1F2RI

Nmr structure of the heterodimeric complex between cad domains of cad and icad
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MELSRGASAPDPDDVRPLKPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWTYNDSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-ACTIVATED DNASE
publication title Structure of the heterodimeric complex between CAD domains of CAD and ICAD.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f2rI00
2JWUA 1UWXA 4D2KA 1D4BA 3FILB 2LGIA 1KH0A 5BMIA 2K0PA 2I2YA 2N7JA 3UI3A 1PGBA 3FILA 1FD6A 2RMMA 4GLSC 2N9LA 2EELA 1JMLA 1MI0A 4HJGE 3GB1A 5BMGA 4MACA 4OZCA 5BMHA 2PLPA 2ZW0A 2KDMA 2LUMA 5HI1A 1GB4A 5HHDG 2RPVA 2QMTA 1MHHE 1Q10A 1F2RC 4IKGA 1K53A 1HZ6A 1K51A 1MVKA 3V3XA 4KGRA 4OZAA 5HFYA 1PGXA 1FCLA 2KACA 1IGCA 2QSDA 5HG2A 1XCQL 1FCCC 2PTLA 2GB1A 2GI9A 2LHDA 1EM7A 1IGDA 2IGDA 2LHEA 1YMHE 2KN4A 1XCTL 2PW9A 2J53A 2IGHA 1IBXB 1GB1A 2KQ4X 1MPEA 4OZBA 2JXTA 2I38A 2NMQA 1XF5L 2OEDA 1F2RI 1QKZA 1IBXA 3MP9A 1K50A 1ZXHA 1K52A 4KGSA 2IGGA 2JSVX 2ZW1A 2J52A 4KGTA 5JXVA 2KWDA 1MHXA 2ONQA 1P7FA 1C9FA 2N9KA 1HZ5A 1P7EA 2ON8A 1YNTE 1HEZE 4WH4A 4IOIE 2JU6X 1PGAA 4HKZE 2JZPA
chains in the Genus database with same CATH superfamily
1YD8U 2K8HA 4A20A 2L83A 4CYEA 2W82A 2LD9A 1XLQA 4J6IA 3BVMA 5IKCM 2XN9C 5JH5C 1S3SG 4GDKB 3DBRB 2KTRB 3ZXRA 4GLSC 3SU8X 3VRBB 1FNWA 2JYTA 5JHAA 4UDUC 1T6BX 1WYWB 4G11A 4MJSB 2BQQA 4HDOA 3B08A 1F2RC 3M63B 3V60A 5D94A 1K51A 2L32A 4JLCA 4JQWC 1S1QB 3DBLI 5JZEB 2NR2A 3L4PA 1WGDA 1PGXA 4MGZE 1TZOA 2JPHA 4X57B 4YWGG 4CHKA 1NENB 4XGAB 5HG2A 1TGZB 3AB5A 1FCCC 2V4LA 3RZFA 2I1KA 3ZDTA 3H7PA 1T5XD 1XLPA 2H88B 4W9FA 1Z5SB 2KD0A 3GS2A 2KDIA 2XK5A 4GOCA 4QAYA 3S2AA 1GB1A 1P9DU 3ML8A 2FCQA 2ASQA 2KC1A 1DGJA 1N6ZA 3OAWA 4A55A 2IO1B 2M1MA 3DHGC 2KMMA 1N60A 2WXPA 3IXSA 2LJ5A 3A9JB 4RMAA 2DZKA 2L1AA 3AE8B 2LGDA 2WXFA 2HJ8A 3RMKC 3SFDB 4NZLB 1HZ5A 3AEFB 2LVQA 4HCNB 1UGMA 2KN5A 3MC8A 1NVID 3M95A 4E3CA 3MJWA 3VTUA 3A4SC 1HTQA 2V4IB 3AN1A 2K0PA 4GSWA 3VDZA 1R4MB 2H89B 3I9V1 2WU2B 1WR6E 2V3PA 1E10A 3QK0A 2QCZA 2XK5B 1KF6B 1CJEA 4LNFA 4XDDA 4IDIA 2BW2A 1KLUD 2K9XA 4XE0A 1D3ZA 4M02A 2CU3A 2BS4B 1I4PA 5CHVC 1ZDXA 3N9YC 1FCLA 1C79A 4HPMB 2IO2B 1XLNA 2DZJA 2CHZA 1WJUA 2L76A 1OTRB 1YJ1A 2L52A 4IW0A 2WXRA 1L7YA 2WDTB 2M0AA 1WGHA 2KO3A 2L0FA 4FJZA 1FFVA 1ACCA 1N62A 2BB5A 1I4QA 2LASA 2RDGA 3NJTA 3SDLC 2L05A 4KKJA 3PV1A 3VAWA 1F2RI 3SFEB 5J17A 2O6VD 3MP9A 4BKGA 4M0WA 1I42A 5AZGA 2AQ2B 3Q3OC 4GDLB 3P4PB 3DBRI 3HK0A 4WQMA 3U7DA 3Q3NC 1YQBA 2DBYA 5J18A 1E8YA 1AARA 3AE7B 3PLVA 2BVCA 4ZRQA 3P4RB 3DHHC 5KHQA 4BAXA 4IM0A 2WGSA 2JU6X 1V81A 2G1EA 4HKZE 1AYFA 2WX1A 1WGKA 3HVZA 1M94A 4A3OA 3IT4B 1FMAD 2KOXA 5BMIA 3AV8A 3NRZA 2D3GA 5DPSA 2NCNA 4K81A 1UZXB 3UI3A 2BT6A 4B95A 2N9XA 3H7SA 1ESFA 4N9F4 2I1JA 3U7ZA 5BMHA 1L2NA 3CIRB 4DDGD 5EE1A 5CHFA 2MEKA 2DENB 3O13A 3IG3A 4NPNA 5EE0A 3Q3FA 1I4GA 3SHQA 3W1SA 2A5UA 2WDQB 4LNKA 1I4RA 1KRHA 2AQ3B 2JRIB 1MG4A 3V61A 4EEWA 4ZRPA 5MPOA 3R3MA 2MX2A 5HFYA 1P1AA 3KYDD 1YN3A 2V0GA 1VLBA 4H2AA 3PZ7A 3N1ZC 4FXCA 2AQ1B 4RNAA 4K7SA 3RD2A 3RNFC 5CX3A 2OJWA 1V1PA 2W9NA 1I4XA 2BYVE 3A9KA 2Y5BB 4NY0A 2KN4A 4PS7A 3U8ZA 1ET6A 4LLGM 2IDYA 2IGHA 4HWIB 2KQ4X 2DZIA 1U4AA 2KFJA 1EO6A 3WA0A 2FAZA 3BYYB 1QKZA 3RNAC 4IG7B 2KQ7A 1WRIA 4AJYB 1LFDA 5L95C 1YIWA 2QIEB 1D5ZC 4DHJD 1J7BA 4YXDB 4AOFA 2L3ZA 1WM3A 4HRSA 3T3OA 1TS3A 3R2TA 3PRMB 3N20C 1J8CA 4WH4A 4S17A 2ZNVB 3MHSD 3HIZA 1G6JA 4DBGA 1WRDB 1KH0A 4WURA 4KZ0A 1DOYA 2M17A 5C1ZA 3PSEB 4XZ4A 5AUIA 3N30A 3U30A 2CS4A 4K1RB 2NVUI 3DBHB 3VFKA 3A9KB 2HTHA 2G4SA 2ZNVC 2J0JA 2RPVA 1TY2A 2AL6A 4GN1A 2KC2A 4IKGA 1FRDA 2GBNA 1XD3B 2PJHA 1IUEA 3NZ3A 2NS5A 3TCAA 3JSVB 2BBCA 4JWUC 3J9CA 1GAQB 2KWCA 2CU1A 4KKIA 3ZJVA 3ZDMC 3GP7A 2FCNA 2RSUA 3Q69A 3ENEA 1NI3A 2IO0B 1ENFA 1GNUA 2FE8A 2DX5B 1SBBB 1KOTA 3QCAA 2I38A 4EKUA 2MJDA 3UQBA 1C4AA 1ZXHA 2RDBC 1K52A 2KZRA 2OHFA 4W9DA 3TEWA 3QX1A 4NJ7A 4ANVA 2C7MB 4YL8A 5C23A 2KX3A 1HE8A 1T0SC 3QA8A 1WR1A 1F77A 4KZCA 1RRBA 3AE2B 2HDEA 3PHWB 2NPTA 1K8RB 1UWXA 4IWPA 2QC8A 3ZVVA 1XLOA 4HEA1 1ZP0B 3A4RA 1R7SA 1E8XA 2IY0B 3I3TB 1TJEA 1UF0A 2GBRA 3JW0X 4I6NB 2HJ1A 3FILA 1T0YA 5IAAC 3B9JA 1ZDVA 4LJOB 1WGRA 3NUHB 1JMLA 5KHOA 4HJGE 2D11A 2GOWA 2KDMA 3TMPB 4IWOA 1GC6A 3CF6E 1F9JA 1RM6C 4FHKA 3B0AA 4ZHPA 4KSLC 1SJED 3R2IA 2EMSA 2KKCA 3BZDB 5E6PA 3ZKJC 4HPPA 4MDKE 2KAJA 4OVZA 2C9WB 3HRDD 1RYJA 1TYGB 3BYTB 1WWTA 3PZ8A 3U52E 3H9DA 1C78A 1TKYA 4C00A 4P6VF 3QAQA 2TSSA 2KFKB 2E3TA 4ARCA 3LB8C 2GB1A 1VCBA 4C7ZA 2D5GA 3EHVA 1E9MA 4B0MA 5AZHA 3EC8A 3P2BA 1WSPA 1XO3A 4AP4C 3ZGZA 2J0KA 4LCDE 4YTNB 4MSQB 3RNCC 4ZDVA 3LXFA 4II3B 2FIFA 3A33B 3OLMD 2ZCBA 2C7HA 4KDIC 3W5UB 3LDZE 3RNEC 1JW9D 1LM8B 2UWQA 3DBHI 2MJEA 4BVUC 3P1MA 2ON8A 2PIAA 1J7CA 2LZ6A 3WANA 1GJZA 1I35A 3APDA 1ZUD2 2AL3A 2IPKD 2JZPA 3NVVA 2LUEA 2WQYB 2CHWA 3NVYA 2WXGA 3ZQ4A 2HTME 1WXSA 2N9EB 3OG5A 3TBLD 4KX6B 1TTNA 4JPSA 2RPQA 3NS8A 3DHIC 4IUMB 4FHJA 5FR3A 4W9HA 1QF6A 1UGJA 4OZCA 4EUTA 1I7HA 4AUQC 4B0EA 2BWFA 3RCZA 2G3QB 5AZFA 2MHJA 1TY0A 5CTRC 4W9GA 3PRPB 1KFYB 2JRHA 1JWUD 1OQYA 1Q1OA 4PS8A 2JQRB 1ZOYB 4G50A 2Z8LA 1VJKA 2REXA 4MGKE 3KYCD 4CO7A 3TEZA 3AECB 1RAXA 3BY4B 1KTKA 2IGDA 3L17A 3WCQA 4MM3A 1FIQA 3BK2A 1F0ZA 1WF9A 1FXIA 4OZBA 4W9IA 4ITKA 2PEAA 3IAS1 1ZW7A 