1F2RI

Nmr structure of the heterodimeric complex between cad domains of cad and icad
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
b'MELSRGASAPDPDDVRPLKPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWTYNDSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-ACTIVATED DNASE
publication title Structure of the heterodimeric complex between CAD domains of CAD and ICAD.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f2rI00
4IOIE 4IKGA 4MACA 2EELA 4KGSA 5BMHA 1FD6A 1MHXA 1Q10A 4KGRA 4HKZE 5HI1A 1F2RC 1C9FA 1HZ6A 2LHEA 5HFYA 1EM7A 1MHHE 4OZAA 2KDMA 1P7FA 2ON8A 1XCQL 4KGTA 3UI3A 1GB1A 2N7JA 1QKZA 1GB4A 2ONQA 2PTLA 4WH4A 5HG2A 1HZ5A 1KH0A 2QSDA 1P7EA 1IGDA 1ZXHA 2JZPA 5HHDG 2NMQA 2KACA 4OZCA 5BMIA 4OZBA 1IBXB 2ZW1A 4D2KA 1F2RI 2J52A 2J53A 3MP9A 2LHDA 2RPVA 2IGGA 4HJGE 1YMHE 1IBXA 5JXVA 2RMMA 3FILB 1PGBA 1FCCC 3GB1A 1MI0A 1K53A 2N9KA 2JXTA 1D4BA 2QMTA 2IGHA 1XF5L 1PGXA 2PLPA 1XCTL 2K0PA 1YNTE 2N9LA 2JU6X 4GLSC 2GB1A 2ZW0A 1MPEA 1FCLA 2JSVX 2PW9A 1JMLA 2KWDA 5BMGA 1MVKA 2JWUA 1K52A 2I2YA 1IGCA 2KN4A 3V3XA 2KQ4X 1K50A 1K51A 1UWXA 3FILA 2GI9A 2IGDA 2OEDA 1PGAA 2LGIA 2LUMA 2I38A 1HEZE
chains in the Genus database with same CATH superfamily
2J4XA 1WRIA 3R8BA 4WJOA 4IM0A 2Y5PA 3TSSA 2G3QB 3K9PB 4LLGM 2ZEQA 2KO3A 5CHWA 5JH5C 5BYRA 3B2FA 3BK2A 1VZ6A 4ZRJA 4A90A 3ECIA 1F77A 1T0SC 2KN5A 4L1BA 2LEKA 3OAWA 1HE8A 5IP4D 3UI3A 4IG7B 2FUG1 1JWUD 3RI7C 4YTPB 1IGDA 4MT5A 4HK2A 4M01A 4ZYNA 3WCQA 4OZBA 4DXAB 3AE8B 2RDHA 3PLVA 2RPQA 5J2RA 2KX3A 1I4XA 2TSSA 1U4AA 4FULA 4HPLB 2SEBD 1HTOA 1KFYB 2N9EB 1ZP0B 1PGBA 2E3TA 3Q3FA 1TS2A 1JW9D 2R2OA 4ICVA 4HDQA 1R4MI 4ZRQA 2D3AA 3ML8A 3PRMB 3TEYA 3NHEB 3EA6A 3AXCA 1WR1A 1B1ZA 2MSED 2ZCBA 2GB1A 3H7PB 4NQLB 1RAXA 5EE9A 2KK8A 4HEA1 4US9A 3NVZA 1QILA 4RFBA 1JCKB 3VHTC 4KDIC 2KWUB 2WXNA 2BF8B 4EFOA 3FILA 2G1EA 1LQBA 4DDGD 3W1YA 4HDOA 4W9HA 2JYEA 2BBCA 2AQ1B 3ZTDA 2R61A 2KNBA 3PO0A 3B9JA 4CHKA 4IM2A 2LMCA 2L0FA 2LXCA 4HKQA 4PYZA 1GOZA 1WR6E 2DZIA 3B08A 3PPAA 2UWQA 5KHQA 3ZIMA 3I5JC 1M4VA 3AM9A 4PS7A 2MLBA 1NDDA 1I35A 3PLUA 3TL5A 1FFVA 1FMAD 4EZJA 2CHWA 4LNIA 3ZVVA 3U2SC 4A20A 2NMQA 4OVVA 4W9FA 3UIPB 2JZZA 2AYOB 4DHZB 2Z0DB 1V97A 2IGGA 2MBQA 1P98A 4XGAB 5EE3A 3BVGA 4C00A 2N0SB 3Q69A 2DYMA 4GU2A 3I63C 2KTFA 4RH6A 3V62A 1SEBD 2FIFA 2EMSA 2JT4B 4LCDE 4YXDB 2ZCCA 1KM7A 2HTME 1F0ZA 2W82A 2IZVB 4YSXB 1QQRA 1XLQA 2KMCA 3TJPA 3ONSA 3BIID 3ZXVA 3ZNID 2BKRB 4DBGA 3U7ZA 5FR6A 4XDDA 5BYQA 3V3XA 4S17A 1L0VB 5JZEB 2LXAA 4FADA 2KD0A 2YEPF 4ZDVA 1STEA 2CU3A 1KOTA 3I9V1 2W55A 3RNEC 2AL3A 2UYZB 4PYUA 2JWZA 1S1QB 1GC6A 3AE9B 3TBLD 2QDFA 2Z59B 3DPDA 3X23A 2NTTA 3EC8A 1UD7A 2KANA 3C0RB 3VTWA 3SFEB 4ICUA 3AEBB 1KF6B 2JRHA 4MSQB 3RPFC 3AE3B 1E7UA 2ON8A 1ZXIA 3MHZA 4MGKE 1PUTA 1TS4A 5IN7A 4ZYSA 2N7JA 3N20C 2J7QB 2FUHB 3A4SC 4HXDA 4C7ZA 2ONQA 1V1PB 3VAWA 1EWCA 4TKNA 4TMAB 1ZOYB 3P1MA 1UGMA 3CF6E 4GXBA 4BKSD 4W9LA 5KHOA 2K6QA 4XC2A 4G0NB 5H8YE 1ACCA 2JPHA 3P4SB 2FCNA 1EU3A 1Z5SB 2O2VB 2DZKA 4XYCA 2CJNA 1XLPA 3SHQA 3WALA 3P2BA 4FBJB 3QWZB 2VZKD 3QIJA 3IFWB 2CS4A 2KYWA 1L6VA 2PLPA 3DBHB 4FHJA 2KQ7A 2K0PA 2MA9B 2N9LA 2DYBA 2K5PA 2J0JA 4HPPA 1MPEA 4G11A 4ASWC 4DK5A 4KX6B 1N6ZA 1QOAA 1XLOA 3DHIC 1D3ZA 3MHSD 1WXAA 2KN4A 1BMLC 3P4PB 3Q8FA 5CX3A 1CZPA 1PQSA 3Q3MC 1C78A 3QC8B 1WGRA 3RMKC 2WDVB 3NZSA 4GDKA 1ZDVA 3VUWA 4JWSC 1FNWA 5BYSA 2YEPB 1TYGB 4LDTD 1AYFA 4HKZE 3HK0A 2BVCA 3O65B 1UF0A 1ZW7A 3PZ7A 2N9XA 4YTMB 2BS4B 3H1UA 2K8HA 4AWJA 1EF5A 3H8HA 2DZJA 4P1CC 4BBNF 4MM3A 1I4PA 1QKZA 4W9KA 2MBEA 1QOBA 2WGSA 2PEAA 2M0AA 5D6JB 4NJCA 2AEHA 1KJTA 2D2QA 4GN1A 3BWUD 5BMIA 1CMXB 4QAYA 2Y5BB 4KZCA 1C4AA 2W3SA 3AI5A 3R7QA 4MGIE 2BYEA 1FXTB 2J42A 3A33B 1R4NI 4JL9A 2KVZA 4ACFA 3HM6X 4YSYB 1DOIA 4OHJA 5I4DA 1JWMD 1WXMA 2QMTA 3DBRB 5IA7A 1XF5L 1HA5A 1VJKA 4RF0A 1L0XB 1WXVA 2LZ6A 1GPXA 4NAWB 4BAXA 5AUIA 3NVWA 2PE9A 1LXDA 5EE0A 2KWVB 1JQ4A 3QJZA 2XN9C 2G9HD 2V3SA 5AEKB 1I4HA 2LWPA 4A8XC 3N1ZC 3AEFB 2WQYB 4EOYA 2HE7A 2INCC 5J17A 2LFIA 3ETRA 1HEZE 3E9SA 1FXAA 4HWIB 3IBEA 5JHAA 3P42A 2MJDA 3HIZA 1HXYD 3C19A 3NS8A 3ABVB 3AEAB 1KLGD 1HZ6A 1UNSA 3DQVA 4RF1A 2CKHB 3A1QB 4FHKA 3OWEB 1VRAB 2KFJA 4PS8A 2WS3B 1C1YB 5E6PA 2O6VA 1ZXHA 1RLFA 3MFGA 1WY8A 1OQRA 3HVZA 3PTFC 2BB5A 2ZJDA 4OZCA 2D10A 1ENFA 3RNBC 3ML9A 4MH0E 3VXWA 2WDQB 3M62B 1C77A 2BS2B 3IAM1 4ANWA 3PZ8A 2AWTA 2FE8A 2L7RA 5JXVA 1V49A 1QOGA 1FO4A 3OJ3A 4USAA 3AE1B 1FPYA 4ZHOA 1C4PA 4DHJB 2I1KA 3GE3C 4KKIA 2X8XX 4KV2A 5IAAC 1TY0A 3Q8BA 4GGQA 4NJ7A 2GLSA 4IWQA 2CJOA 4XWWA 1WRDB 1YNTE 4W9IA 3A9KA 1T0YA 2JU6X 1I4RA 4GLSC 1FM0D 4ARIA 4KSKC 1UH6A 3NVVA 3RULA 4LJOB 1IGCA 2KQ4X 1C3TA 3MTNB 1ZDXA 3NRZA 4CYEA 2VRRB 3NOBA 5FKAC 1DOYA 3GZNI 4LNFA 1WIAA 1OGWA 1WXSA 4I6PA 3BY4B 4ZOHC 4C4VB 3AU5A 2R2QA 2GBMA 3RNAC 2C7NB 3VVWB 2N7DA 2YVCA 2A4ZA 2BYVE 3HUIA 4NZLB 2PE6B 2WX0A 2CU1A 2N9PC 1OFFA 2DENB 1N60A 2G45B 3GE8C 4GDLB 2LHEA 2KMMA 4P7IA 5CTRC 2WXLA 3ZJVA 4RM8A 2MWSB 3AE4B 2MP2B 4ZRKA 2HTHA 5DCNA 2DNFA 1TT5B 2IYDB 2LGSA 1GB1A 4B9KA 1J7BA 1KH0A 1Q0WB 2QSDA 1SIJA 3DBSA 2FCMA 5HKHA 1JWSD 3ZJUA 2PMVA 3L13A 2YLMA 1WSPA 2WXPA 2KZRA 4FXCA 3JW0X 3T9LA 1WMHB 4GSWA 1SIFA 3EUB2 1WGDA 3VRAB 1D5MC 2XBBC 2MH7A 1WYGA 2PPHA 1E8WA 1I7HA 1FNVA 1D5XC 2DX5B 4MELA 2DWQA 4PT5A 1EWYC 5CHVC 3DOWA 1FXIA 