1F2TB

Crystal structure of atp-free rad50 abc-atpase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
b'AREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tB00
4EJSC 4A82A 3QEOA 3SE0A 2Z5FA 4GP6A 2D3WA 3B1ZA 3U3KA 3NBYC 2B8WA 2O0HA 3VAAA 5CJ2A 4I81A 1ZNZA 1LB1B 2CXXA 1F3OA 2QPOA 3B1YA 1IJEA 2NZ8A 2BKUA 5IDVA 5J4YA 3PITA 1RC8A 5FFMA 1TQ2A 4KODA 4EPYA 2V9PA 4Q1FA 2ZR0A 3A8TA 3KTAB 1GL6A 1UADA 2QSZA 4KYIB 5B58C 4RJLA 4JSTA 2A5YB 4NL4H 2ZVQX 5H8WA 3AKDA 2OAP1 1P73A 1GITA 3FVQA 3LV8A 2GJKA 2PX0A 3U61B 4JJKA 4KBGA 5HCIA 4BFZA 2IS6A 4FCTA 1E9FA 1ZCAA 2OCAA 3TVTA 4F4CA 2AX4A 1S0UA 2ZQ5A 3AF3A 3AB3A 1HE1C 3OAAA 2XTMA 4W5HA 4FWTA 2GBLC 1OXXK 5KU1A 5KOYA 3RRZA 3QKRA 1E6CA 2EFCB 3UG7A 3GLHE 1E1QD 4OHWA 2D62A 3UIEA 2J87A 5DHAA 4A0GA 3GFOA 1NP6A 3I5XA 2VHTA 3KB1A 1W0JA 1E2FA 2HXSA 1GM5A 3BS4A 4HAVA 4O25A 1J2JA 2BV3A 3VR5A 4KSBA 521PA 1Z07A 1E1RD 1XJQA 3QKRB 1YZLA 1VTKA 2BDTA 4M21A 4PX9A 1P2UA 2ORWA 4RZ2A 2GEVA 4Q19A 4D4KA 4AIIA 1PZNA 1GOTA 1YZKA 2XNDD 4MYUA 4QHSA 4PSVA 2O0JA 3I1FA 5FTMA 2ORIA 1W5SA 4A8JB 3SYLA 5LB4A 1U94A 1NLFA 4Q4LA 3O8RA 2OUKA 3A1UA 4BLTA 3IEVA 1G5PA 2BVNA 2YWGA 2HCBA 1CBUA 1YJ5A 2VP4A 3BRWD 1CJTC 1E2DA 1US8A 4R98A 1JPNA 3ZH9B 2VHUA 1OXTA 3RS2A 1KK2A 5AJXA 5K8UA 3AUYA 3MLEA 1U9IA 3QBTA 4HDOB 3SYNA 5KDDA 4KAXA 1YRAA 1XEXB 5HE8A 2W6IA 3WBJA 2W83A 3BXZA 2G0TA 3WHKA 2P3SA 2ZRPA 4QBFA 4ZPXA 4A36A 1OHHD 1MH1A 1A7JA 3EZ6A 1FTNA 5F9FA 1N6PA 1E9DA 3AVTA 1ZINA 3BH7A 1N25A 1UF9A 3W90A 1MT0A 2C96A 1XMVA 3MFYA 1P62B 1RW4A 3SQWA 4BFWA 2QZ4A 5KDLA 5GADl 1UBCA 1DVRA 2VPPA 4DVGA 4HLUA 5G3ZA 3OFNA 1VYUA 5CIWA 1Z06A 1NL3A 1I4LD 1E0SA 2PLRA 2A5DA 4PTLA 2F1HA 4KCGA 4XVQA 3K0CC 4KV9A 3TQCA 3TIFA 2B7BA 2F43A 2G88A 2RGNC 2VSXA 2WKQA 5EXTA 1E2NA 2F9LA 2GCNA 5A4JA 2WVJA 3SBEA 4Z8XA 4M9XA 1VYVA 1NVVR 4UJ3A 3BB4A 2RGBA 1NBMA 2GILA 2R8RA 5FOVA 2VLIA 5DYIA 4D26A 1CEEA 3CX7A 4NDZA 1RZ3A 5FBWB 4RZ3A 1KGDA 4CF7A 5DO9A 5G40A 2IUTA 5EXSA 5CB6A 1L2TA 4A0FA 1G8FA 1X8LA 2R6DA 3G82C 4LV5B 3RS7A 3NXSA 4B6EA 5G53C 2OZEA 2QG6A 3AP2A 4G5OA 2ZU6A 5EUMA 3QXXA 4QGAA 1XBTA 1G1MA 4XWKA 3CIOA 1M7BA 1G18A 2EWVA 2IYZA 4UKDA 3REGA 1DG3A 2RHMA 1ZD9A 3WP1B 3IDQA 2A30A 5F2EA 2JJ2D 4Q1DA 3SJZA 3ZVRA 4BFUA 1ZM7A 4S2EA 2W0SA 1FMLA 4PHFA 2IYWA 2A2ZA 2BMJA 2RB4A 3OIYA 5DSZA 2ZRHA 3LBIA 1YHNA 4NCJA 3K9NA 1EFUA 4BFVA 1YZQA 3W34A 1P60A 5DN6D 1H8HD 3M1IA 1VG8A 1NNEA 4F38A 1IN8A 3KKNA 2HEIA 1BKDR 2QP9X 3PXGA 4AKHA 2GJ9A 2Q9CA 4TMTA 1H8ED 3MJHA 1GTVA 3T5DA 4DDUA 2JIZD 1W7AA 2ZR9A 2J3EA 4PSKA 1ANKA 1YQTA 2X77A 2HJVA 4LK2A 621PA 3GEEA 3VKWA 1E2HA 2QAJA 2R2AA 3A1SA 4D81A 2F3TA 1CR2A 1JALA 5BN4A 1OFHA 4A6PA 1XEWX 1X6VA 2CNWD 5JZVA 2NGRA 1N5LA 2F3RA 5CM8B 3L43A 1VG1A 3EXAA 4DLYA 4C2UA 1DTSA 1R0XA 3I32A 2E87A 1Q57A 2W6JA 3I72A 3LAWA 5IF9A 1Q44A 4OHXA 1XXHA 4B2LA 5IHPA 2EFDB 1FL9A 2GVDC 4L8GA 4D25A 5AUPB 2REBA 2E1RA 3E1SA 4ZO4A 3TAUA 4PR0A 5JWHA 4W5JA 2B8TA 3LNCA 4RD0A 2ZSFA 2QORA 4JYBA 1MV5A 1ESNA 3CRQA 3MG9A 1W1WA 3NTUA 4IXMA 4RFSB 4KU4A 2IK8A 1Y63A 3EASA 3BB1A 1QVRA 1VCIA 1XXHB 4HUQA 3GJ7A 1L4UA 3WMEA 1G5TA 2V7QD 3IIKA 3UMFA 3TGPA 5FBQB 3CH4B 4LJ9A 1RFLA 1CRQA 3CRRA 1IN6A 4DSUA 4F93B 1CP2A 3CWZA 3RVBA 1O87A 2C99A 5BXQC 4HAUA 2ZSEA 2IUUA 3D31A 3HJNA 4D0NA 3EPJA 2WJYA 3OEHA 4N0DA 4P4SA 3U7EB 1M7GA 1Z0FA 4C0SA 2KI5A 4RVCA 3KXLA 3IHLA 1RVDA 4F91B 2QRNA 1QZXA 2CE7A 2QP3A 4KVGA 4AWXA 1WP9A 4DLTA 3CX8A 2W00A 3P4YA 5JCPA 4DSOA 3T5GA 3MRSA 2ZRGA 5CITA 5KHOC 4GP7A 4ILEA 1P9RA 2BBTA 1J90A 5JJKA 2XNSA 2ZYVX 3KDSE 3Q85A 4LJ8A 1K8RA 1T6NA 1OKKD 1VCOA 3J81k 1KSGA 2UZIR 1CS4C 4I4LA 4DIDA 2FN4A 2RHDA 3AF2A 2BJWA 3LRPA 1ETUA 4F7WA 3UWOA 4M1OA 1KO1A 2ZIAA 2AHOA 1RRPA 3KKOA 4MKHA 1OLOA 1NLYA 3VU9A 4B2PA 4CEIA 1W4CA 1WB9A 4E03A 3I73A 1U8AA 4JIMA 2ZI5A 1KIMA 2CDNA 2OO7A 5JMTA 2IHBA 2ODEA 1XCPA 3X1DA 2CL0X 4C0LA 4LJ6A 3LH5A 1OF1A 1WXQA 4NU0A 4RD1A 1E9SA 4Q00A 4LPSA 1GWNA 2CCKA 2RGAA 2J5XA 1E9CA 3VU9B 1W48A 4D6PA 2G83A 1J70A 5L3QB 2G1JA 3TW4A 3R20A 3W8RA 1KI3A 5AUOB 5F98A 3K09A 4NYIR 1GFIA 3EA5A 3IILA 4QGFA 1II9A 3FFBA 5DGXA 4ACBA 1HEIA 1T8TA 2GJSA 4EAQA 1XMIA 3REFA 4X8HA 1W5TA 4P0TA 4NYIQ 5DLQC 1BMFA 1TF5A 3QF4B 2ORVA 5FBRB 1OE0A 4J0QA 3A6PC 1DO2A 3S1AA 3ZS9A 1M6NA 4LPKA 1SVOA 4MUBA 3L0SA 3ND9A 3SQXA 5JJLA 3ZZUA 3AP3A 2J7KA 3OHMA 3DVLA 4KO8A 4EIWA 2PZGA 2OSBA 3X2SA 4KSCA 1PUIA 3CRW1 3KQHA 3K8YA 1VYTA 2VP2A 1JBKA 5IT5A 2H18A 4GOKA 4Q9LA 2XTNA 1W36C 3PIRA 2FV8A 2J0UB 2ODWA 1S3GA 2EFEB 1XXHE 3B6EA 1X8KA 4RKEA 2WJJA 1TUEA 4JJZA 1GSIA 3NEJA 1EWRA 1I2DA 3SDZA 2OBMA 3R9WA 3WBKA 1FNNA 2A78A 1P75A 1SHKA 3I92A 1E94E 3LLMA 1GKUB 4WIAA 2HV8A 5H1YA 3ZGXA 1WA5A 5L3SB 3D8BA 3AVPA 3IUYA 2DWOA 4XD7A 1XCGB 2UKDA 3AP1A 4C7OA 2FA9A 1AZTA 4TYYA 1AQYA 1G7TA 1UFQA 3PEYA 2D7CA 1C9KA 3THWA 1XTJA 1YKSA 1W0KA 1KZ7B 1PJRA 3FMIA 2P2LA 3TUJC 2IF0A 4HYYA 3M4YA 3RWOA 4JYCA 3NBZC 5FUVA 5HE9A 5JHHB 3A4LA 2O8DA 1Q22A 4Q1CA 4EDHA 3UG6A 4MRSA 4JLNA 1JEEA 4C7OB 2O8EA 4RSGA 4PPNA 2B92A 1EFCA 3GQBA 3GMTA 3THWB 4AYTA 1WQ1R 1YR6A 1N3BA 3W6PA 1EXMA 3CR7A 3FYHA 5KO2A 1YE8A 2IEZA 4NKRA 2R62A 2QROA 1S9HA 2ATVA 3B9PA 