4RH6A 3ZJTA 2WWZA 3Q3MC 4XWTA 1NEKB 2B76B 4KGSA 2IGGA 1WYGA 3QQ8B 4ASWC 4MSMB 1B1ZA 3ZW3A 2N9KA 2WXKA 3DBSA 1EF5A 4WJNA 5IOIA 1LO5D 2JVCA 3R66C 4CQNA 3C8YA 4C56C 1E5WA 3PLUA 3KQ4A 2I2YA 2IYDB 3RPFC 2K8CA 1STEA 2N7DA 3RUIB 5BMGA 3GB1A 2X38A 3HHMA 3EECA 2IZVB 2PLPA 3ETRA 4MM3B 4KV2A 2MP2A 3UGBB 5LNK1 1C3TA 4JWSC 1SXTA 3NOBA 3KW5B 3P42A 1Q5WB 3TEXA 4ZOHC 3DDCB 1NYQA 1TS5A 3EGRA 3H7PB 2KVZA 3HUIA 3TIXA 2QSDA 4W9LA 4XYCA 1T0QC 1P0RA 4NNJB 4BZAA 4RGTA 2JZZA 2LHDA 4ANUA 4I6LB 5EDSA 4FULA 3B2GA 2MH7A 3EA6A 1OEYA 3Q2AC 1MJDA 1V8CA 2YEPB 4KSKC 3RYTA 4MGIE 2OOBB 1H4RA 1FPYA 1YOVB 1IBXA 3WALA 5C2TB 2N9PC 3AEGB 4LTUA 5BYRA 4RGNA 1ET9A 4MGYE 1KJTA 4NAWA 1MHXA 2JZ3B 3H6NA 2INNE 3HVDA 3RULA 2MP2B 4URKA 2JWZA 3ZRCA 2WDVB 2KTFA 5DPRA 3BWUD 2K8BA 1R4NB 5G5GA 3N32A 2LRUA 2FUG1 2CKHB 1A5RA 2KK8A 2V3NA 3QIJA 1ZGUB 1FXAA 2LGIA 4B6WA 1E7VA 2DZMA 3VVWB 2WLBA 1WIAA 2KWUB 1SB3C 2SEBD 2EELA 3VH4B 2K25A 3W2DA 3Q8AA 5IN7A 3BK1A 4MACA 4FADA 2W3RA 3L54A 3HM6X 1EF1A 3R8BA 1UWMA 4WWNA 3ZUNA 1ROEA 2WXIA 3UIOB 2BKFA 3AI5A 1MVKA 2LGSA 3TL5A 4BKSD 2IJ0A 2N0SB 4OVVA 4I6PA 5TR5A 3DVGY 1RWSA 4F1SA 2FBWB 3TSSA 3QJZA 4NAWB 3PS6A 2RD0A 2EKEC 3TUOA 2WXHA 4IWQA 4EOYA 2AEHA 3D32A 4KIKA 4W9CA 4BBNC 4W9JA 5BO4B 1NDDA 4AQ7A 2LJIA 3AE9B 4M0WB 3VTVA 2JXTA 1WXVA 2ZEQA 2KXJA 4MT5A 2DHZA 3C0RB 1WJ6A 3ONSA 2K1FA 3KWLA 3APCA 3P63A 2ZW1A 2KMCA 3NY5A 4P7IA 3X23A 4M8NA 3GE8C 3OJ4B 1TBEA 2GBMA 2V9HA 4XX5A 2BYTA 2RGFA 1V5OA 2KYWA 4EZLA 3H8HA 1IYFA 3NVWA 1V2YA 2ZCCA 2VZKD 4PYUA 1PGAA 3W5VB 3CSTA 3APFA 3N3KB 3VUWA 1C77A 3BIID 4D2KA 2L00B 5DPWA 4WJQA 2MBQA 2BF8B 1R4MI 2G45B 2ZVOA 1V86A 3PPAA 4IM2A 4ZRIA 1ZXIA 2PPHA 2R2OA 2FUHB 3GZNB 1WX9A 2DLBA 1UBIA 2LXAA 4ZYNA 2ZW0A 4TSSA 3Q8BA 2O6VA 2EKIA 1FO4A 3Q3JA 2C5LC 1VZ6A 4P16A 1ZKHA 1WZ0A 2ZPYA 4W9KA 1K53A 3ZNGC 3VUXA 4NQKE 3V3XA 2ZVNA 4KGRA 4TMAB 2DYOA 2GBKA 2BS3B 2KDFB 2YLMA 3IVFA 1V1PB 2J7QB 3SEBA 5L83A 1V1OA 4N58A 3CSFA 1DYQA 1N63A 1JWSD 2GI9A 3W1SC 1C76A 2MLBA 3N1XC 5I4DA 1Y8RC 4J3OD 4L2YA 4A8XC 1CZPA 2PW9A 1YX5B 2J53A 1HXYD 1R4NI 1WXMA 3OWEB 4MEMA 5TSSA 3T8MA 1P3QU 1V80A 4LJPB 1C4CA 1TS2A 1WGGA 4LDTB 2KDEB 3B1LX 3KH0A 1NBFC 2MBOA 1OEYJ 2KWDA 1E6EB 1C9FA 4NAMA 1QOFA 4F7ZA 2WYQA 1WE6A 2Y5CA 2D3CA 1F52A 1IPGA 4YTPB 3LJ3A 1L4DB 4HPLB 2JT4B 3JVZX 3MJ5A 3Q6BA 2M0XA 3Q14C 1QZEA 4Q2JA 1WMHA 2KT7A 3A1QA 2R61A 1V5TA 4JX1C 3WAOA 4A90A 2XNAC 1FFUA 2D10A 1CK1A 5CHWA 3W9CB 2WXMA 1SE3A 2W55A 4MH8A 4ZRJA 3Q8CA 1MI0A 4AWJA 3ZNHB 1Z2MA 4TKNA 1XQQA 3T3NA 3KLSX 4NJ6A 5E6OA 1N61A 3R7QA 3L0WB 5GMVA 4BOSC 3ZLZA 3I57A 1J0GA 3DQVA 2G4DB 3BVZA 4W9EA 1L0XB 4OVUA 1SJHD 3K9OB 1L6VA 1QT9A 2K3UA 4HDQA 2CHXA 2HD5B 3AE3B 3NVZA 3DWMA 2PE9A 3MC0B 4AJWA 1FNUA 4HKQA 2D07B 3QARA 4HJKA 3ZTDA 1WY8A 1TKEA 2VZKB 4LK0M 3Q8EA 1XF5L 1E8ZA 1L4ZB 3LYYA 3A1QB 1WXAA 4A9AA 4BFRA 1BUIC 1H8CA 1FEHA 4XDCA 3GZNI 5BYSA 4GMVA 4MELA 2ONQA 2Z0DB 4OHJA 2NPTB 1JCKB 1UUPA 2O2VA 3PHXB 4GIVA 1E0ZA 4DXAB 1E7UA 2PVGC 3C19A 1E90A 5D6JB 3IBEA 2YVCA 1SEBD 2OJRA 2UYZB 2W54A 3AE6B 5BYQA 4KDLB 1UD7A 3FILB 2JXXA 3U2SC 5JHBA 3I5JC 4RGOS 1D6EC 4DXFA 1JWBD 3OJ3A 2EMTA 3AM9A 3TJPA 3AH7A 4YT0B 3N1YC 3M62B 3RNBC 1WE7A 4GDKA 1V49A 3PREA 1TKGA 3ML9A 3E56A 1TIFA 2QMTA 1Q10A 1L6UA 4C80A 1JRPA 5D2MB 1SSNA 4MJSA 2CJNA 1E8WA 1BT0A 3Q8FA 4K7UA 4IC7B 2GBJA 4BOZB 1A70A 5G2NA 3NHEB 4G3XB 1YQ3B 3V62A 2L0TA 1VZ7A 1KLVA 2O2VB 4RM8A 3GOEA 3I63C 3RN9C 2M4NA 2WXNA 1WGYA 1UH6A 2VH1A 4S0RA 1HTOA 1WH3A 1PFDA 2NMQA 3ZJUA 3AULA 2OEDA 2KLCA 3PTFC 2NBWB 2M8SA 1K50A 2JX5A 4TV3A 3V6CB 2MBBB 4LNIA 2IBIB 3PT2B 4PK1A 1VD2A 1WX7A 1JROA 2DYBA 4YSXB 4WAFA 1N5XA 3ALBA 4ZHOA 1SIJA 4KVGB 1YJIA 2WXQA 2KNBA 3A9JA 1ZE3D 1YNTE 4AS1A 2LMCA 1C4PA 3PRZA 4ZYSA 2JWUA 3HM3A 4O1NA 1SE4A 2ZJDA 4EFOA 1C1YB 1SE9A 2LXCA 5LXHA 2N7JA 2X8XX 2IY1B 2QJLA 2D3AA 2D2QA 2XEWA 3DOWA 3ZYYX 4K3BA 2N1WA 5HI1A 4XWWA 2LGXA 4K3CA 2DNFA 3VH3B 4HROA 1WXQA 1BMLC 3QHTA 4M00A 4ICUA 4PT5A 4GB9A 4ANWA 2BB6A 1EUVB 5IO9A 5AEKB 1QOBA 1IGCA 1T0RC 1VZ8A 2AX5A 3AEBB 4C4VA 2BS2B 4JIOU 3T9LA 2DWQA 1ZPSA 2WU5B 3MC9A 5H92C 3AU4A 3AEAB 2LVOA 3RT3B 2MBHA 3PZDA 2LHEA 1B9RA 3DVGX 3KUZA 1BXTA 2FNJB 2K5PA 2QDFA 1D5XC 3TEYA 1WJ4A 2DAFA 2LI5A 1QOAA 2BPSA 4IM3A 5FKAC 1PYWD 2LFIA 2Y3AA 5D3IB 2KX0A 5LXIB 3KUCB 3U4EG 2NTTA 3VQIA 1V97A 3L16A 2AYOB 3MHZA 1Y56A 3AE1B 3AE4B 1CQVA 1QLBB 4F8CB 1UNSA 4HLEA 5D3DA 1SE2A 4GDLA 2VRRB 1HEZE 1QILA 4LNOA 4IOIE 2K6DB 1MG8A 1NYRA 1X1MA 3AEDB 2KLGA 5HKHA 2KANA 3ECIA 2PVOD 1D4BA 1WX8A 3P4QB 3P4SB 4PS3A 4C4VB 2WXJA 2A4ZA 2C7NB 1NI2A 2JUOA 4WQOB 4US8A 2GLSA 1OQRA 2CJOA 2WNMA 4RF0A 4A3PA 2LUMA 1WM2A 1GB4A 5HHDG 5LLIA 2FIDA 4LDTD 3PVLA 1EU3A 4L1BA 4FJYA 1JWAD 3DWGC 3ABVB 3IT6B 5E6NA 2JYEA 2V1YA 4N6EB 3VUYA 4ANXA 3ZO5B 2YEPF 3ZNID 4LNNA 1PQSA 1LQBA 1P98A 3PGEA 3MTNB 1YJJA 4YTMB 1M4VA 1GUAB 2BWES 4RM9A 2MWSB 4DQOC 2WXLA 3VR8B 2WXOA 1AN8A 2LGYA 2MRPA 2J0MA 3H1UA 4N59A 1IBXB 4RGMA 1WJNA 1YN4A 3IAM1 3RNGC 3GE3C 3RI7C 4WWPA 3BINA 1KM7A 2LVPA 2WS3B 4E74A 1VRAB 4HK2A 2J4XA 1L0VB 2ZPNA 3VTWA 4ACFA 3KVFB 1P7EA 1OFFA 4E71A 2W3SA 5IP4D 2WX0A 2K6QA 2QHOA 2LWPA 1TS4A 4DDID 1QOGA 3URYA 4M8MA 3FKYA 2GMIC 2E6XA 2NBVB 3O65B 5C3JB 5FR6A 3E9SA 1YQ4B 3VRAB 4BBNF 4ICVA 1PGBA 3UF8A 1FD6A 2RMMA 4HVBA 4NJCA 1YX6B 3BVGA 3RZWC 1QQRA 2MBEA 4JGHB 4WJPA 4OW0A 3VHTC 5AUKA 