3UIOB 1FCLA 5DPTA 5LXIB 4DXFA 4S0RA 3BINA 5D7GA 2L00B 5E6OA 2QC8A 3APCA 2MCNB 1UWMA 3SDLC 1M94A 1K50A 2KHWB 3QQ8B 2JRIB 2V1YA 4BBNC 1FRRA 2NPTA 3N1XC 3JSVB 4C7YA 1E8XA 1YQ4B 1WZ3A 1I4QA 5HI1A 4ANUA 2NCNA 4NJ6A 3KYDD 1YQBA 4BKTA 2EELA 3L10B 2AL6A 5TSSA 2ASQA 2JQRB 2M56B 2QEJC 2XEWA 1ZGUB 4AUQC 1KTKA 1WM3A 1YJ1A 4OZAA 4WQOB 4OVUA 4JWUC 2KVRA 2GMIC 2K1FA 2W54A 2BYTA 1DOXA 4DHZE 1E90A 1VD2A 1GB4A 3V61A 2ZVOA 1E7PB 2BYFA 2IDYA 4ZHPA 4JLCA 2KACA 2HJ1A 3AEDB 3APDA 2WLBA 3KW5B 5G2NA 1E8YA 1TKYA 2LUEA 2OJWA 2PIAA 3MC8A 3AE7B 1S3SG 2C7HA 1YX5B 2GBJA 3GB1A 4HPMB 1KRHA 2N9KA 1D5ZC 2AQ2B 3AEEB 3AH7A 2IBIB 3N30A 1J19A 4M8MA 1WGHA 1TJEA 3N3KB 3AE2B 2KWCA 2M1MA 1ET9A 1F9JA 3PRZA 1WJUA 1DYQA 1B9RA 1WH3A 2DLBA 3L4PA 1UBQA 2Z0EB 1WWTA 1TS3A 2PVOD 3U30A 3L54A 3NZUA 3DWGC 2LUMA 4NAMA 5BMHA 2WXGA 2LVPA 1IP9A 1R4MB 3W5UB 4C4VA 2AQ3B 4CO7A 3QAQA 2KMAA 3HM3A 4BKGA 1FIQA 1BUIC 4US8A 1P1AA 1P9DU 2KXJA 1H4RA 3NUHB 2WWZA 5DPSA 5C23A 2FCQA 4JIOU 4K1RB 3RNGC 4F8CB 1Q5WB 1RWSA 2WXFA 1JROA 3N9YC 2JVCA 1ZE3D 2KC1A 2M8SA 2H89B 3RUIB 2MP2A 1EF1A 5E6NA 1T5XD 4FJYA 3RD2A 3ZO5B 5IOIA 1E0ZA 2KFKB 4M02A 4TV3A 1LGRA 3LYYA 4GMVA 4K7SA 1V5TA 2LGXA 4A3OA 1UELA 3AULA 3R7RA 1YMHE 2L0TA 4KDLB 1L2NA 1VR9A 2M17A 3PSEB 2L52A 4P6VF 1K53A 2JXTA 3IAS1 1OTRB 1H8CA 4IWOA 3RN9C 1V2YA 4LK0M 1N5XA 1WGYA 4AOFA 1XCTL 2UU7A 3FKYA 3ZUNA 2NBVB 4I6LB 5D94A 5CHFA 1IYFA 3HHMA 3L0WB 3T3NA 1WE7A 4NNJB 3AB5A 1K52A 2KDIA 2M4NA 2HD5B 1JWAD 3ZLZA 5LLIA 3NG0A 3VRBB 4M0WB 2BT6A 3R3MA 3AEGB 2LJ5A 2O6VD 3L16A 3P4RB 2ZPNA 2KLGA 2V3NA 2MRPA 1NYRA 4LDTB 2K6DB 4K3BA 4F1SA 1WGKA 3H7PA 3V6CB 5J18A 1YJIA 1BT0A 4A9AA 5G55A 2RR9A 4W9GA 2ACZB 2CHZA 4YWGG 4FN2A 2ZNVC 3AN1A 2RGFA 4KGTA 3U52E 4WURA 3AU4A 3URYA 2PTLA 4WH4A 4FA6A 1IPGA 2JZPA 3PGEA 3L08A 3SU8X 1EO6A 1Z2MA 1SXTA 2HJ8A 2BTEA 2ZW1A 4IDIA 3J9CA 4AS1A 4GIVA 2K22A 3CSFA 2LHDA 4JX1C 1TY2A 4RGNA 5AZHA 4WAAA 1UBIA 5G5GA 3U7DA 4G50A 5D3IB 4W9EA 2DAJA 2GOWA 4W9CA 2ZZPB 2L76A 1KLVA 1V9JA 3A4RA 5AZGA 2K8CA 2NTSA 1AWDA 3ZGZA 2IGHA 3ZRFA 3WA0A 4E74A 3DBLI 1ISNA 2PJHA 3QHTA 3SR6A 2JY6A 1HQRD 1ZKHA 2IY1B 2V4IB 4A55A 1E6EB 4YT0B 4DDID 4PS3A 1QF6A 3GS2A 3W1SC 1JALA 4EE2A 4BFRA 3AECB 2LRUA 3EFUA 4YTNB 1C4CA 1K51A 2KDEB 1RFKA 3DVNV 2IGDA 2INDC 1NI2A 2ICIA 1WF9A 2ZVNA 1WE6A 4EEWA 2PVGC 3P4QB 2DAFA 5C1ZA 1J7AA 1AW7A 3UQBA 2G4DB 2C60A 4DQOC 3AE5B 1XO3A 4FJZA 3VR8B 3FC4A 3D32A 2BGFA 3ZQ4A 1CK1A 2KDMA 2WXQA 4RCOA 4HJKA 3IHPC 2C9WB 2CR5A 2KT7A 1P0RA 2K39A 4C80A 4A3PA 3L17A 4JPSA 1C76A 4EZLA 1TIFA 4GB9A 1HTQA 4DXGA 2OOBB 4IC7B 2WDTB 1F2RI 4RM9A 3SD5A 3H7SA 2BW2A 3JYUA 1SJHD 4L23A 2D3BA 3CIRB 4WIPA 2RMMA 3FILB 4KZ0A 1KLUD 3PREA 3MC0B 1T6BX 4ANXA 1K8RB 2OJRA 3X0WA 3BK1A 4M8NA 4MJSB 3WAMA 3PZDA 3RFZB 1V1PA 2W3RA 2B3AA 4RNAA 3VQIA 4L2YA 1NVID 3VTVA 4ZRIA 2IO2B 2DYOA 3K9OB 2L05A 1V1OA 2L1AA 4EZKA 2QJLA 2RSUA 3WIMA 1R7SA 4TQ0A 3Q2AC 4WWMA 3HRDD 1GJZA 2WXIA 5MPOA 1ZPSA 1RYJA 3ZKJC 3KLSX 2O2VA 4XDCA 5C3JB 3TEWA 2KAJA 1V86A 2KJRA 3UQAA 2I38A 5IO9A 2N1VA 2WXKA 4J6IA 4M0WA 3U8ZA 4KGSA 1R4NB 1FD6A 1YX6B 3T3OA 3E56A 2JXXA 3B0AA 1V80A 2KJHB 2GRIA 1XCQL 1SJED 4HROA 3N1YC 1WM2A 3OG5A 1ROEA 2JUOA 1HZ5A 3NY5A 1GC7A 2V3PA 3B2GA 4ANVA 2G4SA 2WXOA 4TQ1A 2KDBA 3TIXA 4HCPB 1N62A 3PT2B 3MP9A 4OW0A 2RPVA 2RDGA 2GBRA 3ZJTA 3QK0A 1SE4A 2GBKA 4Q2JA 4AJYB 3IXSA 4LTUA 3KUDB 1D4BA 2K8BA 2LVOA 1Y8RC 2PKOA 4YSZB 2D5GA 5BO4B 1X1MA 2ZW0A 1LM8B 4HCNB 3NS1A 1I42A 2WXHA 1XEEA 5BMGA 3U4EG 3VH4B 2MJ3A 3PVLA 4H2AA 5GXGB 5E6JA 2IO0B 3WAPA 2C5LC 3DVGX 4WJPA 3VR9B 4M00A 4WAFA 1PFDA 2WDRB 2FIDA 1J8CA 1WX9A 1PGAA 3NZ3A 3MC9A 1UZXB 2Q5WD 2KX0A 1N5WA 4MACA 1XXGA 1GG3A 4K7UA 4NAWA 4LJPB 4N6EB 4EKUA 1E7VA 3VUXA 1E8ZA 4B0EA 1WXQA 3GOEA 3LDZE 4P1BC 5EDSA 2J0KA 1MJDA 5HFYA 1MHHE 1P7FA 3IVFA 2LGYA 4ARCA 1GUAB 1TKEA 2ZPYA 3V05A 5C2TB 4JQWC 4E71A 1XD3B 3VFKA 2Y3AA 3KVFB 4LNOA 1L6UA 3NJTA 3QA8A 3GZNB 1FFUA 4IUMB 3ZTCA 3Q6BA 4C56C 5T8IA 1G6JA 2M0XA 2IY0B 2QHOA 2C7MB 3DVNU 2MJEA 4MDKE 3RZWC 1L0YB 3EGRA 1TKGA 4J3OD 1YIWA 3BYYB 3A1QA 1YQ3B 2FBWB 2AX5A 2KOXA 4GDKB 1MI0A 1SE2A 3DHHC 3SFDB 3W2DA 2H88B 2NBWB 3ZW3A 4CQNA 2Z8LA 1V5OA 4KIKB 3BVMA 4MJSA 2PW9A 1JMLA 1C79A 2CHXA 4ZRPA 2INNE 4BZAA 3AE6B 2N7EA 4MM3B 3IT4B 3KQ4A 2WXJA 1UUPA 2GI9A 3EHVA 2N4FA 3DDCB 3KWVA 1NENB 2OEDA 2ZNVB 3ZNZB 1UGJA 2BB6A 4IOIE 3UGBB 4IM3A 1Q10A 3W5VB 1SBBB 2B76B 2E6XA 4KKJA 2WXMA 1SF0A 2KTRB 4HLEA 1F2RC 1C9FA 2QCZA 2V9HA 2JX5A 1WJ4A 2WP9B 1PYWD 1WJ6A 3Q3NC 3DBHI 3HVDA 2V0GA 4MGYE 5FK9C 1CQVA 5LNK1 1EU4A 3ZDMC 1ESFA 2RDBC 2WXRA 1OQQA 3VUYA 3BYTB 2WU5B 3PHWB 4NPNA 3TMPB 1P7EA 5L95C 1MG4A 3AMZA 3APFA 1T3QA 1IBXB 4D2KA 1L4ZB 4W9JA 1MG8A 2XK5B 2BKFA 4B6WA 4JE3B 5TR5A 2BS3B 2D3GA 3IT6B 1SSNA 1QT9A 2NR2A 4XZ4A 1J0GA 4GDLA 2JYTA 2D07B 3T8MA 1AARA 2D11A 2BPSA 1OQYA 1L7YA 3H6NA 4W9DA 1L5PA 2VH1A 2KDFB 4YL8A 2FAZA 1XQQA 2JSVX 3M95A 1E9MA 1JRUA 3PHXB 4BVUC 1SE3A 5EE1A 2I2YA 1WMHA 1ET6A 4TSSA 2MBOA 4K81A 2IO1B 2VZKB 3P63A 1P3QU 1NBFC 4B95A 3CSTA 2O6VB 2MQJA 2IO3B 1EUVB 3DWMA 3ZYYX 2WYQA 1CJEA 4IKGA 1TZOA 3UF8A 2EMTA 1MHXA 4RGMA 3Q8EA 1YN3A 2KKCA 2KLCA 3BZDB 1AN8A 4KSLC 4B0MA 4K3CA 3TEXA 1TTNA 3I3TB 3EECA 2DBYA 1SE9A 3LB8C 4WQMA 2WX1A 3DBRI 3R66C 3LJ3A 3OJ4B 3RZFA 1J7CA 1QZEA 4WJQA 2DZMA 2WU2B 5G5HA 4G3XB 2INPE 3MJ5A 2MEKA 3RNFC 3JSVA 