1F2TB

Crystal structure of atp-free rad50 abc-atpase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
AREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
molecule keywords RAD50 ABC-ATPASE
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tB00
3GLIE 2AD5A 3DMDA 3CPHA 4M4SA 3TNFA 4D82A 1G18A 2PT7A 2B6HA 1FL9A 2NQ2C 2ZRHA 2OXRA 1KO8A 2ZSAA 4IFBA 2REXB 2GWHA 1PVOA 3U7FB 4YDSA 1IN6A 4H1VA 1D9XA 3TUJC 3PJRA 1KIMA 1U9IC 1YKSA 3SBEA 4BLPA 2ZUCA 4ZI3A 3NBZC 1ZM9A 3BXZA 3QKUA 2O8CB 2O0KA 1UFQA 2G77B 5CYPA 1H8EA 4Q5IA 5JECA 2LWIA 1N25A 4IOJA 2VHQA 1VIYA 2P6RA 2JEOA 4MRVA 5D3MA 2OEPA 4MGZR 4X8OA 2EU8A 1ZCAA 1VCIA 4JBWA 3C4JA 2DWOA 3EARA 3JZAA 3NBYC 4N1AA 2EFGA 2C9YA 1OB5A 1KSJA 3AF1A 4HSEA 2K5UA 1IHUA 4CW7A 3GPLA 4HUQA 1Z0AA 2OE2A 1E9SA 3SBDA 4TT3D 4GBMA 2W00A 1WDTA 2ZRJA 4BECA 2RGDA 2VPPA 1IONA 1HE1C 2HV8A 2W2VA 1VG8A 4M53A 3PVSA 1NMZA 4PR0A 4BZPA 1I4TD 4JLOA 4DJTA 2QTFA 1E2FA 1OYYA 5KDDA 2JASA 3CPJB 5J4HA 1EFRA 1P60A 4GL2A 4GZLA 3TUZC 2WICA 1A1VA 1Z8FA 2R8RA 3FGNA 3R8FA 1IM2A 1OE0A 1B23P 1G6OA 3P32A 1P2UA 3W3ZB 4JKYA 4YLGA 3TSWA 1HT1E 3D3QA 2GDJA 2VSFA 4NYIQ 3EASA 3B5JA 3PUVA 4NYIR 2AWOA 2ZI7A 4LOAA 1N3BA 1SKYE 3BH7A 1VMAA 1TF5A 3VR3A 1KI6A 4B3CA 2QMOA 1VCMA 3U7GA 3K70C 1ZC3A 3KJGA 1MRNA 4DLUA 2QTVB 4XH9B 2GVZC 3QVVA 1A2BA 2BM1A 4Q21A 2Q0HA 2PX3A 1IJFA 3Q3JB 4KLNA 1R0WA 5HKKD 1ZM2A 2JJ8A 2OESA 5FTMA 1QF9A 1AKYA 1CR4A 2N42A 3K70D 3UG6A 4G5OA 3GLGA 5SZHB 3IBYA 3B2EA 4PHTA 1J7KA 2VSXA 4TMKA 5JFGA 3L0IB 4UQOA 2XZOA 1CJTC 3CBQA 1X8JA 3C7KA 4GMXA 2WMNB 1GKYA 2C03A 3G82C 3I72A 2BJVA 4M2LA 2ZYTX 2AX4A 2V7QA 5CDFE 3ECCA 1KJYA 4D0NA 4Q1FA 2E1RA 1RFLA 1LS6A 2LCFA 4TN1A 1JBKA 5FOVA 2A78A 3MSXA 2IYVA 3LXXA 5SZJA 2OLJA 1ZW6A 4JJKA 5GJCA 4DDWA 2XZPA 4HAVA 3WYGA 2JLUA 1T4GA 1P9NA 1NLYA 1Z08A 2HT6A 3ADCA 3N5CA 4KBFA 2IT1A 2WZQA 3CM0A 4JLJA 2IYWA 4KXFB 4LBVA 2PT5A 1Z0IA 3U4QB 3BE4A 3PCRB 1OXTA 5L3QB 1JPNA 3RYTC 2QE7D 5IDVA 3THXB 2VP4A 2NGRA 4R98A 1ESNA 1YR7A 3OHMA 3U3OA 2Q3FA 1PLLA 2CCKA 2GF0A 3NEYA 1MO4A 1GNQA 1UKVY 4KYUA 5AJYA 4TLDA 2ZQ5A 5H8WA 2F9LA 1ZU5A 4PTLA 1NSTA 1HE8B 1RZ3A 4KFRA 3BJIC 2G0TA 1SXJD 2DBYA 4OQLA 4BWYA 5JRJA 1OIVA 4NBSA 1HTWA 2VF8A 4YMSA 3IPYA 4DT1B 2IWHA 3VNUA 5M04A 3TMKA 3GEEA 1AM4D 3BFKA 5FBVB 1OFUX 1R0YA 4NYJR 1JNYA 2W58A 1SXJC 1ZINA 1NVWQ 1TEVA 3I92A 3A1WA 4DC9A 4OQFA 3WBJA 4IJMA 4MDEA 3HU1A 4GPTA 1J8YF 1DBSA 1KI1A 1ZBDA 3K9LA 5TV2A 3QPUA 4G5RA 4PAOA 3CRRA 1KYIA 1JJ7A 2OILA 3RABA 4KFSA 3H84A 2GF9A 4RKFA 1WCV1 3EA0A 4P3YA 2YVUA 4TQAA 3VU9A 1WXQA 2ZSFA 4R7ZA 2AKYA 3VR5A 2ZYUX 3VAAA 4BASA 3E1SA 1MT0A 1OF1A 3CH5A 3T06B 4Q9HA 1PV4A 3L82B 3VHLB 5BYKA 3D7MA 2IF2A 5G3YA 3CWZA 1TUEA 4C30A 3OESA 1GWNA 1EFCA 1Z63A 1TQ2A 2OHFA 1NY6A 4Z1MD 1KMHB 4URYR 1G3UA 2FJUA 2RHDA 5DI3B 5B2ZA 1W36B 3LV8A 5DYIA 2DB3A 1GILA 3DPUA 1UDXA 1MABB 1E6CA 2FE4A 4B48A 521PA 2VEDA 4L8GA 4LYJA 4RZXA 5FUYA 2CL0X 3T34A 4KSBA 2GBLA 3A6PC 1E2DA 4GOKA 3VFDA 2WJJA 2MSCB 3D8BA 2XEXA 2ZI5A 4WOPA 4GZMA 5KNDA 3VKHA 1SQ5A 3UANA 3L0SA 2KB0A 3W6OA 4RJLA 3L8ZA 5J40A 1E79A 4HLQB 1E0SA 2QRNA 3K09C 4IDQA 5IT5A 2NMVA 2NTYC 2EFCB 4IRUB 1S3GA 2BIFA 1JI0A 2GTPA 3MFYA 5FOUA 5D3QA 4NONA 2W6ID 4BGDA 2VO1A 4PX9A 4RFVA 2J45A 1NI3A 2ODEA 4CT4B 3RSOA 3KKNA 4QJ4A 1K5GA 1NN0A 2WM9B 4AI6A 2F1RA 2ZE6A 2Q3MA 4KFUA 2ORWA 3KQKA 1JJVA 3I62A 4FWTA 3SS8A 1JECA 5FUVA 3T1QA 1S4QA 3IIJA 3GJXC 1GKIA 3CNLA 3ZJYA 2RGGA 4ZIRB 2PLFA 4NYMQ 4P0TA 2IX3A 1TQDA 3B1ZA 2QA5A 1YR8A 4Q4HA 4A8JC 1U8ZA 4DRZA 2QEQA 1AJEA 3FOZA 3QXCA 3B6EA 3MWLA 5EUMA 2SHKA 1XCMA 4QOSA 3TLXA 2BMFA 5DSZA 4UKDA 2YHSA 3KUDA 2FX3A 4QNMA 2XX3A 3LFUA 3SYNA 1TX4B 3EZFA 2FN4A 2QM8A 2ZU6A 3LH5A 4GOXA 4DDTA 2XTNA 1SVWA 4OI2A 4ZPXA 4C7OA 4PC2A 4JT2A 2OBNA 2W83A 1GNRA 3W3AA 1UBCA 4R71A 3AKCA 4G1UC 1TQ4A 4M22A 3MMPA 1M2OB 1F2UB 1UBGA 1QVAA 1VIAA 3KQUA 3QBVA 4RD4A 2VH5R 1OPXA 3X2SA 2HF8A 1JXMA 4AY2A 4JYCA 3WNBA 3B60A 1XFAA 4C0KA 4JVNA 3TSZA 1D2EA 1MR3F 4QG7A 4DEYA 4YMWA 3U3KA 3NHAA 1R2QA 3AP1A 2BOVA 4NYJQ 1DVRA 3I4LA 4PXAA 2C5LA 4GNKA 2V6JA 4QM7A 2IYXA 3HYTA 3SN6A 1YZGA 3W8RA 1EGAA 3FPAA 5TXGA 1BYIA 2YOFA 4HEJA 2QTHA 1KGDA 4RFSB 1VCOA 1M7HA 2IF0A 2QPTA 2D4HA 3V00A 2JLVA 1XJCA 2CE7A 2OZEA 2R62A 4LBWA 5GJBA 2DFTA 3NEJA 1KO4A 1KY3A 3BGWA 4JVSB 3CZQA 3B78A 3IKJA 