3DCGA 1J7AA 2UU7A 1WZ3A 2K39A 4DHZE 2BYEA 5G5HA 1WI0A 3ZIMA 4WWOA 3ZXVA 1N5WA 1XEEA 4OZAA 1EU4A 2LEKA 2R2QA 4L23A 2KWVB 2Q5WD 2KACA 4YSYB 1SIFA 2BGFA 3NS1A 3EFUA 4REZA 2PTLA 3JSVA 1CMXB 2KJRA 4KIKB 3WAPA 4ZRKA 3L08A 1EM7A 5IA7A 3DVNV 2CR5A 1IGDA 1VDVA 2INDC 1LGRA 1XCTL 1L5PA 2FCMA 5T8IA 4FLHA 2K22A 1XXGA 3AMZA 3R7RA 2KJ6A 2XBBC 2BTEA 5H8YE 3EUB2 2MSED 1Q0WB 4JE3B 2BYFA 4HCPB 3L10B 3AE5B 2BKRB 2J52A 1SF0A 2MA9B 1RFAA 2KQSA 1RFKA 4USAA 2QILA 1DOXA 4BKSA 3DVNU 4MH0E 1FM0D 2NTSA 1FNVA 2AWTA 4M01A 3CWIA 4DXGA 3V6EB 3JYUA 4A6QA 3CMMB 2M56B 1GG3A 2INCC 1MFWA 2KJHB 3UINB 1RLFA 3AXCA 2Z59B 2PMVA 5J2RA 1JWMD 1GOZA 2MW5A 2C60A 2WP9B 2O6VB 1PDXA 1JRUA 1F1HA 3AU5A 2MQJA 2KDBA 1JALA 1KLGD 1FXTB 3QWZB 3AEEB 4FA6A 1JQ4A 4US9A 1EWYC 3SD5A 4RCOA 4WAAA 3NZSA 4P1CC 4DWFA 1HZ6A 4FN2A 2N7EA 2ZZPB 4P1BC 2KVRA 2Z0EB 2MJ3A 4RFBA 2N4FA 3IFWB 3ZRFA 4WIPA 3RFZB 3X0WA 2WDRB 1OGWA 4K7WA 3M3JA 2G9HD 1XCQL 2PE6B 4PYZA 1AWDA 3IHPC 3QC8B 2JY6A 5DCNA 5DPTA 2B3AA 4GU2A 4EZJA 4GXBA 1YMHE 2KFKA 2QEJC 2N1VA 2IO3B 2ICIA 1I4HA 1MPEA 1SGHA 1TZ1A 2HE7A 4NQLB 3DPDA 3DBLB 2L8JA 2JF5A 4DHZB 5FK9C 1YN5A 3SR6A 4DK5A 5JXVA 4KGTA 1VR9A 4R3DA 3WIMA 3ZTCA 5GXGB 1EWCA 2FCSA 5G55A 1WMHB 1WFYA 1PUTA 2RR9A 2PKOA 3FAHA 4G0NB 1TT5B 4EE2A 5EE9A 4RF1A 1HQRD 4B9KA 1D5MC 1V9JA 3KWVA 1L0YB 2Y5PA 2N9LA 2KMAA 1DOIA 4EZKA 3WAMA 2WHIA 2NBUA 1E7PB 2V3SA 2J42A 4C7YA 4DHJB 1MHHE 1ISNA 4JL9A 3EFCA 4II2B 2M19A 3B2FA 1OQQA 2GRIA 3ZNZB 1UELA 2RDHA 2L7RA 4GGQA 1GC7A 5E6JA 1GPXA 3L13A 1UBQA 4TQ1A 2KTRA 1XT9B 3VR9B 1J19A 4TUUA 1V6EA 2MCNB 2DAJA 2LRWA 4XC2A 3MFGA 3NG0A 3NZUA 4BKTA 2SAKA 3V05A 1AW7A 3VXWA 2D3BA 2VH2A 1T3QA 3UQAA 2KHWB 2DYMA 2INPE 1HA5A 3FC4A 4HXDA 2ACZB 4YSZB 2JSVX 4FBJB 4FJVB 3W1YA 1LXDA 3PO0A 3K9PB 5EE3A 1P7FA 1FRRA 4ARIA 4WWMA 3UIPB 1IP9A 4WJOA 4TQ0A 3KUDB 5D7GA
chains in the Genus database with same CATH topology
2L83A 1C77A 3BIID 1UWXA 4D2KA 2PVOD 2W82A 1XLOA 4HEA1 1D4BA 1ZP0B 1XLQA 3P4QB 3BVMA 3P4SB 1R7SA 2XN9C 1TJEA 2WXJA 4GDKB 1ZXIA 3FILA 4US8A 4GLSC 3B9JA 1OQRA 1ZDVA 2DLBA 3NUHB 1JMLA 4HJGE 3VRBB 1FNWA 2JYTA 2CJOA 2WNMA 4RF0A 4UDUC 1T6BX 2ZW0A 2KDMA 2LUMA 4TSSA 3Q8BA 1GB4A 5HHDG 2EKIA 1FO4A 1RM6C 4L1BA 1EU3A 1VZ6A 4P16A 1JWAD 1F2RC 4ZHPA 1SJED 3R2IA 1K53A 3BZDB 3DWGC 1K51A 3ABVB 3V3XA 2L32A 2KAJA 3IT6B 4OVZA 4KGRA 2JYEA 4N6EB 4TMAB 2DYOA 3HRDD 1RYJA 1TYGB 3BYTB 1WWTA 3L4PA 1PGXA 2YEPF 3PZ8A 1TZOA 2BS3B 3U52E 1C78A 1V1PB 1TKYA 4YWGG 3SEBA 1NENB 4P6VF 5HG2A 3AB5A 1FCCC 2TSSA 1V1OA 4N58A 2E3TA 4ARCA 3LB8C 1YJJA 4YTMB 1DYQA 1M4VA 1N63A 1JWSD 2GB1A 2GI9A 1T5XD 1XLPA 1C76A 2H88B 4C7ZA 2D5GA 1E9MA 3GS2A 5I4DA 4J3OD 4DQOC 2WXLA 4B0MA 4L2YA 3VR8B 4A8XC 1CZPA 2WXOA 1AN8A 2PW9A 2J53A 1WSPA 1XO3A 4N59A 1HXYD 1IBXB 1GB1A 4RGMA 3OWEB 5TSSA 3ZGZA 1YN4A 3IAM1 4YTNB 1C4CA 1TS2A 1DGJA 3LXFA 2WS3B 1VRAB 4A55A 2J4XA 2KMMA 1N60A 2WXPA 3IXSA 1L0VB 3W5UB 2L1AA 2KWDA 1E6EB 1JW9D 3AE8B 2WXFA 1C9FA 4NAMA 1QOFA 3SFDB 2MJEA 2Y5CA 4NZLB 1HZ5A 1P7EA 2ON8A 3AEFB 3P1MA 2PIAA 1J7CA 1OFFA 4YTPB 2W3SA 1ZUD2 1L4DB 2IPKD 1NVID 2JZPA 3NVVA 3MJ5A 2WQYB 3NVYA 2WXGA 1TS4A 1QOGA 3ZQ4A 2HTME 3URYA 4Q2JA 4KX6B 2E6XA 2V4IB 3AN1A 5C3JB 2R61A 2K0PA 3E9SA 4JPSA 1YQ4B 4JX1C 3VRAB 2XNAC 4A90A 5FR3A 1FFUA 1CK1A 3W9CB 1PGBA 2WXMA 1SE3A 2W55A 2H89B 3I9V1 4MH8A 1QF6A 1FD6A 2RMMA 2WU2B 4NJCA 1UGJA 3Q8CA 3BVGA 1MI0A 1QQRA 2V3PA 1E10A 4OZCA 1KF6B 1CJEA 1I7HA 3T3NA 3KLSX 1N61A 4OW0A 4XDDA 4IDIA 2BW2A 4B0EA 3I57A 5AUKA 1KLUD 1J7AA 2K9XA 1TY0A 4XE0A 5G5HA 2CU3A 3BVZA 2BS4B 1I4PA 1L0XB 1N5WA 1KFYB 1SJHD 1XEEA 4OZAA 1EU4A 2LEKA 1ZDXA 1L6VA 1QT9A 4L23A 3N9YC 1JWUD 1FCLA 2Q5WD 2KACA 4YSYB 2K3UA 1C79A 2JQRB 1XLNA 1ZOYB 3NS1A 2Z8LA 3AE3B 3NVZA 3DWMA 4REZA 2PTLA 1VJKA 3MC0B 2L52A 3TEZA 2WXRA 3AECB 1FNUA 1EM7A 1KTKA 2M0AA 1IGDA 1VDVA 2IGDA 4HKQA 3WCQA 1XCTL 1L5PA 1FIQA 5T8IA 1FFVA 3BK2A 1ACCA 1F0ZA 1N62A 2BB5A 1I4QA 1TKEA 2K22A 2VZKB 1FXIA 4OZBA 1XXGA 2RDGA 3AMZA 4LK0M 4ITKA 3Q8EA 1XF5L 4KKJA 1L4ZB 3LYYA 3IAS1 1F2RI 3SFEB 4A9AA 4RH6A 3ZJTA 2BTEA 5H8YE 3MP9A 3EUB2 4M0WA 4JE3B 2AQ2B 1BUIC 4XWTA 1NEKB 4GDLB 2B76B 4KGSA 1FEHA 3P4PB 2IGGA 1WYGA 3AE5B 4XDCA 2J52A 5BYSA 1SF0A 4WQMA 2ONQA 2DBYA 3AE7B 4OHJA 1B1ZA 1RFKA 1JCKB 2N9KA 2QILA 4USAA 2WXKA 1UUPA 3P4RB 4ZRQA 1DOXA 1LO5D 1FM0D 1E0ZA 2NTSA 2PVGC 1FNVA 2JU6X 2G1EA 4HKZE 1AYFA 1SEBD 4CQNA 3AE6B 2W54A 3CWIA 1WGKA 4DXGA 5BYQA 3C8YA 3HVZA 4C56C 4A6QA 3IT4B 1FMAD 3FILB 3U2SC 2M56B 5BMIA 3KQ4A 3AV8A 4RGOS 2I2YA 1D6EC 4DXFA 1JWBD 3RPFC 3NRZA 2PMVA 3AM9A 1STEA 3UI3A 2BT6A 3AH7A 1JWMD 4YT0B 1GOZA 1ESFA 2WP9B 1PDXA 5BMGA 3GB1A 3U7ZA 2X38A 3ETRA 5BMHA 2PLPA 3CIRB 4MM3B 1TKGA 1JALA 1KLGD 5EE1A 2MEKA 3E56A 5LNK1 2QMTA 3O13A 3AEEB 4JWSC 1Q10A 1JQ4A 1SXTA 5EE0A 1L6UA 4US9A 1EWYC 4C80A 1JRPA 1I4GA 1SSNA 4RCOA 3W1SA 2WDQB 3P42A 1HZ6A 1I4RA 1KRHA 2AQ3B 4ZRPA 3TEXA 2CJNA 5MPOA 4ZOHC 5HFYA 1YN3A 3Q8FA 2V0GA 2MJ3A 4RFBA 1VLBA 1NYQA 1TS5A 4WIPA 3EGRA 3PZ7A 4H2AA 3RFZB 3HUIA 1A70A 2WDRB 2QSDA 4FXCA 2AQ1B 2G9HD 4RNAA 1XCQL 1YQ3B 1AWDA 4RGTA 2LHDA 1V1PA 1VZ7A 3B2GA 2MH7A 1I4XA 3EA6A 1YMHE 2QEJC 2KN4A 2WXNA 1ET6A 2ICIA 4LLGM 2IDYA 2IGHA 1PFDA 1V8CA 2YEPB 2KQ4X 1I4HA 1MPEA 2NMQA 3ZJUA 2OEDA 3BYYB 1QKZA 1IBXA 5C2TB 1K50A 1WRIA 2JX5A 5FK9C 3AEGB 4LTUA 5BYRA 1YN5A 2QIEB 4RGNA 3SR6A 