3A9KB 4ITKA 1FEHA 4MSMB 1YJJA 2SAKA 2MW5A 3A9JB 1F52A 4JGHB 3S2AA 3R2TA 2LVQA 4IWPA 5H92C 3R2IA 2BQQA 4RMAA 1PDXA 4PK1A 1I4GA 4E3CA 2NVUI 1TZ1A 4II3B 1YOVB 4BOZB 1T0QC 1NEKB 2VH2A 1E5WA 4WJNA 3TUOA 4TUUA 1PGXA 2N1WA 1GAQB 4FLHA 1RRBA 5DPRA 3W9CB 2EKIA 2LRWA 1D6EC 3Q3OC 1VZ7A 1NYQA 4XE0A 5AZFA 2QIEB 1VLBA 4EUTA 2MBHA 3N32A 1VZ8A 4KIKA 3VDZA 1TBEA 1BXTA 1UWXA 1F1HA 3QCAA 3QX1A 4HRSA 4WWOA 2IJ0A 3DHGC 1L4DB 1YN4A 2LGIA 3KWLA 4XWTA 3Q14C 4REZA 1VCBA 3V6EB 3ENEA 1A5RA 5JHBA 2KQSA 2XNAC 4NQKE 1E10A 2HDEA 3FAHA 4N59A 1EM7A 4WWPA 1SB3C 1LO5D 1RM6C 1YD8U 3CWIA 1TGZB 2KTRA 3AV8A 4II2B 3H9DA 2NBUA 5L83A 2WNMA 4FJVB 3RCZA 1OEYA 3SEBA 5HHDG 4HVBA 4LNNA 3WAOA 1WFYA 2J52A 3TCAA 4X57B 2NS5A 4N58A 3B1LX 3KUCB 1JRPA 2FNJB 5AUKA 1Q1OA 3V60A 1IBXA 1WYWB 2LASA 4URKA 2XK5A 2KC2A 2BWFA 3M3JA 1V8CA 3PV1A 3IG3A 2DHZA 4OVZA 3O13A 2K3UA 3KH0A 4IW0A 2NPTB 4A6QA 3Q8AA 2MHJA 2EKEC 3ZNHB 3DCGA 3C8YA 2LJIA 3W1SA 3NVYA 1WX7A 2QILA 3RT3B 4BKSA 3UINB 2KFKA 4AJWA 1IUEA 2KWDA 3JVZX 3KYCD 2K25A 4F7ZA 3KUZA 5LXHA 1V81A 4AQ7A 1TS5A 2LGDA 4RGTA 4AP4C 2J0MA 2M19A 1OEYJ 3ZXRA 2D3CA 1WX8A 3EFCA 2L3ZA 1XLNA 2Y5CA 2V4LA 3I57A 4R3DA 4MH8A 2FCSA 2OHFA 1QLBB 2WHIA 2JF5A 3LXFA 3Q8CA 3ZRCA 1DGJA 2I1JA 2IPKD 3ZNGC 4KGRA 1WGGA 3RNCC 2REXA 1WZ0A 3DBLB 1NI3A 4KVGB 4XX5A 1WI0A 4N9F4 3CMMB 2GBNA 3OLMD 3BVZA 1FNUA 3TEZA 4RGOS 5HG2A 4I6NB 1N61A 4UDUC 3PS6A 2K9XA 4LNKA 4O1NA 4MGZE 1A70A 3MJWA 1WJNA 1N63A 2BWES 2J53A 2MX2A 3QARA 4NY0A 2LD9A 1V6EA 4DWFA 4MEMA 4HJGE 1YN5A 2L83A 2KJ6A 3A9JA 4WWNA 3DVGY 1ZUD2 1Y56A 5IKCM 1FCCC 3VTUA 4DHJD 5FR3A 3PRPB 2W9NA 3ZDTA 4GOCA 3Q3JA 5GMVA 2L8JA 1MFWA 1LFDA 2JZ3B 3GP7A 1FRDA 2L32A 3RYTA 1VDVA 4K7WA 1XT9B 1MVKA 2JWUA 1QOFA 1SGHA 5D3DA 1JWBD 2RD0A 2MBBB 2A5UA 1RFAA 1GNUA 1T0RC 5DPWA 3VH3B 4P16A 3WANA 2X38A 5D2MB 3ALBA 2LI5A 3M63B 4BOSC
chains in the Genus database with same CATH topology
2BB6A 2J4XA 1WRIA 4IOIE 3R8BA 2V3NA 3P42A 2MJDA 2Y5PA 3TSSA 1Q10A 3W5VB 4LLGM 1NYRA 1HXYD 1SBBB 2B76B 2E6XA 5BYRA 4KKJA 2WXMA 3B2FA 3BK2A 1WGKA 1VZ6A 1SF0A 4A90A 1YJIA 1F2RC 1F77A 3ABVB 3AEAB 1KLGD 4A9AA 1C9FA 1HZ6A 1UNSA 2JX5A 2WP9B 4RF1A 1PYWD 4L1BA 2LEKA 2ACZB 4YWGG 3OWEB 1VRAB 3HVDA 3AN1A 4KGTA 3UI3A 2V0GA 5FK9C 1CQVA 2WS3B 1EU4A 5LNK1 3U52E 2FUG1 4WURA 3URYA 1ESFA 2WXRA 1JWUD 1OQQA 3BYTB 2PTLA 2WU5B 4WH4A 4YTPB 1P7EA 1IGDA 1ZXHA 2JZPA 4MT5A 3MFGA 3AMZA 1OQRA 3HVZA 2BB5A 4OZCA 1T3QA 3WCQA 4OZBA 1ENFA 1SXTA 1IBXB 2BTEA 2ZW1A 1L4ZB 4D2KA 2WDQB 3AE8B 3J9CA 4IDIA 4AS1A 2RDHA 2K22A 1C77A 2BS2B 1I4XA 2LHDA 2TSSA 3IAM1 4JE3B 4JX1C 2BS3B 3PZ8A 2SEBD 1TY2A 4RGNA 3IT6B 1SSNA 1QT9A 2FE8A 1KFYB 5JXVA 1QOGA 5G5GA 1FO4A 1ZP0B 1PGBA 4USAA 5D3IB 3AE1B 2E3TA 2JYTA 4ZHOA 1C4PA 1TS2A 1JW9D 4KKIA 4ZRQA 3TEYA 2NTSA 1AWDA 3ZGZA 2IGHA 1L5PA 1TY0A 3Q8BA 3EA6A 2CJOA 4XWWA 1YNTE 1B1ZA 3SR6A 2JU6X 1I4RA 2GB1A 4GLSC 1HQRD 2JSVX 1E9MA 5EE9A 1FM0D 2V4IB 4ARIA 4A55A 1E6EB 4HEA1 4YT0B 4US9A 3NVZA 1QF6A 1QILA 3GS2A 3NVVA 1JALA 1SE3A 4RFBA 4EE2A 1JCKB 5EE1A 2I2YA 1IGCA 2KQ4X 3AECB 1ET6A 4TSSA 1ZDXA 4YTNB 2WXNA 3NRZA 1C4CA 2VZKB 3P63A 1DOYA 5FKAC 1K51A 3FILA 2G1EA 1RFKA 2IGDA 2ICIA 4ZOHC 3DWMA 3ZYYX 2JYEA 2PVGC 3P4QB 2BBCA 2AQ1B 1CJEA 4IKGA 1TZOA 2R61A 1MHXA 1J7AA 3Q8EA 1YN3A 4RGMA 1AW7A 3PO0A 3HUIA 3B9JA 3BZDB 1AN8A 2LMCA 4NZLB 3AE5B 1XO3A 4B0MA 4DQOC 4HKQA 3TEXA 1GOZA 3VR8B 1OFFA 1N60A 3FC4A 2DBYA 3LB8C 2LHEA 2KMMA 1M4VA 3AM9A 4GDLB 4WQMA 3ZQ4A 1CK1A 2WXLA 2KDMA 3ZJVA 2WXQA 4RCOA 3AE4B 1J7CA 1FFVA 1FMAD 2WU2B 5G5HA 4C80A 1GB1A 2INPE 4JPSA 1C76A 3MJ5A 1J7BA 2MEKA 1KH0A 2QSDA 1SIJA 3U2SC 2NMQA 4DXGA 4ITKA 1FEHA 1JWSD 3ZJUA 1YJJA 1F2RI 2PMVA 2SAKA 1WSPA 2WXPA 1V97A 4FXCA 2IGGA 2BW2A 1SJHD 5EE3A 4L23A 3BVGA 3R2TA 2N0SB 3CIRB 3Q69A 2DYMA 3EUB2 5H92C 4WIPA 2RMMA 3R2IA 3FILB 4RH6A 1PDXA 1KLUD 1SEBD 1I4GA 3VRAB 1D5MC 3MC0B 1T6BX 2MH7A 1WYGA 1NEKB 4YXDB 1I7HA 3BK1A 1FNVA 1D5XC 2DWQA 3TUOA 1V1PA 2W3RA 2HTME 3RFZB 1PGXA 1F0ZA 4RNAA 3VQIA 2W82A 1GAQB 4PT5A 1EWYC 4YSXB 4L2YA 1QQRA 1XLQA 3W9CB 1NVID 1FXIA 2EKIA 1D6EC 1VZ7A 1FCLA 2DYOA 3BIID 4DXFA 1NYQA 4XE0A 1V1OA 2L1AA 3U7ZA 5D7GA 4XDDA 2QIEB 2QJLA 1VLBA 5BYQA 3V3XA 1VZ8A 1R7SA 1UWMA 4TQ0A 1L0VB 1K50A 2YEPF 4WWMA 3HRDD 1BXTA 1STEA 1UWXA 2WXIA 5MPOA 1ZPSA 1RYJA 2CU3A 3KLSX 4HRSA 3I9V1 4XDCA 5C3JB 2IJ0A 3TEWA 1FRRA 2KAJA 2W55A 4C7YA 1L4DB 1YN4A 1YQ4B 2LGIA 3KWLA 1I4QA 2I38A 4XWTA 5HI1A 4REZA 3AE9B 2WXKA 4M0WA 2EELA 4KGSA 1FD6A 5TSSA 3T3OA 3E56A 2JQRB 2NTTA 2M56B 2XNAC 2QEJC 3SFEB 3AEBB 1KF6B 1E10A 3RPFC 2HDEA 3AE3B 3FAHA 1KTKA 4N59A 1EM7A 2GRIA 4OZAA 2ON8A 1XCQL 1SB3C 1ZXIA 3MHZA 1SJED 1LO5D 1RM6C 3CWIA 1PUTA 3AV8A 4HROA 4JWUC 2W54A 1DOXA 1TS4A 2BYTA 4ZYSA 2N7JA 1GB4A 4C7ZA 1ROEA 2ONQA 2WNMA 1V1PB 1HZ5A 1E7PB 1EWCA 2IDYA 4TMAB 2V3PA 3SEBA 3B2GA 5HHDG 4ZHPA 1ZOYB 2WXOA 4TQ1A 3P1MA 2KACA 2J52A 1N62A 3AEDB 3MP9A 4OW0A 4N58A 2RPVA 2WLBA 1JRPA 2RDGA 5AUKA 5H8YE 1ACCA 3ZJTA 1TKYA 1IBXA 1SE4A 2PIAA 1V8CA 3AE7B 4OVZA 3P4SB 1EU3A 3O13A 2K3UA 4Q2JA 2CJNA 1XLPA 4A6QA 3IXSA 3Q8AA 3GB1A 4LTUA 3C8YA 2VZKD 1KRHA 2N9KA 1D4BA 2LJIA 1D5ZC 3W1SA 3NVYA 2AQ2B 1L6VA 2PLPA 3AEEB 2PKOA 2K0PA 4YSZB 2D5GA 2QILA 2N9LA 3AH7A 2K5PA 2ZW0A 1MPEA 3NS1A 4KX6B 2WXHA 1IUEA 1XEEA 2KWDA 5BMGA 3U4EG 2MJ3A 5GXGB 1QOAA 1XLOA 4H2AA 1TJEA 5E6JA 3AE2B 2KN4A 1BMLC 