4N3NA 5EZ5A 2O8DB 1N5JA 4Z1MA 4BASA 2O8EB 2W2XA 2UZ3A 2OILA 1ZU4A 4JLOA 4LHYA 1IXZA 4DBLC 2XZOA 2Q21A 2R6FA 4CEJA 3GLIA 2BCJQ 2WM9B 4BUJA 3T1OA 3SJAA 3FHTA 821PA 1GRNA 4W7SA 2XEXA 3HPRA 3MWJA 1SHZA 4M1WA 5AJWA 1DAIA 1AA9A 1QDEA 3D7MA 2QE7A 3O8BA 3TKLA 4JVNA 4P3YA 2ZXUA 1GUAA 1CF4A 4NYMR 4CEJB 4FIDA 4HEJA 2B7CA 3BGWA 4C0JA 1F2UB 1XZPA 3W3ZB 1J7KA 1E2JA 2QENA 2C77A 2YKGA 4IDHA 2ERXA 2NO1A 2QP4A 3C16C 2F1IA 1AZSC 2VP9A 1COWD 4IVQA 2GZDA 2ZRFA 1GNQA 1SKQA 1UJ2A 1KHTA 1ZMXA 2YC4C 4OJKA 4Y0AA 3B5JA 1Q20A 2XJ9A 2O0KA 5KSOA 4RD6A 1VG0B 2FMXA 1ZAKA 1UKYA 4BZQA 3AM1A 1B23P 2XITA 2PT7A 4FI3C 2W2TA 2Q9AA 3BAFA 4UXIA 4Q5IA 2MSCB 5KNBA 4US2R 1SXJC 1WBDA 5FTLA 2W2VA 1G7RA 2IW3A 3NG1A 5AUQA 4HAWA 3WNDA 1WMSA 2GXUA 2CCGA 2FE4A 3A4MA 3IIMA 2ZJ2A 1TF7A 5DI3A 2JLYA 1HYQA 3RLFA 1NG1A 2IS2A 1NMXA 1KDOA 1W46A 2Q3FA 1KSFX 3RDPA 3K70D 4Q7KA 2GVZC 2FFBA 3EAQA 1R5OA 3QEJA 4X8OA 1N5KA 4BGDA 2R6AA 2QTVB 1FUUA 2C98A 3CPHA 2WMOB 4IW3B 4U5XA 4ZI2A 2IYYA 4AC9A 2QPTA 1UKVY 2WJIA 1NIPA 1R0YA 2YOHA 4B6FA 1P6XA 1CIPA 4IOLA 5TXGA 3CBQA 3GD7A 2C9CA 4XVUA 1U9IC 4ZIRA 4G0NA 5BN3A 4XIGS 2WAXA 4UNRA 2JATA 4R2HA 2IT1A 5BN5A 5L8VA 3EIQA 3BFKA 4YMVA 2ZI7A 1CLUA 2ERYA 3DM9B 3PJRA 1T0HB 1Y3AA 4QBGB 5FH9A 2JDIA 3X1XA 4BFTA 1UAAA 3MWLA 3ONWA 1M34E 3IQWA 4GSYA 1R6BX 3JVUA 5H68A 4ZIRB 2ZEJA 4DLXA 3TR0A 1Q21A 2RGDA 1T91A 1RKBA 1MABA 2NO0A 4TMVA 5CDFA 4Q4HB 4X8MA 1R8QA 1GG2A 4JVMA 5FPYA 3ZS8A 3A1VA 3LBHA 4MYCA 4U02A 3L0OA 4HLUC 2QQ0A 4M0LA 3NEYA 4JBWA 3H1TA 3RANA 2REXB 4GOJA 3Q5EA 5HPYB 5IK2A 1NIJA 1DG1G 1AN0A 1ZVQA 5G41A 3LDAA 4Q1AA 3LXXA 4OHVA 1MABB 5CYOA 1FMJA 4TL9A 2O5VA 4IDPA 3R7WA 5K8LA 4XVRA 5LD2C 3PUZA 1U0JA 3LQRA 5DH9A 3CF6R 4IVRA 4PZYA 4L16A 2UVQA 4C0BA 3A1TA 3LW8A 4TL7A 2WZQA 4IEIA 5TY0A 3BJIC 1QHHA 1SVWA 2FEOA 4RD3A 4DLUA 221PA 2DB3A 4ZCMA 1QBKC 2GXQA 4EUNA 1UBFA 3PCRB 3WYGA 2QMEA 4H9GA 4Q7JB 1NN3A 2PMDA 3QKUA 1Z0AA 4UXJA 3CZPA 1GL7A 4DIEA 2ZE7A 4B33A 2REOA 1N2CE 1WE2A 4MITA 2RGCA 4HSEA 2XJ4A 1N6IA 2ZYUX 2J7PA 4V0NA 2J9RA 4IDNA 2ZRIA 1Q0UA 3DMDA 1XPUA 2DFNA 2FG5A 2ZRNA 4JLJA 1W36D 3T1QA 2YNMA 4PPFA 4RD2A 2CL7X 3N70A 3TJZA 1J99A 4NMMA 2QAGA 3ZIAA 2BHRA 1EESA 4TLBA 4D2IA 2FZ4A 2WWFA 1HE8B 1Z2AA 2CHVA 2HYDA 3CPJB 5E4FA 4C9BA 4HAZA 3AF1A 2Z4SA 2D2EA 5GJVC 5TDHA 2XOKD 2IYLD 4L4UA 2N1BA 4OI1A 4IFBA 1ZUNB 2ZS7A 721PA 1QF9A 3LLUA 3A37A 5EQTA 1CJKC 2D7DA 4OQFA 4URUR 2QGNA 1GIAA 3FKSA 4LYHA 4F92B 4LV6A 4GMXA 5HKKA 3KKPA 3EIEA 4AKEA 3TAHA 3DOFA 1Z63A 2OESA 2DY1A 4FMDF 4PPQA 2GESA 4A2PA 4L9WA 5E7MA 3W9YA 3GLFB 2GZHA 4QOSA 1E79D 1OSNA 1P61B 1HV8A 2OFOA 4DCVA 4PANA 1G64A 3H4MA 5AJVB 2V55B 2KJQA 4RKFA 3SEAA 1E9AA 3ZYCA 5C46F 3NWJA 4GNKA 2HLDA 3KTAA 1ZC4A 3TE6A 5DNYB 2IXFA 1E0KA 3QENA 1QHNA 2CLSA 2ZYWX 2JLZA 3BORA 3FGNA 3AVUA 2RGXA 4TLDA 3AVOA 4TSFD 2ZRMA 3SJBA 4DZZA 3EWAA 1OJLA 2JLWA 1WCV1 4RFVA 5TVKA 1Z0JA 1NVXQ 1Z6YA 4JLBA 2JLUA 2IS1A 2XZLA 1AS3A 3CNOA 2HJGA 3I8SA 2VHCA 2C8VA 2H17A 3VKGA 1OIXA 4V0MA 5SZHB 5ANRB 3MUFA 4B35A 1E2GA 4KI0A 4JLVA 4TQAA 3DO6A 5CLLA 4LYJA 4C0AC 421PA 1SZPA 5J47A 1ZBDA 3SNHA 1V43A 1LV7A 3AVVA 1IHUA 4OQXA 2CBZA 3M0EA 3F3YA 1PLLA 1NY5A 5E95A 2P6UA 3R8CA 5CDFE 1KAOA 2ZSAA 3MWKA 2JLQA 3TVDA 4D4MA 1G8HA 1ZW6A 1NG9A 2R9VA 1XEFA 2FFHA 4UXHA 5B2ZA 2XTZA 1KI6A 1QHYA 4B44A 1GILA 1ZM9A 1IJFA 4A8JA 2L0XA 2BM1A 1G16A 1E1QA 4IEEA 3TRFA 2GCOB 2ATXA 1EWQA 4ZDKA 3C14C 2IYRA 3ZD7A 5EE0A 5L3RA 3SS8A 5B30A 1SVKA 4A2QA 1CULC 1SXJD 4EPRA 3I5YA 3Q9LA 4WZ6A 3ZQJA 1KI6B 3AUXA 4KYUA 4O0MA 4QNMA 5UKDA 4BQSA 5ELXA 3VX4A 1E1RA 3T35A 4NCKA 4A6XA 1XEXA 1P9NA 2IBMA 3TUIC 3ZZTA 2GAOA 2XNDA 2YWHA 3FFAA 2ZTSA 1E0JA 2IYVA 1BYUA 2A9KA 2IUSA 5J4HA 4US1R 2J1LA 4FCVA 2ZAMA 1IN7A 2DR3A 1FZQA 3NKVA 4YLGA 1R8SA 4K81B 1FFHA 1SXJB 4EPXA 1R5BA 3EPKA 4A1FA 2TMKA 3IO5A 2LCFA 1RIFA 2NIPA 1P3JA 4GBMA 2ZI3A 1XPRA 4LX0A 5G3YA 3QE0A 4GFDA 4LJ4A 1II8A 1Z0DA 1R2QA 1RRFA 3QF7A 2HT1A 1A2BA 1OHHA 2K5UA 4M8NE 3DOEA 1A2KC 2IYUA 2ZSDA 2ZROA 3N2IA 4FMBB 4DCNA 3GLFE 2ZJ5A 1T3SA 1Q1QA 1XRJA 2GEDA 4OL0A 2AK2A 1N6LA 2ZJ8A 3RRMA 1T9HA 4FINA 2P5SA 4ARZA 4C3ZA 5BQ5A 2IXEA 1E4VA 1II8B 3Q5DA 3GJ6A 4IHQA 1OIWA 4ZDWA 2V6JA 1IONA 4AYWA 3B78A 5JI2E 3K70C 4HB3A 4UQOA 4GZLA 5C2JB 1G21E 4PPGA 1ONBA 1SULA 4WOPA 4F4IA 1EGAA 4P4TA 1NVVQ 3NC1C 1IY0A 2RKOA 3AKCA 3FMFA 4ARZB 1TTTA 3AF0A 3OIUA 3BFVA 1XP8A 2N42A 1HQCA 4DLRA 3A4NA 4A0RA 1L4YA 4D4JA 2FX3A 5AWFC 1NF3A 3KX2A 1OB5A 1BO6A 3OEEA 3QPUA 3RABA 1UDXA 1XJ0A 1WRBA 4TQUS 4RCYA 3Q72A 3NC0C 4MKGA 3SZRA 3KXIA 1DPFA 3P27A 1RPZA 1XJCA 1Z5ZA 1S96A 2O8FB 3CO5A 5GJBA 1G3UA 4V0ME 4MGYR 4EQ6B 1Q3HA 2PT5A 2QU8A 3C41J 1LW7A 2X2EA 1OT3A 3HWSA 4JVLA 4JKIA 4OQMA 1DAGA 5EP1A 2OBNA 3NH6A 2D4HA 4B34A 2V6IA 5E7IA 2AK3A 3QPWA 3DEFA 3U4QB 2W0MA 4ESVA 4JLKA 2JJ2A 4Q4JA 2GJ8A 4QM7A 4YMUA 4URZR 4CIDA 3T06B 3TSWA 2ODNA 2JLXA 1CU1A 4IDQA 4ZDIA 1YZUA 3X1WA 1TAGA 5JS8A 1VPLA 2J41A 3RS4A 4TYWA 2OT3B 4B3CA 3D3QA 1SGWA 3CPEA 4BLQA 3L0IB 2C9OA 4EPTA 5DN6A 2XAUA 5EJEA 1H8HA 4CZ2A 2FFQA 4WXPA 4Q4JB 1QHIA 4YMWA 2B6HA 2YOFA 1H8EA 3KJGA 4Q9JA 4XH9B 1PVOA 4PC6A 1LNZA 2JIZA 2D74A 5J40A 4DDWA 4QHYA 