1D5ZC 1ET9A 5JXVA 4KGTA 1JROA 4YSXB 4WAFA 1VR9A 1J7BA 1N5XA 4R3DA 4YXDB 1MHXA 4ZHOA 1SIJA 1YJIA 2WXQA 2INNE 3HVDA 5GXGB 4HRSA 1ZE3D 1YNTE 4AS1A 3T3OA 1TS3A 3R2TA 1EWCA 2LMCA 1C4PA 2WDVB 4WH4A 3BWUD 5G5GA 1PUTA 2FUG1 4ZYSA 2JWUA 2PKOA 3FAHA 1SE4A 2V3NA 4O1NA 1FXAA 2LGIA 1KH0A 4EE2A 4WURA 5EE9A 4RF1A 1DOYA 2WLBA 1HQRD 2N7JA 1D5MC 2QJLA 5AUIA 3KWVA 1SB3C 1L0YB 2Y5PA 2N9LA 2SEBD 1DOIA 2EELA 3W2DA 3Q8AA 3BK1A 4MACA 2W3RA 3ZYYX 1E7PB 3R8BA 1UWMA 5HI1A 2J42A 4C7YA 4XWWA 2RPVA 1TY2A 1MHHE 1ROEA 4HROA 2WXIA 1WXQA 4IKGA 1FRDA 1BMLC 1MVKA 3NZ3A 1IUEA 4PT5A 2M19A 2IJ0A 2N0SB 3B2FA 1OQQA 2GRIA 2BB6A 2BBCA 1RWSA 4JWUC 3J9CA 1QOBA 2FBWB 2RDHA 1GAQB 3TSSA 1IGCA 1VZ8A 2AX5A 3AEBB 4NAWB 2BS2B 5E6JA 1GPXA 4KKIA 3ZJVA 4TQ1A 2DWQA 1ZPSA 2WU5B 3VR9B 3TUOA 2WXHA 5H92C 3GP7A 3Q69A 3AEAB 1NI3A 2LHEA 1B9RA 3MFGA 1ENFA 2FE8A 4AQ7A 1BXTA 2LJIA 2K5PA 3AE9B 1SBBB 1D5XC 2SAKA 3TEYA 3V05A 1AW7A 2JXTA 2I38A 1QOAA 1T3QA 2MJDA 5FKAC 1PYWD 2LFIA 4MT5A 2Y3AA 5D3IB 2DYMA 1C4AA 2INPE 1ZXHA 1K52A 3U4EG 1HA5A 2NTTA 3FC4A 3VQIA 1V97A 3KWLA 2ACZB 3P63A 2OHFA 4YSZB 2JSVX 1Y56A 2ZW1A 3AE1B 3MHZA 3TEWA 3AE4B 1CQVA 1QLBB 3PO0A 1UNSA 5EE3A 1P7FA 2BYTA 5D3DA 1SE2A 1FRRA 4ARIA 1HEZE 3H8HA 1QILA 3NVWA 4WWMA 2VZKD 4IOIE 1PGAA 1F77A 3W5VB 3AE2B 2HDEA 1NYRA 4TQ0A 3AEDB 5D7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWU A;  1UWX A;  4D2K A;  1D4B A;  3FIL B;  2LGI A;  1KH0 A;  5BMI A;  2K0P A;  2I2Y A;  2N7J A;  3UI3 A;  1PGB A;  3FIL A;  1FD6 A;  2RMM A;  4GLS C;  2N9L A;  2EEL A;  1JML A;  1MI0 A;  4HJG E;  3GB1 A;  5BMG A;  4MAC A;  4OZC A;  5BMH A;  2PLP A;  2ZW0 A;  2KDM A;  2LUM A;  5HI1 A;  1GB4 A;  5HHD G;  2RPV A;  2QMT A;  1MHH E;  1Q10 A;  1F2R C;  4IKG A;  1K53 A;  1HZ6 A;  1K51 A;  1MVK A;  3V3X A;  4KGR A;  4OZA A;  5HFY A;  1PGX A;  1FCL A;  2KAC A;  1IGC A;  2QSD A;  5HG2 A;  1XCQ L;  1FCC C;  2PTL A;  2GB1 A;  2GI9 A;  2LHD A;  1EM7 A;  1IGD A;  2IGD A;  2LHE A;  1YMH E;  2KN4 A;  1XCT L;  2PW9 A;  2J53 A;  2IGH A;  1IBX B;  1GB1 A;  2KQ4 X;  1MPE A;  4OZB A;  2JXT A;  2I38 A;  2NMQ A;  1XF5 L;  2OED A;  1F2R I;  1QKZ A;  1IBX A;  3MP9 A;  1K50 A;  1ZXH A;  1K52 A;  4KGS A;  2IGG A;  2JSV X;  2ZW1 A;  2J52 A;  4KGT A;  5JXV A;  2KWD A;  1MHX A;  2ONQ A;  1P7F A;  1C9F A;  2N9K A;  1HZ5 A;  1P7E A;  2ON8 A;  1YNT E;  1HEZ E;  4WH4 A;  4IOI E;  2JU6 X;  1PGA A;  4HKZ E;  2JZP A; 
#chains in the Genus database with same CATH topology
 1YD8 U;  2K8H A;  4A20 A;  2L83 A;  4CYE A;  2W82 A;  2LD9 A;  1XLQ A;  4J6I A;  3BVM A;  5IKC M;  2XN9 C;  5JH5 C;  1S3S G;  4GDK B;  3DBR B;  2KTR B;  3ZXR A;  4GLS C;  3SU8 X;  3VRB B;  1FNW A;  2JYT A;  5JHA A;  4UDU C;  1T6B X;  1WYW B;  4G11 A;  4MJS B;  2BQQ A;  4HDO A;  3B08 A;  1F2R C;  3M63 B;  3V60 A;  5D94 A;  1K51 A;  2L32 A;  4JLC A;  4JQW C;  1S1Q B;  3DBL I;  5JZE B;  2NR2 A;  3L4P A;  1WGD A;  1PGX A;  4MGZ E;  1TZO A;  2JPH A;  4X57 B;  4YWG G;  4CHK A;  1NEN B;  4XGA B;  5HG2 A;  1TGZ B;  3AB5 A;  1FCC C;  2V4L A;  3RZF A;  2I1K A;  3ZDT A;  3H7P A;  1T5X D;  1XLP A;  2H88 B;  4W9F A;  1Z5S B;  2KD0 A;  3GS2 A;  2KDI A;  2XK5 A;  4GOC A;  4QAY A;  3S2A A;  1GB1 A;  1P9D U;  3ML8 A;  2FCQ A;  2ASQ A;  2KC1 A;  1DGJ A;  1N6Z A;  3OAW A;  4A55 A;  2IO1 B;  2M1M A;  3DHG C;  2KMM A;  1N60 A;  2WXP A;  3IXS A;  2LJ5 A;  3A9J B;  4RMA A;  2DZK A;  2L1A A;  3AE8 B;  2LGD A;  2WXF A;  2HJ8 A;  3RMK C;  3SFD B;  4NZL B;  1HZ5 A;  3AEF B;  2LVQ A;  4HCN B;  1UGM A;  2KN5 A;  3MC8 A;  1NVI D;  3M95 A;  4E3C A;  3MJW A;  3VTU A;  3A4S C;  1HTQ A;  2V4I B;  3AN1 A;  2K0P A;  4GSW A;  3VDZ A;  1R4M B;  2H89 B;  3I9V 1;  2WU2 B;  1WR6 E;  2V3P A;  1E10 A;  3QK0 A;  2QCZ A;  2XK5 B;  1KF6 B;  1CJE A;  4LNF A;  4XDD A;  4IDI A;  2BW2 A;  1KLU D;  2K9X A;  4XE0 A;  1D3Z A;  4M02 A;  2CU3 A;  2BS4 B;  1I4P A;  5CHV C;  1ZDX A;  3N9Y C;  1FCL A;  1C79 A;  4HPM B;  2IO2 B;  1XLN A;  2DZJ A;  2CHZ A;  1WJU A;  2L76 A;  1OTR B;  1YJ1 A;  2L52 A;  4IW0 A;  2WXR A;  1L7Y A;  2WDT B;  2M0A A;  1WGH A;  2KO3 A;  2L0F A;  4FJZ A;  1FFV A;  1ACC A;  1N62 A;  2BB5 A;  1I4Q A;  2LAS A;  2RDG A;  3NJT A;  3SDL C;  2L05 A;  4KKJ A;  3PV1 A;  3VAW A;  1F2R I;  3SFE B;  5J17 A;  2O6V D;  3MP9 A;  4BKG A;  4M0W A;  1I42 A;  5AZG A;  2AQ2 B;  3Q3O C;  4GDL B;  3P4P B;  3DBR I;  3HK0 A;  4WQM A;  3U7D A;  3Q3N C;  1YQB A;  2DBY A;  5J18 A;  1E8Y A;  1AAR A;  3AE7 B;  3PLV A;  2BVC A;  4ZRQ A;  3P4R B;  3DHH C;  5KHQ A;  4BAX A;  4IM0 A;  2WGS A;  2JU6 X;  1V81 A;  2G1E A;  4HKZ E;  1AYF A;  2WX1 A;  1WGK A;  3HVZ A;  1M94 A;  4A3O A;  3IT4 B;  1FMA D;  2KOX A;  5BMI A;  3AV8 A;  3NRZ A;  2D3G A;  5DPS A;  2NCN A;  4K81 A;  1UZX B;  3UI3 A;  2BT6 A;  4B95 A;  2N9X A;  3H7S A;  1ESF A;  4N9F 4;  2I1J A;  3U7Z A;  5BMH A;  1L2N A;  3CIR B;  4DDG D;  5EE1 A;  5CHF A;  2MEK A;  2DEN B;  3O13 A;  3IG3 A;  4NPN A;  5EE0 A;  3Q3F A;  1I4G A;  3SHQ A;  3W1S A;  2A5U A;  2WDQ B;  4LNK A;  1I4R A;  1KRH A;  2AQ3 B;  2JRI B;  1MG4 A;  3V61 A;  4EEW A;  4ZRP A;  5MPO A;  3R3M A;  2MX2 A;  5HFY A;  1P1A A;  3KYD D;  1YN3 A;  2V0G A;  1VLB A;  4H2A A;  3PZ7 A;  3N1Z C;  4FXC A;  2AQ1 B;  4RNA A;  4K7S A;  3RD2 A;  3RNF