1ET9A 4AQ7A 1TS5A 3P4PB 3Q8FA 3VR9B 4WAFA 1DYQA 4RGTA 1PFDA 2WDRB 1CZPA 1B9RA 2DLBA 2M19A 3L4PA 1WWTA 1C78A 1TS3A 2PVOD 1XLNA 2Y5CA 3DWGC 1PGAA 2LUMA 3NZ3A 2WDVB 3I57A 4NAMA 2Q5WD 4R3DA 4MH8A 1N5WA 1ZDVA 4MACA 2OHFA 5BMHA 1XXGA 1QLBB 2WXGA 3LXFA 1FNWA 3Q8CA 4JWSC 1DGJA 5BYSA 2YEPB 1TYGB 4N6EB 2IPKD 3W5UB 2AQ3B 4KGRA 1AYFA 1FIQA 4HKZE 4B0EA 1WXQA 1BUIC 1NI3A 3PZ7A 4YTMB 4US8A 2BS4B 5HFYA 1MHHE 1P7FA 4ARCA 3H8HA 3NUHB 3BVZA 1FNUA 3TEZA 1TKEA 1I4PA 4RGOS 1QKZA 3V05A 5C2TB 5HG2A 1RWSA 2WXFA 1JROA 1N61A 4UDUC 3N9YC 1QOBA 1ZE3D 2K9XA 2H89B 2M0AA 2Y3AA 4NJCA 4O1NA 1T5XD 1L6UA 3BWUD 5BMIA 1E0ZA 1A70A 1FFUA 3LYYA 1N63A 2J53A 4C56C 5T8IA 1C4AA 2W3SA 2MJEA 1L0YB 3EGRA 4HJGE 1YMHE 1TKGA 1YN5A 2L83A 4J3OD 3BYYB 2J42A 1YQ3B 1ZUD2 1Y56A 2FBWB 1FCCC 1VR9A 2AX5A 4YSYB 5FR3A 1DOIA 2L52A 4GDKB 4OHJA 4P6VF 5I4DA 1JWMD 1K53A 1MI0A 2JXTA 3IAS1 1SE2A 2QMTA 3SFDB 3W2DA 1XF5L 4LK0M 1HA5A 1N5XA 1VJKA 2H88B 1L0XB 4RF0A 1GPXA 1XCTL 4NAWB 4CQNA 3GP7A 1FRDA 2L32A 5AUIA 2Z8LA 3NVWA 1VDVA 3BVMA 5EE0A 2PW9A 1JQ4A 1JMLA 1C79A 3T3NA 1MVKA 2JWUA 2XN9C 3AB5A 2G9HD 1QOFA 4ZRPA 1I4HA 1K52A 2INNE 5D3DA 1JWBD 3AE6B 4A8XC 3AEFB 2WQYB 1JWAD 4MM3B 3IT4B 3KQ4A 3VRBB 2BT6A 1UUPA 2WXJA 4P16A 3AEGB 2GI9A 3P4RB 2LFIA 2X38A 3KWVA 1NENB 2OEDA 3ETRA 1UGJA 1HEZE 3E9SA 1FXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOI E;  4IKG A;  4MAC A;  2EEL A;  4KGS A;  5BMH A;  1FD6 A;  1MHX A;  1Q10 A;  4KGR A;  4HKZ E;  5HI1 A;  1F2R C;  1C9F A;  1HZ6 A;  2LHE A;  5HFY A;  1EM7 A;  1MHH E;  4OZA A;  2KDM A;  1P7F A;  2ON8 A;  1XCQ L;  4KGT A;  3UI3 A;  1GB1 A;  2N7J A;  1QKZ A;  1GB4 A;  2ONQ A;  2PTL A;  4WH4 A;  5HG2 A;  1HZ5 A;  1KH0 A;  2QSD A;  1P7E A;  1IGD A;  1ZXH A;  2JZP A;  5HHD G;  2NMQ A;  2KAC A;  4OZC A;  5BMI A;  4OZB A;  1IBX B;  2ZW1 A;  4D2K A;  1F2R I;  2J52 A;  2J53 A;  3MP9 A;  2LHD A;  2RPV A;  2IGG A;  4HJG E;  1YMH E;  1IBX A;  5JXV A;  2RMM A;  3FIL B;  1PGB A;  1FCC C;  3GB1 A;  1MI0 A;  1K53 A;  2N9K A;  2JXT A;  1D4B A;  2QMT A;  2IGH A;  1XF5 L;  1PGX A;  2PLP A;  1XCT L;  2K0P A;  1YNT E;  2N9L A;  2JU6 X;  4GLS C;  2GB1 A;  2ZW0 A;  1MPE A;  1FCL A;  2JSV X;  2PW9 A;  1JML A;  2KWD A;  5BMG A;  1MVK A;  2JWU A;  1K52 A;  2I2Y A;  1IGC A;  2KN4 A;  3V3X A;  2KQ4 X;  1K50 A;  1K51 A;  1UWX A;  3FIL A;  2GI9 A;  2IGD A;  2OED A;  1PGA A;  2LGI A;  2LUM A;  2I38 A;  1HEZ E; 
#chains in the Genus database with same CATH topology
 2J4X A;  1WRI A;  3R8B A;  4WJO A;  4IM0 A;  2Y5P A;  3TSS A;  2G3Q B;  3K9P B;  4LLG M;  2ZEQ A;  2KO3 A;  5CHW A;  5JH5 C;  5BYR A;  3B2F A;  3BK2 A;  1VZ6 A;  4ZRJ A;  4A90 A;  3ECI A;  1F77 A;  1T0S C;  2KN5 A;  4L1B A;  2LEK A;  3OAW A;  1HE8 A;  5IP4 D;  3UI3 A;  4IG7 B;  2FUG 1;  1JWU D;  3RI7 C;  4YTP B;  1IGD A;  4MT5 A;  4HK2 A;  4M01 A;  4ZYN A;  3WCQ A;  4OZB A;  4DXA B;  3AE8 B;  2RDH A;  3PLV A;  2RPQ A;  5J2R A;  2KX3 A;  1I4X A;  2TSS A;  1U4A A;  4FUL A;  4HPL B;  2SEB D;  1HTO A;  1KFY B;  2N9E B;  1ZP0 B;  1PGB A;  2E3T A;  3Q3F A;  1TS2 A;  1JW9 D;  2R2O A;  4ICV A;  4HDQ A;  1R4M I;  4ZRQ A;  2D3A A;  3ML8 A;  3PRM B;  3TEY A;  3NHE B;  3EA6 A;  3AXC A;  1WR1 A;  1B1Z A;  2MSE D;  2ZCB A;  2GB1 A;  3H7P B;  4NQL B;  1RAX A;  5EE9 A;  2KK8 A;  4HEA 1;  4US9 A;  3NVZ A;  1QIL A;  4RFB A;  1JCK B;  3VHT C;  4KDI C;  2KWU B;  2WXN A;  2BF8 B;  4EFO A;  3FIL A;  2G1E A;  1LQB A;  4DDG D;  3W1Y A;  4HDO A;  4W9H A;  2JYE A;  2BBC A;  2AQ1 B;  3ZTD A;  2R61 A;  2KNB A;  3PO0 A;  3B9J A;  4CHK A;  4IM2 A;  2LMC A;  2L0F A;  2LXC A;  4HKQ A;  4PYZ A;  1GOZ A;  1WR6 E;  2DZI A;  3B08 A;  3PPA A;  2UWQ A;  5KHQ A;  3ZIM A;  3I5J C;  1M4V A;  3AM9 A;  4PS7 A;  2MLB A;  1NDD A;  1I35 A;  3PLU A;  3TL5 A;  1FFV A;  1FMA D;  4EZJ A;  2CHW A;  4LNI A;  3ZVV A;  3U2S C;  4A20 A;  2NMQ A;  4OVV A;  4W9F A;  3UIP B;  2JZZ A;  2AYO B;  4DHZ B;  2Z0D B;  1V97 A;  2IGG A;  2MBQ A;  1P98 A;  4XGA B;  5EE3 A;  3BVG A;  4C00 A;  2N0S B;  3Q69 A;  2DYM A;  4GU2 A;  3I63 C;  2KTF A;  4RH6 A;  3V62 A;  1SEB D;  2FIF A;  2EMS A;  2JT4 B;  4LCD E;  4YXD B;  2ZCC A;  1KM7 A;  2HTM E;  1F0Z A;  2W82 A;  2IZV B;  4YSX B;  1QQR A;  1XLQ A;  2KMC A;  3TJP A;  3ONS A;  3BII D;  3ZXV A;  3ZNI D;  2BKR B;  4DBG A;  3U7Z A;  5FR6 A;  4XDD A;  5BYQ A;  3V3X A;  4S17 A;  1L0V B;  5JZE B;  2LXA A;  4FAD A;  2KD0 A;  2YEP F;  4ZDV A;  1STE A;  2CU3 A;  1KOT A;  3I9V 1;  2W55 A;  3RNE C;  2AL3 A;  2UYZ B;  4PYU A;  2JWZ A;  1S1Q B;  1GC6 A;  3AE9 B;  3TBL D;  2QDF A;  2Z59 B;  3DPD A;  3X23 A;  2NTT A;  3EC8 A;  1UD7 A;  2KAN A;  3C0R B;  3VTW A;  3SFE B;  4ICU A;  3AEB B;  1KF6 B;  2JRH A;  4MSQ B;  3RPF C;  3AE3 B;  1E7U A;  2ON8 A;  1ZXI A;  3MHZ A;  4MGK E;  1PUT A;  1TS4 A;  5IN7 A;  4ZYS A;  2N7J A;  3N20 C;  2J7Q B;  2FUH B;  3A4S C;  4HXD A;  4C7Z A;  2ONQ A;  1V1P B;  3VAW A;  1EWC A;  4TKN A;  4TMA B;  1ZOY B;  3P1M A;  1UGM A;  3CF6 E;  4GXB A;  4BKS D;  4W9L A;  5KHO A;  2K6Q A;  4XC2 A;  4G0N B;  5H8Y E;  1ACC A;  2JPH A;  3P4S B;  2FCN A;  1EU3 A;  1Z5S B;  2O2V B;  2DZK A;  4XYC A;  2CJN A;  1XLP A;  3SHQ A;  3WAL A;  3P2B A;  4FBJ B;  3QWZ B;  2VZK D;  3QIJ A;  3IFW B;  2CS4 A;  2KYW A;  