1F2RI

Nmr structure of the heterodimeric complex between cad domains of cad and icad
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MELSRGASAPDPDDVRPLKPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWTYNDSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the heterodimeric complex between CAD domains of CAD and ICAD.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords CASPASE-ACTIVATED DNASE
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f2rI00
1Q10A 1C9FA 2KACA 5HFYA 5JXVA 1GB1A 1IGDA 1IBXA 2JXTA 1K51A 3FILB 1MHHE 2LHEA 4OZBA 3GB1A 1ZXHA 2N7JA 1P7FA 2OEDA 4OZAA 1XF5L 2J52A 1GB4A 1MHXA 2KN4A 1K53A 4KGSA 1HZ6A 4MACA 1F2RC 1XCQL 1PGAA 2PTLA 2N9LA 4D2KA 2PLPA 2IGDA 1IBXB 4GLSC 1F2RI 2RPVA 2GB1A 4IKGA 4HKZE 2LHDA 2IGGA 1P7EA 1PGXA 2IGHA 2ONQA 2RMMA 2N9KA 2NMQA 2J53A 2LGIA 2LUMA 1YMHE 1FD6A 2QSDA 4IOIE 2K0PA 1UWXA 2I38A 5BMGA 2KQ4X 4WH4A 2ZW0A 2EELA 3V3XA 4KGTA 1PGBA 4KGRA 5BMIA 1HEZE 2JSVX 2KWDA 1FCLA 5HI1A 3FILA 1IGCA 1XCTL 4OZCA 1MI0A 1D4BA 1K52A 1KH0A 2ON8A 2PW9A 2QMTA 3UI3A 3MP9A 1HZ5A 1K50A 1YNTE 1MVKA 1QKZA 2GI9A 2KDMA 1FCCC 5BMHA 1EM7A 4HJGE 2I2YA 5HG2A 5HHDG 2JWUA 1MPEA 1JMLA 2JZPA 2JU6X 2ZW1A
chains in the Genus database with same CATH superfamily
1PDXA 4IM0A 3DBSA 1ET9A 5H8YE 1ZXIA 1T3QA 5BYQA 3Q69A 1N5XA 1IGDA 4NAWB 3LB8C 2IJ0A 3P42A 1Q5WB 2BYVE 2WDVB 4ZHPA 1WSPA 2YVCA 1N5WA 1T0RC 4YL8A 1S3SG 2NBUA 3MJ5A 2PE6B 1F2RC 1JW9D 2BVCA 2RDBC 2WYQA 2KDBA 1MG4A 4MELA 3WCQA 1ZPSA 1WGGA 3CSTA 2IY0B 3TMPB 2K25A 4KX6B 4BAXA 3MHSD 4MSQB 1YIWA 1IUEA 2C7HA 3RNGC 4KKJA 4YSZB 3VR9B 2MQJA 3ZNGC 3H1UA 5E6JA 4G3XB 2KJ6A 4C56C 4TQ0A 2IO1B 3VHTC 2FNJB 5BMGA 2K3UA 1E7UA 2AEHA 2EELA 4M01A 3UQBA 4ARIA 1PGBA 3RYTA 2MH7A 2KX3A 3WAPA 4F7ZA 1T6BX 5HI1A 2JX5A 5G5HA 2QMTA 3PSEB 2BTEA 4ACFA 4LNKA 1HZ5A 3PVLA 1YNTE 2WXRA 2B3AA 3DHIC 3TEXA 4DK5A 2L32A 3N32A 1PFDA 4XWTA 3TCAA 1E7PB 4P16A 1J8CA 1V1PA 2K39A 1HA5A 2KC1A 5HFYA 2GBKA 2JXTA 1ISNA 3L0WB 2KNBA 1XXGA 2FCMA 3GZNB 4MH8A 2R2QA 2CHZA 1VRAB 1K8RB 1UF0A 1MHXA 4KGSA 3B2FA 3RD2A 2RPQA 1JWAD 2WDQB 4OW0A 1L0YB 1L6VA 2DZIA 3ZQ4A 2LJ5A 2M4NA 3PZDA 2KT7A 2L83A 3ML9A 3QWZB 3N30A 5DPSA 3W9CB 5HKHA 4ANUA 2ZPYA 2IZVB 3SHQA 4KSKC 2BBCA 2WS3B 5AUKA 4NQLB 3HHMA 3KYDD 1CQVA 3R7QA 3ZTCA 2B76B 4BKSD 1SE2A 1D5ZC 1XLOA 2Y3AA 2Z0EB 2KANA 3K9OB 1STEA 5EE9A 2W3SA 1NYRA 3M3JA 2N9KA 2I1JA 4JE3B 1YOVB 5AZHA 1RYJA 2AYOB 3QJZA 2M56B 3BVMA 1TKYA 4MGYE 2PKOA 2BKFA 2KDEB 1SIJA 1E10A 1YQBA 3ZRFA 2C7MB 3DQVA 3M62B 1V8CA 4O1NA 2INDC 5FR3A 2WXFA 1Q0WB 1NYQA 1T0SC 4LCDE 4KDLB 3QQ8B 3APDA 3H9DA 3ETRA 3FKYA 1FCCC 2JZ3B 1EM7A 3VXWA 3P4SB 4WWMA 1QOFA 4NJ6A 5G5GA 1JWBD 2Q5WD 1WM2A 2WXIA 3L08A 1SE9A 2KDFB 1SB3C 4P6VF 4HPPA 1YX5B 1F1HA 3PLVA 2LASA 2Y5BB 4KVGB 1TBEA 2JXXA 1VR9A 2L0FA 4RH6A 4DQOC 5EE3A 4XDCA 5KHQA 3A1QA 2QIEB 2A5UA 2J42A 2JT4B 1XF5L 2J52A 2OOBB 2JZZA 4KZCA 3UF8A 3RMKC 4NPNA 2WDTB 3UQAA 1EUVB 3CF6E 1TS5A 1FO4A 3T3NA 1P0RA 2G3QB 4E74A 3W1SA 4XWWA 2K9XA 3NZSA 3GS2A 5LXIB 2M1MA 2JYEA 4ANWA 2REXA 1EU3A 4NJ7A 3A9JB 2X8XX 4IW0A 4YSYB 2LGSA 1IBXB 2NBVB 1OGWA 3L13A 2ZNVC 1N60A 4K3CA 1RFKA 5CTRC 3KVFB 5E6PA 2JPHA 2BF8B 3VUWA 4MH0E 2ICIA 2NBWB 3H6NA 1QOGA 3IFWB 3PO0A 1FM0D 2IO3B 4RGNA 3ZLZA 4HKQA 3R3MA 4WQOB 2M17A 1I4PA 2G4DB 2DENB 2GBMA 4URKA 4B95A 2KWDA 3GOEA 3R66C 2EKIA 1MI0A 3PZ8A 3OWEB 5IA7A 2MA9B 1MFWA 3IHPC 2KHWB 3L17A 3N1XC 5H92C 4RGTA 3P4QB 1KLGD 1WGHA 3SEBA 2NTSA 4RM9A 2W54A 1JCKB 3D32A 1BMLC 4EZKA 1JRPA 2KACA 5CHWA 3R2IA 2WX1A 1TY2A 3ALBA 5DPWA 1EWCA 1MHHE 2N9PC 3DBHI 3PRMB 4G50A 3DBLB 3GB1A 4I6LB 3LYYA 2CU1A 4RF1A 3MC8A 3E9SA 1C79A 2N9XA 3P1MA 4IWQA 1WWTA 2JY6A 1LO5D 2XEWA 1V9JA 2PJHA 4TSSA 4A3PA 1PGAA 3ZXVA 1WY8A 2O6VB 4EOYA 4BOSC 3Q2AC 1E8ZA 4X57B 2LVPA 1V1OA 3AEAB 2AX5A 2MHJA 4K3BA 1OEYA 2K1FA 2DWQA 3NS1A 4XZ4A 2V4IB 4A6QA 1UGMA 1GG3A 1NENB 3VUXA 4LJOB 1JWUD 3OJ4B 3TSSA 1JROA 1VJKA 4QAYA 1JALA 1VD2A 5DPRA 3C0RB 1DOXA 3UIPB 1MG8A 2BS3B 3RT3B 1HTOA 3RNFC 1A70A 3IG3A 3DBRB 1C4CA 4DHJB 3RCZA 1FMAD 3NG0A 5IAAC 1WJ4A 5G2NA 2DBYA 1GC6A 1X1MA 2IO0B 2K6QA 1WGKA 3MP9A 3A9KB 4W9FA 4TKNA 3IAM1 3GE8C 1V1PB 2X38A 4W9JA 1SF0A 3DDCB 1XO3A 4LNFA 5GMVA 1FXTB 1F9JA 3HRDD 5D7GA 4A20A 4FHKA 2BYEA 1D5XC 1QOAA 4RNAA 2E3TA 4LLGM 1WFYA 4ZRIA 2KD0A 2G1EA 1WE6A 2LFIA 3B0AA 4ANVA 2WU2B 2KLCA 2O2VA 1C77A 1OQQA 2GBRA 2KMCA 2C9WB 1ENFA 1WYWB 1RRBA 2MBOA 1V81A 4II3B 2K22A 2DAFA 3LXFA 1SJED 3NHEB 2WXMA 2ZNVB 2V9HA 3DWGC 4NY0A 4PS3A 4BKSA 4HLEA 5I4DA 4DWFA 4ARCA 3ZJTA 1KM7A 3TJPA 1WR6E 3U7DA 2PIAA 3VFKA 1WI0A 3ABVB 3N3KB 2LHDA 2KTRA 2D3CA 2IGHA 3AU4A 4N6EB 2RMMA 1WIAA 4YT0B 3DBHB 4LNIA 2BGFA 1QZEA 3AE5B 2XNAC 4KIKB 2WNMA 2ACZB 4LDTD 4IOIE 1HQRD 3Q8CA 4FBJB 2FCSA 2WHIA 4XC2A 3PGEA 3PREA 1ESFA 1GJZA 3ZTDA 1FNUA 1PUTA 1K50A 5MPOA 5C1ZA 5D3IB 4W9EA 3RN9C 5HG2A 3RUIB 1JWMD 1JMLA 1RFAA 4KSLC 4ZRKA 2JU6X 3VH3B 2LJIA 1M4VA 4OVVA 4OVZA 4S17A 4TV3A 1C9FA 2NR2A 4WWPA 2ZCBA 4C80A 3VRBB 3N1ZC 5L83A 2DLBA 1K51A 1WGRA 5BO4B 2GRIA 4N58A 1YN3A 4W9IA 2BB6A 3NY5A 3KWVA 4HK2A 2L3ZA 2OHFA 2ZVOA 4W9LA 3SFEB 2HTHA 4I6NB 2DHZA 4HPMB 3VR8B 1WZ3A 3HVDA 4YSXB 3S2AA 1QT9A 2QCZA 1L2NA 3M63B 4NAWA 5C3JB 1C4AA 1YQ4B 3AEGB 3TIXA 2MW5A 3Q8EA 2LWPA 2IPKD 3IT4B 1TIFA 2FCNA 2L05A 3URYA 1CK1A 4HCNB 3AULA 2PVOD 2KLGA 3HM3A 1VZ6A 