I57 A;  4N59 A;  3SFD B;  3DWM A;  4KKI A;  2BW2 A;  1DOX A;  2JWU A;  1PYW D;  4OW0 A;  3TSS A;  1WXQ A;  2JXT A;  4RF1 A;  4O1N A;  2WXI A;  2JU6 X;  3AE4 B;  1XO3 A;  3C8Y A;  5AUK A;  1JWS D;  2FUG 1;  3AM9 A;  2INN E;  3SR6 A;  2JYT A;  5D3D A;  1VJK A;  3HVZ A;  1V8C A;  4C56 C;  5I4D A;  1QF6 A;  1VZ7 A;  1E10 A;  1SXT A;  1DGJ A;  2WXJ A;  4ZYS A;  2WXN A;  1FFU A;  2K0P A;  1K53 A;  2LEK A;  4D2K A;  3TEY A;  4IDI A;  2YEP B;  4JWS C;  4KGR A;  2HDE A;  1DOY A;  1J7B A;  4YSZ B;  1GB4 A;  2L1A A;  2M56 B;  3TEZ A;  1L4D B;  4LLG M;  1HXY D;  3CIR B;  1JQ4 A;  1FM0 D;  1C4P A;  3ZJV A;  2QJL A;  3E9S A;  5E6J A;  1ZXH A;  2ZW1 A;  5EE9 A;  1KTK A;  1ZUD 2;  1L6U A;  5GXG B;  1RWS A;  1EU3 A;  3VQI A;  2PLP A;  2XN9 C;  4C80 A;  3P63 A;  3P4Q B;  4XDC A;  3TUO A;  1ESF A;  3R2T A;  1ZXI A;  2OHF A;  2RDH A;  4WAF A;  4YSX B;  3ZGZ A;  1SF0 A;  2WU5 B;  2HTM E;  1L5P A;  4ZOH C;  4MAC A;  1KLG D;  2XNA C;  3AE8 B;  2J53 A;  2WXK A;  3IT4 B;  5MPO A;  2V0G A;  2DYO A;  3AV8 A;  2EEL A;  3W5V B;  2KDM A;  1L0V B;  3MHZ A;  3U7Z A;  1FNV A;  1HQR D;  3FAH A;  3RPF C;  3J9C A;  4J3O D;  1GPX A;  1VZ8 A;  2WLB A;  4YTM B;  1NVI D;  4TMA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...