4W5JA 4IKEA 1HA3A 4HLUA 3TE6A 3TK1A 5DISB 1E9CA 2D62A 5DLQC 2VL7A 4NCIA 3WY9A 1Y63A 4GFDA 2R9VA 1GOTA 3TVTA 2EVWX 4AYXA 2MMGA 3CO5A 4EPTA 4Q19A 2QPOA 3R9IA 1EWQA 5TB5A 1NP6A 3EG5A 3GJ4A 4HAYA 2ZRIA 1CJKC 1ZUNB 3KFXA 2AFIE 2ZAOA 1M34E 4LDJA 4PO9A 5DO9A 3PR1A 5J4YA 2CNWA 4V0ME 5KDOA 1NNEA 1HYQA 1N5IA 5DI3A 4C0BA 1TUIA 3RS7A 2ZE7A 3M6AA 2QN6A 4M1YA 3KKPA 2QP4A 2IEYA 3EWSA 4B2PA 4NYMR 3C16C 2V8OA 4D26A 2IS2A 4LRWA 1E2HA 4AURA 3FKQA 1LFDB 2FNAA 4RZ3A 5FBLB 1VDZA 2D74A 3E70C 5FOWA 5CB8A 5HZHA 2CHGA 4BRWA 2A9KA 4DVGA 5FOSA 5IK2D 1G1MA 4KI0A 3PUZA 1II8A 1T91A 4PO8A 5K8TA 3QY0A 1E2KA 4HB3A 1TQ6A 2W6JD 4HATA 4DB2A 4FMDF 4JLVA 4LYAA 4IFEA 3I5YA 4ARZA 3FB4A 4A1FA 1W4RA 2YOHA 4WZ6A 4LBZA 2HCJB 3SQXA 4PANA 2ZRGA 3QG1A 2VHCA 3F5FA 1ZNXA 4QGAA 3HPQA 1KDOA 2ATVA 3RS2A 3IDQA 3O8BA 3A4NA 1T8UA 3JVUA 4F38A 3FWYA 4OHXA 2XSZA 2RCNA 2BBSA 3QF7A 4RD3A 1YRBA 3UATA 3CF2A 5JHGB 1G3IA 3OEHD 2F6RA 4HB4A 1SVMA 3EPHA 3QXSA 5FUWA 2NO0A 2Q9CA 1ZUIA 2RGXA 3B9PA 4NKRA 4Y0AA 2KSQA 4F4CA 3K70B 4Q9IA 4V0MA 3NIBA 4LJ5A 3KXLA 4MA4A 5E7IA 4DLYA 4TYYA 1QHNA 2BCJQ 2VYFA 4RY2A 4OJQA 3KDSE 3R7WA 5AWFC 3RHFA 2CLSA 2J46A 1KDTA 4TMVA 2BJWA 1Q20A 4OHVA 4HAWA 4Q7LA 1QRAA 1MRSA 3ZQ6A 2ANBA 2RKOA 4MGYR 4I4LA 4WBSA 2JJ1D 1IXZA 2X2EA 3AQ4A 3EIHA 2GEVA 1Z0DA 4B43A 1D2MA 1J99A 5FL7A 1IN8A 1ANKA 3TGPA 3KQNA 2DPXA 1W46A 4IDNA 2D3WA 5IF9A 5KTYA 1NG9A 1W47A 1UAAA 1XP8A 4CRWB 2FPLA 4PZYA 3RC8A 1N6PA 1M7BA 3A1VA 4NTZA 2H16A 3EA5A 4XVRA 5JJIA 1BMFD 1CR0A 1NN1A 5E3HA 3BFXA 4M1KA 1UBEA 5F2EA 4JL8A 3U60B 4OI0A 2KE5A 1XZQA 4NE2A 3AF2A 1W0KA 2WJYA 2XXAA 2P6NA 1FP7A 3B1YA 3AV0B 5EP4A 1AKEA 4G5GA 2NPIA 1FMJA 2I1QA 1R6BX 1COWD 1AA9A 3IO5A 5LD2B 1OSNA 5AJVB 1HQYE 2FH5B 2JJ1A 2RMKA 1L4UA 1U9IA 4TL8A 4FMBB 3H0KA 2F55A 3U3JA 1D2NA 5JZVA 4OBEA 4P4TA 1XTKA 3PFIA 4M1MA 3TR0A 1D9ZA 2OG2A 3K9NA 1E2GA 4US2R 1X8KA 1G7SA 4LJ7A 1NVUQ 2XNDA 1E2QA 4CEJB 4QHSA 1W2GA 1S9HA 1X3SA 1Z0KA 4IDPA 1GIAA 1OT3A 4LI0A 1J70A 2FFHA 4NDZA 5J4VA 5FPSA 4D4KA 4P31A 1KNXA 1E2JA 5AJZA 3THWA 2OAP1 4DB4A 4XWKA 3RAPR 1HH4A 2GZDA 1I4LD 2HXSA 4XVQA 1XEXA 4EAQA 4BFUA 3REGA 1DAHA 4MUAA 5BXQC 3MAAC 4YQFA 1NMYA 3MJHA 1QHHB 2DFNA 3I73A 4Q1CA 3VKWA 3R9WA 3MRSA 2R2AA 3T1VA 1KK3A 3N2EA 4TLAA 2CXXA 2PCLA 3BIFA 2FGJA 2QM7A 3KB1A 3AGQA 3FHCB 3BH0A 2XAUA 4HDOB 3W9YA 2VP0A 3NH6A 3RRYA 3LBIA 4A92A 1OFIA 2UKDA 2VBCA 3W6PA 3P27A 4PQFA 3UWOA 2JGNA 4AWXA 2D2FA 4IEEA 4UXIA 4W9MC 4IEIA 1WBDA 3GLFB 4KVAA 2WWFA 4L16A 2QPAA 3L43A 2GAAA 3ADBA 4MUBA 2BEJA 1Q1ZA 3I8SA 4A4DA 4JSYA 1S8FA 1G21E 3X1DA 3EPKA 4OKSA 4B76A 1G41A 2NO7A 4NMMA 4CEJA 2OXCA 2YINC 3OIWA 1FUKA 4HLCA 1SXJB 1VTKA 3IILA 4DCTA 2R6DA 1WB9A 4D80A 1KZGB 1W49A 3V4RA 1KSFX 3B1XA 1OFHA 3HPRA 4BPBA 3EC2A 2WV9A 4O2LA 2ONJA 1E0KA 1G8FA 2ZJZA 3EC1A 3X1ZA 5CJPA 4CEHB 2J0SA 4PZZA 3ZH9B 1DTSA 1YZUA 3R20A 2AWNA 3IUYA 3IQWA 1KDRA 1RJ9A 1QHHA 1RYHA 4JLKA 4MYTA 4X8MA 2VP6A 3OE7A 3RWOA 2LKDA 3TAUA 2A2ZA 1E32A 4JZKA 3B8HA 4KITB 5HCNA 3LWNA 1I2MA 1NRJB 1DARA 3M0EA 5EXTA 2ZJOA 1LV7A 4MQBA 4LHYA 3ZZTA 4O3MA 2IUSA 1KHTA 2W0MA 1Z2CA 2Z83A 2VP9A 1Z47A 2YWFA 3NWJA 5FBWB 3AVWA 1XTJA 1N0VC 2HF9A 2ZE5A 1G3QA 3KJIA 4NPHA 1JXOA 4JLMA 1XD8A 1N5JA 1E2IA 2REBA 3CX7A 2AXNA 4MKHA 5KDLA 4Z8YA 1IY1A 2ZRMA 3A1TA 3TRFA 3QG5A 4OQNA 4Q1DA 1P9WA 2KJQA 3KJEA 4II7A 3THOA 1QHGA 4A2PA 3AVXA 2JLXA 4ACBA 3EPLA 3RWMB 4DCNA 2Z0MA 3CRMA 1EFUA 1CS4C 4P4UA 2W2TA 1Z22A 3OEEA 1Q21A 4JBYA 4Q1AA 4RZ2A 1X8LA 5A5GA 1MABA 1W36D 1AGRA 5CM9C 3WBKA 1JR3E 5DE3A 3FE2A 1N0UA 4RSGA 1GNPA 1QVRA 4P4SB 2GNOA 3F0TA 1G5TA 3IPXA 4Q4LA 3T5GA 4ZKDA 2UVQA 1QHSA 3C5CA 5BN4A 1QBKC 4IXMA 4URWR 2PLRA 1VHLA 4WAUA 2KWIA 1GTVA 2R65A 3AB3A 3PUWA 4LHVA 4UNSA 1AS2A 1G5RA 3PXGA 1G7TA 4DWJA 3LX5A 2IWRA 3HR8A 4XSGA 3HWSA 4F4IA 4F7WA 3NVAA 4DLVA 2H8KA 3SJCA 4R2IA 2Z5FA 1SHZA 2OSBA 4YMTA 1ZM7A 4E09A 3UMFA 4L5BA 4MITA 4MKIA 1E2MA 5FPYA 3U44B 2PZGA 3LVRE 3Q7QA 1XB2A 1A5TA 2BHRA 4M1TA 2QMUA 4ZV4A 1L7VC 3UPUA 1H8HD 3AF4A 4BFVA 4BFTA 2ZJ2A 3B1VA 2MMCA 4HUQB 3CRQA 3QEOA 4AYTA 4BLRA 4ZCIA 3TR5A 2H57A 1X1SA 1F5NA 3AKEA 4PC7A 3WHKA 4YXWD 3WRYC 4EKDA 1N5LA 4GI7A 1J90A 1O3YA 3FYHA 3ND8A 221PA 4FMCF 4CT5A 5LBIA 1R5BA 4EPVA 2GK7A 3RS5A 4B33A 5DN6D 3WP0A 2A30A 4KFTA 1CLUA 4QGGA 3TUIC 4PFSA 4TL6A 1SVKA 2IW3A 2O8BB 1RRPA 