1OTRB 4FXCA 2K0PA 2L52A 1L6UA 2DYOA 4PK1A 2DYMA 3ZJUA 2ZZPB 5G55A 1UNSA 2WXNA 2INCC 2BWFA 3U8ZA 4UDUC 2NCNA 3L16A 5AUIA 1AN8A 4HPLB 4BKTA 3FILA 1IGCA 1YX6B 1BUIC 4TQ1A 3U2SC 4G0NB 1ZGUB 1FRRA 1XLQA 3UI3A 3QCAA 5CHVC 2KC2A 4XGAB 4BVUC 5TR5A 3WANA 4FN2A 1TKGA 1IPGA 2D3GA 1L4DB 1KFYB 1MPEA 2R61A 3DBRI 3KUCB 3PT2B 1ZKHA 3H7PA 4M02A 1E90A 2FCQA 4EUTA 1GB1A 1FIQA 2DX5B 3V6EB 3MTNB 4AOFA 2WXJA 2JVCA 4A3OA 1SSNA 1YJIA 4TUUA 4GU2A 3VRAB 2JWZA 2NTTA 3EHVA 1K53A 3P63A 2WXPA 2O6VD 1LFDA 3K9PB 1YN5A 3AH7A 3A1QB 1LM8B 2AL6A 4HCPB 2XBBC 4GSWA 3ZDTA 2J7QB 1TJEA 2HJ8A 3EC8A 4K81A 2H89B 3TL5A 3PTFC 4GN1A 3BY4B 5LXHA 3V05A 1PGXA 3AE6B 1NBFC 3AE8B 1E8YA 3DVNV 4MT5A 4CYEA 3PV1A 1GC7A 2L7RA 1AW7A 2W55A 3AECB 4EZJA 1ZDVA 2AQ3B 4AJWA 5EDSA 2QILA 2KQ4X 3U4EG 3QA8A 1N63A 1M94A 1WYGA 4DXAB 4IM3A 5IN7A 3O65B 3NZ3A 3BINA 2XK5B 3TEWA 4JGHB 3V6CB 4ANXA 1VCBA 1KH0A 2FUG1 2PE9A 2D3AA 1WZ0A 1MJDA 1OFFA 2O2VB 1NEKB 1LXDA 1JQ4A 1PYWD 3AE3B 4YTPB 3EUB2 5HHDG 3NVVA 1NI2A 4FJVB 1V5TA 2BWES 4P7IA 2BQQA 1J7AA 2L76A 4LTUA 2KMAA 2N4FA 3UGBB 4LK0M 3RI7C 3Q6BA 4XYCA 1KJTA 4TMAB 3T3OA 4IWOA 4HJKA 1WMHB 2L1AA 4OZBA 3B2GA 4LDTB 1E8XA 1H8CA 1D5MC 1FEHA 1R4MB 3KW5B 4AP4C 4B0EA 5JHBA 4R3DA 3AE2B 2DZMA 4KZ0A 1R7SA 4DXGA 2H88B 4G11A 3P4RB 2ZPNA 4D2KA 2INPE 3DVNU 2LVOA 2WXOA 3HM6X 1TS3A 2LGDA 4C4VB 2NPTA 1TZOA 3N9YC 4PYUA 4EKUA 1TS4A 2BS4B 1P7EA 2K8CA 3R8BA 2OJWA 2Z8LA 3MJWA 2WQYB 4RFBA 3VTVA 2NVUI 3RNAC 2KYWA 4MJSB 2DZJA 2EKEC 1Z2MA 1OQRA 3AE9B 4GXBA 1FRDA 3JYUA 3AE1B 2QHOA 1N61A 3EFUA 2G45B 1WJUA 2KQ7A 1N6ZA 4CHKA 2CKHB 4M0WB 3APCA 4ZRJA 4MGKE 2LRUA 4P1CC 3MC0B 5D94A 2LZ6A 4JIOU 2KDMA 2KTFA 5C23A 1ZE3D 3EA6A 2I2YA 1UZXB 2CR5A 5E6OA 1C78A 1EU4A 2J0MA 1GNUA 1LGRA 3L4PA 2CJOA 3I57A 2C5LC 3CWIA 4GGQA 4DBGA 1J19A 4GDLB 3AV8A 4FLHA 2N7JA 1V5OA 4M0WA 3AB5A 1FNVA 4YXDB 4KV2A 2MJ3A 1V49A 2MBQA 1J0GA 2MBHA 2K5PA 2KJHB 2WP9B 3AE7B 3AMZA 3Q3JA 4AS1A 2IO2B 3ZRCA 4HXDA 4IWPA 5BYSA 1WR1A 1C3TA 3PHWB 2IGGA 1TZ1A 3ML8A 3ENEA 1LQBA 5FR6A 4K7WA 3DBLI 4K7UA 2NMQA 2V3NA 3PRZA 2LGIA 2FBWB 2WWZA 1UH6A 4WWOA 1I4XA 2G9HD 2ZW0A 3ZNZB 3KWLA 3VUYA 1FFUA 2UWQA 1HXYD 1GPXA 5BYRA 4FULA 2BW2A 1N62A 1D4BA 3O13A 1ZUD2 3RNEC 5FKAC 3SU8X 1MVKA 4WWNA 2FIFA 1P3QU 3AM9A 4RF0A 2JWUA 4ICVA 3IT6B 3ZVVA 4AUQC 3ZGZA 2KXJA 1UBIA 3AEDB 1J7BA 1UBQA 3C19A 3AU5A 4XX5A 1V86A 1IBXA 4DHJD 1ZXHA 1I4HA 1P7FA 2AL3A 2Z0DB 5JZEB 5LNK1 2FIDA 2WU5B 2V3PA 4LJPB 4MACA 4EE2A 3KLSX 1XCQL 3OAWA 4AWJA 2BPSA 3P4PB 3ZKJC 4RM8A 1VDVA 2MLBA 2PTLA 2BKRB 2YLMA 4CQNA 1I7HA 3KYCD 4US9A 3Q3FA 2KWCA 4YTNB 2RDHA 2WX0A 1TYGB 4BBNF 4GIVA 5CX3A 4EEWA 4N9F4 1Q1OA 3I63C 1YN4A 2J53A 1HTQA 2MEKA 4ZYSA 4JPSA 1KLVA 4LNOA 3IXSA 3NRZA 2JF5A 4W9CA 1SXTA 3IAS1 4ICUA 4KGTA 1WX7A 3QK0A 3W1YA 3HUIA 3ZYYX 3DVGY 1ZOYB 5FK9C 1BXTA 1JWSD 2AQ1B 3ZUNA 5J17A 2LVQA 2W82A 2NS5A 2KVZA 1L7YA 1GAQB 1SE3A 2WXKA 2GI9A 3A9JA 2LGXA 5LLIA 3AEEB 4W9HA 4HJGE 1NI3A 4MM3A 4W9KA 4N59A 1TKEA 3SR6A 1ACCA 3JSVB 2O6VA 1JRUA 1Q10A 3WAOA 1F52A 1TGZB 5IO9A 4LNNA 2WXGA 1P98A 4W9DA 4WQMA 3GZNI 3AE4B 3BYYB 2KDIA 4IDIA 4PS7A 5T8IA 2HJ1A 3TEZA 2KAJA 2OEDA 1UWMA 1UUPA 1SIFA 4IM2A 2UYZB 3W1SC 3BVGA 1PQSA 2K8BA 4JLCA 4HDOA 4HROA 3BZDB 3SDLC 1F77A 3JSVA 4JWUC 2XK5A 1QLBB 3X0WA 2ZVNA 3HK0A 1Y56A 4M8NA 2MWSB 3I3TB 2IGDA 4C00A 3H7PB 4ZRPA 2KO3A 1F2RI 2GB1A 4W9GA 3GP7A 3EFCA 5J18A 1L4ZB 4ZRQA 2IY1B 1KRHA 2KK8A 2DNFA 3PZ7A 1DOYA 2RD0A 4DXFA 1QOBA 1YD8U 2PVGC 3QC8B 1UELA 2M0AA 1IYFA 3UIOB 2JRIB 3WIMA 3ZIMA 4OHJA 1WM3A 4XE0A 3NVYA 4Q2JA 1FXAA 1WF9A 1E8WA 2CS4A 1FCLA 4JWSC 4ZYNA 3LJ3A 1XCTL 1H4RA 4HRSA 2V4LA 2KWVB 3PS6A 3RPFC 3CSFA 3NUHB 3EGRA 5DPTA 3NZUA 1QKZA 1WJ6A 3AN1A 3VH4B 4A90A 1FPYA 2N9EB 3CIRB 3WALA 3R7RA 1V80A 1DOIA 2N1VA 2RSUA 2IYDB 3NS8A 4H2AA 4ZHOA 4HDQA 2YEPF 2KX0A 5AZFA 1L0VB 1D6EC 4K1RB 4WURA 3AXCA 3IBEA 1YJJA 2KWUB 2BS2B 1P9DU 1R4MI 1SEBD 4MJSA 2ZEQA 3B9JA 2D07B 3AEFB 2N0SB 4YTMB 1T5XD 3W5VB 1FFVA 3ZW3A 2FE8A 3VQIA 2KTRB 3NVWA 1KF6B 5EE0A 2AWTA 1TY0A 4GLSC 1KOTA 2DAJA 2RPVA 2BT6A 1CJEA 2VH1A 3TEYA 4GB9A 4NNJB 2L00B 4HEA1 3V60A 3U30A 5EE1A 1SGHA 3PLUA 2KN5A 2L8JA 1WX9A 2EMTA 3IVFA 2WGSA 3Q3MC 4JL9A 1U4AA 3A33B 1WXAA 1WRIA 4NZLB 2BB5A 2HD5B 5E6NA 1C76A 3VDZA 3MHZA 4FJZA 2W3RA 4ITKA 4MSMB 3Q8BA 1VZ8A 3BK2A 2JQRB 2D2QA 3RNCC 4I6PA 4PYZA 4B9KA 2UU7A 2WXLA 1RWSA 3BIID 3DCGA 3RFZB 1D3ZA 1I35A 1SE4A 1S1QB 4OVUA 3A4SC 1XT9B 2PMVA 3EECA 4DDID 1KTKA 4PT5A 2RR9A 5JHAA 4AJYB 1I4QA 2DYBA 1WXMA 1OEYJ 2G4SA 3DHHC 2VH2A 3NJTA 3QX1A 2V0GA 2ZJDA 2GOWA 1Z5SB 2QDFA 2KN4A 3PPAA 4ASWC 3QIJA 4HWIB 3WAMA 3QAQA 4FHJA 1ZW7A 1TT5B 3HVZA 2N9LA 1HE8A 3L10B 1EF1A 2YEPB 2D5GA 4L23A 4WAAA 2M8SA 1GUAB 2GBJA 4IKGA 4JX1C 3Q3NC 3VTUA 1ET6A 2ONQA 3MC9A 1L5PA 5D3DA 3DVGX 5AEKB 4M8MA 3ECIA 3B08A 3C8YA 3PRPB 4II2B 5D6JB 4WJNA 2M0XA 3DWMA 4F8CB 3H7SA 4RMAA 1YMHE 1E0ZA 4B6WA 1GOZA 2KFKB 4WJQA 4CO7A 2JYTA 4WH4A 3ZJVA 3SD5A 2PPHA 1AARA 2JUOA 2EMSA 4XDDA 4WAFA 2V3SA 1I4RA 3H8HA 4C7ZA 2N7DA 1V97A 4MM3B 4E71A 2ON8A 2PW9A 3AEBB 2R2OA 2LRWA 2LI5A 2Z59B 2C60A 3GE3C 4JQWC 3R2TA 2CU3A 4FJYA 2J4XA 5IP4D 1P1AA 3KUZA 3ZO5B 3Q14C 2A4ZA 2C7NB 1XD3B 4GDKA 2E6XA 4C7YA 2INNE 4DHZB 1RM6C 1WRDB 2MRPA 3BYTB 4NQKE 3ZNID 1TTNA 3APFA 2KFKA 3WA0A 2LXCA 4ZOHC 3JVZX 2N7EA 3JW0X 4KIKA 4DDGD 5D2MB 4KKIA 4DHZE 1E5WA 1C4PA 3OG5A 