1L6V A;  2PLP A;  3DBH B;  4FHJ A;  2KQ7 A;  2K0P A;  2MA9 B;  2N9L A;  2DYB A;  2K5P A;  2J0J A;  4HPP A;  1MPE A;  4G11 A;  4ASW C;  4DK5 A;  4KX6 B;  1N6Z A;  1QOA A;  1XLO A;  3DHI C;  1D3Z A;  3MHS D;  1WXA A;  2KN4 A;  1BML C;  3P4P B;  3Q8F A;  5CX3 A;  1CZP A;  1PQS A;  3Q3M C;  1C78 A;  3QC8 B;  1WGR A;  3RMK C;  2WDV B;  3NZS A;  4GDK A;  1ZDV A;  3VUW A;  4JWS C;  1FNW A;  5BYS A;  2YEP B;  1TYG B;  4LDT D;  1AYF A;  4HKZ E;  3HK0 A;  2BVC A;  3O65 B;  1UF0 A;  1ZW7 A;  3PZ7 A;  2N9X A;  4YTM B;  2BS4 B;  3H1U A;  2K8H A;  4AWJ A;  1EF5 A;  3H8H A;  2DZJ A;  4P1C C;  4BBN F;  4MM3 A;  1I4P A;  1QKZ A;  4W9K A;  2MBE A;  1QOB A;  2WGS A;  2PEA A;  2M0A A;  5D6J B;  4NJC A;  2AEH A;  1KJT A;  2D2Q A;  4GN1 A;  3BWU D;  5BMI A;  1CMX B;  4QAY A;  2Y5B B;  4KZC A;  1C4A A;  2W3S A;  3AI5 A;  3R7Q A;  4MGI E;  2BYE A;  1FXT B;  2J42 A;  3A33 B;  1R4N I;  4JL9 A;  2KVZ A;  4ACF A;  3HM6 X;  4YSY B;  1DOI A;  4OHJ A;  5I4D A;  1JWM D;  1WXM A;  2QMT A;  3DBR B;  5IA7 A;  1XF5 L;  1HA5 A;  1VJK A;  4RF0 A;  1L0X B;  1WXV A;  2LZ6 A;  1GPX A;  4NAW B;  4BAX A;  5AUI A;  3NVW A;  2PE9 A;  1LXD A;  5EE0 A;  2KWV B;  1JQ4 A;  3QJZ A;  2XN9 C;  2G9H D;  2V3S A;  5AEK B;  1I4H A;  2LWP A;  4A8X C;  3N1Z C;  3AEF B;  2WQY B;  4EOY A;  2HE7 A;  2INC C;  5J17 A;  2LFI A;  3ETR A;  1HEZ E;  3E9S A;  1FXA A;  4HWI B;  3IBE A;  5JHA A;  3P42 A;  2MJD A;  3HIZ A;  1HXY D;  3C19 A;  3NS8 A;  3ABV B;  3AEA B;  1KLG D;  1HZ6 A;  1UNS A;  3DQV A;  4RF1 A;  2CKH B;  3A1Q B;  4FHK A;  3OWE B;  1VRA B;  2KFJ A;  4PS8 A;  2WS3 B;  1C1Y B;  5E6P A;  2O6V A;  1ZXH A;  1RLF A;  3MFG A;  1WY8 A;  1OQR A;  3HVZ A;  3PTF C;  2BB5 A;  2ZJD A;  4OZC A;  2D10 A;  1ENF A;  3RNB C;  3ML9 A;  4MH0 E;  3VXW A;  2WDQ B;  3M62 B;  1C77 A;  2BS2 B;  3IAM 1;  4ANW A;  3PZ8 A;  2AWT A;  2FE8 A;  2L7R A;  5JXV A;  1V49 A;  1QOG A;  1FO4 A;  3OJ3 A;  4USA A;  3AE1 B;  1FPY A;  4ZHO A;  1C4P A;  4DHJ B;  2I1K A;  3GE3 C;  4KKI A;  2X8X X;  4KV2 A;  5IAA C;  1TY0 A;  3Q8B A;  4GGQ A;  4NJ7 A;  2GLS A;  4IWQ A;  2CJO A;  4XWW A;  1WRD B;  1YNT E;  4W9I A;  3A9K A;  1T0Y A;  2JU6 X;  1I4R A;  4GLS C;  1FM0 D;  4ARI A;  4KSK C;  1UH6 A;  3NVV A;  3RUL A;  4LJO B;  1IGC A;  2KQ4 X;  1C3T A;  3MTN B;  1ZDX A;  3NRZ A;  4CYE A;  2VRR B;  3NOB A;  5FKA C;  1DOY A;  3GZN I;  4LNF A;  1WIA A;  1OGW A;  1WXS A;  4I6P A;  3BY4 B;  4ZOH C;  4C4V B;  3AU5 A;  2R2Q A;  2GBM A;  3RNA C;  2C7N B;  3VVW B;  2N7D A;  2YVC A;  2A4Z A;  2BYV E;  3HUI A;  4NZL B;  2PE6 B;  2WX0 A;  2CU1 A;  2N9P C;  1OFF A;  2DEN B;  1N60 A;  2G45 B;  3GE8 C;  4GDL B;  2LHE A;  2KMM A;  4P7I A;  5CTR C;  2WXL A;  3ZJV A;  4RM8 A;  2MWS B;  3AE4 B;  2MP2 B;  4ZRK A;  2HTH A;  5DCN A;  2DNF A;  1TT5 B;  2IYD B;  2LGS A;  1GB1 A;  4B9K A;  1J7B A;  1KH0 A;  1Q0W B;  2QSD A;  1SIJ A;  3DBS A;  2FCM A;  5HKH A;  1JWS D;  3ZJU A;  2PMV A;  3L13 A;  2YLM A;  1WSP A;  2WXP A;  2KZR A;  4FXC A;  3JW0 X;  3T9L A;  1WMH B;  4GSW A;  1SIF A;  3EUB 2;  1WGD A;  3VRA B;  1D5M C;  2XBB C;  2MH7 A;  1WYG A;  2PPH A;  1E8W A;  1I7H A;  1FNV A;  1D5X C;  2DX5 B;  4MEL A;  2DWQ A;  4PT5 A;  1EWY C;  5CHV C;  3DOW A;  1FXI A;  3UIO B;  1FCL A;  5DPT A;  5LXI B;  4DXF A;  4S0R A;  3BIN A;  5D7G A;  2L00 B;  5E6O A;  2QC8 A;  3APC A;  2MCN B;  1UWM A;  3SDL C;  1M94 A;  1K50 A;  2KHW B;  3QQ8 B;  2JRI B;  2V1Y A;  4BBN C;  1FRR A;  2NPT A;  3N1X C;  3JSV B;  4C7Y A;  1E8X A;  1YQ4 B;  1WZ3 A;  1I4Q A;  5HI1 A;  4ANU A;  2NCN A;  4NJ6 A;  3KYD D;  1YQB A;  4BKT A;  2EEL A;  3L10 B;  2AL6 A;  5TSS A;  2ASQ A;  2JQR B;  2M56 B;  2QEJ C;  2XEW A;  1ZGU B;  4AUQ C;  1KTK A;  1WM3 A;  1YJ1 A;  4OZA A;  4WQO B;  4OVU A;  4JWU C;  2KVR A;  2GMI C;  2K1F A;  2W54 A;  2BYT A;  1DOX A;  4DHZ E;  1E90 A;  1VD2 A;  1GB4 A;  3V61 A;  2ZVO A;  1E7P B;  2BYF A;  2IDY A;  4ZHP A;  4JLC A;  2KAC A;  2HJ1 A;  3AED B;  3APD A;  2WLB A;  3KW5 B;  5G2N A;  1E8Y A;  1TKY A;  2LUE A;  2OJW A;  2PIA A;  3MC8 A;  3AE7 B;  1S3S G;  2C7H A;  1YX5 B;  2GBJ A;  3GB1 A;  4HPM B;  1KRH A;  2N9K A;  1D5Z C;  2AQ2 B;  3AEE B;  3AH7 A;  2IBI B;  3N30 A;  1J19 A;  4M8M A;  1WGH A;  1TJE A;  3N3K B;  3AE2 B;  2KWC A;  2M1M A;  1ET9 A;  1F9J A;  3PRZ A;  1WJU A;  1DYQ A;  1B9R A;  1WH3 A;  2DLB A;  3L4P A;  1UBQ A;  2Z0E B;  1WWT A;  1TS3 A;  2PVO D;  3U30 A;  3L54 A;  3NZU A;  3DWG C;  2LUM A;  4NAM A;  5BMH A;  2WXG A;  2LVP A;  1IP9 A;  1R4M B;  3W5U B;  4C4V A;  2AQ3 B;  4CO7 A;  3QAQ A;  2KMA A;  3HM3 A;  4BKG A;  1FIQ A;  1BUI C;  4US8 A;  1P1A A;  1P9D U;  2KXJ A;  1H4R A;  3NUH B;  2WWZ A;  5DPS A;  5C23 A;  2FCQ A;  4JIO U;  4K1R B;  3RNG C;  4F8C B;  1Q5W B;  1RWS A;  2WXF A;  1JRO A;  3N9Y C;  2JVC A;  1ZE3 D;  2KC1 A;  2M8S A;  2H89 B;  3RUI B;  2MP2 A;  1EF1 A;  5E6N A;  1T5X D;  4FJY A;  3RD2 A;  3ZO5 B;  5IOI A;  1E0Z A;  2KFK B;  4M02 A;  4TV3 A;  1LGR A;  3LYY A;  4GMV A;  4K7S A;  1V5T A;  2LGX A;  4A3O A;  1UEL A;  3AUL A;  3R7R A;  1YMH E;  2L0T A;  4KDL B;  1L2N A;  1VR9 A;  2M17 A;  3PSE B;  2L52 A;  4P6V F;  1K53 A;  2JXT A;  3IAS 1;  1OTR B;  1H8C A;  4IWO A;  3RN9 C;  1V2Y A;  4LK0 M;  1N5X A;  