2CNWD 5L3SB 2WIAA 2ZJYA 4FI3C 1G6HA 1XXHB 3ZS8A 1T3HA 1A4RA 4HB0A 5J5CA 1ZU4A 3CKLA 3O8RA 3Q7PA 2QBYB 4C2UA 5KNBA 4KBGA 1W0JD 3IIMA 1Q3TA 2JJ2D 1H8ED 1TADA 4AIIA 3GJ7A 2V9PA 2JIZD 3B9QA 3HYRA 1S96A 1R10A 2PMKA 2JLZA 4TQUS 1XWIA 2TMKA 2B7BA 5IK2A 4LJ8A 4PQYA 3MCAA 5EXXA 3GJ5A 5CIQA 1SVIA 3ZGXA 4EUNA 3BAFA 4PHHA 1CXZA 3OFNA 1C1YA 3QKRB 1G4AE 1E1RD 1G8GA 1Q3HA 2F1JA 2BMJA 2J9RA 4A6PA 3H86A 3QBTA 1FNMA 2C95A 3IIKA 3Q72A 2BMDA 2I1VB 4OJKA 2EQBA 3QE0A 1TMKA 2VSOA 2CK3A 1CBUA 2HLDA 5CLLA 1LTQA 3NKVA 5B30A 1FQJA 4Q7KA 1ZD1A 3SZRA 4U00A 2IXFA 4JL5A 3ZZ0A 1Q1EA 1RYFA 1Q22A 1G17A 4LHWA 4QJ5A 1ZMXA 3GLHA 2O8BA 4CGZA 1FQKA 2FEMA 3I61A 3WHLA 3K53A 1SKYB 3KQLA 4TWZA 1J8MF 1KSHA 4IOKA 4MRRA 1L8QA 3AF0A 3NDBB 1GAJA 1AS3A 5KHOC 2PEZA 3U3MA 3IHLA 3TW8B 2FZ4A 3C5HA 4HZUA 3NH9A 3RNLA 5K8IA 4YC7A 2CL6X 1WBBA 1KI6B 4V03A 4M0LA 2QGZA 1GRQA 3DKPA 5FUXA 3AVYA 4LZZA 1FFHA 1XJQA 2DYKA 3GP8A 3ZVLA 1VG9B 2P65A 1BYUA 2C9OA 4PQRA 2F9MA 4A8JA 4FIDA 3ZYCA 1AS0A 2A5FA 2YJTD 2V4ZA 1P6XA 1DS6A 4EFMA 2J1LA 2H92A 1KO7A 2CEAA 3KUCA 1Y3AA 2GCPA 3U5ZB 4Q7JB 4QHYA 1SVOA 1ELOA 4P33A 3H1TA 4TMWA 4HDCA 3PENA 2FSHA 1W48A 1OHHA 4FCWA 4QGHA 4V0NA 3BWDD 1U0LA 5JCPA 4DHEA 2BEKA 5E4FA 3EPJA 4PC3A 2J41A 2EYQA 2QE7A 2F43B 3BC1A 4Q4JA 5CJ2A 2ZS9A 4NL4H 1HQCA 2ZI3A 2JJ2A 3FMIA 1T3LA 1ZNYA 5LDDC 2OO7A 4CEHA 4M1SA 1VYVA 5FR1A 5J47A 3TSOA 3WMGA 1OH8A 1E9DA 3REFA 3Q85A 2YWGA 2D7DA 4DIDA 3B1WA 3K0CA 2YYZA 4I1OA 4DDVA 1G19A 3QKTA 2Q3HA 4DLWA 1G3RA 1Q12A 2V7QD 5H70A 1U8AA 2QSZA 5FBQB 3W8NA 1CRQA 1RKBA 1FX0B 1W5SA 1XD9A 1OW3B 2J59A 1SULA 2HUPA 2YWHA 3GD7A 4CF7A 1PZNA 4PZLA 4O0MA 3R8CA 4M9SA 1JAHA 1R4AA 2WTUA 3B7GA 4WZBE 1YZTA 2QAGA 4O2RA 4QXAA 2O8DB 2IYZA 1NIJA 4FINA 3AGPA 4W7SA 4UXHA 1FMLA 2GA8A 3EW9A 5JI3E 3RRMA 3KXIA 1XNJA 3ASZA 5FTNA 1XU4A 1XPOA 1OB2A 3OIVA 4QBFA 5EQTA 3SNHA 2F1HA 3Q5EA 4MRNA 3LX8A 1GL7A 1XTSA 3W5JA 1XTRA 3GCGA 1D5CA 2P6UA 3NC0C 2R6GA 3HR7A 1OH7A 3X1YA 1SGWA 2RH5A 1ODFA 1JALA 2YWEA 2FFAA 1UM8A 3QF4A 2XGJA 3L0PA 2ZVPX 3CLVA 1I2DA 2GJ9A 4LPKA 1XBTA 5DNYB 3VR4A 3O47A 1UKEA 4EQ6A 2RGAA 4FD2A 1UKZA 1XMIA 4MGKR 1SXJA 2WSMA 1OXVA 5EZ5A 4KJZA 4BFZA 4ZIRA 1OYWA 3LQRA 2EYUA 5EE1A 3ZVNA 3PEYA 4UXJA 2ZRPA 3CH4B 2ZREA 4PO1A 3ZZUA 3TQFA 4YONB 5GADl 2JLRA 3I8XA 1XTIA 2RAPA 1KK2A 1NN3A 4TL7A 1U0HC 1W5TA 2KI5A 5LB2A 5F98A 4KHZA 1IQPA 2R6CA 1Z5ZA 3OE7D 2AN9A 2J0VA 4KSCA 1E1QD 2C77A 2ECKA 2D2EA 1YZNA 5LPNA 1CEEA 3D31A 5DIFA 2HJGA 2H1LA 4YMVA 3W34A 4B35A 3OEED 3KXKA 3KQHA 3VTKA 1MO6A 4JT4A 2WJVA 5CK5A 2O8EB 2Q9BA 2WOOA 2ZRLA 4E22A 4LV8B 1TU3A 1P2VA 3RRZA 4B3BA 1G64A 4J0QA 3GLFE 5BWMA 3PUXA 4TLEA 1KOFA 4DT1A 1NVVR 2F43A 4KYIB 2JIZA 3AEZA 4DSOA 1W44A 4TLBA 1W1WA 4LK2A 1W4BA 4G3XA 4FCVA 2FDCA 4TTRA 4TMZA 1E1QA 1ZC4A 2Y8EA 4X8HA 4I1SA 5FTKA 2CHVA 1ZIOA 1CTQA 3OAAA 4EFNA 1UDWA 5FBRB 5AUOB 1W2HA 3RLFA 2ZSBA 1JR3A 4BEJA 2I3BA 3EZ9A 2R44A 1HEIA 2VIIA 4XTRA 4JSTA 2PMDA 4DBLC 4TYPA 3A1SA 3P20A 5B57C 3DOEA 5A4JA 3U2QA 5C2JB 5JRZA 1E0AA 4B3DA 2JAQA 4PPNA 1WE2A 5EE0A 1G9XA 2AD1A 4CVNA 2GESA 1EK0A 2E9SA 3H2YA 4XD7A 4JYBA 4YXWA 1GSIA 2GRJA 3ADDA 5EE3A 2V3CC 2IA5A 4RZUA 4NCKA 2FG5A 4JJZA 1OV4A 3FMOB 1UEJA 1Z6TA 2XITA 5HKKA 3QIAA 2WJGA 2ZRAA 1CULC 3LW7A 4NH0A 1KMHA 2GXAA 4K81B 4MDFA 2HEIA 4K8OA 2ORIA 3QPVA 3DZ8A 4MYHA 1HUQA 4TSFD 2ZUDA 4G0NA 3SYLA 2N1BA 2WKPA 3U7HB 2XTMA 4ZDJA 2CVHA 5JHHB 1N6OA 3A4LA 2WOJA 5FPHA 1AZTA 3QUSA 1N6NA 2G0NA 1KK1A 2GK6A 2ZSDA 2Z6VA 1G16A 5SZKB 2D06A 2QUZA 1UJ2A 4NCNA 2C99A 1E9RA 1II8B 1M6NA 3UXMA 2ZJ5A 1FNNA 4OQXA 4Q18A 4C0HA 3FKSA 4NHOA 5DN6A 3FHOA 1G7RA 2WJIA 2FFQA 4JLBA 2QQ0A 1EX6A 5CITA 3ZIAD 3B82A 3BS4A 4PSVA 1U98A 1P75A 5L3RA 3AVQA 4Q1BA 2CCJA 3OIUA 1XEFA 3SR0A 2RGNA 1RRCA 3TH5A 4OI1A 5FOXA 2QL6A 1E3MA 2WWWA 4L15A 3LBHA 1T8TA 3FFBA 3AKDA 3I32A 4LCBA 4XSHA 4FMDB 1KI9A 2OFOA 4FWIB 4WA7A 1NSFA 4V02A 1VHTA 1A2KC 2FMXA 4XWOA 2GEDA 5KNCA 1R5OA 1T6NA 1OXXK 5GJVC 2FEOA 1OIXA 3M1IA 1RC8A 5J4KA 4UNPA 3OF5A 3NBXX 3QKRA 2ZTSA 5G41A 2WWYA 5SZIA 1BMFA 3HU2A 2ZM5A 3BH6A 1UF9A 4I1UA 3QVUA 4BQSA 4P4SA 2PL3A 4BLQA 3GLHE 2NZ8A 1WF3A 2EFHB 1FTNA 1OKKA 1NLZA 2FF7A 1SVLA 4OYHA 4M9ZA 3F8TA 4DIEA 1R5NA 1GUAA 1PJRA 1YU9A 2QU8A 5FL7D 4Q4AA 1R8SA 2P0EA 3LD9A 4G5QA 2O8DA 3FMPB 4M1OA 3QNUA 1Z0JA 5FL3A 3U7EB 3K1JA 1I4DD 