C;  5CX3 A;  2OJW A;  1V1P A;  2W9N A;  1I4X A;  2BYV E;  3A9K A;  2Y5B B;  4NY0 A;  2KN4 A;  4PS7 A;  3U8Z A;  1ET6 A;  4LLG M;  2IDY A;  2IGH A;  4HWI B;  2KQ4 X;  2DZI A;  1U4A A;  2KFJ A;  1EO6 A;  3WA0 A;  2FAZ A;  3BYY B;  1QKZ A;  3RNA C;  4IG7 B;  2KQ7 A;  1WRI A;  4AJY B;  1LFD A;  5L95 C;  1YIW A;  2QIE B;  1D5Z C;  4DHJ D;  1J7B A;  4YXD B;  4AOF A;  2L3Z A;  1WM3 A;  4HRS A;  3T3O A;  1TS3 A;  3R2T A;  3PRM B;  3N20 C;  1J8C A;  4WH4 A;  4S17 A;  2ZNV B;  3MHS D;  3HIZ A;  1G6J A;  4DBG A;  1WRD B;  1KH0 A;  4WUR A;  4KZ0 A;  1DOY A;  2M17 A;  5C1Z A;  3PSE B;  4XZ4 A;  5AUI A;  3N30 A;  3U30 A;  2CS4 A;  4K1R B;  2NVU I;  3DBH B;  3VFK A;  3A9K B;  2HTH A;  2G4S A;  2ZNV C;  2J0J A;  2RPV A;  1TY2 A;  2AL6 A;  4GN1 A;  2KC2 A;  4IKG A;  1FRD A;  2GBN A;  1XD3 B;  2PJH A;  1IUE A;  3NZ3 A;  2NS5 A;  3TCA A;  3JSV B;  2BBC A;  4JWU C;  3J9C A;  1GAQ B;  2KWC A;  2CU1 A;  4KKI A;  3ZJV A;  3ZDM C;  3GP7 A;  2FCN A;  2RSU A;  3Q69 A;  3ENE A;  1NI3 A;  2IO0 B;  1ENF A;  1GNU A;  2FE8 A;  2DX5 B;  1SBB B;  1KOT A;  3QCA A;  2I38 A;  4EKU A;  2MJD A;  3UQB A;  1C4A A;  1ZXH A;  2RDB C;  1K52 A;  2KZR A;  2OHF A;  4W9D A;  3TEW A;  3QX1 A;  4NJ7 A;  4ANV A;  2C7M B;  4YL8 A;  5C23 A;  2KX3 A;  1HE8 A;  1T0S C;  3QA8 A;  1WR1 A;  1F77 A;  4KZC A;  1RRB A;  3AE2 B;  2HDE A;  3PHW B;  2NPT A;  1K8R B;  1UWX A;  4IWP A;  2QC8 A;  3ZVV A;  1XLO A;  4HEA 1;  1ZP0 B;  3A4R A;  1R7S A;  1E8X A;  2IY0 B;  3I3T B;  1TJE A;  1UF0 A;  2GBR A;  3JW0 X;  4I6N B;  2HJ1 A;  3FIL A;  1T0Y A;  5IAA C;  3B9J A;  1ZDV A;  4LJO B;  1WGR A;  3NUH B;  1JML A;  5KHO A;  4HJG E;  2D11 A;  2GOW A;  2KDM A;  3TMP B;  4IWO A;  1GC6 A;  3CF6 E;  1F9J A;  1RM6 C;  4FHK A;  3B0A A;  4ZHP A;  4KSL C;  1SJE D;  3R2I A;  2EMS A;  2KKC A;  3BZD B;  5E6P A;  3ZKJ C;  4HPP A;  4MDK E;  2KAJ A;  4OVZ A;  2C9W B;  3HRD D;  1RYJ A;  1TYG B;  3BYT B;  1WWT A;  3PZ8 A;  3U52 E;  3H9D A;  1C78 A;  1TKY A;  4C00 A;  4P6V F;  3QAQ A;  2TSS A;  2KFK B;  2E3T A;  4ARC A;  3LB8 C;  2GB1 A;  1VCB A;  4C7Z A;  2D5G A;  3EHV A;  1E9M A;  4B0M A;  5AZH A;  3EC8 A;  3P2B A;  1WSP A;  1XO3 A;  4AP4 C;  3ZGZ A;  2J0K A;  4LCD E;  4YTN B;  4MSQ B;  3RNC C;  4ZDV A;  3LXF A;  4II3 B;  2FIF A;  3A33 B;  3OLM D;  2ZCB A;  2C7H A;  4KDI C;  3W5U B;  3LDZ E;  3RNE C;  1JW9 D;  1LM8 B;  2UWQ A;  3DBH I;  2MJE A;  4BVU C;  3P1M A;  2ON8 A;  2PIA A;  1J7C A;  2LZ6 A;  3WAN A;  1GJZ A;  1I35 A;  3APD A;  1ZUD 2;  2AL3 A;  2IPK D;  2JZP A;  3NVV A;  2LUE A;  2WQY B;  2CHW A;  3NVY A;  2WXG A;  3ZQ4 A;  2HTM E;  1WXS A;  2N9E B;  3OG5 A;  3TBL D;  4KX6 B;  1TTN A;  4JPS A;  2RPQ A;  3NS8 A;  3DHI C;  4IUM B;  4FHJ A;  5FR3 A;  4W9H A;  1QF6 A;  1UGJ A;  4OZC A;  4EUT A;  1I7H A;  4AUQ C;  4B0E A;  2BWF A;  3RCZ A;  2G3Q B;  5AZF A;  2MHJ A;  1TY0 A;  5CTR C;  4W9G A;  3PRP B;  1KFY B;  2JRH A;  1JWU D;  1OQY A;  1Q1O A;  4PS8 A;  2JQR B;  1ZOY B;  4G50 A;  2Z8L A;  1VJK A;  2REX A;  4MGK E;  3KYC D;  4CO7 A;  3TEZ A;  3AEC B;  1RAX A;  3BY4 B;  1KTK A;  2IGD A;  3L17 A;  3WCQ A;  4MM3 A;  1FIQ A;  3BK2 A;  1F0Z A;  1WF9 A;  1FXI A;  4OZB A;  4W9I A;  4ITK A;  2PEA A;  3IAS 1;  1ZW7 A;  4RH6 A;  3ZJT A;  2WWZ A;  3Q3M C;  4XWT A;  1NEK B;  2B76 B;  4KGS A;  2IGG A;  1WYG A;  3QQ8 B;  4ASW C;  4MSM B;  1B1Z A;  3ZW3 A;  2N9K A;  2WXK A;  3DBS A;  1EF5 A;  4WJN A;  5IOI A;  1LO5 D;  2JVC A;  3R66 C;  4CQN A;  3C8Y A;  4C56 C;  1E5W A;  3PLU A;  3KQ4 A;  2I2Y A;  2IYD B;  3RPF C;  2K8C A;  1STE A;  2N7D A;  3RUI B;  5BMG A;  3GB1 A;  2X38 A;  3HHM A;  3EEC A;  2IZV B;  2PLP A;  3ETR A;  4MM3 B;  4KV2 A;  2MP2 A;  3UGB B;  5LNK 1;  1C3T A;  4JWS C;  1SXT A;  3NOB A;  3KW5 B;  3P42 A;  1Q5W B;  3TEX A;  4ZOH C;  3DDC B;  1NYQ A;  1TS5 A;  3EGR A;  3H7P B;  2KVZ A;  3HUI A;  3TIX A;  2QSD A;  4W9L A;  4XYC A;  1T0Q C;  1P0R A;  4NNJ B;  4BZA A;  4RGT A;  2JZZ A;  2LHD A;  4ANU A;  4I6L B;  5EDS A;  4FUL A;  3B2G A;  2MH7 A;  3EA6 A;  1OEY A;  3Q2A C;  1MJD A;  1V8C A;  2YEP B;  4KSK C;  3RYT A;  4MGI E;  2OOB B;  1H4R A;  1FPY A;  1YOV B;  1IBX A;  3WAL A;  5C2T B;  2N9P C;  3AEG B;  4LTU A;  5BYR A;  4RGN A;  1ET9 A;  4MGY E;  1KJT A;  4NAW A;  1MHX A;  2JZ3 B;  3H6N A;  2INN E;  3HVD A;  3RUL A;  2MP2 B;  4URK A;  2JWZ A;  3ZRC A;  2WDV B;  2KTF A;  5DPR A;  3BWU D;  2K8B A;  1R4N B;  5G5G A;  3N32 A;  2LRU A;  2FUG 1;  2CKH B;  1A5R A;  2KK8 A;  2V3N A;  3QIJ A;  1ZGU B;  1FXA A;  2LGI A;  4B6W A;  1E7V A;  2DZM A;  3VVW B;  2WLB A;  1WIA A;  2KWU B;  1SB3 C;  2SEB D;  2EEL A;  3VH4 B;  2K25 A;  3W2D A;  3Q8A A;  5IN7 A;  3BK1 A;  4MAC A;  4FAD A;  2W3R A;  3L54 A;  3HM6 X;  1EF1 A;  3R8B A;  1UWM A;  4WWN A;  3ZUN A;  1ROE A;  2WXI A;  3UIO B;  2BKF A;  3AI5 A;  1MVK A;  2LGS A;  3TL5 A;  4BKS D;  2IJ0 A;  2N0S B;  4OVV A;  4I6P A;  5TR5 A;  3DVG Y;  1RWS A;  4F1S A;  2FBW B;  3TSS A;  3QJZ A;  4NAW B;  3PS6 A;  2RD0 A;  2EKE C;  3TUO A;  2WXH A;  4IWQ A;  4EOY A;  2AEH A;  3D32 A;  4KIK A;  4W9C A;  4BBN C;  4W9J A;  5BO4 B;  1NDD A;  4AQ7 A;  2LJI A;  3AE9 B;  4M0W B;  3VTV A;  2JXT A;  1WXV A;  2ZEQ A;  2KXJ A;  4MT5 A;  2DHZ A;  3C0R B;  