1E98A 2JJ8A 3FMOB 3U3MA 3FOZA 3B1XA 2ZPTX 4HB2A 2VYFA 5C4MA 3CM0A 4V03A 1IY2A 3U60B 3ND8A 5LB2A 4RFSA 2V1XA 5DHFA 5EP4A 1QHSA 3W3AA 5HR5A 3CW2A 4JKYA 3AVQA 1VDZA 2A5JA 2CNWA 2EU8A 1G3QA 3RYTC 1SXJE 3T1VA 4DHEA 3EZ9A 3LD9A 1DAKA 4LI0A 4DLVA 2GZAA 1A4RA 2GKSA 2ZUBA 3MMPA 4IRUB 3HYTA 2WOJA 3VMFA 5K8IA 1OFTA 2J45A 1BOFA 5LDDC 4DLZA 4H1VA 4YDHB 2Z43A 2ASEA 1DOAA 2BC9A 3THYA 3AF4A 2NO7A 5FI0B 4A92A 4BFYA 2P67A 4PHHA 4TL8A 4LYAA 1W44A 1F6BA 2H8KA 1DELA 1IY1A 4E09A 3B9QA 2QTFA 2NQ2C 4I1SA 2ZRAA 2WWXA 3IPXA 3VNUA 2ZJZA 4OHZA 3VX3A 5FR2A 3Q8XB 1ZUIA 4GRAA 3THYB 1P2SA 4QBHA 1TU3A 2BEJA 2ZREA 5J5CA 3KKMA 2FH5B 5JEDA 2V7QA 4Q01A 1AK2A 4UJ5A 5KSZA 2HF8A 5EUQB 5TARA 4CGZA 4XWAA 4EJSB 2QSYA 1UEJA 3GJ8A 1PLJA 2DHRA 4BLSA 1ZNWA 4TTQA 2O8CA 1DBSA 4M22A 3HR8A 4HAYA 3WNBA 5DIFA 2ZRBA 2ZRDA 4QGGA 4CRWB 1T0JB 5GJCA 1RYHA 4HB0A 2FFAA 4B76A 2X1VA 3V4FA 1NMYA 3LX8A 4R7ZA 1DAFA 4Q9KA 3SBDA 1VCMA 3K9GA 4WW0A 1DAHA 4LZZA 3SC3A 5GVSA 2O8CB 2GBLA 3WRYC 2OCPA 5TB5A 4A9AA 2WIBA 3KJEA 1AGPA 1XU4A 3FPAA 3O8DA 3QOFA 1CR4A 4G3XA 4Q9IA 4DT1A 2CHGA 1OKKA 3DPUA 1E2IA 3W5IA 2BBSA 3LO5A 4B3FX 1F2TB 2OCYC 3H2YA 2XB4A 4G5QA 4W5WA 2NTYC 3QY0A 3TSOA 4PAMA 4RCZA 5B64A 4Q7LA 3G5UA 4HLQB 3KXKA 4Q9HA 2IXGA 1G7SA 5L3QA 4B2IA 4DT1B 5FPTA 1R7RA 2WOOA 4PSAA 1KK0A 3VTKA 5BW8A 2FPKA 4TTPA 4M9SA 3PUVA 3CR8A 4R2IA 4JSYA 4JLDA 2GK7A 2ZE6A 3EWSA 3UWKA 2WMNB 2BBWA 5SZKB 1VKJA 2P0EA 3CRVA 1MR3F 2QN6A 3OE7D 4P32A 3QF4A 2NPFA 5FTKA 4US0R 4OQNA 4B73A 3PQCA 1JXOA 4DB4A 1TQDA 1T3HA 2JA1A 4G5GA 4DLSA 3SHFA 1KSJA 1G41A 4ASUA 2E9SA 3L0PA 4I1VA 4QHTA 3U3RA 5KYKA 3QPVA 2PEYA 2BEKA 2PLFA 1D5CA 4IKEA 1IQPA 2VH5R 1ZCBA 2J0UA 4L15A 4JT4A 3QXSA 3GCGA 1W2HA 3KQKA 2WWHA 1ZNYA 3AV0B 4C4PA 1UKZA 3B1WA 1G3RA 4MH0R 5SZIA 3T15A 2A3RA 2QNRA 3CZQA 1XD2B 1D2EA 2YV5A 3FMPB 3LWNA 3O47A 5CLQA 1XTRA 2VSOA 5D3QA 4DUGD 1FX0B 2MSEB 4QG7A 1HURA 5L3SA 2QTHA 4WVFA 3OF5A 1C1YA 2GXSA 4NYJR 2AKAB 4LWZA 2B21A 2AR7A 2NMVA 1UM8A 2WSSA 2QT0A 2RGNA 3QG1A 1OPXA 3F5FA 1N6OA 2EW1A 1MO4A 4NYJQ 2AD5A 3V9PA 2ZYTX 4TT3D 3RRYA 3KUDA 4LUCA 2IWRA 1ZRHA 2YOGA 3ZVLA 1FP6A 1MKYA 2HYIC 5JECA 1NMZA 2ZI4A 4BRUA 3TW8B 1U8ZA 2QAGC 3CX6A 1TU4A 4X8LA 2WTUA 1W4BA 4PXAA 2VHJA 2ANCA 1FPMA 1ODFA 3QNUA 4PO8A 4XSGA 2FPMA 1Z0IA 1N6RA 2OBLA 2HCJB 4FCWA 3PUXA 1GVNB 1U90A 4URYR 2PCLA 2KSQA 1N0WA 3GFTA 4QNRA 2EQBA 5FOSA 4KFTA 2F1RA 1CJUC 2FPLA 3RHFA 1S2MA 3HR7A 1L7VC 4LC0A 1JR3D 1WF3A 4M4SA 2GCPA 1EX7A 1UBGA 1ZIOA 2CK3D 3HU2A 4EKDA 1NN0A 1OFUX 1VMAA 4U7DA 4POAA 1MRNA 2QY9A 3HDTA 4MGZR 4LSGA 1F48A 5CB8A 2YHSA 2WJVA 4WAUA 2WJHA 1F2UA 2WWGA 2N46A 3EG5A 4F4JA 1AKYA 1Z0KA 2DFKB 2V4ZA 4NCHA 4OBEA 5FL7D 3M6AA 3HP1A 1GP2A 1FOEB 3ADKA 1JJ7A 3VHLB 2BMEA 4NH0A 1E96A 4DWJA 2V54A 1MRSA 2WV9A 4M1YA 4KFUA 2JCSA 4Q1EA 1EK0A 1Z28A 1E9BA 2KE5A 4OK6A 4ZKDA 1LVGA 4D0LB 4EFNA 1XMSA 2OEPA 2YVUA 1Z8FA 3IHWA 1U0HC 3JZAA 1E2MA 4MKFA 1G17A 4NYMQ 2XSZD 1N6HA 5JSZA 3MAAC 1RE0A 1GL9B 3THXA 5EE3A 4IXNA 1F60A 4V02A 5KNDA 2QI9C 1ZD8A 3IBYA 1E0AA 1JB1A 5EXXA 1PUJA 1YZTA 1UDWA 2QGZA 1NVUQ 3AKYA 4KFRA 1COWA 5EE1A 4K8OA 1DEKA 1HH4A 3QQ5A 5EP3A 4V0LA 1VIAA 5EE5B 3G0HA 1OH7A 3B85A 5JSZB 3BD9A 2ZJYA 5AR1A 4BFSA 1AS2A 3GLGB 3THXB 4A8JC 3PR1A 3GJ3A 4QXAA 2C03A 4Q18A 2AKYA 4AYXA 4PZZA 4EPVA 1TMKA 4N1AA 2CLDX 3E2IA 2R6CA 5A0FA 4HATA 1S9DA 4LC1A 3JVVA 4QFMA 1NRJB 1ZM2A 5P21A 4DEYA 2MMCA 4CT4B 5JFGA 1N6KA 2C95A 1SVLA 3QI2A 5FBVB 3B7GA 1AM4D 3K9LA 4WXRA 2FSHA 3TH5A 1KNXA 4K46A 3DMNA 3KUCA 4LHWA 4WBSA 1ZYUA 2YZ2A 1MOZA 1NVWQ 3U44B 1KI9A 4FD2A 3FHOA 4URVR 2W58A 1FW6A 3ASYA 3PEUA 4Q4HA 4LRWA 1G5RA 2FSIA 2QRZA 4AD8A 2WJGA 4JBYA 3DHWC 3K70B 3LFUA 1Z3IX 1O3YA 5FOUA 2CE2X 3FDIA 3KFVA 4HZIA 4FW9A 1Z6AA 4E07A 2D06A 2FJUA 3X1YA 1E2QA 3L82B 4DB2A 2FZLA 2AD1A 3EIHA 2JJ1D 5JRJA 4RY2A 3U7FB 5JCZA 4A2WA 2C78A 4JLMA 4YXWA 2EFHB 3V00A 4LDJA 5TV2A 3K0AA 3P1JA 1XZQA 1G8YA 3VQTA 4OYHA 3BERA 4PHGA 3TSZA 2WPDD 1M2OB 1M7HA 1W4RA 2AXPA 3UXMA 5KPDA 4PC1A 4TMWA 4OK5A 2BIFA 2WIAA 1NKTA 4L9SA 2GK6A 4PO9A 8OHMA 2OXCA 2ZAOA 4PAOA 2GNOA 2C04A 1Q1BA 3CNLA 4GZMA 3KFXA 3P20A 3U2QA 3U5ZB 4AI6A 4QJ3A 3U6KA 2IYTA 3K0AB 1CR0A 1DADA 4AKIA 1Q12A 3W8NA 4OI0A 2EFGA 2DWQA 4Q66C 3UKDA 5A5GA 1OXVA 4JVSB 1NJFA 2VP5A 3EA0A 3BIFA 3CH5A 2ZI9A 1T5LA 4LYFA 1W4AA 4AG5A 4G5RA 2G9NA 1EFRD 3H0KA 3SFZA 3RWMB 1X86B 2J46A 5D3MB 4UNPA 1IN5A 1T4GA 3BH0A 4YC7A 1XFAA 4ERNA 3RNLA 1LS6A 1YR8A 4OI4A 4OJQA 2BMDA 2VIIA 3CONA 1RYFA 5DYGA 2IYSA 2IYQA 1R5NA 1FQKA 1DE0A 3QVUA 1SVIA 4DRZA 5JWOA 4XTCS 4M9QA 4WA7A 5DI9A 2QMUA 4PFSA 2WHXA 2MSDB 2GF9A 3PEWA 3GLGE 1XTIA 5E3HA 1ZM4A 4CT5A 2PEZA 3RSLA 3E70C 4ZCLA 4NE2A 4G5SA 3BE4A 4I99A 5IRCD 1FUKA 1T5IA 4FMCF 1S1CA 3GLFA 4D4LA 1KO8A 1E2KA 1LFDB 1XD8A 2H16A 1NSFA 1FQJA 2BMFA 2RCNA 1D9ZA 1W36B 4CEHA 5DE3A 2XOKA 2OCBA 3GEHA 4ZCIA 2Q0HA 2P65A 4KHZA 4PQRA 3QUSA 4BZPA 2Z4RA 1KI7A 5FTJA 4E22A 3LXRA 5TMPA 2HDNB 3NDBB 1Z6XA 1KDRA 2LKDA 2ZE5A 4OHYA 4OK3A 3ICEA 4CEHB 4M1KA 5C1BA 2ZM5A 4HLDA 4DXAA 3O8CA 2IA5A 4JLPA 4EPWA 1DO0A 1E79A 1AS0A 4EFMA 1M74A 1IXRC 4TMKA 2P6RA 5FUWA 2QBYA 2X8AA 3W6NA 2VRWA 4ESHA 3TBKA 4MYHA 