1WGY A;  4AOF A;  1XCT L;  2UU7 A;  3FKY A;  3ZUN A;  2NBV B;  4I6L B;  5D94 A;  5CHF A;  1IYF A;  3HHM A;  3L0W B;  3T3N A;  1WE7 A;  4NNJ B;  3AB5 A;  1K52 A;  2KDI A;  2M4N A;  2HD5 B;  1JWA D;  3ZLZ A;  5LLI A;  3NG0 A;  3VRB B;  4M0W B;  2BT6 A;  3R3M A;  3AEG B;  2LJ5 A;  2O6V D;  3L16 A;  3P4R B;  2ZPN A;  2KLG A;  2V3N A;  2MRP A;  1NYR A;  4LDT B;  2K6D B;  4K3B A;  4F1S A;  1WGK A;  3H7P A;  3V6C B;  5J18 A;  1YJI A;  1BT0 A;  4A9A A;  5G55 A;  2RR9 A;  4W9G A;  2ACZ B;  2CHZ A;  4YWG G;  4FN2 A;  2ZNV C;  3AN1 A;  2RGF A;  4KGT A;  3U52 E;  4WUR A;  3AU4 A;  3URY A;  2PTL A;  4WH4 A;  4FA6 A;  1IPG A;  2JZP A;  3PGE A;  3L08 A;  3SU8 X;  1EO6 A;  1Z2M A;  1SXT A;  2HJ8 A;  2BTE A;  2ZW1 A;  4IDI A;  3J9C A;  4AS1 A;  4GIV A;  2K22 A;  3CSF A;  2LHD A;  4JX1 C;  1TY2 A;  4RGN A;  5AZH A;  4WAA A;  1UBI A;  5G5G A;  3U7D A;  4G50 A;  5D3I B;  4W9E A;  2DAJ A;  2GOW A;  4W9C A;  2ZZP B;  2L76 A;  1KLV A;  1V9J A;  3A4R A;  5AZG A;  2K8C A;  2NTS A;  1AWD A;  3ZGZ A;  2IGH A;  3ZRF A;  3WA0 A;  4E74 A;  3DBL I;  1ISN A;  2PJH A;  3QHT A;  3SR6 A;  2JY6 A;  1HQR D;  1ZKH A;  2IY1 B;  2V4I B;  4A55 A;  1E6E B;  4YT0 B;  4DDI D;  4PS3 A;  1QF6 A;  3GS2 A;  3W1S C;  1JAL A;  4EE2 A;  4BFR A;  3AEC B;  2LRU A;  3EFU A;  4YTN B;  1C4C A;  1K51 A;  2KDE B;  1RFK A;  3DVN V;  2IGD A;  2IND C;  1NI2 A;  2ICI A;  1WF9 A;  2ZVN A;  1WE6 A;  4EEW A;  2PVG C;  3P4Q B;  2DAF A;  5C1Z A;  1J7A A;  1AW7 A;  3UQB A;  2G4D B;  2C60 A;  4DQO C;  3AE5 B;  1XO3 A;  4FJZ A;  3VR8 B;  3FC4 A;  3D32 A;  2BGF A;  3ZQ4 A;  1CK1 A;  2KDM A;  2WXQ A;  4RCO A;  4HJK A;  3IHP C;  2C9W B;  2CR5 A;  2KT7 A;  1P0R A;  2K39 A;  4C80 A;  4A3P A;  3L17 A;  4JPS A;  1C76 A;  4EZL A;  1TIF A;  4GB9 A;  1HTQ A;  4DXG A;  2OOB B;  4IC7 B;  2WDT B;  1F2R I;  4RM9 A;  3SD5 A;  3H7S A;  2BW2 A;  3JYU A;  1SJH D;  4L23 A;  2D3B A;  3CIR B;  4WIP A;  2RMM A;  3FIL B;  4KZ0 A;  1KLU D;  3PRE A;  3MC0 B;  1T6B X;  4ANX A;  1K8R B;  2OJR A;  3X0W A;  3BK1 A;  4M8N A;  4MJS B;  3WAM A;  3PZD A;  3RFZ B;  1V1P A;  2W3R A;  2B3A A;  4RNA A;  3VQI A;  4L2Y A;  1NVI D;  3VTV A;  4ZRI A;  2IO2 B;  2DYO A;  3K9O B;  2L05 A;  1V1O A;  2L1A A;  4EZK A;  2QJL A;  2RSU A;  3WIM A;  1R7S A;  4TQ0 A;  3Q2A C;  4WWM A;  3HRD D;  1GJZ A;  2WXI A;  5MPO A;  1ZPS A;  1RYJ A;  3ZKJ C;  3KLS X;  2O2V A;  4XDC A;  5C3J B;  3TEW A;  2KAJ A;  1V86 A;  2KJR A;  3UQA A;  2I38 A;  5IO9 A;  2N1V A;  2WXK A;  4J6I A;  4M0W A;  3U8Z A;  4KGS A;  1R4N B;  1FD6 A;  1YX6 B;  3T3O A;  3E56 A;  2JXX A;  3B0A A;  1V80 A;  2KJH B;  2GRI A;  1XCQ L;  1SJE D;  4HRO A;  3N1Y C;  1WM2 A;  3OG5 A;  1ROE A;  2JUO A;  1HZ5 A;  3NY5 A;  1GC7 A;  2V3P A;  3B2G A;  4ANV A;  2G4S A;  2WXO A;  4TQ1 A;  2KDB A;  3TIX A;  4HCP B;  1N62 A;  3PT2 B;  3MP9 A;  4OW0 A;  2RPV A;  2RDG A;  2GBR A;  3ZJT A;  3QK0 A;  1SE4 A;  2GBK A;  4Q2J A;  4AJY B;  3IXS A;  4LTU A;  3KUD B;  1D4B A;  2K8B A;  2LVO A;  1Y8R C;  2PKO A;  4YSZ B;  2D5G A;  5BO4 B;  1X1M A;  2ZW0 A;  1LM8 B;  4HCN B;  3NS1 A;  1I42 A;  2WXH A;  1XEE A;  5BMG A;  3U4E G;  3VH4 B;  2MJ3 A;  3PVL A;  4H2A A;  5GXG B;  5E6J A;  2IO0 B;  3WAP A;  2C5L C;  3DVG X;  4WJP A;  3VR9 B;  4M00 A;  4WAF A;  1PFD A;  2WDR B;  2FID A;  1J8C A;  1WX9 A;  1PGA A;  3NZ3 A;  3MC9 A;  1UZX B;  2Q5W D;  2KX0 A;  1N5W A;  4MAC A;  1XXG A;  1GG3 A;  4K7U A;  4NAW A;  4LJP B;  4N6E B;  4EKU A;  1E7V A;  3VUX A;  1E8Z A;  4B0E A;  1WXQ A;  3GOE A;  3LDZ E;  4P1B C;  5EDS A;  2J0K A;  1MJD A;  5HFY A;  1MHH E;  1P7F A;  3IVF A;  2LGY A;  4ARC A;  1GUA B;  1TKE A;  2ZPY A;  3V05 A;  5C2T B;  4JQW C;  4E71 A;  1XD3 B;  3VFK A;  2Y3A A;  3KVF B;  4LNO A;  1L6U A;  3NJT A;  3QA8 A;  3GZN B;  1FFU A;  4IUM B;  3ZTC A;  3Q6B A;  4C56 C;  5T8I A;  1G6J A;  2M0X A;  2IY0 B;  2QHO A;  2C7M B;  3DVN U;  2MJE A;  4MDK E;  3RZW C;  1L0Y B;  3EGR A;  1TKG A;  4J3O D;  1YIW A;  3BYY B;  3A1Q A;  1YQ3 B;  2FBW B;  2AX5 A;  2KOX A;  4GDK B;  1MI0 A;  1SE2 A;  3DHH C;  3SFD B;  3W2D A;  2H88 B;  2NBW B;  3ZW3 A;  4CQN A;  2Z8L A;  1V5O A;  4KIK B;  3BVM A;  4MJS A;  2PW9 A;  1JML A;  1C79 A;  2CHX A;  4ZRP A;  2INN E;  4BZA A;  3AE6 B;  2N7E A;  4MM3 B;  3IT4 B;  3KQ4 A;  2WXJ A;  1UUP A;  2GI9 A;  3EHV A;  2N4F A;  3DDC B;  3KWV A;  1NEN B;  2OED A;  2ZNV B;  3ZNZ B;  1UGJ A;  2BB6 A;  4IOI E;  3UGB B;  4IM3 A;  1Q10 A;  3W5V B;  1SBB B;  2B76 B;  2E6X A;  4KKJ A;  2WXM A;  1SF0 A;  2KTR B;  4HLE A;  1F2R C;  1C9F A;  2QCZ A;  2V9H A;  2JX5 A;  1WJ4 A;  2WP9 B;  1PYW D;  1WJ6 A;  3Q3N C;  3DBH I;  3HVD A;  2V0G A;  4MGY E;  5FK9 C;  1CQV A;  5LNK 1;  1EU4 A;  3ZDM C;  1ESF A;  2RDB C;  2WXR A;  1OQQ A;  3VUY A;  3BYT B;  2WU5 B;  3PHW B;  4NPN A;  3TMP B;  1P7E A;  5L95 C;  1MG4 A;  3AMZ A;  3APF A;  1T3Q A;  1IBX B;  4D2K A;  1L4Z B;  4W9J A;  1MG8 A;  2XK5 B;  2BKF A;  4B6W A;  4JE3 B;  5TR5 A;  2BS3 B;  2D3G A;  3IT6 B;  1SSN A;  1QT9 A;  2NR2 A;  4XZ4 A;  1J0G A;  4GDL A;  2JYT A;  2D07 B;  3T8M A;  1AAR A;  2D11 A;  2BPS A;  1OQY A;  1L7Y A;  3H6N A;  4W9D A;  1L5P A;  2VH1 A;  2KDF B;  4YL8 A;  2FAZ A;  1XQQ A;  2JSV X;  3M95 A;  1E9M A;  1JRU A;  