4M00A 3BWUD 2D10A 1A5RA 3Q3OC 4BOZB 2D3BA 2DZKA 1E9MA 1XQQA 1R4NI 2K8HA 2N1WA 2LXAA 5AZGA 2GBNA 1V2YA 2MBBB 4KDIC 2MBEA 2BYTA 3RZFA 2M19A 3OJ3A 1FNWA 2PEAA 1CMXB 4L2YA 1UGJA 4WJPA 4GDKB 4IG7B 2J0KA 2FAZA 1XLNA 2MJDA 2V1YA 1ZP0B 2GLSA 4MEMA 2LUMA 2MX2A 2QSDA 1KLUD 3B1LX 2KKCA 3I5JC 4IUMB 2ASQA 2KOXA 2HE7A 4FADA 2L0TA 4KGRA 1I4GA 2TSSA 1WMHA 2RDGA 4MDKE 2QJLA 2ZCCA 3NOBA 2K6DB 1T0QC 3A9KA 2IBIB 3KQ4A 2KFJA 2RGFA 4EZLA 1FXIA 4F1SA 2SAKA 1ROEA 2LEKA 3RZWC 3M95A 2JZPA 2ZW1A 2FUHB 4USAA 4REZA 1EO6A 3X23A 3NVZA 1I42A 2QC8A 2MJEA 3TBLD 5J2RA 2XN9C 1V6EA 1QILA 1EF5A 2LHEA 1WXQA 3DHGC 2QEJC 4YWGG 3W5UB 2CHWA 3FC4A 1J7CA 1F0ZA 2VZKB 1OQYA 5TSSA 2Y5PA 2MSED 4S0RA 1HZ6A 4GOCA 1WJNA 3KH0A 1AWDA 2KVRA 3ZXRA 3ONSA 1BT0A 1DYQA 4WIPA 3RULA 3U7ZA 4B0MA 2I1KA 4L1BA 2KJRA 3FAHA 4PS8A 1Y8RC 3PHXB 1RAXA 4E3CA 4P1BC 2MP2A 5L95C 3QARA 1AYFA 4HKZE 1ZDXA 5JH5C 2HTME 4BFRA 2HDEA 3VTWA 5CHFA 1WE7A 1FD6A 2VZKD 4US8A 1UWXA 2J0JA 2WXHA 3UINB 3V3XA 3BK1A 2WXQA 4IC7B 2LUEA 2IDYA 5BMIA 4J3OD 2JSVX 4A9AA 3QHTA 2CJNA 3P2BA 3W2DA 1RLFA 1WX8A 4FA6A 2SEBD 4OZCA 4RGOS 1XLPA 1SJHD 1WH3A 3L54A 1G6JA 2D11A 3Q8FA 1NVID 2AQ2B 2BYFA 4RCOA 3T9LA 2W9NA 3DPDA 4MGZE 1IP9A 4HVBA 2Y5CA 4C4VA 5JXVA 3FILB 3CMMB 4NAMA 3E56A 4EFOA 2KQSA 4GDLA 4BBNC 1E7VA 4OZAA 1GB4A 3I9V1 2WLBA 3TUOA 3VVWB 2NPTB 3Q8AA 4WJOA 2OJRA 3HIZA 3DOWA 3N1YC 1WXVA 5KHOA 5IOIA 1VLBA 3BVZA 1QF6A 2PLPA 3SFDB 4GMVA 5C2TB 3V62A 1B1ZA 4ZDVA 3OLMD 1NDDA 4BZAA 1CZPA 3A4RA 5GXGB 1YQ3B 4A55A 5IKCM 1WXSA 1YJ1A 2LGYA 3RNBC 1XEEA 1T0YA 2KMMA 2MP2B 4AQ7A 3T8MA 4MGIE 1E6EB 2I38A 3V61A 1B9RA 3ZDMC 2LMCA 3MFGA 2JRHA 4NJCA 1DGJA 2GMIC 1WGDA 1HEZE 4RGMA 3KUDB 1SBBB 1QQRA 3N20C 1K52A 2CHXA 3LDZE 2KZRA 1TS2A 2MCNB 4J6IA 1EWYC 1UD7A 3ZNHB 4BKGA 5BMHA 3VAWA 2WDRB 1VZ7A 5DCNA 1R4NB 3U52E 3AI5A 1C1YB 2LD9A 2VRRB 3J9CA 4A8XC 4K7SA 1WGYA 1L0XB
chains in the Genus database with same CATH topology
1PDXA 1D5XC 1ET9A 5H8YE 1ZXIA 1T3QA 2PMVA 1QOAA 3L4PA 2CJOA 3I57A 2E3TA 4RNAA 5BYQA 3CWIA 4LLGM 3Q69A 1KTKA 4PT5A 1N5XA 1IGDA 4NAWB 2G1EA 3LB8C 1I4QA 2IJ0A 3P42A 4GDLB 2LFIA 3AV8A 2N7JA 2V0GA 2WDVB 2WU2B 4ZHPA 1WSPA 1C77A 1N5WA 1OQQA 2KN4A 1ENFA 4M0WA 3AB5A 1FNVA 3MJ5A 4YXDB 2K22A 1F2RC 2MJ3A 3LXFA 1JW9D 1SJED 2WXMA 3HVZA 2N9LA 2K5PA 3DWGC 2WP9B 3AE7B 3AMZA 5I4DA 4AS1A 4ARCA 2YEPB 3ZJTA 3WCQA 1ZPSA 2D5GA 4L23A 5BYSA 2PIAA 3ABVB 4KX6B 4IKGA 4JX1C 2LHDA 1ET6A 2IGGA 2IGHA 2ONQA 1L5PA 5D3DA 4N6EB 1IUEA 2RMMA 4KKJA 4YSZB 3VR9B 4YT0B 2NMQA 3C8YA 2V3NA 3AE5B 2XNAC 5E6JA 2WNMA 3DWMA 2ACZB 4C56C 2LGIA 1YMHE 2FBWB 4IOIE 1E0ZA 4TQ0A 1GOZA 1HQRD 1I4XA 5BMGA 2JYTA 2G9HD 3Q8CA 2K3UA 4WH4A 3ZJVA 2ZW0A 2EELA 4ARIA 3KWLA 1PGBA 1FFUA 2MH7A 4XDDA 4WAFA 1I4RA 1HXYD 3H8HA 4C7ZA 5BYRA 1GPXA 1V97A 4MM3B 1T6BX 1ESFA 5HI1A 2JX5A 5G5HA 2BW2A 1N62A 1D4BA 3O13A 2QMTA 2ON8A 2PW9A 3AEBB 2BTEA 1ZUD2 1FNUA 1PUTA 5FKAC 1HZ5A 1K50A 1YNTE 1MVKA 2WXRA 3TEXA 5MPOA 2L32A 3R2TA 2CU3A 2J4XA 3AM9A 1PFDA 5D3IB 4RF0A 5HG2A 1JWMD 2JWUA 1JMLA 4XWTA 1E7PB 4P16A 2E6XA 2JU6X 2INNE 4C7YA 1RM6C 3IT6B 2LJIA 1V1PA 1HA5A 1M4VA 3ZGZA 3BYTB 4OVZA 1C9FA 3AEDB 1J7BA 4C80A 3VRBB 5HFYA 2DLBA 4ZOHC 1IBXA 2JXTA 1K51A 1XXGA 1ZXHA 4MH8A 4KKIA 1I4HA 2GRIA 1P7FA 1VRAB 1C4PA 4N58A 3BWUD 1YN3A 2BB6A 1MHXA 5LNK1 3KWVA 4KGSA 3B2FA 1E9MA 2V3PA 2OHFA 2WU5B 1JWAD 2WDQB 4MACA 1L0YB 1L6VA 4OW0A 3SFEB 3KLSX 4EE2A 1XCQL 3ZQ4A 3P4PB 1VDVA 2L83A 2PTLA 3W9CB 3VR8B 4CQNA 2BBCA 3HVDA 2WS3B 1I7HA 4US9A 5AUKA 4YSXB 1QT9A 1CQVA 2BYTA 2M19A 5C3JB 4YTNB 2B76B 2RDHA 1FNWA 1C4AA 1YQ4B 1SE2A 3AEGB 1TYGB 1D5ZC 3Q8EA 1XLOA 2Y3AA 4L2YA 1UGJA 1STEA 2IPKD 3IT4B 4GDKB 5EE9A 3URYA 1CK1A 1XLNA 2PVOD 2W3SA 1NYRA 1YN4A 2N9KA 2MJDA 4JE3B 1ZP0B 2J53A 2MEKA 2LUMA 2QSDA 1VZ6A 1KLUD 1RYJA 4FXCA 2K0PA 4JPSA 4ZYSA 3IXSA 3NRZA 2M56B 1SXTA 1TKYA 3BVMA 2L52A 1L6UA 3IAS1 2DYOA 2PKOA 2DYMA 3ZJUA 1SIJA 1E10A 1UNSA 4KGTA 2WXNA 4KGRA 1I4GA 2TSSA 4UDUC 3ZYYX 3HUIA 2RDGA 2QJLA 5AUIA 1ZOYB 5FK9C 1AN8A 1V8CA 4O1NA 1BXTA 1IGCA 3FILA 1BUIC 4TQ1A 3U2SC 5FR3A 1JWSD 2WXFA 2AQ1B 1FRRA 3KQ4A 1XLQA 3UI3A 1NYQA 2W82A 1FXIA 1GAQB 1SE3A 2WXKA 2GI9A 3ETRA 1FCCC 3AEEB 1EM7A 1NI3A 4HJGE 2SAKA 1TKGA 3P4SB 4WWMA 1L4DB 1KFYB 2LEKA 1QOFA 1MPEA 1ROEA 2R61A 4N59A 1TKEA 3SR6A 1ACCA 2JZPA 5G5GA 2ZW1A 1JWBD 4USAA 4REZA 2Q5WD 1Q10A 2WXIA 3NVZA 4P6VF 1SB3C 2WXGA 2MJEA 2XN9C 4WQMA 1GB1A 1QILA 1FIQA 1VR9A 2LHEA 4RH6A 3AE4B 3BYYB 4DQOC 1WXQA 5EE3A 2WXJA 4IDIA 4XDCA 2QIEB 2QEJC 4YWGG 5T8IA 3W5UB 3TEZA 1SSNA 2OEDA 2KAJA 2J42A 1UWMA 1YJIA 3FC4A 1J7CA 1UUPA 1F0ZA 3VRAB 2VZKB 1XF5L 2J52A 3BVGA 2NTTA 1K53A 5TSSA 2Y5PA 1HZ6A 1TS5A 3P63A 1FO4A 3T3NA 2WXPA 4HROA 3BZDB 1AWDA 3W1SA 4XWWA 1F77A 1YN5A 2K9XA 4JWUC 3GS2A 3AH7A 1DYQA 2JYEA 4WIPA 1QLBB 3U7ZA 4B0MA 1EU3A 1Y56A 4L1BA 3FAHA 4YSYB 2IGDA 1IBXB 1TJEA 4ZRPA 1F2RI 2H89B 1N60A 2GB1A 3GP7A 1AYFA 1RFKA 4HKZE 1L4ZB 3V05A 1PGXA 3AE6B 1ZDXA 3AE8B 4ZRQA 2ICIA 1KRHA 4MT5A 3PZ7A 1DOYA 2HTME 4DXFA 1QOBA 1QOGA 2HDEA 3PO0A 1FM0D 1AW7A 2W55A 3AECB 1FD6A 2PVGC 2VZKD 1ZDVA 4RGNA 2AQ3B 1UWXA 4US8A 4HKQA 2QILA 2KQ4X 2M0AA 2WXHA 3U4EG 1N63A 1WYGA 3V3XA 3BK1A 2WXQA 4OHJA 4XE0A 2IDYA 3NZ3A 3TEWA 1I4PA 3NVYA 4Q2JA 5BMIA 1FXAA 2JSVX 4J3OD 4A9AA 2CJNA 2KWDA 3W2DA 1FCLA 4JWSC 2SEBD 1XCTL 2EKIA 4OZCA 1MI0A 3PZ8A 4HRSA 1KH0A 4RGOS 3RPFC 