2ZI4A 3KZ1E 1E96A 3ZVMA 621PA 1XPUA 2ZR9A 2QQEA 4DLXA 3KX2A 2ZSEA 4TZ6A 2GJAA 4QBHA 4U5XA 1P3JA 3T61A 4ZKEA 5BYJA 1JEEA 2X8AA 1IAQA 2QORA 3BFVA 4IDHA 3CX8A 2WHXA 4IOLA 2CDNA 2IYLD 2YV5A 5KSYA 1DG1G 3CR7A 3VR6A 4B6FA 1Q0UA 2QENA 4C0LA 5C4GB 2ZVQX 2GBLC 4A8JB 2R6AA 4A0GA 2XOKD 1CR1A 2H18A 3NC1C 2JLQA 1EXMA 1T0HB 2BKUA 3HP1A 4Q9LA 4N0DA 1Q1QA 3C15C 4BE7B 2GILA 3DM9B 4Q02A 1E99A 1DAMA 1E1RA 3HU3A 4G5SA 1T9HA 3IEUA 2FSIA 4DLZA 3OFND 2KBEA 3KKQA 2XZLA 1UEIA 3K0FA 2ONKA 1DPFA 1KKMA 1WA5A 2X2FA 1XXHA 2PBRA 3VHXA 1CKEA 1B0UA 4DLTA 3LDAA 5FOTA 2NZJA 2CCGA 2WSSD 2J7KA 4JLDA 3EZ6A 1JR6A 4V0KA 4TZ0A 4Z51A 4M8NE 2NPFA 2C96A 2P2LA 4Q01A 5JJKA 1JB1A 1XMSA 3EXAA 421PA 4Q48A 3SJAA 4DKXA 4PPGA 2GZAA 3BK7A 4TTQA 4LHXA 3JZMA 1G8PA 3WMFA 4A9AA 1US8B 2QAGC 5G3ZA 1OLOA 1G8YA 2J0UB 4Q9KA 1HURA 1DE0A 3EIQA 1XEWX 1LB1B 4Q4HB 5DHFA 4Q03A 3K0AB 4BLOA 2FGKA 4S35A 2GHIA 2XXAB 2G9NA 1GFIA 2IYSA 2ZITA 2Q21A 2BCGY 3B85A 2ZAMA 4JVMA 4IOMA 5G53C 1FTSA 1VCNA 1NG1A 1LY1A 1ZUHA 5TARA 2G6BA 3H4MA 1NBME 3UKDA 2G3YA 3GFOA 1AQUA 3SDZA 3V4FA 3EZ2A 5H68A 2AKAB 2DFKB 2VHTA 3WNCA 4AK9A 4GP7A 3K0FB 4D4LA 3DM5A 3CWQA 121PA 4Q1EA 5KO2A 1ZD9A 3AUYA 1E94E 3GEIA 4JS0A 2QGNA 2ZRNA 5L3SA 2B8TA 3X1WA 1RRFA 1OXSC 1E98A 3ZDQA 1N5KA 2HXYA 3WXMA 2O5VA 3FVQA 4UNNA 3UMRA 2IYYA 4KV9A 4LUCA 2FZLA 5JWHA 2Z43A 4NU0A 4OHZA 4BLTA 5KPJA 4A2WA 1JQJC 3DMNA 2ERYA 2V55B 4DSNA 1MO5A 4PPQA 3UK6A 1NVVQ 2NOAA 1OJLA 1NIPA 2N46A 3LVQE 4HLUC 1KTVA 4HI0E 4EJSB 3U6BA 2ZXUA 3GLIA 1EWRA 1II0A 2ZIAA 3R9XA 1E69A 1KI7A 2AL7A 2YC4C 5ELXA 2G83A 1DAKA 2QSYA 2RB4A 1KAOA 1TF2A 3SC3A 5B58C 1E9FA 4LJ6A 1KK0A 3AVPA 2WPDA 2C04A 4LJ9A 3AP3A 4URXR 1QG2A 4AKIA 2IUUA 2ZRDA 4B44A 1HT2E 5BQ5A 3ZS9A 1X1RA 2IHYA 2Z4SA 5EE5B 5FI0B 1VYTA 3WYFA 2QAGB 2QNRA 1E9EA 2QY9A 2WKRA 2HT1A 1MH1A 2IYRA 3PITA 4C2TA 3SHWA 3NXSA 2UZIR 3CUEF 1M7GA 3AKYA 4QL3A 1P5ZB 4XJXA 3CF6R 3SFVA 4A0RA 4MRSA 3WNDA 3I3SR 1P61B 3RVBA 1RVDA 5GJWC 1FZQA 3G0HA 1G291 2B8WA 4DEXA 5L3VA 3ZIAA 1HY3A 4TTPA 1IY2A 1R0XA 4IVRA 3K0SA 1IY0A 4LV5B 3WMEA 1YR9A 5TVKA 4D81A 3P4YA 2PEYA 2ZANA 1UPTA 5G40A 3C41J 5C1BA 2DFLA 1E79D 2BBTA 2OV2A 1GZSA 1KAGA 2EFEB 3V9PA 3GMTA 1MV5A 2VP2A 2V54A 2WWGA 4XWAA 1M74A 1A82A 2FPKA 2ERXA 4IHQA 4DCVA 2QI9C 4F4JA 2DWPA 2ZROA 3SE0A 1IN4A 2GJ8A 5LD2C 4R9UC 4DDUA 1FUUA 3Q9LA 3RDPA 5L3QA 1CJVC 2YOGA 1HV8A 3TQCA 3LLUA 1XD2A 3E5HA 1TF7A 4H9GA 4FXPA 4RVCA 1XXHE 1G3MA 4C4PA 3CX6A 8OHMA 4FMCB 1AIPA 3SJZA 4A82A 5JLJA 4ASUA 3QSYA 4V0OA 1NY5A 1AZSC 1F6BA 1FPMA 1NF3A 1G7CA 2WAXA 3GJ6A 3SJBA 5AJXA 3BB1A 2CVFA 3R7WB 3LQQA 3T1OA 4POAA 1DO0A 4ITRC 3ONWA 2IXGA 1IJEA 2ZRFA 1T0JB 3CW2A 3PG5A 3AVVA 2Q6TA 3THYB 4PC1A 4LY6A 3AVUA 1XCGB 2MSDB 1DELA 4Z1MA 4KCGA 1JR3D 1KDPA 1KO1A 1C4OA 1KMQA 1SVSA 4GRAA 1IN7A 4IVQA 2AHOA 1CJUC 2AR7A 2V6IA 4D4JA 5KSOA 3BB3A 2MSEB 4H1UA 2EFDB 5EXSA 2ODBA 1NKTA 3ZLJA 4B34A 1ZIPA 3BB4A 2OBLA 4LPSA 5JJLA 4RD6A 1WRBA 1Z3IX 2GCOA 4OK3A 1KO5A 5CDFA 2PJRA 4URZR 1EX7A 3I1FA 3J81k 3AVTA 2OCBA 1LVGA 1ZNZA 4LGMA 2NIPA 3C14C 3N2IA 3P1JA 2ZRBA 3OZXA 4EIWA 5IHPA 2OT3B 2ZYVX 5HE8A 4CYMA 3GLGE 1E2PA 4DUGD 2GXQA 4W5HA 3T5DA 1ZM3A 1TPZA 1VKJA 4PAMA 2ZEJA 2G1KA 2BWJA 2HCBA 3LLMA 2IS4A 1N6RA 2V1XA 2ZE8A 1NBMA 5EE9A 5EXPA 1ONBA 4B73A 821PA 1RRGA 4F93B 1N2CE 3T15A 2DY1A 1Q1BA 4BUJA 1E4YA 4ZO4A 3DHWC 2LKCA 2WJHA 3GLHB 2J5XA 2GJKA 5JWOA 1SHKA 1N6KA 1OKKD 4FN5A 4JVLA 4MKFA 3DKVA 1W0JA 4A2QA 2WWHA 4CDGA 1GG2A 2QMEA 3VU9B 2OUKA 2PH1A 3SYKA 4LC0A 4EFLA 2PCJA 4MRPA 4AG6A 2JATA 4PPFA 4OHWA 1ZJ6A 3MD0A 4B3XA 3K0AA 5P21A 2FV8A 2WAYA 1CIPA 4B6EA 1XMJA 3THXA 1GDDA 4LJYA 2WMOB 2FFBA 3K9GA 3FDIA 2A3RA 4C0JA 4ZDIA 3L0OA 2IYUA 2XJ4A 2O8FB 2EWWA 3QXHA 1ZYUA 1U8YA 4PHGA 3T35A 3RRNA 1F48A 5GVRA 2W2XA 3A8TA 3LNCA 2GETA 1AGPA 5C18A 1AQYA 2AXPA 4MYUA 1S3SA 4DSUA 4OHYA 2GCNA 4ESHA 2W6IA 4RD0A 1GL9B 2XB4A 2G1JA 1KSGA 4B47A 5KSPA 3WP1B 5KSZA 4URVR 4JLAA 4YMUA 4QGFA 2QP3A 1JPJA 2Z4RA 1O87A 2RHMA 5KOYA 1DAGA 1XJ0A 5C4MA 3GEHA 5F3WB 1DAIA 1TTTA 2J3EA 4RCYA 3SU8A 5F9HA 3CR8A 2H17A 1Q44A 3MUFA 4WW0A 1D8TA 2JLYA 4AG5A 1VECA 2GAOA 4LJ4A 1S0UA 3EX7C 4IDOA 1JAIA 2BC9A 4ESVA 2O0HA 1TEXA 4C9BA 5K8LA 1PLJA 4MH0R 1E2NA 4EPYA 3AF3A 4TYNA 1QZXA 3Q8XB 4EJSA 3GLIB 2X1VA 4LSGA 2HDNB 4EPXA 2ZI9A 3DZDA 1N0WA 2ZRCA 1FX0A 1Q57A 