3PHX B;  4BVU C;  1SE3 A;  5EE1 A;  2I2Y A;  1WMH A;  1ET6 A;  4TSS A;  2MBO A;  4K81 A;  2IO1 B;  2VZK B;  3P63 A;  1P3Q U;  1NBF C;  4B95 A;  3CST A;  2O6V B;  2MQJ A;  2IO3 B;  1EUV B;  3DWM A;  3ZYY X;  2WYQ A;  1CJE A;  4IKG A;  1TZO A;  3UF8 A;  2EMT A;  1MHX A;  4RGM A;  3Q8E A;  1YN3 A;  2KKC A;  2KLC A;  3BZD B;  1AN8 A;  4KSL C;  4B0M A;  4K3C A;  3TEX A;  1TTN A;  3I3T B;  3EEC A;  2DBY A;  1SE9 A;  3LB8 C;  4WQM A;  2WX1 A;  3DBR I;  3R66 C;  3LJ3 A;  3OJ4 B;  3RZF A;  1J7C A;  1QZE A;  4WJQ A;  2DZM A;  2WU2 B;  5G5H A;  4G3X B;  2INP E;  3MJ5 A;  2MEK A;  3RNF C;  3JSV A;  3A9K B;  4ITK A;  1FEH A;  4MSM B;  1YJJ A;  2SAK A;  2MW5 A;  3A9J B;  1F52 A;  4JGH B;  3S2A A;  3R2T A;  2LVQ A;  4IWP A;  5H92 C;  3R2I A;  2BQQ A;  4RMA A;  1PDX A;  4PK1 A;  1I4G A;  4E3C A;  2NVU I;  1TZ1 A;  4II3 B;  1YOV B;  4BOZ B;  1T0Q C;  1NEK B;  2VH2 A;  1E5W A;  4WJN A;  3TUO A;  4TUU A;  1PGX A;  2N1W A;  1GAQ B;  4FLH A;  1RRB A;  5DPR A;  3W9C B;  2EKI A;  2LRW A;  1D6E C;  3Q3O C;  1VZ7 A;  1NYQ A;  4XE0 A;  5AZF A;  2QIE B;  1VLB A;  4EUT A;  2MBH A;  3N32 A;  1VZ8 A;  4KIK A;  3VDZ A;  1TBE A;  1BXT A;  1UWX A;  1F1H A;  3QCA A;  3QX1 A;  4HRS A;  4WWO A;  2IJ0 A;  3DHG C;  1L4D B;  1YN4 A;  2LGI A;  3KWL A;  4XWT A;  3Q14 C;  4REZ A;  1VCB A;  3V6E B;  3ENE A;  1A5R A;  5JHB A;  2KQS A;  2XNA C;  4NQK E;  1E10 A;  2HDE A;  3FAH A;  4N59 A;  1EM7 A;  4WWP A;  1SB3 C;  1LO5 D;  1RM6 C;  1YD8 U;  3CWI A;  1TGZ B;  2KTR A;  3AV8 A;  4II2 B;  3H9D A;  2NBU A;  5L83 A;  2WNM A;  4FJV B;  3RCZ A;  1OEY A;  3SEB A;  5HHD G;  4HVB A;  4LNN A;  3WAO A;  1WFY A;  2J52 A;  3TCA A;  4X57 B;  2NS5 A;  4N58 A;  3B1L X;  3KUC B;  1JRP A;  2FNJ B;  5AUK A;  1Q1O A;  3V60 A;  1IBX A;  1WYW B;  2LAS A;  4URK A;  2XK5 A;  2KC2 A;  2BWF A;  3M3J A;  1V8C A;  3PV1 A;  3IG3 A;  2DHZ A;  4OVZ A;  3O13 A;  2K3U A;  3KH0 A;  4IW0 A;  2NPT B;  4A6Q A;  3Q8A A;  2MHJ A;  2EKE C;  3ZNH B;  3DCG A;  3C8Y A;  2LJI A;  3W1S A;  3NVY A;  1WX7 A;  2QIL A;  3RT3 B;  4BKS A;  3UIN B;  2KFK A;  4AJW A;  1IUE A;  2KWD A;  3JVZ X;  3KYC D;  2K25 A;  4F7Z A;  3KUZ A;  5LXH A;  1V81 A;  4AQ7 A;  1TS5 A;  2LGD A;  4RGT A;  4AP4 C;  2J0M A;  2M19 A;  1OEY J;  3ZXR A;  2D3C A;  1WX8 A;  3EFC A;  2L3Z A;  1XLN A;  2Y5C A;  2V4L A;  3I57 A;  4R3D A;  4MH8 A;  2FCS A;  2OHF A;  1QLB B;  2WHI A;  2JF5 A;  3LXF A;  3Q8C A;  3ZRC A;  1DGJ A;  2I1J A;  2IPK D;  3ZNG C;  4KGR A;  1WGG A;  3RNC C;  2REX A;  1WZ0 A;  3DBL B;  1NI3 A;  4KVG B;  4XX5 A;  1WI0 A;  4N9F 4;  3CMM B;  2GBN A;  3OLM D;  3BVZ A;  1FNU A;  3TEZ A;  4RGO S;  5HG2 A;  4I6N B;  1N61 A;  4UDU C;  3PS6 A;  2K9X A;  4LNK A;  4O1N A;  4MGZ E;  1A70 A;  3MJW A;  1WJN A;  1N63 A;  2BWE S;  2J53 A;  2MX2 A;  3QAR A;  4NY0 A;  2LD9 A;  1V6E A;  4DWF A;  4MEM A;  4HJG E;  1YN5 A;  2L83 A;  2KJ6 A;  3A9J A;  4WWN A;  3DVG Y;  1ZUD 2;  1Y56 A;  5IKC M;  1FCC C;  3VTU A;  4DHJ D;  5FR3 A;  3PRP B;  2W9N A;  3ZDT A;  4GOC A;  3Q3J A;  5GMV A;  2L8J A;  1MFW A;  1LFD A;  2JZ3 B;  3GP7 A;  1FRD A;  2L32 A;  3RYT A;  1VDV A;  4K7W A;  1XT9 B;  1MVK A;  2JWU A;  1QOF A;  1SGH A;  5D3D A;  1JWB D;  2RD0 A;  2MBB B;  2A5U A;  1RFA A;  1GNU A;  1T0R C;  5DPW A;  3VH3 B;  4P16 A;  3WAN A;  2X38 A;  5D2M B;  3ALB A;  2LI5 A;  3M63 B;  4BOS C; 
#chains in the Genus database with same CATH homology
 2BB6 A;  2J4X A;  1WRI A;  4IOI E;  3R8B A;  2V3N A;  3P42 A;  2MJD A;  2Y5P A;  3TSS A;  1Q10 A;  3W5V B;  4LLG M;  1NYR A;  1HXY D;  1SBB B;  2B76 B;  2E6X A;  5BYR A;  4KKJ A;  2WXM A;  3B2F A;  3BK2 A;  1WGK A;  1VZ6 A;  1SF0 A;  4A90 A;  1YJI A;  1F2R C;  1F77 A;  3ABV B;  3AEA B;  1KLG D;  4A9A A;  1C9F A;  1HZ6 A;  1UNS A;  2JX5 A;  2WP9 B;  4RF1 A;  1PYW D;  4L1B A;  2LEK A;  2ACZ B;  4YWG G;  3OWE B;  1VRA B;  3HVD A;  3AN1 A;  4KGT A;  3UI3 A;  2V0G A;  5FK9 C;  1CQV A;  2WS3 B;  1EU4 A;  5LNK 1;  3U52 E;  2FUG 1;  4WUR A;  3URY A;  1ESF A;  2WXR A;  1JWU D;  1OQQ A;  3BYT B;  2PTL A;  2WU5 B;  4WH4 A;  4YTP B;  1P7E A;  1IGD A;  1ZXH A;  2JZP A;  4MT5 A;  3MFG A;  3AMZ A;  1OQR A;  3HVZ A;  2BB5 A;  4OZC A;  1T3Q A;  3WCQ A;  4OZB A;  1ENF A;  1SXT A;  1IBX B;  2BTE A;  2ZW1 A;  1L4Z B;  4D2K A;  2WDQ B;  3AE8 B;  3J9C A;  4IDI A;  4AS1 A;  2RDH A;  2K22 A;  1C77 A;  2BS2 B;  1I4X A;  2LHD A;  2TSS A;  3IAM 1;  4JE3 B;  4JX1 C;  2BS3 B;  3PZ8 A;  2SEB D;  1TY2 A;  4RGN A;  3IT6 B;  1SSN A;  1QT9 A;  2FE8 A;  1KFY B;  5JXV A;  1QOG A;  5G5G A;  1FO4 A;  1ZP0 B;  1PGB A;  4USA A;  5D3I B;  3AE1 B;  2E3T A;  2JYT A;  4ZHO A;  1C4P A;  1TS2 A;  1JW9 D;  4KKI A;  4ZRQ A;  3TEY A;  2NTS A;  1AWD A;  3ZGZ A;  2IGH A;  1L5P A;  1TY0 A;  3Q8B A;  3EA6 A;  2CJO A;  4XWW A;  1YNT E;  1B1Z A;  3SR6 A;  2JU6 X;  1I4R A;  2GB1 A;  4GLS C;  1HQR D;  2JSV X;  1E9M A;  5EE9 A;  1FM0 D;  2V4I B;  4ARI A;  4A55 A;  1E6E B;  4HEA 1;  4YT0 B;  4US9 A;  3NVZ A;  1QF6 A;  1QIL A;  3GS2 A;  3NVV A;  1JAL A;  1SE3 A;  4RFB A;  4EE2 A;  1JCK B;  5EE1 A;  2I2Y A;  1IGC A;  2KQ4 X;  3AEC B;  1ET6 A;  4TSS A;  1ZDX A;  4YTN B;  2WXN A;  3NRZ A;  1C4C A;  2VZK B;  3P63 A;  1DOY A;  5FKA C;  1K51 A;  3FIL