2G6BA 1XCMA 4CDGA 1JPJA 2G1KA 4BLPA 3TLXA 1XTSA 3OIWA 4JT2A 1TEXA 2Z0MA 5CK5A 6Q21A 4JL6A 1OYYA 1XWIA 3EZFA 4TSFA 2IWHA 3CUEF 4TLCA 3C5CA 2AWNA 2WWYA 4YMSA 2VQSA 2DCUA 2PMKA 1TEVA 3OIVA 3SU8A 1G6HA 5F3WB 3GFPA 4Y0VA 5C18A 2R6GA 4BRWA 3I62A 2DPXA 4PC3A 2GCOA 5BYKA 1IXSB 1LS1A 2V3CC 4AY2A 4DCUA 5JHGB 2JGNA 4P4UA 2RMKA 3DZ8A 3WHLA 4LBWA 1P2VA 2J0SA 1N0UA 1AKEA 1YRBA 5CK4A 4JLAA 4TZ0A 3Q7QA 3DKVA 5FR1A 4DSTA 3C4JA 3OAAD 4M2LA 1EX6A 2JLVA 3UPUA 3CKLA 4IJMA 4Q03A 2AFHE 4B74A 4B48A 5DISB 5FPSA 4FMCB 1VG9B 3GJ5A 1M8PA 3GJXC 3ASZA 3K1JA 1W0JD 5M04A 4LV8B 1R0ZA 2ZR7A 4ZV4A 1DARA 3EZ2A 4RZUA 5FBLB 1Z47A 2LKCA 3KJIA 3SJCA 2DFTA 1SXJA 4GDFA 1TPZA 3K0EA 1KOFA 2RGGA 4OQLA 4FMDB 4FWIB 1I2MA 5FTNA 1HQYE 2GJAA 4BZXA 1X1RA 1AQUA 4LJYA 4KLZA 4BEJA 1C4OA 1KSHA 2YC2C 4TZ6A 4ON9A 4JL5A 1W49A 3I8XA 1XB2A 2DFLA 2WWWA 1E69A 1KI4A 2XZPA 4JMPA 4V0OA 2QMOA 4R71A 4TLEA 1N0VC 2Q3MA 3TK1A 1OXUA 2VTKA 1GKYA 4GT1A 2OV2A 2VP0A 1XPOA 4PO1A 3ZJYA 2W6ID 2PX3A 3MD0A 3K09C 3I4LA 4ZKEA 3OZXA 4M1SA 5JS7A 3SN6A 1T8UA 1TNDA 1GKIA 5JRZA 4MA4A 2AXNA 2HUPA 4URWR 4B47A 1HUQA 2VF7A 1NLZA 2PZEA 1US8B 4C30A 5H70A 1G20E 1GZSA 1OB2A 3AVYA 4A4DA 2HT6A 3GP8A 2AL7A 3C8UA 2GF0A 2H7VA 1P4SA 3OFND 2IS4A 2HF9A 1P72A 2ZANA 1KMQA 4TMZA 2ZVPX 3SOPA 3PFIA 4NP6A 2IL1A 5KDOA 3FE2A 1VECA 1G291 4MRPA 4E5UA 4DDTA 2P5TB 2ZI6A 4UNSA 3KQLA 3RS3A 2O8FA 3SHWA 1NBMD 2GWHA 4EQ6A 2GETA 3W6OA 1FP7A 1S8FA 4Z54A 2GTPA 4P31A 2YWFA 1XTQA 3AEZA 1KO7A 2RH5A 3U4QA 4N0EA 1EFTA 4AG6A 2NO9A 4I1UA 4HB4A 1K6MA 5AK0A 1GDDA 1KO5A 3LA6A 2KBFA 4NBSA 1JAIA 5B57C 1BH2A 3N2EA 4DKXA 4CVNA 4TN1A 5CJPA 2WKPA 3OEED 3ZDQA 5FPKA 4D82A 2PJRA 3MSXA 2F43B 3GJ0A 2Z6VA 1R0WA 2O52A 3LVRE 4DCTA 2VEDA 1CJMA 2NZJA 5LD2B 4GL2A 1YR9A 5FOXA 1E9EA 3PENA 3LX5A 3B60A 3HPQA 4CYMA 1D6JA 4Z51A 1JAHA 1GRQA 1YVDA 4RZXA 1E2LA 4MYTA 4KXFB 2PH1A 4QJ4A 3QXJA 5HTKA 3WYFA 2C2HA 3VR4A 4XWOA 1G3MA 3MJRA 1U2RA 3I61A 5CM9C 2FSFA 3UANA 3B1VA 1Z22A 2ZUCA 3VR6A 1IN4A 3IQXA 1LF5A 2BKEA 4PZLA 3RRNA 4C0QC 2J0QA 1M1YE 4URXR 4Q48A 4PC2A 1XNJA 3WMGA 3R9IA 3KL4A 5JEEA 3DKPA 2ZJBA 3KZ1E 2OXRA 1KMHA 2BOVA 1OYWA 3CLVA 4GMDA 4P33A 4PC7A 4NCIA 4Q1BA 3IKJA 3SFVA 2CCJA 1D9XA 1S4QA 4G1UC 3ZLJA 1KAGA 1CR1A 4IOKA 2NOAA 3V4RA 3CNNA 1NKSA 2P6NA 3WY9A 4G01B 1KZGB 5E7JA 3LY5A 2X19A 1SKYB 1KMHB 5LBIA 1TUIA 2ANBA 3VFDA 1G7CA 2W6JD 5CIQA 3KQUA 1A5TA 1N5IA 5C4GB 2FNAA 4KVAA 4AK9A 2ZE8A 4Q47A 4WZAE 2WSMA 1SQ5A 4D80A 3WXMA 3THOA 4EJSA 4DDVA 4QL3A 3ZVNA 1KYIA 2F1JA 2GXAA 3A36A 3EW9A 4S35A 3IIJA 5EZ6B 4IOJA 3KQNA 3TNFA 4ABYA 4W9MC 3ZD6A 2IC5A 2I4IA 4TYPA 2ZUDA 3IO3A 2CJWA 3AGQA 4DCSA 5J4KA 2F9MA 3VNVA 5JI3E 4XJXA 4HDQB 2EYQA 4BPBA 3CB4A 1ZM3A 1OIVA 1A1VA 2FEMA 2FU5C 1GNRA 3CWQA 2PBRA 4JBXA 2FOLA 1A82A 1U99A 4EFLA 1T3LA 4RD4A 3U6BA 3OEHD 2CJWB 3NHAA 3QIAA 3NIBA 5FL3A 2VO1A 1F2TA 3BC1A 1OW3B 2BWJA 2OFWA 3BH6A 2YYZA 2FGJA 2QUZA 3VR2A 1W47A 4HUQB 2KBEA 1PV4A 3B82A 2J59A 3D6TB 3IBGA 4Q4AA 3IGFA 3QBVA 1F5NA 2BCGY 4ZI3A 2OLKA 2QA5A 4BECA 1RRCA 2ZRLA 1ZU5A 4KITB 4LBZA 2VF8A 4BEBA 1XX6A 1RRGA 3VR1A 1QHGA 4R9UC 1IOZA 4YONB 2I1VB 4TYQA 2Q6TA 1TQ6A 4P4SB 1G3IA 3HYRA 3T12A 4O2LA 1I4TD 3LW7A 4Q4AB 4LBYA 3RAPR 1KDPA 1NBME 4II7A 1MO5A 1Q1EA 2MMGA 3KJHA 1S3SA 5EP2A 1YR7A 5AUNB 4FXPA 3K9HA 2QT1A 1DS6A 1CRPA 2FWRA 1GAJA 4ITRC 1VCNA 4B43A 1E2EA 4IVPA 1P7CA 1DAEA 1G6OA 2QPAA 2CLCX 2ONJA 4UNQA 2WKRA 1G4AE 1KI8A 1Z08A 2GDJA 2Q3HA 3K53A 2WWIA 5JWRA 2WAYA 3OE7A 4V0KA 1X3SA 1FNMA 3EPLA 3AH8A 1LF0A 3HU1A 1S1MA 1KJZA 3MCAA 1XD2A 1K5GA 4TWZA 4M9ZA 4YMTA 1FX0A 3BFXA 1JXMA 3SR0A 4ZDJA 1JI0A 3IPYA 2A7QA 3SI7A 3PEVA 4QBIA 2BBOA 3CF0A 3PV0A 4CEIB 4D0GA 1JQLB 5LPNA 5CYPA 4ASUD 3T61A 2CHQA 1SKYE 1E99A 4B3XA 1BMFD 3PVSA 3B8HA 3H84A 3GPLA 4KFSA 1KJYA 4LJ7A 1CXZA 2D2FA 5AJZA 4LHXA 3F8TA 2OAQ1 2QM7A 2AWOA 3B2EA 5JLJA 1UEIA 2QBYB 1AGRA 3K0CA 4DUGA 1KKLA 1L8QA 3C15C 3I3SR 3TUZC 2JAQA 4KBFA 2VA8A 2NPIA 5KSYA 2F7SA 2LWIA 2ZSBA 4PQFA 5J4VA 1MO3A 3RC3A 1ZNXA 1G9XA 5KUTA 4A15A 2ZS8A 2PL3A 2KB0A 2WSSD 2ZU0C 4TT3A 2ZETA 3U3JA 1G4UR 1P2TA 4BLOA 1TL7C 4U00A 1IBRA 2EVWX 3S1AB 3FKQA 1V5WA 5KTYA 3NBXX 1JR6A 3RS0A 1MO6A 1X1SA 2ODBA 3FWYA 1I4DD 4XTRA 1J8MF 1LTQA 1NN5A 1QVAA 1ELOA 1AJEA 2DYKA 1K5DA 4XD7D 4DLWA 4NHOA 2G3YA 4MRVA 4QJ5A 3ADBA 2Q9BA 1ZIPA 2XGJA 1U8YA 1JECA 3E5HA 1N6NA 1Z83A 1SVMA 2FF7A 3CF2A 4LBVA 1W0KD 3L8YA 2EWWA 4LGMA 2CEAA 3QKTA 1IM2A 2VHQA 2WBLC 4M53A 4TYNA 1EG7A 2QM8A 1JR3A 4PAQA 2ZJOA 3CRMA 3KB2A 2ONKA 5SZJA 2IX3A 2OE2A 1DAMA 2CK3A 1ZJ6A 5KSPA 3W5JA 4GOXA 4AURA 4TMXA 4DJTA 3N5CA 1JEDA 1KK3A 4HDCA 3U7GA 3BBPA 1ZD1A 3PUWA 2H1LA 5J4LA 4C2TA 2G77B 1U0LA 3EX7C 5F9HA 1CJVC 1G8GA 3QJYA 1QRAA 3RS5A 1CTQA 3UATA 4Z1MD 2VSFA 5FL7A 4XSHA 1XD9A 1KNQA 3KKQA 3BK7A 1Z2CA 3WRXC 3PUYA 5K8TA 2NO6A 1HT2E 1YZGA 2V8OA 4MRNA 2R44A 3BWDD 5FOWA 3WNCA 1EFHA 1WBBA 2OLJA 1XEWY 1NI3A 1E2PA 1E4YA 1IAQA 2QE7D 3GLGA 2PJZA 3VR3A 1KTVA 2CVHA 2IYXA 4A0HA 3A58B 3A1WA 1WDTA 2XSZA 4YDSA 4WZBE 1D2MA 1GRRA 4KLNA 1KK1A 4GPTA 1QHXA 3P4XA 4Q21A 2RAPA 4IOMA 2X2FA 1NY6A 4O3MA 4O2RA 1OH8A 2ECKA 3L2OB 1KO4A 1ZP6A 3FTQA 4PHTA 3P26A 4TTRA 3F0TA 