5UKDA 4LV6A 2RGEA 3DO6A 4GT1A 2ANCA 4IXNA 5HTKA 1ZAKA 3KTAA 2IC5A 3K8YA 3CRW1 5EZ6B 4NCJA 3U4QA 1KJWA 1QDEA 1KNQA 4PSAA 2W0SA 4NCHA 3FTQA 3D6TB 4ERNA 2A5GA 3O8DA 4LC1A 3DVLA 3SI7A 5HR5A 1P72A 2YZ2A 4LWZA 1NLFA 2AK3A 1XX6A 3BBPA 4RFSA 5EP3A 2QAJA 2HJVA 1E2LA 2WBLC 3B13B 4KLZA 4KVGA 2V1UA 3QPWA 1K5DA 2E87A 2YNMA 4NP6A 4ACAA 4GMDA 2ZJAA 2B92A 2RGCA 2X77A 2ZS7A 4E5UA 2NO1A 4W5WA 1XMVA 3LY5A 2VA8A 3QJYA 2BDTA 3GFPA 2CBZA 2ZJ8A 4QBIA 3FFAA 3IO3A 2QZ4A 4MGIR 2VP5A 3BOSA 5C46F 1NBMD 5JMTA 4DCSA 4Z54A 1S1CA 4HB2A 2CLCX 4HUTA 1F2TA 3GLFA 4A0FA 2IHBA 2OFXA 4BRUA 3TJZA 4LHZA 3EWAA 3LBNA 1VG0B 2CJWB 1CP2A 2IEZA 1H65A 2CMKA 4UJ5A 2DCUA 1R7RA 1YVDA 2QT0A 5E95A 3S1AB 4S2EA 5BN5A 3GJ3A 1GKUB 1PUJA 4M1WA 2CHQA 3ZD7A 1VYUA 4OI4A 2P3SA 4C0SA 3RS4A 3GFTA 3Q5DA 2YC2C 5HCIA 3IEVA 2PJZA 4N3NA 3CONA 3U61B 2P67A 4Q00A 3JVVA 1TAGA 5CIWA 2ZYWX 3CNNA 2F7SA 4D0LB 4E03A 3O8CA 5IRCD 1II9A 5DI9A 4XVUA 1U99A 3ASYA 2D7CA 4OQMA 3BD9A 4L9SA 2CL7X 1RJ9B 1X6VA 5CYOA 4ASUD 1YHNA 2ODWA 1EFHA 2VLIA 1YZQA 3VKGA 5JEEA 1PLKA 3MGCA 5JEDA 3OEHA 3A58B 2NO6A 1S2MA 2FA9A 5JWRA 2PZEA 1W4CA 4M9XA 3W5IA 5HPYB 5E7MA 3VX4A 4E07A 2ZETA 2WIBA 3NHBA 3WYAA 2R6FA 4JLNA 4QJ3A 1LW7A 2ATXA 5AR1A 3TVDA 5FH9A 4JIMA 4ZI2A 1NN5A 3RC3A 3K09A 1C9KA 4V0LA 1F2TB 3L2OB 1W7AA 3P4XA 3PQCA 5CK4A 3KKMA 3THWB 3SEAA 4D25A 1V43A 2BKEA 2RGBA 2HYIC 3A37A 4L4UA 1ZCBA 1LF5A 4BFXA 1A7JA 2B7CA 1IXSB 3M4YA 4Q4AB 1YZLA 2A7QA 2JDID 2C78A 4KODA 3KKOA 4FW9A 1XRJA 4OK6A 4PHFA 1KI4A 4EDHA 4GDFA 3GJ8A 2BMEA 5ANRB 1FOEB 1D6JA 2QP9X 2KBFA 4IVPA 4D4MA 1CRPA 5J4LA 1GM5A 4AYWA 1GITA 3KTAB 2PZFA 1GRNA 2FU5C 4HLDA 4GSYA 1XTQA 1XCPA 3GQBA 2QT1A 1BKDR 1F60A 3W90A 3OIYA 2P5TB 1NL3A 4C3ZA 3IHWA 1V5WA 4JKIA 4O25A 1H8HA 4Q4JB 4XIGS 1TU4A 2JCSA 3UWKA 2VTKA 2ZJBA 3EAQA 3NTUA 1OFTA 4A0HA 2JLWA 1U2RA 2AK2A 1L4YA 5CLQA 4ILEA 4XOIA 2IUTA 1OH6A 3MWJA 1Z06A 721PA 4MKGA 5B64A 2J7PA 4JBXA 1U0JA 2QROA 4D0GA 4PSKA 1ETUA 2BVNA 3UG7A 1ZP6A 1UKYA 3LXRA 1R8QA 3RS3A 3LRPA 4UNQA 1Z29A 2P5SA 3P26A 4DSTA 1S9DA 2GKSA 4TT3A 1N6LA 5DH9A 2REOA 4HYYA 2I4IA 4US1R 3QENA 1AN0A 2DWQA 2OCPA 4TLCA 2ZI6A 1NJFA 4KO8A 2GJSA 5KUTA 2H7VA 2FSGA 4N0EA 4P32A 5JS7A 1GRRA 5JI2E 1SKQA 3DL0A 1L2TA 1COWA 1YRAA 2C98A 5DGXA 2GEUA 2WPDD 3MLEA 1BO6A 4A36A 1M8PA 1P2TA 4LJAA 5HZKA 1IN5A 2C8VA 4A15A 4DUGA 1XEWY 1E9AA 2ZU0C 1US8A 3SFZA 4US0R 5CB6A 1OIWA 3T1TA 2WVJA 3MWYW 5KU1A 1ZRHA 5JSZB 2IS6A 2GXUA 2OM2A 2QBYA 2GCOB 3TAHA 1DADA 1FW6A 4QRHA 4TMXA 4D2IA 1J2JA 4HDQB 3QXXA 2J87A 1KI2A 1P2SA 1T3SA 3MJRA 4QHTA 4B2LA 3I5XA 4B74A 3WRXC 3RSLA 2OBMA 4LBYA 5FTLA 4WXPA 1Z07A 5L8VA 4LYFA 4Q66C 1Z6YA 3CPEA 2EW1A 3BORA 2H5EA 4DLSA 2HLDD 3NDPA 1KI3A 1YJ5A 3PEVA 2O8EA 4UNRA 3CF0A 4WXRA 4HAZA 5DYGA 1XD2B 2A5JA 1XF9A 1LNZA 1NMXA 4KAXA 5AUQA 5AJWA 1XEXB 4B2IA 1DOAA 2ORVA 3MWKA 3ND9A 4BFYA 2A5DA 4IW3B 2CLDX 4Y0VA 3VX3A 3LA6A 4RCZA 2RGNC 1DAFA 1F3OA 5HE9A 4BFSA 2XJ9A 4QNRA 1CU1A 4I99A 1YQTA 3ICQB 3LAWA 4TMTA 2FWRA 4ABYA 2YKGA 5FR2A 1GVNB 5KPDA 4QBGB 5FTJA 2FSFA 2ZPTX 4HZIA 2NO9A 6Q21A 1S1MA 1BH2A 3CRVA 4TL9A 3VR2A 4U7DA 1CR2A 2ZRKA 1XZPA 2F1IA 3N70A 1BIFA 1QHIA 3SOPA 1RIFA 3ZVRA 1IXRC 4F91B 1P4SA 2C2HA 1MOZA 2AFHE 2WKQA 1TNDA 4C7OB 2IYQA 4EPWA 2GXSA 5TDHA 2CJWA 5TY0A 1WMSA 1U81A 4EPRA 4DXAA 3A4MA 4BLSA 4ZCLA 1OH5A 1F2UA 3NBFA 5D3MB 3PUYA 4K46A 5JBQA 1EESA 4OL0A 4TYQA 3NG1A 1FP6A 3EIEA 4Z8XA 4C0QC 5AUNB 5EJEA 2Q9AA 4WZAE 3FHTA 1IOZA 2J0QA 2OCAA 1Z2AA 3HDTA 2IS1A 4DLRA 1EFTA 2XOKA 3F3YA 3AM1A 1E2EA 2ZR0A 5EP2A 4Q9JA 3VMFA 2C9CA 5FPKA 2CE2X 1KI8A 1KKLA 3PV0A 1LF0A 1GP2A 1R0ZA 1VG1A 3K0CC 3A1UA 1ZM4A 5AUPB 4M21A 3KJHA 4OK5A 3BERA 1G5PA 1N6IA 1PUIA 2OCYC 3AUXA 4LX0A 3RS0A 1YR6A 3AVOA 1WQ1R 3A36A 3TW4A 4AKEA 1JQLB 2J0UA 3TKLA 4HAUA 1RPZA 2UZ3A 3QEJA 3PIRA 1BOFA 1Z6XA 3PEUA 4GP6A 4PAQA 3K9HA 4WIAA 5JSZA 4UJ3A 5FFMA 3E2IA 2XTZA 1VPLA 2VRWA 3QKSB 4ZDWA 4BZXA 5BW8A 3UIEA 4ZCMA 2B21A 2GVDC 2JA1A 2DHRA 3QXJA 4NZYA 3CZPA 4QFMA 2PX0A 1G20E 1IBRA 2OFWA 4I81A 1T5LA 2X19A 5EP1A 4CEIA 4MYCA 5JS8A 3U44A 2VF7A 4D6PA 4M9QA 1Z0FA 1UADA 4RD2A 1Z6GA 4Q7MB 2DR3A 2VHUA 3X1XA 1Z83A 2XNSA 3THYA 1XDBA 2A5YB 4F92B 2VQSA 5FI1B 1W36C 2IBMA 2IXEA 4L9WA 2JLSA 4FCTA 4ON9A 2QG6A 1W0KD 4XTCS 3IGFA 4QKQA 5TMPA 4JLPA 3ICEA 1SXJE 4CZ2A 1RW4A 4HZUB 5LB4A 3BRWD 