3OWEB 2FUG1 3NUHB 3EGRA 1XLPA 1SJHD 1QKZA 3AN1A 1OFFA 1NEKB 4A90A 5H92C 4RGTA 3CIRB 3P4QB 1KLGD 1JQ4A 1PYWD 3AE3B 4YTPB 3Q8FA 3EUB2 1NVID 5HHDG 3NVVA 3SEBA 2NTSA 1DOIA 2W54A 2AQ2B 1JCKB 1BMLC 4H2AA 4ZHOA 4RCOA 1J7AA 2YEPF 4LTUA 4LK0M 1JRPA 2KACA 3R2IA 1TY2A 2Y5CA 4TMAB 5JXVA 3T3OA 1L0VB 1EWCA 3FILB 1MHHE 1D6EC 2L1AA 4OZBA 3E56A 4NAMA 3GB1A 3LYYA 4RF1A 4WURA 1YJJA 3B2GA 3E9SA 1D5MC 1C79A 1FEHA 2BS2B 4OZAA 1GB4A 3P1MA 3I9V1 1WWTA 2WLBA 1SEBD 1LO5D 4B0EA 3TUOA 3B9JA 3Q8AA 4R3DA 3AEFB 3AE2B 2N0SB 4TSSA 1PGAA 4YTMB 1R7SA 4DXGA 1T5XD 2H88B 3W5VB 1VLBA 1FFVA 3P4RB 3BVZA 2FE8A 1QF6A 3VQIA 4D2KA 2INPE 2PLPA 3NVWA 1KF6B 5EE0A 3SFDB 1V1OA 5C2TB 2WXOA 3AEAB 2AX5A 1TY0A 1TS3A 4GLSC 2RPVA 1B1ZA 2BT6A 1TZOA 1CJEA 3N9YC 1CZPA 1TS4A 2BS4B 3TEYA 1P7EA 5GXGB 1YQ3B 2DWQA 4A55A 3NS1A 3R8BA 2V4IB 4A6QA 2Z8LA 4HEA1 1NENB 5EE1A 2WQYB 1XEEA 1JWUD 3TSSA 1JROA 2KMMA 1VJKA 4AQ7A 1JALA 4RFBA 1B9RA 1E6EB 2I38A 2LMCA 3MFGA 1OQRA 3AE9B 1DOXA 1WRIA 4NZLB 2BS3B 1A70A 4NJCA 1DGJA 2BB5A 1C4CA 1FRDA 1FMAD 1HEZE 3AE1B 1C76A 4RGMA 1N61A 3MHZA 1SBBB 2DBYA 1QQRA 2W3RA 4ITKA 3Q8BA 1K52A 1VZ8A 3BK2A 2JQRB 1WGKA 3MP9A 1TS2A 3IAM1 1EWYC 1V1PB 2X38A 3MC0B 2WXLA 1RWSA 2KDMA 3BIID 5BMHA 1SF0A 2WDRB 1VZ7A 1ZE3D 3U52E 3EA6A 2I2YA 1XO3A 3J9CA 3HRDD 5D7GA 3RFZB 4A8XC 1C78A 1EU4A 1SE4A 1L0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q10 A;  1C9F A;  2KAC A;  5HFY A;  5JXV A;  1GB1 A;  1IGD A;  1IBX A;  2JXT A;  1K51 A;  3FIL B;  1MHH E;  2LHE A;  4OZB A;  3GB1 A;  1ZXH A;  2N7J A;  1P7F A;  2OED A;  4OZA A;  1XF5 L;  2J52 A;  1GB4 A;  1MHX A;  2KN4 A;  1K53 A;  4KGS A;  1HZ6 A;  4MAC A;  1F2R C;  1XCQ L;  1PGA A;  2PTL A;  2N9L A;  4D2K A;  2PLP A;  2IGD A;  1IBX B;  4GLS C;  1F2R I;  2RPV A;  2GB1 A;  4IKG A;  4HKZ E;  2LHD A;  2IGG A;  1P7E A;  1PGX A;  2IGH A;  2ONQ A;  2RMM A;  2N9K A;  2NMQ A;  2J53 A;  2LGI A;  2LUM A;  1YMH E;  1FD6 A;  2QSD A;  4IOI E;  2K0P A;  1UWX A;  2I38 A;  5BMG A;  2KQ4 X;  4WH4 A;  2ZW0 A;  2EEL A;  3V3X A;  4KGT A;  1PGB A;  4KGR A;  5BMI A;  1HEZ E;  2JSV X;  2KWD A;  1FCL A;  5HI1 A;  3FIL A;  1IGC A;  1XCT L;  4OZC A;  1MI0 A;  1D4B A;  1K52 A;  1KH0 A;  2ON8 A;  2PW9 A;  2QMT A;  3UI3 A;  3MP9 A;  1HZ5 A;  1K50 A;  1YNT E;  1MVK A;  1QKZ A;  2GI9 A;  2KDM A;  1FCC C;  5BMH A;  1EM7 A;  4HJG E;  2I2Y A;  5HG2 A;  5HHD G;  2JWU A;  1MPE A;  1JML A;  2JZP A;  2JU6 X;  2ZW1 A; 
#chains in the Genus database with same CATH topology
 1PDX A;  4IM0 A;  3DBS A;  1ET9 A;  5H8Y E;  1ZXI A;  1T3Q A;  5BYQ A;  3Q69 A;  1N5X A;  1IGD A;  4NAW B;  3LB8 C;  2IJ0 A;  3P42 A;  1Q5W B;  2BYV E;  2WDV B;  4ZHP A;  1WSP A;  2YVC A;  1N5W A;  1T0R C;  4YL8 A;  1S3S G;  2NBU A;  3MJ5 A;  2PE6 B;  1F2R C;  1JW9 D;  2BVC A;  2RDB C;  2WYQ A;  2KDB A;  1MG4 A;  4MEL A;  3WCQ A;  1ZPS A;  1WGG A;  3CST A;  2IY0 B;  3TMP B;  2K25 A;  4KX6 B;  4BAX A;  3MHS D;  4MSQ B;  1YIW A;  1IUE A;  2C7H A;  3RNG C;  4KKJ A;  4YSZ B;  3VR9 B;  2MQJ A;  3ZNG C;  3H1U A;  5E6J A;  4G3X B;  2KJ6 A;  4C56 C;  4TQ0 A;  2IO1 B;  3VHT C;  2FNJ B;  5BMG A;  2K3U A;  1E7U A;  2AEH A;  2EEL A;  4M01 A;  3UQB A;  4ARI A;  1PGB A;  3RYT A;  2MH7 A;  2KX3 A;  3WAP A;  4F7Z A;  1T6B X;  5HI1 A;  2JX5 A;  5G5H A;  2QMT A;  3PSE B;  2BTE A;  4ACF A;  4LNK A;  1HZ5 A;  3PVL A;  1YNT E;  2WXR A;  2B3A A;  3DHI C;  3TEX A;  4DK5 A;  2L32 A;  3N32 A;  1PFD A;  4XWT A;  3TCA A;  1E7P B;  4P16 A;  1J8C A;  1V1P A;  2K39 A;  1HA5 A;  2KC1 A;  5HFY A;  2GBK A;  2JXT A;  1ISN A;  3L0W B;  2KNB A;  1XXG A;  2FCM A;  3GZN B;  4MH8 A;  2R2Q A;  2CHZ A;  1VRA B;  1K8R B;  1UF0 A;  1MHX A;  4KGS A;  3B2F A;  3RD2 A;  2RPQ A;  1JWA D;  2WDQ B;  4OW0 A;  1L0Y B;  1L6V A;  2DZI A;  3ZQ4 A;  2LJ5 A;  2M4N A;  3PZD A;  2KT7 A;  2L83 A;  3ML9 A;  3QWZ B;  3N30 A;  5DPS A;  3W9C B;  5HKH A;  4ANU A;  2ZPY A;  2IZV B;  3SHQ A;  4KSK C;  2BBC A;  2WS3 B;  5AUK A;  4NQL B;  3HHM A;  3KYD D;  1CQV A;  3R7Q A;  3ZTC A;  2B76 B;  4BKS D;  1SE2 A;  1D5Z C;  1XLO A;  2Y3A A;  2Z0E B;  2KAN A;  3K9O B;  1STE A;  5EE9 A;  2W3S A;  1NYR A;  3M3J A;  2N9K A;  2I1J A;  4JE3 B;  1YOV B;  5AZH A;  1RYJ A;  2AYO B;  3QJZ A;  2M56 B;  3BVM A;  1TKY A;  4MGY E;  2PKO A;  2BKF A;  2KDE B;  1SIJ A;  1E10 A;  1YQB A;  3ZRF A;  2C7M B;  3DQV A;  3M62 B;  1V8C A;  4O1N A;  2IND C;  5FR3 A;  2WXF A;  1Q0W B;  1NYQ A;  1T0S C;  4LCD E;  4KDL B;  3QQ8 B;  3APD A;  3H9D A;  3ETR A;  3FKY A;  1FCC C;  2JZ3 B;  1EM7 A;  3VXW A;  3P4S B;  4WWM A;  1QOF A;  4NJ6 A;  5G5G A;  1JWB D;  2Q5W D;  1WM2 A;  2WXI A;  3L08 A;  1SE9 A;  2KDF B;  1SB3 C;  4P6V F;  4HPP A;  1YX5 B;  1F1H A;  3PLV A;  2LAS A;  2Y5B B;  4KVG B;  1TBE A;  2JXX A;  1VR9 A;  2L0F A;  4RH6 A;  4DQO C;  5EE3 A;  4XDC A;  5KHQ A;  3A1Q A;  2QIE B;  2A5U A;  2J42 A;  2JT4 B;  1XF5 L;  2J52 A;  2OOB B;  2JZZ A;  4KZC A;  3UF8 A;  3RMK C;  4NPN A;  2WDT B;  3UQA A;  1EUV B;  3CF6 E;  1TS5 A;  1FO4 A;  3T3N A;  1P0R A;  2G3Q B;  4E74 A;  3W1S A;  4XWW A;  2K9X A;  3NZS A;  3GS2 A;  5LXI B;  2M1M A;  2JYE A;  4ANW A;  2REX A;  1EU3 A;  4NJ7 A;  3A9J B;  2X8X X;  4IW0 A;  4YSY B;  2LGS A;  1IBX B;  2NBV B;  1OGW A;  3L13 A;  2ZNV C;  1N60 