121PA 3GLIB 3K0SA 2G0NA 1R10A 4QGHA 2FSGA 3TMKA 3HU3A 4IFEA 2V1UA 4UNNA 1D8TA 1OH5A 3WMFA 4BFXA 1ZC3A 1UKEA 3P32A 2DWPA 1X8JA 5FOTA 4AKGA 1KJWA 5HCNA 1SVSA 1JNYA 1Q1ZA 1TX4B 3EC2A 3UMSA 4NONA 2DBYA 4B71A 4LOAA 1D2NA 3DM5A 3U44A 2AFIE 2R65A 3FHCB 1J8YF 4HUTA 1II0A 2QEQA 1OH6A 2IEYA 3BOSA 3C5HA 2GHIA 2PZFA 1ZUHA 1QG2A 4LJ5A 2JEOA 4NPHA 2C9YA 3GJ4A 1NN1A 3TR5A 1GNPA 1KI2A 4MQBA 2XX3A 1LY1A 3B13B 2ZRKA 4QRHA 2A5FA 3NHBA 1HY3A 4L5BA 4TQ9A 1TF2A 5AJYA 2GRJA 2PCJA 3H86A 2BJVA 5FUXA 1CKEA 5JJIA 3ZQ6A 4QM6A 3NDPA 3AQ4A 1Z6GA 1OV4A 2YWEA 1VIYA 3IEUA 4XOIA 4QC2A 3VKHA 5DI3B 2ZJAA 3R8FA 3L8ZA 4LJAA 3ICQB 1NJGA 2OFXA 3JZMA 2C5LA 4MUAA 3EZ7A 3ADCA 4DSNA 3U7HB 3AVWA 1P5ZB 4BWYA 1E3MA 1BS1A 1XTKA 2JDID 2JJ1A 1PLKA 3QXHA 1NSTA 2A5GA 1E9RA 1G19A 5EE9A 3Q7PA 1OXSC 2ZITA 2HXYA 2J0VA 4YXWD 1QG4A 3MGCA 1U81A 1E32A 1KY3A 3DDCA 4B3GA 2CMKA 1FTSA 3LVQE 1OFIA 2WPDA 2YINC 4NCNA 3ZZ0A 3QXCA 3OESA 4JZKA 5D3MA 1JR3E 2EYUA 2KWIA 2WICA 4B75A 4LY6A 1W2GA 3K0FA 2I3BA 2VL7A 3GLHA 5IK2D 3VHXA 3Q3JB 1AIPA 1HA3A 3LBNA 1H65A 5KPJA 1VHLA 2H92A 4HI0E 2YJTD 3NBFA 3WP0A 1XMJA 3AKEA 4FN5A 2GAAA 5BWMA 2JLSA 4DC9A 4KJZA 1HTWA 5BYJA 2FGKA 2QL6A 3K0FB 5EXPA 4B32A 4MGKR 1EFRA 2Z83A 3GLHB 3DZDA 4TL6A 2I1QA 3BB3A 4HLCA 3SYKA 2IHYA 3TQFA 4CW7A 3C7KA 4HAXA 1KI1A 2F6RA 4JS0A 3R9XA 4IDOA 1P9WA 1XDBA 3ETLA 4BLRA 4HZUA 1KKMA 2GEUA 3QVVA 3NVAA 2XXAA 4OKSA 5GJWC 1YU9A 4LCBA 4H1UA 2O8BA 3ADDA 2J7PD 1BIFA 3R7WB 3GLIE 4TLAA 3RC8A 2CL6X 4I1OA 1UPTA 3MWYW 3ZVMA 1RJ9A 3T1TA 1U98A 4MDFA 1Z29A 4Z8YA 4M1TA 1QHHB 1XF9A 1Z6TA 4HZUB 2F55A 2OG2A 3ZIAD 4PQYA 1R4AA 2XXAB 5KNCA 1HT1E 3UK6A 4B3DA 3EPHA 3T34A 2H5EA 2ZRJA 2O8BB 2NG1A 2FDCA 2SHKA 3WYAA 4B3BA 3PG5A 3EARA 2Y8EA 3UMRA 3NH9A 5GVRA 4QKQA 5FUYA 1RJ9B 4MKIA 2ZRCA 4Q02A 2JASA 3EC1A 2CVFA 4NTZA 4LHZA 3QG5A 1G8PA 2OHFA 4NZYA 1VHTA 3QKSA 1B0UA 5L3VA 3AVXA 4YQFA 4Q7MB 3FKSD 3DL0A 4ACAA 2QQEA 4MDEA 3RSOA 1KDTA 5HKKD 5HZKA 5FI1B 1Q3TA 1TADA 2QAGB 2OM2A 2RGEA 2JLRA 4C0KA 3X1ZA 1JQJC 5HZHA 1KY2A 2QMHA 1BYIA 2BM0A 4C0HA 3LQQA 5JBQA 1JJVA 2IF2A 3QSYA 5FPHA 1UBEA 4M1MA 2ZS9A 4MRRA 4OI2A 3U3OA 4DEXA 2GA8A 2H57A 1TQ4A 2VP6A 3AGPA 3ECCA 3QKSB 4MGIR 4LHVA 4BE7B 2VBCA 3FB4A 2HLDD 1ESMA 1YZNA 4GI7A 3GEIA 2XB2A 4JL8A 2AN9A
chains in the Genus database with same CATH superfamily
3KYJB 1ZEMA 4XEHA 3UOGA 3AHJA 3URMA 3ZV4A 3NP7A 1X3LA 3N05A 4JLSA 5DZSA 4GP6A 1QOZA 1XJWA 2D3WA 3PNYA 4FD3A 4H6XA 8MHTA 2EJUA 3NBYC 1WMFA 2PBLA 2AR0A 4G9EA 5BNWA 4I81A 1LB1B 2VDKB 1E1DA 2B20A 2O7QA 3KPWA 3LQ2A 4TS9A 4AUKA 1RC8A 1RIIA 3IBCA 4KODA 4BV3A 2BFFB 3A8TA 3GUYA 4OBXA 5CD9A 1IZ0A 4KYIB 3OPYI 4TMYA 4RJLA 1JFSA 3ZE8A 1WKCA 3H1GA 1ZY2A 4WOKA 5AKXA 2XNHA 3AKDA 1P73A 3I8OA 2HIHA 1UJ6A 5G1NA 4UTPA 2GJKA 4ZCQA 3WQHA 3BEDA 3U61B 5HCIA 1L7OA 1QONA 2WWRA 1W35A 4W5QA 1G8SA 4HGYA 1Y9EA 2OCAA 3TVTA 1ST2A 1NPYA 3WGVA 4EA6A 4PYJA 1THGA 2CVPA 1W6UA 1JE0A 1NTOA 1QFSA 4H7IA 5C3MA 3GDHA 1M10A 3NEAA 2G5GX 1QCCA 3NHFA 1I9GA 3ED5A 4QEKA 5DHPA 4GR5A 3KELA 1ADJA 4DRXA 1KEEB 1AV7A 3DGEC 1ZDMA 2BGMA 4YUAA 4UHFA 5TC4A 2D62A 3C1TA 1OPRA 4NY1A 5E4YA 3UIEA 4D9MA 5JFOA 5IS2A 3U1BA 3HDGA 3I5XA 2A9VA 1W0JA 4WFKA 2HXSA 1R12A 3P0IA 3BS4A 1QYDA 5CLIA 2OZLB 1A9PA 4WE3A 4KLCA 4X61A 5KNCD 3BXPA 3QVOA 2IV7A 2UVPA 1XMOB 2BV3A 3H5IA 3N0RA 3ZHSA 1XROA 3SOZA 3VR5A 4R9SA 4LF6B 4BWFB 1Y34E 2P69A 1VTKA 4A1OA 4BB5A 2BDTA 3PQ6A 2QRHA 4P36A 4R1MA 4NF2A 4PX9A 2ORWA 2GEVA 4Q19A 4W82A 5B4VA 1PZNA 2NTJA 3WICA 1I0ZA 4QHSA 4BMZA 3QU9A 2O0JA 4JC0A 1V6SA 3VKVA 1L5SA 2FLVA 2P9YA 3IOMA 3EQ6A 3G23A 2VDJA 5H80A 3IEVA 3WGLA 3C8DA 4GEGA 3ZJ5A 2JFVA 2BVNA 2GFHA 3HXPA 2YWGA 1WF6A 2HCBA 4Q3BA 4BNTA 1SOAA 3GRVA 1CZUA 1ZSVA 3I6YA 4R98A 4WNYA 3CSSA 5ECDA 3ZH9B 3ZTWA 4BAUA 1KK2A 1OBOA 1NW8A 4O1IA 1J49A 5TPWA 1RSZA 2I6QA 2H2HA 1KA9H 2QQ5A 2VXOA 4C20A 1U9IA 2PGLA 5KDDA 1Q2UA 1X1TA 3ZD9A 3ESAA 4GLFA 3CZAA 1XEXB 2O2XA 3HCPA 2D6FA 4HXYA 4PGHA 3WBJA 1SD2A 2BFCB 2G0TA 2ONYA 4I6JA 4CMEA 1KPGA 4CN8A 1XQ6A 2J8ZA 3PQEA 1Y6QA 1JLLA 1OHHD 4P6VF 3N0WA 3QW4B 4PYMA 2VQ6A 3EIFA 1HK7A 3C3XA 4HNHA 4LFBB 3TZKA 3FZGA 2NU6B 3AVTA 3BH7A 3IJEB 4DY4A 4F6RB 4NBVA 2BH2A 4J29A 1CUDA 1ODLA 4Q3KA 3DTTA 5K3CA 3SY8A 2HTFA 2HGSA 4JNCA 4JBLA 2A0YA 1DVRA 3I2YX 5G3ZA 3OI7A 3GEGA 3K2BA 2Y1CA 3KP1A 2EP7A 1PR3A 4H4CA 1W94A 4I8XA 4MJLA 4NK5A 5AK6A 3TOZA 4DNPA 4B3JA 1XRMA 4NPCA 5KOJB 5DXAA 2P9HA 1N7JA 1XTPA 1YS1X 3HKCA 1IB0A 4XVQA 3TQCA 3JATA 1HXHA 5AOVA 4L07A 4M1ZA 4FNGA 3TIFA 4C78A 5MN5A 1GNSA 4K0RA 1K8ZB 5IKEA 4BO1A 4Y2VA 5A4JA 3OWOA 4MW9A 2VYVD 3N0TA 2Q6VA 3OOJA 4UJ3A 5ICSA 4I66A 5FOVA 1O89A 2R8RA 4D26A 2VLIA 2R8YA 3IC5A 3CX7A 5IMBA 4NDZA 3KSBC 3T3GA 2D4AA 1KGDA 1C7ZA 4L9AA 2I1WA 3H7IA 4MVJH 4L57A 5EXSA 5KOIA 3UW3A 4A0FA 1G8FA 1X8LA 2QTGA 2QV7A 2R6DA 3CLUC 4KRYA 3UZUA 2VSQA 1H6DA 4ZZIA 5C8DA 3EF3A 4RK5A 3DT9A 3VPCA 2F8SA 4B6EA 3UHAA 3SIRA 4TM8A 3A3NA 4MVJE 3AP2A 2Y1WA 1M72A 5EUMA 4KX5A 4BFCA 5E9WA 4BX0A 5AVXA 3KZNA 4CJXA 1BCRA 1KYXA 4NNPA 2JAXA 2OHGA 3OICA 4MYRA 1M7BA 1T0BA 1VHWA 1O6ZA 1R0BA 4UKDA 4N7JA 4D9CA 1R27A 1ZD9A 2VDMB 4J1NA 4CT0A 4HWGA 1C50A 5F2EA 