1U90A 4B71A 5JCZA 1K8RA 2O8FA 4B3GA 4RD1A 4ARZB 4BFWA 3ETLA 1W4AA 4EJSC 4A6XA 3ZQJA 3PEWA 2ODNA 2CK3D 5FPTA 1NKSA 1YE8A 3UMSA 1KJZA 4Q47A 1K6MA 1GL6A 1WP9A 2VHJA 3T12A 1QHYA 5CM8B 2F3RA 3DDCA 3CNOA 2G88A 2J7PD 4X8LA 3QI2A 1E9BA 3VR1A 4BEBA 1XPRA 1P73A 3U3RA 3IQXA 2FOLA 5H1YA 1CJMA 4R2HA 5A0FA 3KFVA 4TQ9A 2ASEA 3AP2A 5KYKA 1P7CA 1QG4A 3FKSD 3G5UA 3L8YA 4U02A 1M1YE 5BN3A 1U94A 2QMHA 1G8HA 4URUR 5E7JA 1QHXA 1MKYA 2XSZD 1SZPA 4RKEA 4G01B 2ZUBA 3CIOA 2F3TA 1MO3A 4QC2A 4EQ6B 4I1VA 3CB4A 2HYDA 4TSFA 1TL7C 4LYHA 5EUQB 4KU4A 4BZQA 3ZD6A 1DEKA 2QRZA 1NVXQ 4C0AC 1P62B 5AK0A 2BV3A 2O52A 4AKHA 1X86B 1OXUA 1CF4A 3RANA 2W6JA 4DZZA 2JDIA 3LO5A 3DOFA 1OHHD 4QM6A 2WSSA 1RE0A 2BBOA 3GJ0A 5GVSA 2L0XA 1AK2A 5F9FA 2O0JA 1EFRD 1EG7A 3FMFA 2GZHA 4XD7D 3W6NA 3OAAD 2EWVA 2BBWA 3DEFA 1N6HA 4B75A 3KB2A 3KL4A 4B32A 4AKGA 2ZS8A 2NG1A 4DCUA 3QQ5A 4AC9A 4YDHB 3ADKA 1Z6AA 2XNDD 1NJGA 2BM0A 4HAXA 1YZKA 3TBKA 3VQTA 2O8CA 1G4UR 4ZDKA 3C8UA 4JL6A 2IK8A 2ZR7A 3LW8A 5K8UA 4AD8A 1T5IA 1KY2A 1ZNWA 1LS1A 1E4VA 2IYTA 3VNVA 3QOFA 1DG3A 3GLGB 3U6KA 2WWXA 4GOJA 4WVFA 3SQWA 2FPMA 3QKSA 3EZ7A 1Z28A 4JMPA 2IL1A 3IBGA 3TIFA 3HJNA 3K0EA 1JEDA 3AH8A 3QF4B 5DHAA 1DO2A 2XB2A 1P9RA 3MG9A 1UBFA 4CIDA 3S1AA 4B3FX 4PC6A 1KZ7B 3SHFA 4TYWA 1ZD8A 1BS1A 4CEIB 1DAEA 1E0JA 1ZVQA 1ESMA 2WWIA 2OAQ1 2OLKA
chains in the Genus database with same CATH superfamily
2CVPA 3MILA 5CTJA 4WN9B 3X0DA 1X1DA 3DMDA 5I7WA 4UMFA 2QZ9A 2A59A 4M4SA 3D4LA 2C5HA 3D3EA 3K05A 2WWVD 4HJRA 4O4IA 2XNKA 2JA2A 2C07A 2C2WA 2REXB 5EHNA 4EQZA 1X94A 1WQ4A 3JAKB 2C4UA 3CXUA 2IXTA 3QEKA 4YDSA 5DNCA 5DYTA 1H4QA 1D9XA 1Y8AA 3TUJC 1FPQA 1KIMA 1U9IC 1YKSA 3PJRA 3SBEA 3D9QX 3GVHA 3QFTA 3QWFA 3RBXA 3H13A 5CDUA 1ZM9A 4C1NA 1OTYA 4X3PA 4O4LF 1GQRA 1IUNA 3FW1A 1G8MA 3RTGA 3MD9A 4RULA 1DI0A 2G77B 3OECA 3R8XA 5L7YA 1H0SA 4NNJA 3NETA 4ZI7A 4Q5IA 1RQPA 1T8RA 3ECAA 4TVBA 2ZZMA 2P6RA 4AKTA 3CLUC 4ND3A 1J42A 3CX4A 1TA4A 1LPOA 2QU7A 4MR7A 1GGHA 2I54A 4Y6PA 5EIHA 1ZCAA 4LFCB 8AT1A 1GGKA 4H6XA 4KB5A 2C9YA 2JFUA 5FUBA 4MUKA 3AF1A 2OC4A 4XM0A 2PQMA 5E2BA 1IHUA 4CQMA 4DXHA 1FNCA 1NKVA 2DBRA 1BDBA 1NDHA 2OE2A 2XECA 4KO3S 1RWNA 2MTBA 4TT3D 2WU0A 1TFRA 1IHXA 1WDTA 3L8CA 3MTIA 3JU3A 5HIAA 1SIOA 2VJMB 3CLUD 2P4SA 4UZSA 2HLHA 3WYBA 1YV9A 4L4SA 4ZU1X 5DHQA 4DJTA 2VVTA 1JN0A 2AH5A 2YN4A 3JATA 5J4HA 1IXKA 1EFRA 3SX4A 3QLTA 1KMCA 1HDEA 3GPCA 3EQZA 4J43A 4GL2A 2P7HA 1T2VA 3KQOA 1A1VA 3FCAA 4NU5A 3R8FA 2MSWA 3TKAA 1IM2A 1HDGO 1G6OA 2XMGA 2WFMA 5BSVA 1P2UA 3HTXA 2OY0A 3DUFB 1VI2A 4YLGA 4L75A 1HT1E 1GTZA 2GDJA 3KVOA 3MAJA 2A94A 3ZY3A 1FDWA 5E6UA 3LY9A 2QD3A 5ITZB 2AWOA 1NW5A 1GM5A 3PTAA 4EG3A 1Z37A 2BD0A 1C30A 1M2EA 4KOAA 4PYMA 1KI6A 3VR3A 2Z8YA 1OGYA 5G1PA 4C4RA 4UVEA 3K70C 2YR0A 3KJGA 5A9TA 3TMYA 2GVZC 3KEQA 2QXYA 5DNVA 1YCFA 3T9DA 3PE6A 2GPBA 2DHQA 2BM1A 3LYHA 3ASUA 3CLHA 3Q3JB 1U2ZA 1IJFA 1P80A 2PX3A 4XX0B 1PG0A 2ZJ4A 5C80A 2YIDA 1LBTA 3DOIA 3UOGA 3HI6A 4OYYA 3DVRX 4PNHA 4PLPA 5FTMA 3UJ9A 4B6JA 5CCXA 1W6UA 1AKYA 1CR4A 3HY6A 2GN0A 2N42A 3K70D 1IULA 3OO1A 3GLGA 3PJFA 5SZHB 4PHTA 3B2EA 2PRKA 3PPWA 5A4MS 6ADHA 2OCXA 4F93B 2GHTA 2L69A 4RK4A 3NEAA 3SQLA 1X8JA 3K9WA 4GMXA 4MLZA 2Z57A 3OJWA 1TYBE 4TLMB 4YEDA 2XYPA 2HA2A 3G82C 1XZJA 2ZYTX 1K8QA 2GAFA 5CDFE 5JJBA 4QYIA 3RYHA 3TMAA 1ZCFA 2FPIB 1PWEA 1EXWA 1RAIA 2HK9A 4FUQA 4MKXA 4LSZA 4D0NA 4E4YA 5D3KA 1EFPB 1OWOA 2RSLA 4ROTA 2A78A 3DMTC 1E3WA 3MSXA 2IIQA 2OLJA 3BE5A 4JJKA 4LXTA 4TWIA 3TZCA 1MZVA 3DVAA 5DRYA 3ZCSA 2NU8A 3IYLW 3N5CA 1JR4A 1G2QA 1OXMA 2YX1A 4KBFA 2OKCA 1CP3A 1BRMA 3M1AA 4C20A 3RSQA 2AJLI 2DPGA 2OAEA 1DBPA 4KXFB 2OD9A 1M9NA 2J3KA 3VR0A 3B7PA 2QN9A 4EB8A 3O4FA 3C8HA 4Z4HA 5KB3A 2A5LA 5L3QB 5IDVA 3FTCA 3EWIA 4FIZA 4KQFA 5IM5A 1YR7A 2VT7A 2R66A 3ZXYA 1PLLA 1U6KA 5DCUA 1J21A 2Z6UA 2HDHA 4J03A 2C92A 4CR7A 5AJYA 4TKVA 3RV3A 3IC5A 3D4OA 4YJ2A 2F9LA 1NSTA 1RZ3A 2W93A 5JPCA 1X7HA 4D44A 2IOFK 2EP8A 4EY5A 5IVPA 3J81A 4TM8A 1NOKA 2ETVA 1I3KA 4A10A 5I3ZA 4XUGB 2IWHA 5KWJA 5M04A 3PRJA 3VNUA 1G5FA 4EHJA 4CMCA 4ZQCB 1I6MA 2C4VA 3BMCB 3GEEA 5ILGA 1QVVA 4YT4A 3GARA 1OJ7A 1ZKDA 4DLAA 4IJKA 4YT2A 2IU3A 3QTTA 1LTHR 4ENQA 3I92A 1NVWQ 1TEVA 4DC9A 4KREA 3WBJA 3PL1A 1DWUA 4GPIB 2MHCA 4I3GA 4ZC1A 1LLCA 4ML3A 1QZTA 2IYFA 2QTZA 1VLVA 1HFWA 3COYA 1DBSA 