A;  4K3C A;  1RFK A;  5CTR C;  3KVF B;  5E6P A;  2JPH A;  2BF8 B;  3VUW A;  4MH0 E;  2ICI A;  2NBW B;  3H6N A;  1QOG A;  3IFW B;  3PO0 A;  1FM0 D;  2IO3 B;  4RGN A;  3ZLZ A;  4HKQ A;  3R3M A;  4WQO B;  2M17 A;  1I4P A;  2G4D B;  2DEN B;  2GBM A;  4URK A;  4B95 A;  2KWD A;  3GOE A;  3R66 C;  2EKI A;  1MI0 A;  3PZ8 A;  3OWE B;  5IA7 A;  2MA9 B;  1MFW A;  3IHP C;  2KHW B;  3L17 A;  3N1X C;  5H92 C;  4RGT A;  3P4Q B;  1KLG D;  1WGH A;  3SEB A;  2NTS A;  4RM9 A;  2W54 A;  1JCK B;  3D32 A;  1BML C;  4EZK A;  1JRP A;  2KAC A;  5CHW A;  3R2I A;  2WX1 A;  1TY2 A;  3ALB A;  5DPW A;  1EWC A;  1MHH E;  2N9P C;  3DBH I;  3PRM B;  4G50 A;  3DBL B;  3GB1 A;  4I6L B;  3LYY A;  2CU1 A;  4RF1 A;  3MC8 A;  3E9S A;  1C79 A;  2N9X A;  3P1M A;  4IWQ A;  1WWT A;  2JY6 A;  1LO5 D;  2XEW A;  1V9J A;  2PJH A;  4TSS A;  4A3P A;  1PGA A;  3ZXV A;  1WY8 A;  2O6V B;  4EOY A;  4BOS C;  3Q2A C;  1E8Z A;  4X57 B;  2LVP A;  1V1O A;  3AEA B;  2AX5 A;  2MHJ A;  4K3B A;  1OEY A;  2K1F A;  2DWQ A;  3NS1 A;  4XZ4 A;  2V4I B;  4A6Q A;  1UGM A;  1GG3 A;  1NEN B;  3VUX A;  4LJO B;  1JWU D;  3OJ4 B;  3TSS A;  1JRO A;  1VJK A;  4QAY A;  1JAL A;  1VD2 A;  5DPR A;  3C0R B;  1DOX A;  3UIP B;  1MG8 A;  2BS3 B;  3RT3 B;  1HTO A;  3RNF C;  1A70 A;  3IG3 A;  3DBR B;  1C4C A;  4DHJ B;  3RCZ A;  1FMA D;  3NG0 A;  5IAA C;  1WJ4 A;  5G2N A;  2DBY A;  1GC6 A;  1X1M A;  2IO0 B;  2K6Q A;  1WGK A;  3MP9 A;  3A9K B;  4W9F A;  4TKN A;  3IAM 1;  3GE8 C;  1V1P B;  2X38 A;  4W9J A;  1SF0 A;  3DDC B;  1XO3 A;  4LNF A;  5GMV A;  1FXT B;  1F9J A;  3HRD D;  5D7G A;  4A20 A;  4FHK A;  2BYE A;  1D5X C;  1QOA A;  4RNA A;  2E3T A;  4LLG M;  1WFY A;  4ZRI A;  2KD0 A;  2G1E A;  1WE6 A;  2LFI A;  3B0A A;  4ANV A;  2WU2 B;  2KLC A;  2O2V A;  1C77 A;  1OQQ A;  2GBR A;  2KMC A;  2C9W B;  1ENF A;  1WYW B;  1RRB A;  2MBO A;  1V81 A;  4II3 B;  2K22 A;  2DAF A;  3LXF A;  1SJE D;  3NHE B;  2WXM A;  2ZNV B;  2V9H A;  3DWG C;  4NY0 A;  4PS3 A;  4BKS A;  4HLE A;  5I4D A;  4DWF A;  4ARC A;  3ZJT A;  1KM7 A;  3TJP A;  1WR6 E;  3U7D A;  2PIA A;  3VFK A;  1WI0 A;  3ABV B;  3N3K B;  2LHD A;  2KTR A;  2D3C A;  2IGH A;  3AU4 A;  4N6E B;  2RMM A;  1WIA A;  4YT0 B;  3DBH B;  4LNI A;  2BGF A;  1QZE A;  3AE5 B;  2XNA C;  4KIK B;  2WNM A;  2ACZ B;  4LDT D;  4IOI E;  1HQR D;  3Q8C A;  4FBJ B;  2FCS A;  2WHI A;  4XC2 A;  3PGE A;  3PRE A;  1ESF A;  1GJZ A;  3ZTD A;  1FNU A;  1PUT A;  1K50 A;  5MPO A;  5C1Z A;  5D3I B;  4W9E A;  3RN9 C;  5HG2 A;  3RUI B;  1JWM D;  1JML A;  1RFA A;  4KSL C;  4ZRK A;  2JU6 X;  3VH3 B;  2LJI A;  1M4V A;  4OVV A;  4OVZ A;  4S17 A;  4TV3 A;  1C9F A;  2NR2 A;  4WWP A;  2ZCB A;  4C80 A;  3VRB B;  3N1Z C;  5L83 A;  2DLB A;  1K51 A;  1WGR A;  5BO4 B;  2GRI A;  4N58 A;  1YN3 A;  4W9I A;  2BB6 A;  3NY5 A;  3KWV A;  4HK2 A;  2L3Z A;  2OHF A;  2ZVO A;  4W9L A;  3SFE B;  2HTH A;  4I6N B;  2DHZ A;  4HPM B;  3VR8 B;  1WZ3 A;  3HVD A;  4YSX B;  3S2A A;  1QT9 A;  2QCZ A;  1L2N A;  3M63 B;  4NAW A;  5C3J B;  1C4A A;  1YQ4 B;  3AEG B;  3TIX A;  2MW5 A;  3Q8E A;  2LWP A;  2IPK D;  3IT4 B;  1TIF A;  2FCN A;  2L05 A;  3URY A;  1CK1 A;  4HCN B;  3AUL A;  2PVO D;  2KLG A;  3HM3 A;  1VZ6 A;  1OTR B;  4FXC A;  2K0P A;  2L52 A;  1L6U A;  2DYO A;  4PK1 A;  2DYM A;  3ZJU A;  2ZZP B;  5G55 A;  1UNS A;  2WXN A;  2INC C;  2BWF A;  3U8Z A;  4UDU C;  2NCN A;  3L16 A;  5AUI A;  1AN8 A;  4HPL B;  4BKT A;  3FIL A;  1IGC A;  1YX6 B;  1BUI C;  4TQ1 A;  3U2S C;  4G0N B;  1ZGU B;  1FRR A;  1XLQ A;  3UI3 A;  3QCA A;  5CHV C;  2KC2 A;  4XGA B;  4BVU C;  5TR5 A;  3WAN A;  4FN2 A;  1TKG A;  1IPG A;  2D3G A;  1L4D B;  1KFY B;  1MPE A;  2R61 A;  3DBR I;  3KUC B;  3PT2 B;  1ZKH A;  3H7P A;  4M02 A;  1E90 A;  2FCQ A;  4EUT A;  1GB1 A;  1FIQ A;  2DX5 B;  3V6E B;  3MTN B;  4AOF A;  2WXJ A;  2JVC A;  4A3O A;  1SSN A;  1YJI A;  4TUU A;  4GU2 A;  3VRA B;  2JWZ A;  2NTT A;  3EHV A;  1K53 A;  3P63 A;  2WXP A;  2O6V D;  1LFD A;  3K9P B;  1YN5 A;  3AH7 A;  3A1Q B;  1LM8 B;  2AL6 A;  4HCP B;  2XBB C;  4GSW A;  3ZDT A;  2J7Q B;  1TJE A;  2HJ8 A;  3EC8 A;  4K81 A;  2H89 B;  3TL5 A;  3PTF C;  4GN1 A;  3BY4 B;  5LXH A;  3V05 A;  1PGX A;  3AE6 B;  1NBF C;  3AE8 B;  1E8Y A;  3DVN V;  4MT5 A;  4CYE A;  3PV1 A;  1GC7 A;  2L7R A;  1AW7 A;  2W55 A;  3AEC B;  4EZJ A;  1ZDV A;  2AQ3 B;  4AJW A;  5EDS A;  2QIL A;  2KQ4 X;  3U4E G;  3QA8 A;  1N63 A;  1M94 A;  1WYG A;  4DXA B;  4IM3 A;  5IN7 A;  3O65 B;  3NZ3 A;  3BIN A;  2XK5 B;  3TEW A;  4JGH B;  3V6C B;  4ANX A;  1VCB A;  1KH0 A;  2FUG 1;  2PE9 A;  2D3A A;  1WZ0 A;  1MJD A;  1OFF A;  2O2V B;  1NEK B;  1LXD A;  1JQ4 A;  1PYW D;  3AE3 B;  4YTP B;  3EUB 2;  5HHD G;  3NVV A;  1NI2 A;  4FJV B;  1V5T A;  2BWE S;  4P7I A;  2BQQ A;  1J7A A;  2L76 A;  4LTU A;  2KMA A;  2N4F A;  3UGB B;  4LK0 M;  3RI7 C;  3Q6B A;  4XYC A;  1KJT A;  4TMA B;  3T3O A;  4IWO A;  4HJK A;  1WMH B;  2L1A A;  4OZB A;  3B2G A;  4LDT B;  1E8X A;  1H8C A;  1D5M C;  1FEH A;  1R4M B;  3KW5 B;  4AP4 C;  4B0E A;  5JHB A;  4R3D A;  3AE2 B;  2DZM A;  4KZ0 A;  1R7S A;  4DXG A;  2H88 B;  4G11 A;  3P4R B;  2ZPN A;  4D2K A;  2INP E;  3DVN U;  2LVO A;  2WXO A;  3HM6 X;  1TS3 A;  2LGD A;  4C4V B;  2NPT A;  1TZO A;  3N9Y