4RTPA 2AG1A 3SJZA 3SXPA 4S04A 4A5SA 3ZVRA 4N48A 2ZKLA 2FQWA 4BGEA 2C83A 1CDDA 4F2WA 1E5TA 2OHVA 2VDOB 2W0SA 2FYTA 4WNAA 1VLZA 1FMLA 2BF7A 2WD9A 3KL2A 2QQGA 5DLEA 4QJBA 3ZH2A 5DSZA 3RSZA 4GAEA 4FB5A 1YHNA 5CVCA 4WVLA 3V8BA 4BFVA 1MPTA 1UMKA 4MWZA 1UJMA 3MQFA 3M1IA 2GHRA 4GI2A 5I8ZA 4LAFA 3PXGA 3ZKWB 1Q83A 2GJ9A 2Z2XA 3GZNB 3LKDA 1J2RA 1ZD2P 2GN1A 3TN7A 3MJHA 3WTBA 2ZUFA 3T5DA 4DDUA 2CNDA 1W7AA 2CV2A 1JHUA 3JQ8B 3L7NA 1T9ZA 4C5AA 621PA 4DGSA 3GEEA 1OLSA 4P22A 3JQGB 3VZRA 3A1SA 4ECEA 2JD2A 4YRLA 4U7JA 3C74A 4A6PA 5MDHA 1V41E 4JP2A 1XV5A 3S40A 3CWCA 4EYOA 1S01A 2CNWD 2NGRA 1MB4A 1LGYA 1RQRA 2F3RA 3W79A 5CM8B 3L43A 1VG1A 3DZCA 4RYLA 1CERA 1BXRB 1DTSA 1P4RA 2JGAA 1Q57A 1CQXA 3PRYA 4EHJA 1AQ6A 4RJTA 4IYJA 4KMMA 4AX8A 4ZJYA 1UK9A 1Y6ZA 4X0EA 3SBXA 4E1BA 2EFDB 2GVDC 4MW1A 1D0VA 1VHDA 5AUPB 4CCWA 2E1RA 2R87A 4HDSB 5BN4B 4AJJA 5BVGB 3HJGA 4MR7B 1XPJA 4HSGA 4PR0A 4A03A 3KNZA 4UDNA 1IBMB 1YDMA 2B8TA 2PAAA 4FZ3A 1JJFA 2PR7A 4RD0A 4JYBA 4HEHA 4I7EA 1M73E 2QTMA 4G1EB 1W1WA 3NTUA 4XQCA 2GD1O 3CINA 5C5IA 2BAGA 3HFGA 4HUQA 5DX0A 3WLFA 3QX8A 2Z9DA 4IGEA 5ALZA 3VMMA 3WMEA 1XZJA 2V7QD 2XQVA 3NKLA 2B3TA 1RLOA 3UMFA 4BZZA 2GHTA 2VK1A 2OHJA 2EBWA 2R1ZA 3D4BA 4J9VA 2GVNA 4YV0A 4LJ9A 3TQHA 3WA7A 1U0FA 1U9YA 1Z4QA 4RETA 4DM7A 3U7IA 4JWKA 4MTCA 2HHHB 3CWZA 4QPJC 4NE7A 1O87A 4HAUA 4G8CA 2PX5A 3H83A 3H8VA 3JD3A 2WJYA 3ZHYA 3M70A 4BNKA 4RS3A 4BQOA 1V26A 4BWGA 1CUVA 3LPMA 2WYHA 3OIGA 1UPUA 2ETXA 3M1AA 2GK3A 2HA4A 2GDZA 3HV2A 3KXLA 3IHLA 3EXHA 3A0UA 2ZWMA 5EGSA 2QP3A 4AWXA 1Z5GA 4NZZA 4BJHB 1DX9A 2FTKE 3ZUGA 3BSSA 3NHMA 4CQMA 3PKZA 2C9MA 3N75A 2C5GA 3EAGA 4TZKA 1JA1A 3TIXB 3VDXA 2DLCX 3CVOA 1QH1A 3E2MA 5F7ZA 1RKUA 3LC7O 1XTVA 3H42B 2FZCA 2ZYVX 4JI6B 3WMWA 2VQEB 1B14A 1DMSA 1MENA 3L02A 4ZANA 3R6DA 2Z8ZA 1QHFA 1USUA 2I9PA 2O7NA 4WJKB 5EWMB 3J81k 1E1KA 4P1ZA 2PS0A 3HBAA 2B83A 3ZWKA 1R4MA 1U0SY 1EP1B 1V7CA 1Y6FA 1HX7A 1DWOA 1Q17A 3EVBA 3HVHA 1RHMA 2CZQA 2EP8A 2DLDA 3Q7IA 1PL0A 2BJWA 2LPMA 3ICCA 3LRPA 4CR7A 4ZA2A 1ETUA 2JZNA 3MOIA 4IWNA 1GA6A 3UWOA 3WIEA 2ZIAA 4D9KA 4JI8B 1FC0A 3DFMA 4WD3A 2XRFA 2G25A 2Z57A 4MKHA 4Z6KA 3DE7X 2D8AA 2DT8A 4CEIA 2XRZA 1IMOA 3X2FA 1V35A 2BEWA 2H4HA 3LT2A 1U8AA 3O1HB 3ISVA 4XPZA 2YWBA 5JMTA 3HABA 4RF5A 1DUSA 3X1DA 2EW2A 4TTTS 4AS3A 1K27A 2CL0X 2WV7A 3T7DA 4LJ6A 2WKWA 1YR2A 1OF1A 1KQOA 1WXQA 2V58A 2YVLA 3NHRA 3OJOA 2CNOA 4GGOA 4RD1A 1N8NA 1GWNA 3LT0A 3P2KA 3EFOA 1FFXB 4R69A 1I10A 5KX5F 4BMSA 2FN8A 3UH0A 2PLNA 4LXUA 1J70A 3DMTA 1A9TA 1WHTB 3K5WA 3HUDA 4YP6A 2G1JA 2WFLB 4NIMA 4OSOA 3TW4A 5AUOB 2QN3A 3GGJA 3K09A 2Q49A 4YPFA 3EA5A 1BC5A 1II9A 3FFBA 3VNAA 2IEDA 4H7HA 3BWCA 4UUNA 4EKIA 1L1RA 1C4WA 1MP0A 4P7FA 2ZIXA 3IKMB 4LOLA 4PTZA 2B4AA 3IUBA 3QVMA 3ABQB 2XYRA 2JEYA 3PQ2A 4YAGA 5EIBC 1KPIA 3QF4B 1QO7A 5EQDA 1OE0A 4P81A 4PLHA 3ZY5A 5JSHA 1ONOA 2C88A 2V6BA 2PDAA 5GOTA 2QRQA 3ZS9A 4LS3A 1ORHA 5F3RA 3WIUA 1BN7A 3RTAA 4B2YA 2KLHA 1AURA 2Q3EA 4QOJA 5PNTA 4NDAA 5CCBA 1U6JA 5AXBA 3AP3A 1V11B 2J7KA 1M6VB 3KU1A 3OHMA 4JC4A 2OSBA 2IUEA 2RJOA 1QDLB 3KQHA 1M3SA 4E0BA 4J0IA 1PO7A 4NSNA 4C1BA 2XTNA 3QLVC 3ITNA 3BGIA 1FDUA 5L40A 1PFWA 4LHEA 4RO0A 3ZV5A 5BSUA 3UTDA 1U5BA 3L3BA 5GPBA 2CUZA 3EGXA 5LQCA 1QF7A 3H3FA 1IG3A 3C39A 1Y5LA 1GSIA 3WV4A 4F97A 4J16A 4MR8A 3VYTB 3SDZA 2HRDA 3U4IA 1PQ4A 1X1QA 2GM5A 4P38A 2A33A 3JQAD 1FNNA 3I92A 1E94E 1Y3FE 4I55F 5H1YA 2HV8A 4BCCA 1WA5A 5L3SB 2BD0A 4KXUA 4X44A 3UHOA 3AVPA 4EO7A 2C1ZA 5A4FS 4AU1A 2R1UA 4XVHA 5L4NA 3KLMX 4IVNA 2UKDA 3AP1A 1UK7A 3AEQB 1XWFA 2BMVA 4KN9S 2DUMA 3TTTA 3COWA 4Y2TA 1G7TA 4EMSA 1E9VA 4BUZA 3PEYA 3RVSA 2IYFA 2PBFA 3KLBA 3PGLA 1BKYA 4CW7A 1PQYA 2I80A 3FMIA 3F96A 4DQVA 2FPPB 2P2LA 3GRCA 5K4HA 3BD6A 2VH2A 4FNOA 1I36A 3ZWQA 1K5HA 2IF0A 5M29A 2UUOA 3M4YA 4HYYA 3RWOA 1HNXB 2EX4A 1IOLA 3MM4A 4R6WA 3U09A 2R6ZA 3A4LA 5FFNA 1GPAA 4N0QA 4GF5A 2XUPA 3ZGYA 2ZBRA 5H02A 4EHNA 1QHEA 2B92A 2ZGVA 3ZY3A 4LZWA 1OBFO 2E82A 4YGXB 5KX5B 4F6LA 4Z0NA 5IHXA 2O2CA 5D51S 3W6PA 3T1HB 2HFKA 4UCFA 5KO2A 2VNJA 1YE8A 2E55A 3IELA 2IEZA 3LCMA 3ZTYA 2P6OA 4MHSA 2XT0A 2YW9A 3PIIA 5FORA 2A7XA 4N3NA 1DV2A 1YOVB 2YUIA 1N5JA 1MFPA 2IFTA 3H13A 4BASA 3LXUX 1YA6A 2UZ3A 3FAKA 3FR7A 4HGPA 2OILA 1IRXA 3GQBB 3I1IA 1IXZA 2ZP1A 3RBAA 2Q21A 5MGBA 2XZOA 1QV7A 1X0XA 1BWRA 1YB1A 3GLIA 3R74A 1JTVA 2RC5A 2XCIA 3Q12A 2BI8A 3IT2A 2D59A 4QU9A 4ZHSA 1OBVA 3SJAA 3G0DA 3VPHA 4COOA 1GRNA 4UUBA 3FLMA 3ZN2A 4KR7A 2DM6A 2UYQA 3HPRA 1EP2B 4WCFA 4PQEA 2AJCA 4JJ6A 2HIAA 4RE6A 1DJMA 1VLVA 4UBNA 1QDEA 3AXSA 5KS2A 3I2FA 4J0DA 4V0QA 1ORWA 2II6A 4JVNA 4P3YA 3WG9A 4CV2A 4NYMR 4CEJB 2PUDA 5CIYA 2NO4A 5HF9A 3W3ZB 4IDFA 3ZU2A 1RP1A 3C48A 3PGVA 1NW9B 2WG1A 4IDHA 2NO1A 3DNPA 1FNSA 1I0IA 2F1IA 4P98A 5HP4A 4UVDA 1NQVA 4MUYA 2BZGA 5KOHB 4H2DA 2GZDA 4IVQA 5ESWA 1GNQA 1XMQB 3IFSA 1ZMXA 3UFXA 2C59A 3M82A 5IYZA 1APBA 3H1PA 1QWSA 2PKQO 2VHYA 3IAHA 4UAGA 4RD6A 1KERA 2XMCA 1ZAKA 1UKYA 1BCSA 2F1OA 3CURA 4WLNA 5CPBA 4I55B 4BP1A 2XITA 4BZQA 1JSLA 3AM1A 3W8DA 5J2TA 5E1DA 4GBGA 2QWXA 2W2TA 3BKWA 2PAFA 3BAFA 4ZYTA 4L76A 3VH3A 3I04M 3TRKA 4DCMA 2YBEA 4US2R 2O4UX 2FXIA 