1WJ6 A;  3ONS A;  2K1F A;  3KWL A;  3APC A;  3P63 A;  2ZW1 A;  2KMC A;  3NY5 A;  4P7I A;  3X23 A;  4M8N A;  3GE8 C;  3OJ4 B;  1TBE A;  2GBM A;  2V9H A;  4XX5 A;  2BYT A;  2RGF A;  1V5O A;  2KYW A;  4EZL A;  3H8H A;  1IYF A;  3NVW A;  1V2Y A;  2ZCC A;  2VZK D;  4PYU A;  1PGA A;  3W5V B;  3CST A;  3APF A;  3N3K B;  3VUW A;  1C77 A;  3BII D;  4D2K A;  2L00 B;  5DPW A;  4WJQ A;  2MBQ A;  2BF8 B;  1R4M I;  2G45 B;  2ZVO A;  1V86 A;  3PPA A;  4IM2 A;  4ZRI A;  1ZXI A;  2PPH A;  2R2O A;  2FUH B;  3GZN B;  1WX9 A;  2DLB A;  1UBI A;  2LXA A;  4ZYN A;  2ZW0 A;  4TSS A;  3Q8B A;  2O6V A;  2EKI A;  1FO4 A;  3Q3J A;  2C5L C;  1VZ6 A;  4P16 A;  1ZKH A;  1WZ0 A;  2ZPY A;  4W9K A;  1K53 A;  3ZNG C;  3VUX A;  4NQK E;  3V3X A;  2ZVN A;  4KGR A;  4TMA B;  2DYO A;  2GBK A;  2BS3 B;  2KDF B;  2YLM A;  3IVF A;  1V1P B;  2J7Q B;  3SEB A;  5L83 A;  1V1O A;  4N58 A;  3CSF A;  1DYQ A;  1N63 A;  1JWS D;  2GI9 A;  3W1S C;  1C76 A;  2MLB A;  3N1X C;  5I4D A;  1Y8R C;  4J3O D;  4L2Y A;  4A8X C;  1CZP A;  2PW9 A;  1YX5 B;  2J53 A;  1HXY D;  1R4N I;  1WXM A;  3OWE B;  4MEM A;  5TSS A;  3T8M A;  1P3Q U;  1V80 A;  4LJP B;  1C4C A;  1TS2 A;  1WGG A;  4LDT B;  2KDE B;  3B1L X;  3KH0 A;  1NBF C;  2MBO A;  1OEY J;  2KWD A;  1E6E B;  1C9F A;  4NAM A;  1QOF A;  4F7Z A;  2WYQ A;  1WE6 A;  2Y5C A;  2D3C A;  1F52 A;  1IPG A;  4YTP B;  3LJ3 A;  1L4D B;  4HPL B;  2JT4 B;  3JVZ X;  3MJ5 A;  3Q6B A;  2M0X A;  3Q14 C;  1QZE A;  4Q2J A;  1WMH A;  2KT7 A;  3A1Q A;  2R61 A;  1V5T A;  4JX1 C;  3WAO A;  4A90 A;  2XNA C;  1FFU A;  2D10 A;  1CK1 A;  5CHW A;  3W9C B;  2WXM A;  1SE3 A;  2W55 A;  4MH8 A;  4ZRJ A;  3Q8C A;  1MI0 A;  4AWJ A;  3ZNH B;  1Z2M A;  4TKN A;  1XQQ A;  3T3N A;  3KLS X;  4NJ6 A;  5E6O A;  1N61 A;  3R7Q A;  3L0W B;  5GMV A;  4BOS C;  3ZLZ A;  3I57 A;  1J0G A;  3DQV A;  2G4D B;  3BVZ A;  4W9E A;  1L0X B;  4OVU A;  1SJH D;  3K9O B;  1L6V A;  1QT9 A;  2K3U A;  4HDQ A;  2CHX A;  2HD5 B;  3AE3 B;  3NVZ A;  3DWM A;  2PE9 A;  3MC0 B;  4AJW A;  1FNU A;  4HKQ A;  2D07 B;  3QAR A;  4HJK A;  3ZTD A;  1WY8 A;  1TKE A;  2VZK B;  4LK0 M;  3Q8E A;  1XF5 L;  1E8Z A;  1L4Z B;  3LYY A;  3A1Q B;  1WXA A;  4A9A A;  4BFR A;  1BUI C;  1H8C A;  1FEH A;  4XDC A;  3GZN I;  5BYS A;  4GMV A;  4MEL A;  2ONQ A;  2Z0D B;  4OHJ A;  2NPT B;  1JCK B;  1UUP A;  2O2V A;  3PHX B;  4GIV A;  1E0Z A;  4DXA B;  1E7U A;  2PVG C;  3C19 A;  1E90 A;  5D6J B;  3IBE A;  2YVC A;  1SEB D;  2OJR A;  2UYZ B;  2W54 A;  3AE6 B;  5BYQ A;  4KDL B;  1UD7 A;  3FIL B;  2JXX A;  3U2S C;  5JHB A;  3I5J C;  4RGO S;  1D6E C;  4DXF A;  1JWB D;  3OJ3 A;  2EMT A;  3AM9 A;  3TJP A;  3AH7 A;  4YT0 B;  3N1Y C;  3M62 B;  3RNB C;  1WE7 A;  4GDK A;  1V49 A;  3PRE A;  1TKG A;  3ML9 A;  3E56 A;  1TIF A;  2QMT A;  1Q10 A;  1L6U A;  4C80 A;  1JRP A;  5D2M B;  1SSN A;  4MJS A;  2CJN A;  1E8W A;  1BT0 A;  3Q8F A;  4K7U A;  4IC7 B;  2GBJ A;  4BOZ B;  1A70 A;  5G2N A;  3NHE B;  4G3X B;  1YQ3 B;  3V62 A;  2L0T A;  1VZ7 A;  1KLV A;  2O2V B;  4RM8 A;  3GOE A;  3I63 C;  3RN9 C;  2M4N A;  2WXN A;  1WGY A;  1UH6 A;  2VH1 A;  4S0R A;  1HTO A;  1WH3 A;  1PFD A;  2NMQ A;  3ZJU A;  3AUL A;  2OED A;  2KLC A;  3PTF C;  2NBW B;  2M8S A;  1K50 A;  2JX5 A;  4TV3 A;  3V6C B;  2MBB B;  4LNI A;  2IBI B;  3PT2 B;  4PK1 A;  1VD2 A;  1WX7 A;  1JRO A;  2DYB A;  4YSX B;  4WAF A;  1N5X A;  3ALB A;  4ZHO A;  1SIJ A;  4KVG B;  1YJI A;  2WXQ A;  2KNB A;  3A9J A;  1ZE3 D;  1YNT E;  4AS1 A;  2LMC A;  1C4P A;  3PRZ A;  4ZYS A;  2JWU A;  3HM3 A;  4O1N A;  1SE4 A;  2ZJD A;  4EFO A;  1C1Y B;  1SE9 A;  2LXC A;  5LXH A;  2N7J A;  2X8X X;  2IY1 B;  2QJL A;  2D3A A;  2D2Q A;  2XEW A;  3DOW A;  3ZYY X;  4K3B A;  2N1W A;  5HI1 A;  4XWW A;  2LGX A;  4K3C A;  2DNF A;  3VH3 B;  4HRO A;  1WXQ A;  1BML C;  3QHT A;  4M00 A;  4ICU A;  4PT5 A;  4GB9 A;  4ANW A;  2BB6 A;  1EUV B;  5IO9 A;  5AEK B;  1QOB A;  1IGC A;  1T0R C;  1VZ8 A;  2AX5 A;  3AEB B;  4C4V A;  2BS2 B;  4JIO U;  3T9L A;  2DWQ A;  1ZPS A;  2WU5 B;  3MC9 A;  5H92 C;  3AU4 A;  3AEA B;  2LVO A;  3RT3 B;  2MBH A;  3PZD A;  2LHE A;  1B9R A;  3DVG X;  3KUZ A;  1BXT A;  2FNJ B;  2K5P A;  2QDF A;  1D5X C;  3TEY A;  1WJ4 A;  2DAF A;  2LI5 A;  1QOA A;  2BPS A;  4IM3 A;  5FKA C;  1PYW D;  2LFI A;  2Y3A A;  5D3I B;  2KX0 A;  5LXI B;  3KUC B;  3U4E G;  2NTT A;  3VQI A;  1V97 A;  3L16 A;  2AYO B;  3MHZ A;  1Y56 A;  3AE1 B;  3AE4 B;  1CQV A;  1QLB B;  4F8C B;  1UNS A;  4HLE A;  5D3D A;  1SE2 A;  4GDL A;  2VRR B;  1HEZ E;  1QIL A;  4LNO A;  4IOI E;  2K6D B;  1MG8 A;  1NYR A;  1X1M A;  3AED B;  2KLG A;  5HKH A;  2KAN A;  3ECI A;  2PVO D;  1D4B A;  1WX8 A;  3P4Q B;  3P4S B;  4PS3 A;  4C4V B;  2WXJ A;  2A4Z A;  2C7N B;  1NI2 A;  2JUO A;  4WQO B;  4US8 A;  2GLS A;  1OQR A;  2CJO A;  2WNM A;  4RF0 A;  4A3P A;  2LUM A;  1WM2 A;  1GB4 A;  5HHD G;  5LLI A;  2FID A;  4LDT D;  3PVL A;  1EU3 A;  4L1B A;  4FJY A;  1JWA D;  3DWG C;  3ABV B;  3IT6 B;  5E6N A;  2JYE A;  2V1Y A;  4N6E B;  3VUY A;  4ANX A;  3ZO5 B;  2YEP F;  3ZNI D;  4LNN A;  1PQS A;  1LQB A;  1P98 A;  3PGE A;  3MTN B;  1YJJ A;  4YTM B;  1M4V A;  1GUA B;  2BWE S;  4RM9 A;  2MWS B;  4DQO C;  2WXL A;  3VR8 B;  2WXO A;  1AN8 A;  2LGY A;  2MRP A;  