2VJLA 2KW5A 3GNLA 2G8NA 3CZMA 1G5IA 3M5CA 3QM1A 4ICIA 5FPQA 3TXYA 4R8KA 3CRRA 4HVLA 1KYIA 1JJ7A 3DH0A 4I08A 3RABA 4FLMA 3AI2A 1RHMA 4ETWA 2DQYA 1USGA 1SUAA 2GF9A 2VYCA 1ABFA 3HHPA 1YI1A 4P3YA 4NPCA 4TQAA 1QH0A 4E94A 1Z4LA 3VU9A 4WE3A 1EG2A 1ZZEA 2PM8A 2ZSFA 1MORA 2B0JA 4R7ZA 2AKYA 4Y2JA 1R0SA 1U4SA 2EW8A 3IB6A 3VAAA 3V8QA 3E1SA 1FZTA 2HU5A 3IVXA 4LI3X 3CNQS 2WG1A 4Y30A 2BFEB 3L82B 3VHLB 2E5FA 5EXEA 5C1IA 1GGEA 3JWGA 4A5SA 4J16C 3AU8A 2C2XA 1PYOA 1EFCA 2YJ5A 1Z63A 4IWNA 4F72A 3GA0A 1FX1A 1U1IA 1MP0A 2Q29A 3L7KA 5DI3B 2DB3A 2A9JA 1O4WA 3LV8A 4M49A 4Y2HA 5DYIA 4P3KA 1W36B 2HJ9A 1MABB 1SU6A 1QOPB 2DPYA 1WL8A 2R8OA 3E3OA 2VEDA 3FI9A 4RZXA 521PA 5FUYA 4G6ZA 3DEJA 2GBLA 5JE8A 5KYNA 3FVWA 4Y18A 4YUWA 2GH1A 3D8BA 2XEXA 3VKVA 5EQJB 2FZ5A 2O7QA 2NAFA 3ICPA 3R76A 2X86A 3FUXA 4AMZA 4HRVA 3DFMA 4BQRA 3PVCA 4R2XA 4HLQB 1JLMA 1K0FA 2NMVA 3L41A 1LLDA 4IRUB 4C6TA 2GTPA 1U6IA 3A4TA 3MFYA 3OU7A 4G37A 5FOUA 4UEKA 3ME5A 3ML1A 4M38A 5TS3A 5CDHA 3WLEA 4ZI7F 3BRWA 1AE1A 2N75A 1BKSB 1ZMOA 2J45A 2ODEA 5BN5B 3KKNA 2A4KA 4MR8B 1NN0A 4Q34A 1Y5IA 2Q3MA 3ITEA 4IGIA 3RI3A 4JQSA 5IX8A 3I62A 1OI7A 3ZXXA 1VSBA 3NNDA 3T1QA 1GEEA 4ZIRB 1GKIA 3CNLA 3FPFA 2Q2VA 3RG8A 4P0TA 3RBAA 3JS5A 5JSQA 3PQ4A 1YR8A 1OWLA 4A8JC 4RV5A 2VDLB 3RUDA 4RORA 3B6EA 4BXOA 5ALKA 1HKUA 1S89A 1XCMA 2FCRA 3P9CA 4AY5A 1XU9A 1R0LA 5IYZA 2Z1DA 4DPLA 7YASA 4UKDA 4QNMA 3TRJA 3O21A 3LFUA 4YRCA 3BXHA 3LH5A 2XTNA 5F5LA 1CUHA 4NR0A 1SVWA 5ALYA 1C2TA 1PW5A 4PC2A 3VVLA 2NT3A 3DHEA 1ND6A 5TQ0B 5BSKA 1E3JA 2A8YA 4M7OA 2W83A 2DH5A 1Y3CE 1UBCA 2CFCA 2VJBA 1T1GA 1TQ4A 2WV7A 4WFQA 4ZFNA 1QRSA 2XGGA 2B82A 2YXPX 1F2UB 1QGAA 1YJ8A 2HF8A 4AY2A 3HN7A 3K9FC 4V38A 4MKRA 3WNBA 1XFAA 3IQEA 3BRCA 4JVNA 1Y8QB 3H8VA 3TSZA 2VUIB 1D2EA 4KUEA 5HZMA 2BTOA 9ABPA 1E4OA 1FUEA 2YWXA 2GBPA 4YP6A 2YNMC 1ONNA 6CHYA 3ZHXA 2HIMA 3AP1A 4OQEA 3RVPA 1U02A 1UXJA 3W1EA 2C5LA 2V6JA 3HYTA 4P7FA 1NXPA 4M0EA 5A5FA 1CIVA 4JHLA 1EGAA 5TXGA 1BYIA 3ZK9A 3CKMA 3QELB 3GU3A 1E1CB 1NQOA 1X39A 1VCOA 4RFSB 1KE2A 2D4HA 4L5IA 1T24A 2JLVA 4Z0NA 3WGNA 2OZEA 4LBWA 4BWFB 5GJBA 1TMGE 4I2VA 4S0XA 3HDQA 1YK0A 4IKEA 1XK6A 3DPIA 3MJCA 4S1NA 5TPZA 4IJVA 1HA3A 3VZDA 4B17A 4CKXA 3TK1A 3DP9A 3K4HA 5DLQC 4UTNA 1W85A 4FEGA 1GTRA 5B1HA 1VFNA 5JROA 4B4UA 3UUGA 3AQIA 1AXGA 3DFIA 3PFBA 1AUVA 4QU8A 5CA1F 3RVLA 2EVWX 1B8UA 4AYXA 1UXKA 1UPUA 1GZDA 1QTNA 1XKQA 3D6MA 3HCAA 3OZCA 4KKXB 1WHSA 4ZMBA 4HAYA 2ZRIA 1XU7A 4RHXA 3FYDA 3L4SO 5J4YA 5KDOA 4LCEA 4E5YA 5E6SB 4NIMA 5B55A 5LMNB 3C3EA 5JVDB 1UZUA 4UM5A 4UREA 4C0BA 4J9VA 1Q7CA 3B20A 3M6AA 4J7XA 4JYPA 5BWNA 3GWZA 2ROQA 3MWEB 2QP4A 3QVOA 1Q11A 3QJ5A 1C50A 4R7TA 2IS2A 2EDAA 1UOQA 3QGMA 3PHGA 1MXHA 3BXEA 3L6UA 3TRIA 2FNAA 1FDTA 1ZH8A 2KYRA 3ILXA 4JEMA 3ZZMA 4KPFC 5CB8A 4M0LA 2CHGA 3L4KA 4Q7QA 4BRWA 1XCBA 4QPDA 5KWSA 5IK2D 3DR3A 1G1MA 4KI0A 4W9NC 5K8TA 1I5RA 1E2KA 1L8OA 1T5DX 3IMEA 4UM9D 4HATA 1LRLA 1BXKA 3OPQA 3D3WB 4IFEA 4J49A 4BFCA 4MVJP 4MB0A 1N2BA 2FPUA 2WC1A 4ND8A 3WWDA 1XQXA 2YOHA 2XVXA 2G1UA 4DRXA 1O0BA 1C8LA 3L4JA 3QEBZ 1GPNA 2DAPA 3JPYA 4W99A 4X91A 3TEJA 3SQXA 2FEAA 1QRDA 3QG1A 1EVYA 2AW5A 2VHCA 1ZD3A 3HPQA 3WAGA 4ISCA 1J0AA 1XRRA 3JTMA 3VUEA 1T8UA 3PUKA 3JVUA 4YRQA 1NVMB 3ZE7A 4O2BA 5IJZA 1M6WA 3DD1A 4AZWA 3I5UA 4PAWA 5G0VA 4Z9FA 2MINA 1VE3A 3RQIA 3L7AA 4RD3A 4X00A 1YRBA 5GTDA 1N9ZA 1MX1A 5I5EA 3OEHD 3WLQA 2B2XA 3SR4A 5FUWA 2QTWB 3LT1A 1CVIA 3FNIA 1AC5A 1L3IA 1AV7A 2V5UA 3I2FA 1GGVA 1Y8CA 1C2YA 1RPJA 3GEMA 5KCZA 1QCYA 4NS1A 2VYFA 1MVOA 2PY6A 3MQ4A 5CX1B 4U6SA 4UULA 3KVVA 2B8EA 5A3RA 5EGNA 2J46A 3HJBA 5LLDA 3FOAA 1BS9A 1KDTA 4MCJA 5KWVA 2QUAA 1POXA 3LUJA 4OHVA 4KXUA 3EW7A 4Q7LA 2WJZB 3ZQ6A 4WN9A 1JDTA 3ZHUA 1JJBA 1NNUA 3W4IA 4RDXA 4I4LA 1NRIA 4KH0A 4RTOA 2FZEA 2E4VA 2GEVA 3C97A 3P9ZA 5FL7A 1J99A 2QMQA 3L6EA 4QREA 4Y2RA 1ANKA 2CB0A 2FVXA 2YZ7A 4NECA 3GRYA 1QGDA 3GRVA 5IF9A 2KQUA 1GG9A 1LC3A 2IW1A 1W47A 4BO8A 4F6RB 1SEPA 2BTQB 3CC8A 3T3MB 1PWXA 1QFZA 1QV9A 3BCHA 2H16A 1GA4A 1YHYA 4XVRA 5JJIA 1ID8A 1CR0A 1BX0A 1D0VA 4HC4A 1JT2A 2OBFA 2ODPA 3QBDA 3GRUA 5F2EA 1E5TA 3GQVA 4QTXA 4JSRA 4PZEA 3D0KA 5K4GA 3LT0A 4NE2A 2YY6A 3AF2A 1W0KA 4NAVA 1H3EA 2H9AA 2ORED 2P6NA 4GPEA 4JYMA 5TQ2B 3B1YA 3A9VA 4G24A 4ZT6A 4DE5A 3QE9Y 2NPIA 3EUAA 1FMJA 2NQTA 2QZSA 1COWD 