2PG3A 1V3VA 5B1YA 4JAVC 10MHA 1KBQA 2IW3A 2ZWAA 3NG1A 2WUVA 2PGXA 4HAWA 4IWYA 3C3CA 3ENKA 4KH0A 2B1GA 2V7XA 2HMYB 3V2GA 4BQFA 2FE4A 3HYCA 5DI3A 3BF7A 5B2FA 1MORA 5EMJA 5LYYA 4HJXA 5A04A 2GZRA 3G13A 3RDPA 2GVZC 2WT4A 5DBOA 2H59A 2C5BA 2OV8A 3P0EA 1N5KA 1Z4MA 3HNOA 2I7DA 2C98A 3JYQA 4IW3B 1DCMA 1I3LA 1VE1A 4FYKA 4DW8A 2SCUB 4ZI2A 5C5EA 1PR9A 5D87A 1QO0A 1KC1A 4IFTA 3BF8A 2KW5A 1Y6RA 1TVCA 1SA0A 3CBQA 3EVEA 4IOLA 3S2EA 1E1LA 1XDWA 2C9CA 2W6CX 3MLBA 1U9IC 3HBNA 2MYPA 1K3UB 3DAFA 4G0NA 4HNRA 1QC5B 4ZIRA 1NXTA 2ATEA 4XIGS 4UNRA 5IUKC 3W8FA 2JATA 3A1CA 1A27A 4R2HA 2IT1A 5L8VA 4AY4A 5DHQA 1CLUA 1QB7A 4D3DA 3DM9B 1VLQA 4GXNA 3O1JC 3U19A 1OI3A 4GOOD 2ERCA 2YQ4A 3ONWA 3D5TA 3ZHCA 4HCJA 2PKRA 4BXOA 7MHTA 1KU6A 2Y9MB 1ZWLA 4GGPA 2RGDA 3TI7A 5B2EA 3MN1A 1EFLA 1L4FA 1KORA 1JZSA 1WX1A 2J48A 2P27A 2VHWA 4P9NA 5E1BA 4ZCPA 4EVQA 1FFYA 5BN5B 3SM9A 3TZCA 1GZHB 2HV9A 3L0OA 5FHQA 1ZI9A 4K2HA 3PFWO 3MTJA 2HDWA 2DPMA 1KQGA 4DG9A 1Z7YA 4Z5XA 3RANA 2REXB 4J1QA 5HPYB 3Q5EA 4ER5A 1PCXA 3T5PA 1AN0A 3GT4A 1BZYA 5DHUA 3LDAA 3TQQA 3FPJA 4ZZ0A 1C0EA 3LXXA 1MABB 4KXNA 4OHVA 4JV5B 2O5VA 2QR2A 1YC2A 1TM1E 3PUZA 4DV3B 1WPRA 3LQRA 5DH9A 2L69A 3I0NA 2JHCA 5C1IA 2J3DA 5IX8A 4PZYA 3AFMA 4L16A 4GL4A 3AWIA 4F72A 2GTHA 1EVKA 2ISCA 4LKOA 5BSVA 4EY3A 2PVPA 5TY0A 4RD3A 1QCYA 2FEOA 1Z8NA 3PT9A 4DLUA 4U1RA 4L72A 3S6JA 2DB3A 1NLUA 1PZEA 1QBKC 4D9EA 1HG0A 3MUNA 4IR7A 1UBFA 3PCRB 1EP9A 1JLKA 1SG0A 3W5CA 1Z0AA 1Z6ZA 2IP4A 1PGQA 5AKHA 3VU8A 3IESA 2WM3A 4PXSA 2REOA 5GZ3A 3S2UA 2B4TO 2I22A 4HSEA 3D3WA 2M32A 2ZYUX 2J7PA 3PPWA 2Z98A 4V0NA 3RC2A 1BXKA 2OC4A 4QPPA 2JGIA 2ZRNA 1MC5A 1A4XA 4DUYB 3PQ3A 3T1QA 4PPFA 1P4GA 1VFNA 1DUVG 3AUJB 1KVSA 1Y3CE 3PD1A 1ZIDA 4WK4B 1EM8A 4GSLA 3F47A 3RUPA 1SZJG 2WP8J 4ADSG 3JPWA 3FY4A 4HQNA 4R01A 3VPBA 4LQDA 4TLBA 4D2IA 3SR3A 3RRFA 8LDHA 2V6FA 5DP2A 1V45E 3KAJA 2UZ0A 4IY1A 3AF1A 4CG3A 1AZWA 1MMFB 5TJHA 4IIDA 5GJVC 5LCXA 2HK8A 1ODJA 1EYZA 3I2JA 1DX4A 1Q5PA 3C7DB 4J75A 3UXEA 4EB6A 1ZD5A 1ZUNB 1Y4UA 4J0GA 4CKBA 5EQTA 4P80A 3RREA 1GV1A 1RI2A 3Q7SA 2D7DA 1ZESA 3O92A 2V3WA 3FKSA 3I5MA 4J0FA 1JHOA 2HWWA 1JP7A 5HKKA 1LKZA 3KTDA 4ND4A 4C7MA 1ESCA 3TG2A 3UW1A 1Z63A 4GQAA 4FR5A 4FIZA 4A2PA 1PFYA 1I4OA 3MJ4A 4NAUA 5AJHA 1XVTA 4TRMA 3W9YA 4RDXA 4DR3B 2GZHA 4QOSA 2YMLA 5U9CA 3IVXA 3OWHA 1G21A 1RWKA 1P61B 1HV8A 1TCCA 2OFOA 4LQCA 4LY0A 4TWIA 3ICPA 3PDJA 3RHZA 1DXYA 4M7WA 4PANA 2OXTA 5BQ3A 2V55B 3M6FA 3ZYCA 3DC7A 5EIHA 1ZC4A 3TE6A 5JXIA 2CJYA 4CG2A 2QLLA 3C4VA 4HN4B 5K45A 3JQ7B 2IXFA 3NPMA 1E0KA 1E7QA 2X0KA 1BMTA 1L7EA 2CLSA 3DBLB 3H75A 1GA1A 3BORA 4L78A 3MMXA 2M6SA 2JLZA 3BXHA 2PE5A 1QKKA 4X41A 3KSAC 3K0HA 5FAXA 3AVOA 3FUWA 4TSFD 2ZRMA 2VWPA 2YDYA 1ADFA 1I6WA 1Y6JA 4F8JA 1G6Q1 4RFVA 1PZXA 2QS9A 5C81A 1GYRA 2LBPA 3PRKE 5IKPA 3WRXA 4CM9D 4FSDA 1OAAA 3I8SA 5I9LA 4TVOA 3SC2A 4AFNA 4OYLA 1A98A 1OIXA 1UBHS 2QBYB 1E2GA 1G2QA 4JLVA 1TFUA 2IODA 4D41A 4KQGA 5BQXA 4DR6B 1TW3A 2QVYX 2OENG 4M0KA 1REQB 5FHRA 2RB5A 5K3AA 3RV3A 1LV7A 3T7EA 3CU5A 4B83A 4PLGA 1XZNA 2CBZA 2JS7A 4OQXA 3W4KA 3F3YA 4ZOCA 4MYSA 4IQGA 2XMGA 1NJSA 3VC2A 3EMBA 2ZSAA 1FFEA 3MMSA 4DKJA 4CG1A 3TVDA 3TGLA 1QTNA 4QO8A 1DWQA 5LDGA 1LZKA 2FUNB 1CE8A 1ZW6A 3QU5A 4Q9NA 4LSWA 2FFHA 4UXHA 2RBEA 3AHFA 1KI6A 1ZICA 1P0CA 2BGTA 2HRQA 3CUVA 4XJSA 4B44A 1CZOA 1GILA 3ZWMA 4A8JA 3ED1A 4YRSA 3UUEA 1TAQA 1EWQA 3ENQA 3G59A 4IIJF 5F78A 1SBZA 5EIOA 2IYRA 5EINA 4OU4A 3HP7A 1OX5A 5L3RA 3UCEA 3FPHA 4V1CB 3RVMA 1PEAA 4DF3A 3BMQB 1JKFA 4EPRA 4UBIA 3IJRA 4ERXA 3ILVA 4Y9SA 4ZOEA 4QTYA 3N7AA 4O0MA 4QNMA 1P0PA 5LKRA 3GF4A 3L6BA 1NONA 3SG0A 2HJWA 2WE8A 1S2DA 5AQ1A 4FCCA 2YXEA 5CT6A 3A27A 4ZOAA 3V8VA 3HS3A 3WK5A 1HTTA 2JANA 1YTUA 3NYRA 3EDRA 4O4LF 3L0BA 2OYCA 5K0TA 3N8NA 1JEJA 1CB0A 4IS2A 2IYVA 1N1GA 2A9KA 2IUSA 4US1R 2VA9A 4QGBA 2IH2A 4FCVA 1JTEA 1YB5A 1ISMA 4X93A 3ILXA 4YRJA 1X1DA 3NKVA 2P2ZA 2M6KA 1R8SA 2GCIA 4DLBA 5K01A 1FFHA 3LU1A 2GCEA 2AG5A 2WF6A 3JVEA 3MOGA 1V7PC 4KNWA 4EPXA 3AEUA 5JDCA 4JMLA 3IO5A 3PWKA 3DMGA 3EBOA 1AC5A 1UC4B 1RACA 2LCFA 3OURA 1RIFA 3H0EA 5A6VA 4XEUA 4MUJA 3U39A 2NIPA 1ZKDA 1O94C 4EB3A 2ZI3A 4P53A 3PPIA 2IPMA 2D5BA 4LX0A 3OZAA 3P52A 3IPAA 4BMXA 3QE0A 1VCHA 4GFDA 1HNZB 1II8A 1I3KA 1RRFA 1U7PA 4X20A 1RZRA 1A2BA 3GA0A 4JXKA 1GTRA 3ZGVA 4AQDA 2Z6QA 5JT1A 2R6JA 2XPCA 2DTXA 2ZSDA 1C7QA 2Y05A 3PD7A 3CFYA 3ZLTA 3DLCA 4MWTA 1GY8A 3FNGA 3RAFC 4JD5A 4P0QB 4M76B 1TM5E 4N65A 4AJEA 3UJBA 3TQTA 4P7BA 1SCNE 2W4QA 1VJ0A 1KMIY 3IUQA 4UMVA 3I9FA 3R3YA 4IHQA 1DTEA 2LVBA 4U0JA 4ZDWA 2V6JA 1IONA 1CY1A 4GBJA 4AYWA 4I9NA 2OXIA 2Q7DA 4QNNA 3NV9A 4EHIA 3WWOA 4F4IA 1VJGA 4P4TA 1LDNA 1NVVQ 3L5OA 3OM9A 2XQJA 2A88A 4GMGA 3V7UA 3ZV6A 4EUKA 4YCJA 3X1JA 2PU5A 4MKXA 1NR7A 2N42A 1AGNA 4P3NA 1J22A 1T8RA 3K73O 3A4NA 4IIJB 3ZCRA 1I6LA 2O3TA 2IJGX 4LIPD 4A27A 4D4JA 5AWFC 1NF3A 1W5AA 3NJ8A 1BO6A 2WYUA 3OEEA 1GSOA 3QPUA 2AOTB 3R44A 2R2GA 1PSWA 5JQGF 3SSOA 3GMSA 3FPBA 4J4HA 2QV0A 2Z5GA 2DRIA 2R6HA 3K31A 3NC0C 3OOEA 1WCIB 3ZDZB 5M2QA 4QOHA 4BO6A 1C4KA 4WGGA 3UWSA 4MP8A 2D0PB 4G2TA 4RMJA 3V1UA 3TSAA 1IB6A 1EB8A 5A3RA 3WE7A 5LQJA 1FXSA 