2J0M A;  3H1U A;  4N59 A;  1IBX B;  4RGM A;  1WJN A;  1YN4 A;  3IAM 1;  3RNG C;  3GE3 C;  3RI7 C;  4WWP A;  3BIN A;  1KM7 A;  2LVP A;  2WS3 B;  4E74 A;  1VRA B;  4HK2 A;  2J4X A;  1L0V B;  2ZPN A;  3VTW A;  4ACF A;  3KVF B;  1P7E A;  1OFF A;  4E71 A;  2W3S A;  5IP4 D;  2WX0 A;  2K6Q A;  2QHO A;  2LWP A;  1TS4 A;  4DDI D;  1QOG A;  3URY A;  4M8M A;  3FKY A;  2GMI C;  2E6X A;  2NBV B;  3O65 B;  5C3J B;  5FR6 A;  3E9S A;  1YQ4 B;  3VRA B;  4BBN F;  4ICV A;  1PGB A;  3UF8 A;  1FD6 A;  2RMM A;  4HVB A;  4NJC A;  1YX6 B;  3BVG A;  3RZW C;  1QQR A;  2MBE A;  4JGH B;  4WJP A;  4OW0 A;  3VHT C;  5AUK A;  3DCG A;  1J7A A;  2UU7 A;  1WZ3 A;  2K39 A;  4DHZ E;  2BYE A;  5G5H A;  1WI0 A;  3ZIM A;  4WWO A;  3ZXV A;  1N5W A;  1XEE A;  4OZA A;  1EU4 A;  2LEK A;  2R2Q A;  4L23 A;  2KWV B;  2Q5W D;  2KAC A;  4YSY B;  1SIF A;  2BGF A;  3NS1 A;  3EFU A;  4REZ A;  2PTL A;  3JSV A;  1CMX B;  2KJR A;  4KIK B;  3WAP A;  4ZRK A;  3L08 A;  1EM7 A;  5IA7 A;  3DVN V;  2CR5 A;  1IGD A;  1VDV A;  2IND C;  1LGR A;  1XCT L;  1L5P A;  2FCM A;  5T8I A;  4FLH A;  2K22 A;  1XXG A;  3AMZ A;  3R7R A;  2KJ6 A;  2XBB C;  2BTE A;  5H8Y E;  3EUB 2;  2MSE D;  1Q0W B;  4JE3 B;  2BYF A;  4HCP B;  3L10 B;  3AE5 B;  2BKR B;  2J52 A;  1SF0 A;  2MA9 B;  1RFA A;  2KQS A;  1RFK A;  4USA A;  2QIL A;  1DOX A;  4BKS A;  3DVN U;  4MH0 E;  1FM0 D;  2NTS A;  1FNV A;  2AWT A;  4M01 A;  3CWI A;  4DXG A;  3V6E B;  3JYU A;  4A6Q A;  3CMM B;  2M56 B;  1GG3 A;  2INC C;  1MFW A;  2KJH B;  3UIN B;  1RLF A;  3AXC A;  2Z59 B;  2PMV A;  5J2R A;  1JWM D;  1GOZ A;  2MW5 A;  2C60 A;  2WP9 B;  2O6V B;  1PDX A;  1JRU A;  1F1H A;  3AU5 A;  2MQJ A;  2KDB A;  1JAL A;  1KLG D;  1FXT B;  3QWZ B;  3AEE B;  4FA6 A;  1JQ4 A;  4US9 A;  1EWY C;  3SD5 A;  4RCO A;  4WAA A;  3NZS A;  4P1C C;  4DWF A;  1HZ6 A;  4FN2 A;  2N7E A;  2ZZP B;  4P1B C;  2KVR A;  2Z0E B;  2MJ3 A;  4RFB A;  2N4F A;  3IFW B;  3ZRF A;  4WIP A;  3RFZ B;  3X0W A;  2WDR B;  1OGW A;  4K7W A;  3M3J A;  2G9H D;  1XCQ L;  2PE6 B;  4PYZ A;  1AWD A;  3IHP C;  3QC8 B;  2JY6 A;  5DCN A;  5DPT A;  2B3A A;  4GU2 A;  4EZJ A;  4GXB A;  1YMH E;  2KFK A;  2QEJ C;  2N1V A;  2IO3 B;  2ICI A;  1I4H A;  1MPE A;  1SGH A;  1TZ1 A;  2HE7 A;  4NQL B;  3DPD A;  3DBL B;  2L8J A;  2JF5 A;  4DHZ B;  5FK9 C;  1YN5 A;  3SR6 A;  4DK5 A;  5JXV A;  4KGT A;  1VR9 A;  4R3D A;  3WIM A;  3ZTC A;  5GXG B;  1EWC A;  2FCS A;  5G55 A;  1WMH B;  1WFY A;  1PUT A;  2RR9 A;  2PKO A;  3FAH A;  4G0N B;  1TT5 B;  4EE2 A;  5EE9 A;  4RF1 A;  1HQR D;  4B9K A;  1D5M C;  1V9J A;  3KWV A;  1L0Y B;  2Y5P A;  2N9L A;  2KMA A;  1DOI A;  4EZK A;  3WAM A;  2WHI A;  2NBU A;  1E7P B;  2V3S A;  2J42 A;  4C7Y A;  4DHJ B;  1MHH E;  1ISN A;  4JL9 A;  3EFC A;  4II2 B;  2M19 A;  3B2F A;  1OQQ A;  2GRI A;  3ZNZ B;  1UEL A;  2RDH A;  2L7R A;  4GGQ A;  1GC7 A;  5E6J A;  1GPX A;  3L13 A;  1UBQ A;  4TQ1 A;  2KTR A;  1XT9 B;  3VR9 B;  1J19 A;  4TUU A;  1V6E A;  2MCN B;  2DAJ A;  2LRW A;  4XC2 A;  3MFG A;  3NG0 A;  3NZU A;  4BKT A;  2SAK A;  3V05 A;  1AW7 A;  3VXW A;  2D3B A;  2VH2 A;  1T3Q A;  3UQA A;  2KHW B;  2DYM A;  2INP E;  1HA5 A;  3FC4 A;  4HXD A;  2ACZ B;  4YSZ B;  2JSV X;  4FBJ B;  4FJV B;  3W1Y A;  1LXD A;  3PO0 A;  3K9P B;  5EE3 A;  1P7F A;  1FRR A;  4ARI A;  4WWM A;  3UIP B;  1IP9 A;  4WJO A;  4TQ0 A;  3KUD B;  5D7G A; 
#chains in the Genus database with same CATH homology
 2L83 A;  1C77 A;  3BII D;  1UWX A;  4D2K A;  2PVO D;  2W82 A;  1XLO A;  4HEA 1;  1D4B A;  1ZP0 B;  1XLQ A;  3P4Q B;  3BVM A;  3P4S B;  1R7S A;  2XN9 C;  1TJE A;  2WXJ A;  4GDK B;  1ZXI A;  3FIL A;  4US8 A;  4GLS C;  3B9J A;  1OQR A;  1ZDV A;  2DLB A;  3NUH B;  1JML A;  4HJG E;  3VRB B;  1FNW A;  2JYT A;  2CJO A;  2WNM A;  4RF0 A;  4UDU C;  1T6B X;  2ZW0 A;  2KDM A;  2LUM A;  4TSS A;  3Q8B A;  1GB4 A;  5HHD G;  2EKI A;  1FO4 A;  1RM6 C;  4L1B A;  1EU3 A;  1VZ6 A;  4P16 A;  1JWA D;  1F2R C;  4ZHP A;  1SJE D;  3R2I A;  1K53 A;  3BZD B;  3DWG C;  1K51 A;  3ABV B;  3V3X A;  2L32 A;  2KAJ A;  3IT6 B;  4OVZ A;  4KGR A;  2JYE A;  4N6E B;  4TMA B;  2DYO A;  3HRD D;  1RYJ A;  1TYG B;  3BYT B;  1WWT A;  3L4P A;  1PGX A;  2YEP F;  3PZ8 A;  1TZO A;  2BS3 B;  3U52 E;  1C78 A;  1V1P B;  1TKY A;  4YWG G;  3SEB A;  1NEN B;  4P6V F;  5HG2 A;  3AB5 A;  1FCC C;  2TSS A;  1V1O A;  4N58 A;  2E3T A;  4ARC A;  3LB8 C;  1YJJ A;  4YTM B;  1DYQ A;  1M4V A;  1N63 A;  1JWS D;  2GB1 A;  2GI9 A;  1T5X D;  1XLP A;  1C76 A;  2H88 B;  4C7Z A;  2D5G A;  1E9M A;  3GS2 A;  5I4D A;  4J3O D;  4DQO C;  2WXL A;  4B0M A;  4L2Y A;  3VR8 B;  4A8X C;  1CZP A;  2WXO A;  1AN8 A;  2PW9 A;  2J53 A;  1WSP A;  1XO3 A;  4N59 A;  1HXY D;  1IBX B;  1GB1 A;  4RGM A;  3OWE B;  5TSS A;  3ZGZ A;  1YN4 A;  3IAM 1;  4YTN B;  1C4C A;  1TS2 A;  1DGJ A;  3LXF A;  2WS3 B;  1VRA B;  4A55 A;  2J4X A;  2KMM A;  1N60 A;  2WXP A;  3IXS A;  1L0V B;  3W5U B;  2L1A A;  2KWD A;  1E6E B;  1JW9 D;  3AE8 B;  2WXF A;  1C9F A;  4NAM A;  1QOF A;  3SFD B;  2MJE A;  2Y5C A;  4NZL B;  1HZ5 A;  1P7E A;  2ON8 A;  3AEF B;  3P1M A;  2PIA A;  1J7C A;  1OFF A;  4YTP B;  2W3S A;  1ZUD 2;  1L4D B;  2IPK D;  1NVI D;  2JZP A;  3NVV A;  3MJ5 A;  2WQY B;  3NVY A;  2WXG A;  1TS4 