A;  2G1E A;  1RFK A;  2IGD A;  2ICI A;  4ZOH C;  3DWM A;  3ZYY X;  2JYE A;  2PVG C;  3P4Q B;  2BBC A;  2AQ1 B;  1CJE A;  4IKG A;  1TZO A;  2R61 A;  1MHX A;  1J7A A;  3Q8E A;  1YN3 A;  4RGM A;  1AW7 A;  3PO0 A;  3HUI A;  3B9J A;  3BZD B;  1AN8 A;  2LMC A;  4NZL B;  3AE5 B;  1XO3 A;  4B0M A;  4DQO C;  4HKQ A;  3TEX A;  1GOZ A;  3VR8 B;  1OFF A;  1N60 A;  3FC4 A;  2DBY A;  3LB8 C;  2LHE A;  2KMM A;  1M4V A;  3AM9 A;  4GDL B;  4WQM A;  3ZQ4 A;  1CK1 A;  2WXL A;  2KDM A;  3ZJV A;  2WXQ A;  4RCO A;  3AE4 B;  1J7C A;  1FFV A;  1FMA D;  2WU2 B;  5G5H A;  4C80 A;  1GB1 A;  2INP E;  4JPS A;  1C76 A;  3MJ5 A;  1J7B A;  2MEK A;  1KH0 A;  2QSD A;  1SIJ A;  3U2S C;  2NMQ A;  4DXG A;  4ITK A;  1FEH A;  1JWS D;  3ZJU A;  1YJJ A;  1F2R I;  2PMV A;  2SAK A;  1WSP A;  2WXP A;  1V97 A;  4FXC A;  2IGG A;  2BW2 A;  1SJH D;  5EE3 A;  4L23 A;  3BVG A;  3R2T A;  2N0S B;  3CIR B;  3Q69 A;  2DYM A;  3EUB 2;  5H92 C;  4WIP A;  2RMM A;  3R2I A;  3FIL B;  4RH6 A;  1PDX A;  1KLU D;  1SEB D;  1I4G A;  3VRA B;  1D5M C;  3MC0 B;  1T6B X;  2MH7 A;  1WYG A;  1NEK B;  4YXD B;  1I7H A;  3BK1 A;  1FNV A;  1D5X C;  2DWQ A;  3TUO A;  1V1P A;  2W3R A;  2HTM E;  3RFZ B;  1PGX A;  1F0Z A;  4RNA A;  3VQI A;  2W82 A;  1GAQ B;  4PT5 A;  1EWY C;  4YSX B;  4L2Y A;  1QQR A;  1XLQ A;  3W9C B;  1NVI D;  1FXI A;  2EKI A;  1D6E C;  1VZ7 A;  1FCL A;  2DYO A;  3BII D;  4DXF A;  1NYQ A;  4XE0 A;  1V1O A;  2L1A A;  3U7Z A;  5D7G A;  4XDD A;  2QIE B;  2QJL A;  1VLB A;  5BYQ A;  3V3X A;  1VZ8 A;  1R7S A;  1UWM A;  4TQ0 A;  1L0V B;  1K50 A;  2YEP F;  4WWM A;  3HRD D;  1BXT A;  1STE A;  1UWX A;  2WXI A;  5MPO A;  1ZPS A;  1RYJ A;  2CU3 A;  3KLS X;  4HRS A;  3I9V 1;  4XDC A;  5C3J B;  2IJ0 A;  3TEW A;  1FRR A;  2KAJ A;  2W55 A;  4C7Y A;  1L4D B;  1YN4 A;  1YQ4 B;  2LGI A;  3KWL A;  1I4Q A;  2I38 A;  4XWT A;  5HI1 A;  4REZ A;  3AE9 B;  2WXK A;  4M0W A;  2EEL A;  4KGS A;  1FD6 A;  5TSS A;  3T3O A;  3E56 A;  2JQR B;  2NTT A;  2M56 B;  2XNA C;  2QEJ C;  3SFE B;  3AEB B;  1KF6 B;  1E10 A;  3RPF C;  2HDE A;  3AE3 B;  3FAH A;  1KTK A;  4N59 A;  1EM7 A;  2GRI A;  4OZA A;  2ON8 A;  1XCQ L;  1SB3 C;  1ZXI A;  3MHZ A;  1SJE D;  1LO5 D;  1RM6 C;  3CWI A;  1PUT A;  3AV8 A;  4HRO A;  4JWU C;  2W54 A;  1DOX A;  1TS4 A;  2BYT A;  4ZYS A;  2N7J A;  1GB4 A;  4C7Z A;  1ROE A;  2ONQ A;  2WNM A;  1V1P B;  1HZ5 A;  1E7P B;  1EWC A;  2IDY A;  4TMA B;  2V3P A;  3SEB A;  3B2G A;  5HHD G;  4ZHP A;  1ZOY B;  2WXO A;  4TQ1 A;  3P1M A;  2KAC A;  2J52 A;  1N62 A;  3AED B;  3MP9 A;  4OW0 A;  4N58 A;  2RPV A;  2WLB A;  1JRP A;  2RDG A;  5AUK A;  5H8Y E;  1ACC A;  3ZJT A;  1TKY A;  1IBX A;  1SE4 A;  2PIA A;  1V8C A;  3AE7 B;  4OVZ A;  3P4S B;  1EU3 A;  3O13 A;  2K3U A;  4Q2J A;  2CJN A;  1XLP A;  4A6Q A;  3IXS A;  3Q8A A;  3GB1 A;  4LTU A;  3C8Y A;  2VZK D;  1KRH A;  2N9K A;  1D4B A;  2LJI A;  1D5Z C;  3W1S A;  3NVY A;  2AQ2 B;  1L6V A;  2PLP A;  3AEE B;  2PKO A;  2K0P A;  4YSZ B;  2D5G A;  2QIL A;  2N9L A;  3AH7 A;  2K5P A;  2ZW0 A;  1MPE A;  3NS1 A;  4KX6 B;  2WXH A;  1IUE A;  1XEE A;  2KWD A;  5BMG A;  3U4E G;  2MJ3 A;  5GXG B;  1QOA A;  1XLO A;  4H2A A;  1TJE A;  5E6J A;  3AE2 B;  2KN4 A;  1BML C;  1ET9 A;  4AQ7 A;  1TS5 A;  3P4P B;  3Q8F A;  3VR9 B;  4WAF A;  1DYQ A;  4RGT A;  1PFD A;  2WDR B;  1CZP A;  1B9R A;  2DLB A;  2M19 A;  3L4P A;  1WWT A;  1C78 A;  1TS3 A;  2PVO D;  1XLN A;  2Y5C A;  3DWG C;  1PGA A;  2LUM A;  3NZ3 A;  2WDV B;  3I57 A;  4NAM A;  2Q5W D;  4R3D A;  4MH8 A;  1N5W A;  1ZDV A;  4MAC A;  2OHF A;  5BMH A;  1XXG A;  1QLB B;  2WXG A;  3LXF A;  1FNW A;  3Q8C A;  4JWS C;  1DGJ A;  5BYS A;  2YEP B;  1TYG B;  4N6E B;  2IPK D;  3W5U B;  2AQ3 B;  4KGR A;  1AYF A;  1FIQ A;  4HKZ E;  4B0E A;  1WXQ A;  1BUI C;  1NI3 A;  3PZ7 A;  4YTM B;  4US8 A;  2BS4 B;  5HFY A;  1MHH E;  1P7F A;  4ARC A;  3H8H A;  3NUH B;  3BVZ A;  1FNU A;  3TEZ A;  1TKE A;  1I4P A;  4RGO S;  1QKZ A;  3V05 A;  5C2T B;  5HG2 A;  1RWS A;  2WXF A;  1JRO A;  1N61 A;  4UDU C;  3N9Y C;  1QOB A;  1ZE3 D;  2K9X A;  2H89 B;  2M0A A;  2Y3A A;  4NJC A;  4O1N A;  1T5X D;  1L6U A;  3BWU D;  5BMI A;  1E0Z A;  1A70 A;  1FFU A;  3LYY A;  1N63 A;  2J53 A;  4C56 C;  5T8I A;  1C4A A;  2W3S A;  2MJE A;  1L0Y B;  3EGR A;  4HJG E;  1YMH E;  1TKG A;  1YN5 A;  2L83 A;  4J3O D;  3BYY B;  2J42 A;  1YQ3 B;  1ZUD 2;  1Y56 A;  2FBW B;  1FCC C;  1VR9 A;  2AX5 A;  4YSY B;  5FR3 A;  1DOI A;  2L52 A;  4GDK B;  4OHJ A;  4P6V F;  5I4D A;  1JWM D;  1K53 A;  1MI0 A;  2JXT A;  3IAS 1;  1SE2 A;  2QMT A;  3SFD B;  3W2D A;  1XF5 L;  4LK0 M;  1HA5 A;  1N5X A;  1VJK A;  2H88 B;  1L0X B;  4RF0 A;  1GPX A;  1XCT L;  4NAW B;  4CQN A;  3GP7 A;  1FRD A;  2L32 A;  5AUI A;  2Z8L A;  3NVW A;  1VDV A;  3BVM A;  5EE0 A;  2PW9 A;  1JQ4 A;  1JML A;  1C79 A;  3T3N A;  1MVK A;  2JWU A;  2XN9 C;  3AB5 A;  2G9H D;  1QOF A;  4ZRP A;  1I4H A;  1K52 A;  2INN E;  5D3D A;  1JWB D;  3AE6 B;  4A8X C;  3AEF B;  2WQY B;  1JWA D;  4MM3 B;  3IT4 B;  3KQ4 A;  3VRB B;  2BT6 A;  1UUP A;  2WXJ A;  4P16 A;  3AEG B;  2GI9 A;  3P4R B;  2LFI A;  2X38 A;  3KWV A;  1NEN B;  2OED A;  3ETR A;  1UGJ A;  1HEZ E;  3E9S A;  1FXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...