1N4DA 2JGFA 3CO5A 4L7QA 2HCRA 3FVRA 4CTMA 1WOMA 3F78A 4O4LB 3G68A 1T3TA 3C41J 4WADA 1X94A 4JKIA 4OQMA 1QV6A 1ZQ1A 3OZVA 1DBRA 5DYYA 1X80B 3NH6A 2D4HA 4B34A 3E05A 3GPDG 3N86A 4ENRA 1BDHA 4R2LA 1Q7TA 4BMPB 4Z4FA 1B6GA 1BSVA 1B74A 2JJ2A 1JYFA 3L8EA 4K28A 4YMUA 2A35A 4TOIA 4V0RA 3K5IA 4CIDA 3ZWCA 5AM2A 2NQTA 1WV0A 4MUXA 5AW4A 5K2OA 4IDQA 1J09A 5BQPA 3I9NA 3LUCA 5LZ5A 3AHEA 1TAGA 4MB6A 4HK4A 4YMHA 1P6UA 2J41A 3G6KA 3MJFA 2D7JA 3LF1A 4R1SA 3STVA 2VNHA 5FNVF 4BEWA 4UHHA 1EDEA 3CNHA 1QOQB 3JSAA 1MJFA 1DOHA 2YV1A 3RUHA 5EJEA 4CZ2A 2FFQA 3ORFA 3P5BA 4E21A 4WXPA 2UUPA 4KXXA 2HI0A 4U8HA 5C7OO 3IOCA 2YOFA 4G9GA 5BNTA 2HRCA 4XH9B 4Q9JA 3PNLA 1PVOA 3SXUB 2JIZA 3PNBA 4NICA 4LF5B 3I58A 1U7TA 4EG3A 1FE8A 1T9CA 1CQZA 5L53A 2PXAA 2YR0A 1E6MA 1CYEA 4QFCA 3B1XA 2Z1NA 1SC4A 4I2NA 2V9CA 3BUSA 4V03A 4AZ0B 1IY2A 3ITEA 3UVEA 4FOPA 4PZAA 3HKDB 4WINA 1T9KA 1K6EA 2FPGA 4J49A 5DHFA 2PX2A 3CW2A 5HR5A 2YMMA 4GX2A 3VYVA 5K4GA 1BJRE 3LHFA 2CFSA 2G06A 2PUTA 3GVXA 1DAKA 2VKTA 3OP4A 5AI0A 1ZLYA 2GKSA 4WCFC 2ZUBA 4WQMA 5DNCA 5K8IA 3HYTA 1NC3A 2PSHA 3RVRA 2IXDA 5KYWB 3KB8A 4G4GA 4YDHB 4WI1A 2BC9A 4BGUA 1N5MA 4WWHA 4A92A 2NO7A 2XA9A 1E59A 2L42A 2P67A 3ECAA 3V7YA 4LYAA 1XU7A 4REQB 2NTNA 5ICEA 4E09A 2H1RA 2VZLA 3IA7A 4ZEXA 1FFAA 1F51E 2ZRAA 3KZMA 2A8YA 4ZXFA 2EKBA 3VNUA 3FJ1A 2VJLA 2ZJZA 2P3LA 3BVPA 3CLRC 2R7AA 3PC4A 5FR2A 4MWCA 3HVKA 3MF4A 4GRAA 1WNFA 3C8MA 1GUFA 4ZPJA 5JQGB 5JCOC 1TU3A 2BEJA 4AS2A 1P77A 1SC6A 3OUUA 2FH5B 3Q3CA 3ANNA 4FYWA 4H6PA 4EFDA 4RZQA 1AKWA 5JADA 4DNOA 5I7EA 3C97A 1RXUA 2XD4A 1VDMA 5EUQB 1RHUA 2V7VA 4YCLA 1TZCA 2VPQA 3GB9A 2FKAA 1TU0A 4BLSA 4EO4A 5G02A 4F3CA 1DBSA 4M22A 3D2CA 3HR8A 4FZJA 5TPZD 2CC2A 2VT7A 1WZUA 4EGCB 1V16A 2BONA 3A6FA 2ZRDA 1FTGA 1LUAA 4QGGA 1XRSB 5ALEA 5EJFA 3PSHA 1FYEA 5GJCA 3UV6A 1Z4LA 5DN9A 3VSEA 2Z2IA 4HB0A 1SUBA 4HS9A 4X97A 1ZOLA 2IZ6A 3C8ZA 3DCNA 1L4HA 1U31A 3LX8A 3FRJA 2G7MC 1NF8A 1U1CA 1VCMA 3AOGA 3K9GA 2CVOA 3M4XA 4LZZA 3TOXA 4BNWA 4I9GA 2VWHA 4G1CA 4KNVA 2O8CB 4Q82A 1FDTA 3QVGA 5FNVB 2R751 1OGYA 2VPWA 3FPAA 3QOFA 5DJ5A 5TRTA 1OILA 3TZLA 1NNUA 3W5IA 1E2IA 1OI2A 2W2OA 3LL7A 2EJCA 4IKPA 4RACA 3CW9A 1H2WA 1PT7A 1XR3A 2BHLA 3F9CA 3ETCA 2OCYC 3H2YA 4JP1A 4ONEA 3ZI4A 2A86A 4PYIA 4FOSA 2K2QB 4G5QA 5L9AA 2NTYC 5K3FA 3VC1A 4OATA 1W75A 1K4KA 1ECGA 4CM5A 4Q7LA 5ALDA 4HP8A 3T4UA 2HSDA 3L7IA 3WGYA 3KXKA 1YA4A 3E1KA 3M4ZA 3DCJA 1EE2A 2QNBA 4DT1B 1QE5A 2IZOA 2WOOA 4PG4A 5IAKA 3VTKA 5BW8A 2IY8A 4R2IA 1W19A 1CIJA 2H00A 1MAHA 2WQZA 2Y1FA 3L1JA 3UWKA 2EX1A 2WMNB 5D7BA 3ELYA 4Z4CA 4G8JA 4Z2YA 3VR4H 5JFTA 3MLAA 2VRCA 1CUHA 4G84A 4QJIA 1T3HA 3O0DA 5ERXA 3LBFA 4UTNA 2JA1A 4G5GA 4YCNA 3QYPA 1TYEB 3GN1A 4H77A 3EQZA 2VDWA 3SHFA 1KIAA 4X1KB 3RKUA 3NCHA 4C88A 3L0PA 1A0OA 5BR4A 1MN6A 5CAEB 2IU6A 4X63A 5JO9A 4PLCA 5HEKA 5A6SA 2PLFA 3JASB 3VZBA 3LCRA 1EFPB 2X4LA 4EF5A 1H3NA 3T7IA 2VUTA 4KO3S 3NFRA 1QIJA 5HIJA 4UBOA 1NZJA 2Z4TA 4KVZA 4ZI7A 3E3OA 1KEZA 4C4PA 3AV0B 1E3IA 2B9VA 2YDXA 1G3RA 4O59O 4EEZA 3CZQA 3RROA 2B5WA 1D2EA 2BKAA 1JYEA 2YV5A 3LSYA 2ZVDA 1ULAA 3FMGA 3BHIA 4E5NA 3CVYA 3PHJA 2XYGA 3I6IA 4U9IS 4WVFA 2D54A 2GXSA 4OYYA 3TW8A 3QVWA 1XVUA 4BNGA 3FYDA 1PGOA 4A6EA 2B21A 3AW9A 4JUAA 1U4SA 4B3RB 2B69A 2FVXA 2YW2A 5ALKA 3E1GA 3F5FA 1U8TA 1RJFA 1N6OA 1B26A 2DBVO 3A7DA 1MO4A 3DEYX 5D1HA 5BUCA 1A77A 2AD5A 1JSCA 1XQXA 4MGEA 4K1LA 2AEFA 3FZQA 1C3OA 5FF9A 3WGZA 3TB4A 1JIQA 4N49A 2HYIC 1FP6A 4F9FA 5HRCA 3OQJA 4MQ6A 4LCJA 2OGTA 2P1ZA 3BZBA 3SD7A 4F96A 1BD4A 1W4BA 3WB1A 5EJ9A 2OC9A 3IP7A 1NW5A 1WMDA 4RGVA 2DJIA 3O3NB 5TT1A 1MJGA 2ACWA 4PO8A 3FNEA 4PWZA 4C4XA 2FPMA 1Z0IA 2CD7A 5G1OA 2X7XA 3ZHUA 2OBLA 2HCJB 3AWDA 3PUXA 5A06A 2JK1A 1U90A 1GPYA 2EHDA 2QPLA 2JGLA 1CZLA 3BPSA 1XLWA 3QFFA 1N0WA 3B7WA 3GFTA 4KTVE 3IUEA 2EQBA 3A06A 4EG6A 5K9ZA 4EF6A 2WA1A 3M5PA 4KFTA 3VXKA 3JQAB 4UM9D 2F1RA 4G25A 4QELA 5FD8A 4PLYA 1YQUA 4AN0A 3RHFA 3HR7A 3GVPA 3KJZA 3RJ5A 1JF8A 4NZ9A 2BGGA 4IHJB 1UDBA 3O2QB 3FROA 1UBGA 5EIEA 2ORYA 3E2PA 4JQSA 3NDJA 3A25A 3LYUA 4JFRA 1TA9A 3LHIA 4E5DA 1QH8A 1P4HA 3EVDA 1U2DC 3PICA 2VN8A 2DTEA 5HFAA 1JHQA 1L7QA 1NSYA 2MOKA 4Q9AA 4QECA 4UM7A 4DQDA 2XZTA 1X14A 4WAUA 3TVYA 3L8FA 4EJ0A 1F2UA 1EFVA 2N46A 3EG5A 3P2YA 4QDOA 1UZAA 5ALWA 5KHLB 2DFKB 2V4ZA 2DZDA 2W2PA 4HDKA 4RJJA 4P5PA 5FL7D 3RFTA 1Y37A 4HG2A 1OLUA 1SRQA 4LE1A 1ST3A 1X7XA 4WDRA 4OQ4A 1MRSA 3BICA 2P40A 4INZA 3IVAA 3X43A 1XZHA 2AMLA 5FB3A 3PEFA 2YY7A 4F1JA 4GWGA 1NX6A 5HZGA 4OK6A 2G28A 1LVGA 4D0LB 4EFNA 3IXQA 3WGOA 5K51A 2R68A 2YVUA 3TTWA 3IHWA 3TXAA 3JZAA 3MERA 5CHYA 2V65A 3VR3D 1Q6YA 2GM9A 3C5VA 1G17A 4GWLA 4QFDA 3UK2A 2XSZD 3WSVA 2QTRA 3BE8A 1R16A 3G3EA 3EVNA 2NSLA 5HOQA 5EN4A 3MILA 2IX9A 3FETA 3PXDA 4YP0A 4MKRA 2CVQA 3LP8A 3OFJA 1F06A 5C32A 1CFZA 4BNYA 4WK6A 4V02A 2ZUUA 3TL6A 5KNDA 1DQSA 1ZD8A 2VNAA 4JEHA 4P3KA 1JB1A 1CQJB 4D43A 3PE4A 2G4CA 1NVUQ 4KFRA 1F4LA 1COWA 1L7PA 3HL4A 1RD4A 1JWBB 4JR1A 4K8OA 5EE1A 1VIAA 3LECA 5EP3A 1LSSA 2OQIA 1V4BA 3RFUA 3VTZA 4NZNA 5FADA 1RJDA 2EATA 1A9ZA 1C4XA 3E8MA 5EY5B 5JSZB 3O4FA 1FP1D 3OTWA 2FW7A 1C30A 4BFSA 5B6PA 4FGKA 4OAOA 4A8JC