A;  1QOG A;  3ZQ4 A;  2HTM E;  3URY A;  4Q2J A;  4KX6 B;  2E6X A;  2V4I B;  3AN1 A;  5C3J B;  2R61 A;  2K0P A;  3E9S A;  4JPS A;  1YQ4 B;  4JX1 C;  3VRA B;  2XNA C;  4A90 A;  5FR3 A;  1FFU A;  1CK1 A;  3W9C B;  1PGB A;  2WXM A;  1SE3 A;  2W55 A;  2H89 B;  3I9V 1;  4MH8 A;  1QF6 A;  1FD6 A;  2RMM A;  2WU2 B;  4NJC A;  1UGJ A;  3Q8C A;  3BVG A;  1MI0 A;  1QQR A;  2V3P A;  1E10 A;  4OZC A;  1KF6 B;  1CJE A;  1I7H A;  3T3N A;  3KLS X;  1N61 A;  4OW0 A;  4XDD A;  4IDI A;  2BW2 A;  4B0E A;  3I57 A;  5AUK A;  1KLU D;  1J7A A;  2K9X A;  1TY0 A;  4XE0 A;  5G5H A;  2CU3 A;  3BVZ A;  2BS4 B;  1I4P A;  1L0X B;  1N5W A;  1KFY B;  1SJH D;  1XEE A;  4OZA A;  1EU4 A;  2LEK A;  1ZDX A;  1L6V A;  1QT9 A;  4L23 A;  3N9Y C;  1JWU D;  1FCL A;  2Q5W D;  2KAC A;  4YSY B;  2K3U A;  1C79 A;  2JQR B;  1XLN A;  1ZOY B;  3NS1 A;  2Z8L A;  3AE3 B;  3NVZ A;  3DWM A;  4REZ A;  2PTL A;  1VJK A;  3MC0 B;  2L52 A;  3TEZ A;  2WXR A;  3AEC B;  1FNU A;  1EM7 A;  1KTK A;  2M0A A;  1IGD A;  1VDV A;  2IGD A;  4HKQ A;  3WCQ A;  1XCT L;  1L5P A;  1FIQ A;  5T8I A;  1FFV A;  3BK2 A;  1ACC A;  1F0Z A;  1N62 A;  2BB5 A;  1I4Q A;  1TKE A;  2K22 A;  2VZK B;  1FXI A;  4OZB A;  1XXG A;  2RDG A;  3AMZ A;  4LK0 M;  4ITK A;  3Q8E A;  1XF5 L;  4KKJ A;  1L4Z B;  3LYY A;  3IAS 1;  1F2R I;  3SFE B;  4A9A A;  4RH6 A;  3ZJT A;  2BTE A;  5H8Y E;  3MP9 A;  3EUB 2;  4M0W A;  4JE3 B;  2AQ2 B;  1BUI C;  4XWT A;  1NEK B;  4GDL B;  2B76 B;  4KGS A;  1FEH A;  3P4P B;  2IGG A;  1WYG A;  3AE5 B;  4XDC A;  2J52 A;  5BYS A;  1SF0 A;  4WQM A;  2ONQ A;  2DBY A;  3AE7 B;  4OHJ A;  1B1Z A;  1RFK A;  1JCK B;  2N9K A;  2QIL A;  4USA A;  2WXK A;  1UUP A;  3P4R B;  4ZRQ A;  1DOX A;  1LO5 D;  1FM0 D;  1E0Z A;  2NTS A;  2PVG C;  1FNV A;  2JU6 X;  2G1E A;  4HKZ E;  1AYF A;  1SEB D;  4CQN A;  3AE6 B;  2W54 A;  3CWI A;  1WGK A;  4DXG A;  5BYQ A;  3C8Y A;  3HVZ A;  4C56 C;  4A6Q A;  3IT4 B;  1FMA D;  3FIL B;  3U2S C;  2M56 B;  5BMI A;  3KQ4 A;  3AV8 A;  4RGO S;  2I2Y A;  1D6E C;  4DXF A;  1JWB D;  3RPF C;  3NRZ A;  2PMV A;  3AM9 A;  1STE A;  3UI3 A;  2BT6 A;  3AH7 A;  1JWM D;  4YT0 B;  1GOZ A;  1ESF A;  2WP9 B;  1PDX A;  5BMG A;  3GB1 A;  3U7Z A;  2X38 A;  3ETR A;  5BMH A;  2PLP A;  3CIR B;  4MM3 B;  1TKG A;  1JAL A;  1KLG D;  5EE1 A;  2MEK A;  3E56 A;  5LNK 1;  2QMT A;  3O13 A;  3AEE B;  4JWS C;  1Q10 A;  1JQ4 A;  1SXT A;  5EE0 A;  1L6U A;  4US9 A;  1EWY C;  4C80 A;  1JRP A;  1I4G A;  1SSN A;  4RCO A;  3W1S A;  2WDQ B;  3P42 A;  1HZ6 A;  1I4R A;  1KRH A;  2AQ3 B;  4ZRP A;  3TEX A;  2CJN A;  5MPO A;  4ZOH C;  5HFY A;  1YN3 A;  3Q8F A;  2V0G A;  2MJ3 A;  4RFB A;  1VLB A;  1NYQ A;  1TS5 A;  4WIP A;  3EGR A;  3PZ7 A;  4H2A A;  3RFZ B;  3HUI A;  1A70 A;  2WDR B;  2QSD A;  4FXC A;  2AQ1 B;  2G9H D;  4RNA A;  1XCQ L;  1YQ3 B;  1AWD A;  4RGT A;  2LHD A;  1V1P A;  1VZ7 A;  3B2G A;  2MH7 A;  1I4X A;  3EA6 A;  1YMH E;  2QEJ C;  2KN4 A;  2WXN A;  1ET6 A;  2ICI A;  4LLG M;  2IDY A;  2IGH A;  1PFD A;  1V8C A;  2YEP B;  2KQ4 X;  1I4H A;  1MPE A;  2NMQ A;  3ZJU A;  2OED A;  3BYY B;  1QKZ A;  1IBX A;  5C2T B;  1K50 A;  1WRI A;  2JX5 A;  5FK9 C;  3AEG B;  4LTU A;  5BYR A;  1YN5 A;  2QIE B;  4RGN A;  3SR6 A;  1D5Z C;  1ET9 A;  5JXV A;  4KGT A;  1JRO A;  4YSX B;  4WAF A;  1VR9 A;  1J7B A;  1N5X A;  4R3D A;  4YXD B;  1MHX A;  4ZHO A;  1SIJ A;  1YJI A;  2WXQ A;  2INN E;  3HVD A;  5GXG B;  4HRS A;  1ZE3 D;  1YNT E;  4AS1 A;  3T3O A;  1TS3 A;  3R2T A;  1EWC A;  2LMC A;  1C4P A;  2WDV B;  4WH4 A;  3BWU D;  5G5G A;  1PUT A;  2FUG 1;  4ZYS A;  2JWU A;  2PKO A;  3FAH A;  1SE4 A;  2V3N A;  4O1N A;  1FXA A;  2LGI A;  1KH0 A;  4EE2 A;  4WUR A;  5EE9 A;  4RF1 A;  1DOY A;  2WLB A;  1HQR D;  2N7J A;  1D5M C;  2QJL A;  5AUI A;  3KWV A;  1SB3 C;  1L0Y B;  2Y5P A;  2N9L A;  2SEB D;  1DOI A;  2EEL A;  3W2D A;  3Q8A A;  3BK1 A;  4MAC A;  2W3R A;  3ZYY X;  1E7P B;  3R8B A;  1UWM A;  5HI1 A;  2J42 A;  4C7Y A;  4XWW A;  2RPV A;  1TY2 A;  1MHH E;  1ROE A;  4HRO A;  2WXI A;  1WXQ A;  4IKG A;  1FRD A;  1BML C;  1MVK A;  3NZ3 A;  1IUE A;  4PT5 A;  2M19 A;  2IJ0 A;  2N0S B;  3B2F A;  1OQQ A;  2GRI A;  2BB6 A;  2BBC A;  1RWS A;  4JWU C;  3J9C A;  1QOB A;  2FBW B;  2RDH A;  1GAQ B;  3TSS A;  1IGC A;  1VZ8 A;  2AX5 A;  3AEB B;  4NAW B;  2BS2 B;  5E6J A;  1GPX A;  4KKI A;  3ZJV A;  4TQ1 A;  2DWQ A;  1ZPS A;  2WU5 B;  3VR9 B;  3TUO A;  2WXH A;  5H92 C;  3GP7 A;  3Q69 A;  3AEA B;  1NI3 A;  2LHE A;  1B9R A;  3MFG A;  1ENF A;  2FE8 A;  4AQ7 A;  1BXT A;  2LJI A;  2K5P A;  3AE9 B;  1SBB B;  1D5X C;  2SAK A;  3TEY A;  3V05 A;  1AW7 A;  2JXT A;  2I38 A;  1QOA A;  1T3Q A;  2MJD A;  5FKA C;  1PYW D;  2LFI A;  4MT5 A;  2Y3A A;  5D3I B;  2DYM A;  1C4A A;  2INP E;  1ZXH A;  1K52 A;  3U4E G;  1HA5 A;  2NTT A;  3FC4 A;  3VQI A;  1V97 A;  3KWL A;  2ACZ B;  3P63 A;  2OHF A;  4YSZ B;  2JSV X;  1Y56 A;  2ZW1 A;  3AE1 B;  3MHZ A;  3TEW A;  3AE4 B;  1CQV A;  1QLB B;  3PO0 A;  1UNS A;  5EE3 A;  1P7F A;  2BYT A;  5D3D A;  1SE2 A;  1FRR A;  4ARI A;  1HEZ E;  3H8H A;  1QIL A;  3NVW A;  4WWM A;  2VZK D;  4IOI E;  1PGA A;  1F77 A;  3W5V B;  3AE2 B;  2HDE A;  1NYR A;  4TQ0 A;  3AED B;  5D7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...