C;  4PYU A;  4EKU A;  1TS4 A;  2BS4 B;  1P7E A;  2K8C A;  3R8B A;  2OJW A;  2Z8L A;  3MJW A;  2WQY B;  4RFB A;  3VTV A;  2NVU I;  3RNA C;  2KYW A;  4MJS B;  2DZJ A;  2EKE C;  1Z2M A;  1OQR A;  3AE9 B;  4GXB A;  1FRD A;  3JYU A;  3AE1 B;  2QHO A;  1N61 A;  3EFU A;  2G45 B;  1WJU A;  2KQ7 A;  1N6Z A;  4CHK A;  2CKH B;  4M0W B;  3APC A;  4ZRJ A;  4MGK E;  2LRU A;  4P1C C;  3MC0 B;  5D94 A;  2LZ6 A;  4JIO U;  2KDM A;  2KTF A;  5C23 A;  1ZE3 D;  3EA6 A;  2I2Y A;  1UZX B;  2CR5 A;  5E6O A;  1C78 A;  1EU4 A;  2J0M A;  1GNU A;  1LGR A;  3L4P A;  2CJO A;  3I57 A;  2C5L C;  3CWI A;  4GGQ A;  4DBG A;  1J19 A;  4GDL B;  3AV8 A;  4FLH A;  2N7J A;  1V5O A;  4M0W A;  3AB5 A;  1FNV A;  4YXD B;  4KV2 A;  2MJ3 A;  1V49 A;  2MBQ A;  1J0G A;  2MBH A;  2K5P A;  2KJH B;  2WP9 B;  3AE7 B;  3AMZ A;  3Q3J A;  4AS1 A;  2IO2 B;  3ZRC A;  4HXD A;  4IWP A;  5BYS A;  1WR1 A;  1C3T A;  3PHW B;  2IGG A;  1TZ1 A;  3ML8 A;  3ENE A;  1LQB A;  5FR6 A;  4K7W A;  3DBL I;  4K7U A;  2NMQ A;  2V3N A;  3PRZ A;  2LGI A;  2FBW B;  2WWZ A;  1UH6 A;  4WWO A;  1I4X A;  2G9H D;  2ZW0 A;  3ZNZ B;  3KWL A;  3VUY A;  1FFU A;  2UWQ A;  1HXY D;  1GPX A;  5BYR A;  4FUL A;  2BW2 A;  1N62 A;  1D4B A;  3O13 A;  1ZUD 2;  3RNE C;  5FKA C;  3SU8 X;  1MVK A;  4WWN A;  2FIF A;  1P3Q U;  3AM9 A;  4RF0 A;  2JWU A;  4ICV A;  3IT6 B;  3ZVV A;  4AUQ C;  3ZGZ A;  2KXJ A;  1UBI A;  3AED B;  1J7B A;  1UBQ A;  3C19 A;  3AU5 A;  4XX5 A;  1V86 A;  1IBX A;  4DHJ D;  1ZXH A;  1I4H A;  1P7F A;  2AL3 A;  2Z0D B;  5JZE B;  5LNK 1;  2FID A;  2WU5 B;  2V3P A;  4LJP B;  4MAC A;  4EE2 A;  3KLS X;  1XCQ L;  3OAW A;  4AWJ A;  2BPS A;  3P4P B;  3ZKJ C;  4RM8 A;  1VDV A;  2MLB A;  2PTL A;  2BKR B;  2YLM A;  4CQN A;  1I7H A;  3KYC D;  4US9 A;  3Q3F A;  2KWC A;  4YTN B;  2RDH A;  2WX0 A;  1TYG B;  4BBN F;  4GIV A;  5CX3 A;  4EEW A;  4N9F 4;  1Q1O A;  3I63 C;  1YN4 A;  2J53 A;  1HTQ A;  2MEK A;  4ZYS A;  4JPS A;  1KLV A;  4LNO A;  3IXS A;  3NRZ A;  2JF5 A;  4W9C A;  1SXT A;  3IAS 1;  4ICU A;  4KGT A;  1WX7 A;  3QK0 A;  3W1Y A;  3HUI A;  3ZYY X;  3DVG Y;  1ZOY B;  5FK9 C;  1BXT A;  1JWS D;  2AQ1 B;  3ZUN A;  5J17 A;  2LVQ A;  2W82 A;  2NS5 A;  2KVZ A;  1L7Y A;  1GAQ B;  1SE3 A;  2WXK A;  2GI9 A;  3A9J A;  2LGX A;  5LLI A;  3AEE B;  4W9H A;  4HJG E;  1NI3 A;  4MM3 A;  4W9K A;  4N59 A;  1TKE A;  3SR6 A;  1ACC A;  3JSV B;  2O6V A;  1JRU A;  1Q10 A;  3WAO A;  1F52 A;  1TGZ B;  5IO9 A;  4LNN A;  2WXG A;  1P98 A;  4W9D A;  4WQM A;  3GZN I;  3AE4 B;  3BYY B;  2KDI A;  4IDI A;  4PS7 A;  5T8I A;  2HJ1 A;  3TEZ A;  2KAJ A;  2OED A;  1UWM A;  1UUP A;  1SIF A;  4IM2 A;  2UYZ B;  3W1S C;  3BVG A;  1PQS A;  2K8B A;  4JLC A;  4HDO A;  4HRO A;  3BZD B;  3SDL C;  1F77 A;  3JSV A;  4JWU C;  2XK5 A;  1QLB B;  3X0W A;  2ZVN A;  3HK0 A;  1Y56 A;  4M8N A;  2MWS B;  3I3T B;  2IGD A;  4C00 A;  3H7P B;  4ZRP A;  2KO3 A;  1F2R I;  2GB1 A;  4W9G A;  3GP7 A;  3EFC A;  5J18 A;  1L4Z B;  4ZRQ A;  2IY1 B;  1KRH A;  2KK8 A;  2DNF A;  3PZ7 A;  1DOY A;  2RD0 A;  4DXF A;  1QOB A;  1YD8 U;  2PVG C;  3QC8 B;  1UEL A;  2M0A A;  1IYF A;  3UIO B;  2JRI B;  3WIM A;  3ZIM A;  4OHJ A;  1WM3 A;  4XE0 A;  3NVY A;  4Q2J A;  1FXA A;  1WF9 A;  1E8W A;  2CS4 A;  1FCL A;  4JWS C;  4ZYN A;  3LJ3 A;  1XCT L;  1H4R A;  4HRS A;  2V4L A;  2KWV B;  3PS6 A;  3RPF C;  3CSF A;  3NUH B;  3EGR A;  5DPT A;  3NZU A;  1QKZ A;  1WJ6 A;  3AN1 A;  3VH4 B;  4A90 A;  1FPY A;  2N9E B;  3CIR B;  3WAL A;  3R7R A;  1V80 A;  1DOI A;  2N1V A;  2RSU A;  2IYD B;  3NS8 A;  4H2A A;  4ZHO A;  4HDQ A;  2YEP F;  2KX0 A;  5AZF A;  1L0V B;  1D6E C;  4K1R B;  4WUR A;  3AXC A;  3IBE A;  1YJJ A;  2KWU B;  2BS2 B;  1P9D U;  1R4M I;  1SEB D;  4MJS A;  2ZEQ A;  3B9J A;  2D07 B;  3AEF B;  2N0S B;  4YTM B;  1T5X D;  3W5V B;  1FFV A;  3ZW3 A;  2FE8 A;  3VQI A;  2KTR B;  3NVW A;  1KF6 B;  5EE0 A;  2AWT A;  1TY0 A;  4GLS C;  1KOT A;  2DAJ A;  2RPV A;  2BT6 A;  1CJE A;  2VH1 A;  3TEY A;  4GB9 A;  4NNJ B;  2L00 B;  4HEA 1;  3V60 A;  3U30 A;  5EE1 A;  1SGH A;  3PLU A;  2KN5 A;  2L8J A;  1WX9 A;  2EMT A;  3IVF A;  2WGS A;  3Q3M C;  4JL9 A;  1U4A A;  3A33 B;  1WXA A;  1WRI A;  4NZL B;  2BB5 A;  2HD5 B;  5E6N A;  1C76 A;  3VDZ A;  3MHZ A;  4FJZ A;  2W3R A;  4ITK A;  4MSM B;  3Q8B A;  1VZ8 A;  3BK2 A;  2JQR B;  2D2Q A;  3RNC C;  4I6P A;  4PYZ A;  4B9K A;  2UU7 A;  2WXL A;  1RWS A;  3BII D;  3DCG A;  3RFZ B;  1D3Z A;  1I35 A;  1SE4 A;  1S1Q B;  4OVU A;  3A4S C;  1XT9 B;  2PMV A;  3EEC A;  4DDI D;  1KTK A;  4PT5 A;  2RR9 A;  5JHA A;  4AJY B;  1I4Q A;  2DYB A;  1WXM A;  1OEY J;  2G4S A;  3DHH C;  2VH2 A;  3NJT A;  3QX1 A;  2V0G A;  2ZJD A;  2GOW A;  1Z5S B;  2QDF A;  2KN4 A;  3PPA A;  4ASW C;  3QIJ A;  4HWI B;  3WAM A;  3QAQ A;  4FHJ A;  1ZW7 A;  1TT5 B;  3HVZ A;  2N9L A;  1HE8 A;  3L10 B;  1EF1 A;  2YEP B;  2D5G A;  4L23 A;  4WAA A;  2M8S A;  1GUA B;  2GBJ A;  4IKG A;  4JX1 C;  3Q3N C;  3VTU A;  1ET6 A;  2ONQ A;  3MC9 A;  1L5P A;  5D3D A;  3DVG X;  5AEK B;  4M8M A;  3ECI A;  3B08 A;  3C8Y A;  3PRP B;  4II2 B;  5D6J B;  4WJN A;  2M0X A;  3DWM A;  4F8C B;  3H7S A;  4RMA A;  1YMH E;  1E0Z A;  4B6W A;  1GOZ A;  2KFK B;  4WJQ A;  4CO7 A;  2JYT A;  4WH4 A;  3ZJV A;  3SD5 A;  2PPH A;  1AAR A;  2JUO A;  2EMS A;  4XDD A;  4WAF A;  2V3S A;  1I4R A;  3H8H A;  4C7Z A;  2N7D A;  1V97 A;  4MM3 B;  4E71 A;  2ON8 A;  2PW9 A;  3AEB B;  2R2O A;  2LRW A;  2LI5 A;  2Z59 B;  2C60 A;  3GE3 C;  4JQW C;  3R2T A;  2CU3 A;  4FJY A;  2J4X A;  5IP4 D;  1P1A A;  3KUZ A;  3ZO5 B;  3Q14 C;  2A4Z A;  2C7N B;  1XD3 B;  4GDK A;  2E6X A;  4C7Y A;  2INN E;  4DHZ B;  1RM6 C;  1WRD B;  2MRP A;  3BYT B;  4NQK E;  3ZNI D;  1TTN A;  3APF A;  2KFK A;  3WA0 A;  2LXC A;  4ZOH C;  3JVZ X;  2N7E A;  3JW0 X;  4KIK A;  4DDG D;  5D2M B;  4KKI A;  4DHZ E;  1E5W A;  1C4P A;  3OG5 A;  4M00 A;  3BWU D;  2D10 A;  1A5R A;  3Q3O C;  4BOZ B;  2D3B A;  2DZK A;  1E9M A;  1XQQ A;  1R4N I;  2K8H A;  2N1W A;  2LXA A;  5AZG A;  2GBN A;  1V2Y A;  2MBB B;  4KDI C;  2MBE A;  2BYT A;  3RZF A;  2M19 A;  3OJ3 A;  1FNW A;  2PEA A;  1CMX B;  4L2Y A;  1UGJ A;  4WJP A;  4GDK B;  4IG7 B;  2J0K A;  2FAZ A;  1XLN A;  2MJD A;  2V1Y A;  1ZP0 B;  2GLS A;  4MEM A;  2LUM A;  2MX2 A;  2QSD A;  1KLU D;  3B1L X;  2KKC A;  3I5J C;  4IUM B;  2ASQ A;  2KOX A;  2HE7 A;  4FAD A;  2L0T A;  4KGR A;  1I4G A;  2TSS A;  1WMH A;  2RDG A;  4MDK E;  2QJL A;  2ZCC A;  3NOB A;  2K6D B;  1T0Q C;  3A9K A;  2IBI B;  3KQ4 A;  2KFJ A;  2RGF A;  4EZL A;  1FXI A;  4F1S A;  2SAK A;  1ROE A;  2LEK A;  3RZW C;  3M95 A;  2JZP A;  2ZW1 A;  2FUH B;  4USA A;  4REZ A;  1EO6 A;  3X23 A;  3NVZ A;  1I42 A;  2QC8 A;  2MJE A;  3TBL D;  5J2R A;  2XN9 C;  1V6E A;  1QIL A;  1EF5 A;  2LHE A;  1WXQ A;  3DHG C;  2QEJ C;  4YWG G;  3W5U B;  2CHW A;  3FC4 A;  1J7C A;  1F0Z A;  2VZK B;  1OQY A;  5TSS A;  2Y5P A;  2MSE D;  4S0R A;  1HZ6 A;  4GOC A;  1WJN A;  3KH0 A;  1AWD A;  2KVR A;  3ZXR A;  3ONS A;  1BT0 A;  1DYQ A;  4WIP A;  3RUL A;  3U7Z A;  4B0M A;  2I1K A;  4L1B A;  2KJR A;  3FAH A;  4PS8 A;  1Y8R C;  3PHX B;  1RAX A;  4E3C A;  4P1B C;  2MP2 A;  5L95 C;  3QAR A;  1AYF A;  4HKZ E;  1ZDX A;  5JH5 C;  2HTM E;  4BFR A;  2HDE A;  3VTW A;  5CHF A;  1WE7 A;  1FD6 A;  2VZK D;  4US8 A;  1UWX A;  2J0J A;  2WXH A;  3UIN B;  3V3X A;  3BK1 A;  2WXQ A;  4IC7 B;  2LUE A;  2IDY A;  5BMI A;  4J3O D;  2JSV X;  4A9A A;  3QHT A;  2CJN A;  3P2B A;  3W2D A;  1RLF A;  1WX8 A;  4FA6 A;  2SEB D;  4OZC A;  4RGO S;  1XLP A;  1SJH D;  1WH3 A;  3L54 A;  1G6J A;  2D11 A;  3Q8F A;  1NVI D;  2AQ2 B;  2BYF A;  4RCO A;  3T9L A;  2W9N A;  3DPD A;  4MGZ E;  1IP9 A;  4HVB A;  2Y5C A;  4C4V A;  5JXV A;  3FIL B;  3CMM B;  4NAM A;  3E56 A;  4EFO A;  2KQS A;  4GDL A;  4BBN C;  1E7V A;  4OZA A;  1GB4 A;  3I9V 1;  2WLB A;  3TUO A;  3VVW B;  2NPT B;  3Q8A A;  4WJO A;  2OJR A;  3HIZ A;  3DOW A;  3N1Y C;  1WXV A;  5KHO A;  5IOI A;  1VLB A;  3BVZ A;  1QF6 A;  2PLP A;  3SFD B;  4GMV A;  5C2T B;  3V62 A;  1B1Z A;  4ZDV A;  3OLM D;  1NDD A;  4BZA A;  1CZP A;  3A4R A;  5GXG B;  1YQ3 B;  4A55 A;  5IKC M;  1WXS A;  1YJ1 A;  2LGY A;  3RNB C;  1XEE A;  1T0Y A;  2KMM A;  2MP2 B;  4AQ7 A;  3T8M A;  4MGI E;  1E6E B;  2I38 A;  3V61 A;  1B9R A;  3ZDM C;  2LMC A;  3MFG A;  2JRH A;  4NJC A;  1DGJ A;  2GMI C;  1WGD A;  1HEZ E;  4RGM A;  3KUD B;  1SBB B;  1QQR A;  3N20 C;  1K52 A;  2CHX A;  3LDZ E;  2KZR A;  1TS2 A;  2MCN B;  4J6I A;  1EWY C;  1UD7 A;  3ZNH B;  4BKG A;  5BMH A;  3VAW A;  2WDR B;  1VZ7 A;  5DCN A;  1R4N B;  3U52 E;  3AI5 A;  1C1Y B;  2LD9 A;  2VRR B;  3J9C A;  4A8X C;  4K7S A;  1WGY A;  1L0X B; 
#chains in the Genus database with same CATH homology
 1PDX A;  1D5X C;  1ET9 A;  5H8Y E;  1ZXI A;  1T3Q A;  2PMV A;  1QOA A;  3L4P A;  2CJO A;  3I57 A;  2E3T A;  4RNA A;  5BYQ A;  3CWI A;  4LLG M;  3Q69 A;  1KTK A;  4PT5 A;  1N5X A;  1IGD A;  4NAW B;  2G1E A;  3LB8 C;  1I4Q A;  2IJ0 A;  3P42 A;  4GDL B;  2LFI A;  3AV8 A;  2N7J A;  2V0G A;  2WDV B;  2WU2 B;  4ZHP A;  1WSP A;  1C77 A;  1N5W A;  1OQQ A;  2KN4 A;  1ENF A;  4M0W A;  3AB5 A;  1FNV A;  3MJ5 A;  4YXD B;  2K22 A;  1F2R C;  2MJ3 A;  3LXF A;  1JW9 D;  1SJE D;  2WXM A;  3HVZ A;  2N9L A;  2K5P A;  3DWG C;  2WP9 B;  3AE7 B;  3AMZ A;  5I4D A;  4AS1 A;  4ARC A;  2YEP B;  3ZJT A;  3WCQ A;  1ZPS A;  2D5G A;  4L23 A;  5BYS A;  2PIA A;  3ABV B;  4KX6 B;  4IKG A;  4JX1 C;  2LHD A;  1ET6 A;  2IGG A;  2IGH A;  2ONQ A;  1L5P A;  5D3D A;  4N6E B;  1IUE A;  2RMM A;  4KKJ A;  4YSZ B;  3VR9 B;  4YT0 B;  2NMQ A;  3C8Y A;  2V3N A;  3AE5 B;  2XNA C;  5E6J A;  2WNM A;  3DWM A;  2ACZ B;  4C56 C;  2LGI A;  1YMH E;  2FBW B;  4IOI E;  1E0Z A;  4TQ0 A;  1GOZ A;  1HQR D;  1I4X A;  5BMG A;  2JYT A;  2G9H D;  3Q8C A;  2K3U A;  4WH4 A;  3ZJV A;  2ZW0 A;  2EEL A;  4ARI A;  3KWL A;  1PGB A;  1FFU A;  2MH7 A;  4XDD A;  4WAF A;  1I4R A;  1HXY D;  3H8H A;  4C7Z A;  5BYR A;  1GPX A;  1V97 A;  4MM3 B;  1T6B X;  1ESF A;  5HI1 A;  2JX5 A;  5G5H A;  2BW2 A;  1N62 A;  1D4B A;  3O13 A;  2QMT A;  2ON8 A;  2PW9 A;  3AEB B;  2BTE A;  1ZUD 2;  1FNU A;  1PUT A;  5FKA C;  1HZ5 A;  1K50 A;  1YNT E;  1MVK A;  2WXR A;  3TEX A;  5MPO A;  2L32 A;  3R2T A;  2CU3 A;  2J4X A;  3AM9 A;  1PFD A;  5D3I B;  4RF0 A;  5HG2 A;  1JWM D;  2JWU A;  1JML A;  4XWT A;  1E7P B;  4P16 A;  2E6X A;  2JU6 X;  2INN E;  4C7Y A;  1RM6 C;  3IT6 B;  2LJI A;  1V1P A;  1HA5 A;  1M4V A;  3ZGZ A;  3BYT B;  4OVZ A;  1C9F A;  3AED B;  1J7B A;  4C80 A;  3VRB B;  5HFY A;  2DLB A;  4ZOH C;  1IBX A;  2JXT A;  1K51 A;  1XXG A;  1ZXH A;  4MH8 A;  4KKI A;  1I4H A;  2GRI A;  1P7F A;  1VRA B;  1C4P A;  4N58 A;  3BWU D;  1YN3 A;  2BB6 A;  1MHX A;  5LNK 1;  3KWV A;  4KGS A;  3B2F A;  1E9M A;  2V3P A;  2OHF A;  2WU5 B;  1JWA D;  2WDQ B;  4MAC A;  1L0Y B;  1L6V A;  4OW0 A;  3SFE B;  3KLS X;  4EE2 A;  1XCQ L;  3ZQ4 A;  3P4P B;  1VDV A;  2L83 A;  2PTL A;  3W9C B;  3VR8 B;  4CQN A;  2BBC A;  3HVD A;  2WS3 B;  1I7H A;  4US9 A;  5AUK A;  4YSX B;  1QT9 A;  1CQV A;  2BYT A;  2M19 A;  5C3J B;  4YTN B;  2B76 B;  2RDH A;  1FNW A;  1C4A A;  1YQ4 B;  1SE2 A;  3AEG B;  1TYG B;  1D5Z C;  3Q8E A;  1XLO A;  2Y3A A;  4L2Y A;  1UGJ A;  1STE A;  2IPK D;  3IT4 B;  4GDK B;  5EE9 A;  3URY A;  1CK1 A;  1XLN A;  2PVO D;  2W3S A;  1NYR A;  1YN4 A;  2N9K A;  2MJD A;  4JE3 B;  1ZP0 B;  2J53 A;  2MEK A;  2LUM A;  2QSD A;  1VZ6 A;  1KLU D;  1RYJ A;  4FXC A;  2K0P A;  4JPS A;  4ZYS A;  3IXS A;  3NRZ A;  2M56 B;  1SXT A;  1TKY A;  3BVM A;  2L52 A;  1L6U A;  3IAS 1;  2DYO A;  2PKO A;  2DYM A;  3ZJU A;  1SIJ A;  1E10 A;  1UNS A;  4KGT A;  2WXN A;  4KGR A;  1I4G A;  2TSS A;  4UDU C;  3ZYY X;  3HUI A;  2RDG A;  2QJL A;  5AUI A;  1ZOY B;  5FK9 C;  1AN8 A;  1V8C A;  4O1N A;  1BXT A;  1IGC A;  3FIL A;  1BUI C;  4TQ1 A;  3U2S C;  5FR3 A;  1JWS D;  2WXF A;  2AQ1 B;  1FRR A;  3KQ4 A;  1XLQ A;  3UI3 A;  1NYQ A;  2W82 A;  1FXI A;  1GAQ B;  1SE3 A;  2WXK A;  2GI9 A;  3ETR A;  1FCC C;  3AEE B;  1EM7 A;  1NI3 A;  4HJG E;  2SAK A;  1TKG A;  3P4S B;  4WWM A;  1L4D B;  1KFY B;  2LEK A;  1QOF A;  1MPE A;  1ROE A;  2R61 A;  4N59 A;  1TKE A;  3SR6 A;  1ACC A;  2JZP A;  5G5G A;  2ZW1 A;  1JWB D;  4USA A;  4REZ A;  2Q5W D;  1Q10 A;  2WXI A;  3NVZ A;  4P6V F;  1SB3 C;  2WXG A;  2MJE A;  2XN9 C;  4WQM A;  1GB1 A;  1QIL A;  1FIQ A;  1VR9 A;  2LHE A;  4RH6 A;  3AE4 B;  3BYY B;  4DQO C;  1WXQ A;  5EE3 A;  2WXJ A;  4IDI A;  4XDC A;  2QIE B;  2QEJ C;  4YWG G;  5T8I A;  3W5U B;  3TEZ A;  1SSN A;  2OED A;  2KAJ A;  2J42 A;  1UWM A;  1YJI A;  3FC4 A;  1J7C A;  1UUP A;  1F0Z A;  3VRA B;  2VZK B;  1XF5 L;  2J52 A;  3BVG A;  2NTT A;  1K53 A;  5TSS A;  2Y5P A;  1HZ6 A;  1TS5 A;  3P63 A;  1FO4 A;  3T3N A;  2WXP A;  4HRO A;  3BZD B;  1AWD A;  3W1S A;  4XWW A;  1F77 A;  1YN5 A;  2K9X A;  4JWU C;  3GS2 A;  3AH7 A;  1DYQ A;  2JYE A;  4WIP A;  1QLB B;  3U7Z A;  4B0M A;  1EU3 A;  1Y56 A;  4L1B A;  3FAH A;  4YSY B;  2IGD A;  1IBX B;  1TJE A;  4ZRP A;  1F2R I;  2H89 B;  1N60 A;  2GB1 A;  3GP7 A;  1AYF A;  1RFK A;  4HKZ E;  1L4Z B;  3V05 A;  1PGX A;  3AE6 B;  1ZDX A;  3AE8 B;  4ZRQ A;  2ICI A;  1KRH A;  4MT5 A;  3PZ7 A;  1DOY A;  2HTM E;  4DXF A;  1QOB A;  1QOG A;  2HDE A;  3PO0 A;  1FM0 D;  1AW7 A;  2W55 A;  3AEC B;  1FD6 A;  2PVG C;  2VZK D;  1ZDV A;  4RGN A;  2AQ3 B;  1UWX A;  4US8 A;  4HKQ A;  2QIL A;  2KQ4 X;  2M0A A;  2WXH A;  3U4E G;  1N63 A;  1WYG A;  3V3X A;  3BK1 A;  2WXQ A;  4OHJ A;  4XE0 A;  2IDY A;  3NZ3 A;  3TEW A;  1I4P A;  3NVY A;  4Q2J A;  5BMI A;  1FXA A;  2JSV X;  4J3O D;  4A9A A;  2CJN A;  2KWD A;  3W2D A;  1FCL A;  4JWS C;  2SEB D;  1XCT L;  2EKI A;  4OZC A;  1MI0 A;  3PZ8 A;  4HRS A;  1KH0 A;  4RGO S;  3RPF C;  3OWE B;  2FUG 1;  3NUH B;  3EGR A;  1XLP A;  1SJH D;  1QKZ A;  3AN1 A;  1OFF A;  1NEK B;  4A90 A;  5H92 C;  4RGT A;  3CIR B;  3P4Q B;  1KLG D;  1JQ4 A;  1PYW D;  3AE3 B;  4YTP B;  3Q8F A;  3EUB 2;  1NVI D;  5HHD G;  3NVV A;  3SEB A;  2NTS A;  1DOI A;  2W54 A;  2AQ2 B;  1JCK B;  1BML C;  4H2A A;  4ZHO A;  4RCO A;  1J7A A;  2YEP F;  4LTU A;  4LK0 M;  1JRP A;  2KAC A;  3R2I A;  1TY2 A;  2Y5C A;  4TMA B;  5JXV A;  3T3O A;  1L0V B;  1EWC A;  3FIL B;  1MHH E;  1D6E C;  2L1A A;  4OZB A;  3E56 A;  4NAM A;  3GB1 A;  3LYY A;  4RF1 A;  4WUR A;  1YJJ A;  3B2G A;  3E9S A;  1D5M C;  1C79 A;  1FEH A;  2BS2 B;  4OZA A;  1GB4 A;  3P1M A;  3I9V 1;  1WWT A;  2WLB A;  1SEB D;  1LO5 D;  4B0E A;  3TUO A;  3B9J A;  3Q8A A;  4R3D A;  3AEF B;  3AE2 B;  2N0S B;  4TSS A;  1PGA A;  4YTM B;  1R7S A;  4DXG A;  1T5X D;  2H88 B;  3W5V B;  1VLB A;  1FFV A;  3P4R B;  3BVZ A;  2FE8 A;  1QF6 A;  3VQI A;  4D2K A;  2INP E;  2PLP A;  3NVW A;  1KF6 B;  5EE0 A;  3SFD B;  1V1O A;  5C2T B;  2WXO A;  3AEA B;  2AX5 A;  1TY0 A;  1TS3 A;  4GLS C;  2RPV A;  1B1Z A;  2BT6 A;  1TZO A;  1CJE A;  3N9Y C;  1CZP A;  1TS4 A;  2BS4 B;  3TEY A;  1P7E A;  5GXG B;  1YQ3 B;  2DWQ A;  4A55 A;  3NS1 A;  3R8B A;  2V4I B;  4A6Q A;  2Z8L A;  4HEA 1;  1NEN B;  5EE1 A;  2WQY B;  1XEE A;  1JWU D;  3TSS A;  1JRO A;  2KMM A;  1VJK A;  4AQ7 A;  1JAL A;  4RFB A;  1B9R A;  1E6E B;  2I38 A;  2LMC A;  3MFG A;  1OQR A;  3AE9 B;  1DOX A;  1WRI A;  4NZL B;  2BS3 B;  1A70 A;  4NJC A;  1DGJ A;  2BB5 A;  1C4C A;  1FRD A;  1FMA D;  1HEZ E;  3AE1 B;  1C76 A;  4RGM A;  1N61 A;  3MHZ A;  1SBB B;  2DBY A;  1QQR A;  2W3R A;  4ITK A;  3Q8B A;  1K52 A;  1VZ8 A;  3BK2 A;  2JQR B;  1WGK A;  3MP9 A;  1TS2 A;  3IAM 1;  1EWY C;  1V1P B;  2X38 A;  3MC0 B;  2WXL A;  1RWS A;  2KDM A;  3BII D;  5BMH A;  1SF0 A;  2WDR B;  1VZ7 A;  1ZE3 D;  3U52 E;  3EA6 A;  2I2Y A;  1XO3 A;  3J9C A;  3HRD D;  5D7G A;  3RFZ B;  4A8X C;  1C78 A;  1EU4 A;  1SE4 A;  1L0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...