1AA9A 2BTEA 3GBSA 3IO5A 2AFRA 2X0EA 4YK7A 2CXPA 4QYSA 1USUA 3GAFA 5CT6A 5DEIA 2AZXA 2EKDA 4FMBB 3IEMA 4MICA 4L0DA 2X76A 3C8ZA 3OKCA 4L08A 4V0RA 4XGQA 2I29A 4L5AA 4P4TA 1YMVA 5ARDA 3V80A 1TEHA 3JPWA 3KQTA 3E8SA 4YUAA 2ZYIA 4JGGA 1M8KA 3SR3A 1GPBA 2XNDA 4DY4A 2VKQA 3FFXA 4QHSA 1S9HA 2CKMA 4WK0B 3EMKA 1ZXXA 2ID4A 3P52A 3J80A 5FPSA 4IDAA 4FB5A 4BNYA 3NB0A 3QU9A 1YDMA 1N5DA 2IKSA 3M34A 2W6PA 3C4VA 1ML4A 3HMKA 4YJGA 2NZVG 3S4YA 1NOIA 3NGXA 4K6KA 3RAPR 4DB4A 4UZFA 2HXSA 4EAQA 3EVBA 4FGZA 3MMXA 2VYVD 4OFZA 1YJXA 3WLRA 1WF6A 3MHPA 2GAJA 3R5HA 1N77A 4RDIA 1ECGA 3MAAC 1NQXA 3QEMA 2C5EA 5DP1A 2DFNA 3VKWA 4Q1CA 3OIFA 1MTOA 2PL9A 3CGWA 3V9AA 2CXXA 3L1JA 3JVIA 1OTXA 5FRDA 1I51A 1YBHA 3I6QA 1IZ0A 3FZQA 3H18A 3ZD8A 3H99A 1TO1E 2R1TB 4G9EA 2VDOB 3IE0A 4JN6B 2QTTA 2WKWA 4LMAA 3W9YA 4RJKA 2PXCA 1OCEA 5GZ6A 1HYGA 2B4KA 1M54A 4P98A 2R4TA 2XGMA 3W6PA 4FC7A 4ZGWA 2GEBA 2CNBA 1VQ1A 4IEEA 3DLAA 5AKIA 4DQXA 3OG9A 5KTRA 1DKRA 2XUDA 1X42A 2B61A 3CKKA 3M5DA 3GLFB 4L16A 3HDJA 2GAAA 3RRXA 4GMGA 3ADBA 4KWHA 2CUTA 2JIPA 1TUBB 1WUTA 1Q1GA 2PLWA 5EJIA 1Q1ZA 4FHCA 4G1EB 4GP9A 4IIFA 5IM4F 3ZC3A 3IDFA 1EUCB 5ILQA 5HYVA 4CLEA 1S8FA 2V4UA 1W25A 3MYYA 1G21E 4DOMA 3X1DA 3GG2A 1G41A 1NF9A 2ARKA 4KV7A 2PT6A 2PZAA 2YINC 3IAM1 3OZVA 1X70A 3P0JA 1KE1A 3TLAA 4KAFA 1MHTA 2Y77A 4BB0A 1TECE 3VNQA 4D80A 3C7CB 2I6UA 2YY5A 1DMRA 2XE6A 3CUWA 3V4RA 3FTDA 5E9AA 1MT3A 1KSFX 2GPAA 1OFHA 4MP3A 3A6FA 2GSWA 3EC2A 2WV9A 4RH1A 1GRVA 4O2LA 2CXHA 2AUMA 1E0KA 4OMUA 2ZJZA 1ICIA 4M9RA 4UHFA 3H75A 3W9UA 1VLJA 2FX2A 2LDBA 1XPJA 3O03A 3WVNA 5CEFA 1P7YA 1Z2NX 2DUMA 3IUYA 3BGDA 4GVPA 1Z2PX 4YP9A 1RYHA 3EC7A 4JLKA 1BVRA 4MYTA 3RTDA 4CBVA 6PFKA 2OD7A 4NBVA 3A2MA 1T2FA 2LKDA 3PSAA 2A2ZA 3HCEA 4U2FA 4ED9A 2PQ6A 3KKEA 3PGJA 4TKVB 5EXTA 5E8RA 1LRKA 3F7TA 2ZJOA 1CETA 2AG8A 5A7HA 1XIVA 3L6CA 2XT9A 3U4AA 3ZZTA 1S3FA 4EAAA 4O3MA 1UQUA 2VP9A 3COWA 3D0QA 3HK2A 4B79A 5FBWB 3ABIA 4ZAYA 3MOIA 2QW1A 4L72A 4AJ4A 4WZAA 2LIPA 3BRQA 1YDFA 1PNVA 5KOHB 2AXNA 4N5MA 5KDLA 3STHA 1RTTA 1J25A 4WN3A 3N87A 1BQEA 4YN3A 3A26A 1IY1A 3TIXB 2GZSA 4KIJA 2ZRMA 2Z2JA 3A1TA 3LCUA 3TRFA 1TKBA 4PCLA 4OQNA 4U7PB 5FXMA 4TN5A 3KJEA 1PDVA 1X1CA 2IPAB 2MR6A 4MP6A 1R88A 3KEOA 4I7EA 5HIIA 3SY8A 3THOA 3V55A 1ID1A 2XMRA 3Q88A 3RWMB 3ZTTA 1MJGA 1OBHA 2Z0MA 1EFUA 4DYVA 2QQGA 2YHUA 2OMKA 2F4NA 2HQ1A 3NTQA 4IGFA 4Q1AA 2BGIA 3B3FA 4JBYA 1X8LA 1Y5MA 2XQKA 4O5AA 2NUTA 3G2JA 3CLTC 2P78A 1EQUA 2BF7A 2H54A 4ALKA 4RSGA 2GCIA 4HMQA 2IHJA 2PWZA 5C5DA 4FOPA 3U26A 1NR5A 2JIOA 3IPXA 1JGTA 1QH1B 5ITWA 2C0CA 2CMDA 3C5CA 3QOXA 2PS1A 4HQLA 4TRMA 5T8KA 3FUVA 4IXMA 3SNKA 1PJ3A 2PKXA 3B6KA 4UASA 1VHLA 5JYEA 2KWIA 2R65A 3DONA 3PUWA 4UNSA 3WJAA 1XXLA 3K8ZA 3PXGA 4G9GA 3WQHA 1NVGA 3CLTD 3LX5A 4XSGA 4NG5A 4F7WA 1JIKA 1U0SY 1J56A 1CQIA 1TFUA 3GC6A 3OQIA 1PX0A 4KQGA 4NFLA 3ZCUA 2FYTA 5LQRA 1DPGA 4YMTA 1SHZA 4FBGA 4HUJA 2XUAA 3AO0B 2XRFA 4OKNA 2V03A 2QD5A 4ZZIA 4R9SA 5LL6P 4ENPA 2J9ZB 3FBTA 1QAMA 3KSDO 5K01A 2A7XA 4MKIA 2CDCA 1SC9A 2ENUA 5D01A 5FPYA 2PZGA 3U44B 1JU3A 2ZFUA 4OM7A 1A5TA 1IOVA 2WUFA 4RPJA 4JQCA 1R6VA 2E4YA 3VI3B 3WLFA 1IIBA 3LC2O 2WWTA 3HBNA 1DT5A 3LQYA 4EHHA 3B1VA 2MMCA 4HUQB 4PHCA 1FSSA 1HSOA 1XL0A 3CRQA 1DJOA 3QEOA 3TSCA 3M89A 1LBHA 1E8DA 3SZOA 4PC7A 3TR5A 3H1FA 1H22A 3RK4A 3EFOA 1N5LA 1ZD4A 4UEQA 3PRYA 4GI7A 2H4WA 5HF9A 5I7AA 3U7RA 3FYHA 3T3OA 221PA 3V1UA 5LBIA 3UMVA 2XKKA 1WPQA 1EUDA 5H9WA 3ON5A 1RXIA 4B33A 5FWNA 5B1DA 3HWRA 1CLUA 3SLRA 1RBYA 4UFPA 1DBQA 1E5DA 2VDKB 3N7UA 5EWLA 3H7AA 4CQMD 5L3SB 4BNKA 1SHLA 3ZV6A 4TKLA 4ZRDA 7ADHA 1G6HA 1XXHB 2B1QA 3ZS8A 4E31A 1A4RA 1G6Q1 2POQX 5HJ7A 4PICA 3GD5A 3H9EO 3Q7PA 3O8RA 1EK1A 3LOPA 3B3QA 3M5WA 3IUEA 3IIMA 1Q3TA 3PZBA 3OC0A 4INOA 3IXLA 1Q2UA 3TKYA 2FQWA 1A0OA 3I6MA 4R3UC 2J9YB 3GJ7A 1E20A 5AI5A 4KBYA 2P0AA 5KYGA 1Y8RB 2H7YA 1G5QA 2AEJA 2VPXA 2ZDGA 3L7YA 3ZHSA 3JQBC 4PEVA 2QSUA 3A3OA 4TQUS 2TMKA 2P40A 4YUZA 1FJHA 4C4OA 4HTFB 2AXEA 5EXXA 4WBNF 3ZGXA 2XE4A 1NW9B 1Z3CA 5JBIA 3D0RA 5D6OA 1CXZA 3OFNA 1X7ZB 3MUEA 4MV7A 4B4WA 1BCSA 1EH5A 2Q99A 1MB2A 4F11A 1G8GA 1E1RD 1RAFA 1Q3HA 1QZUA 1VSTA 2F1JA 2W2NA 5K0GA 2BMJA 2NYAA 3IURA 3LQ1A 3H86A 4L8FA 5EHQA 3RV4A 4BB5A 4LRQA 3V33A 5HQJA 2DBVO 1SOUA 3JARA 3IIKA 3T3GA 4M60A 4OJKA 2EQBA 1TMKA 5AVUA 1CBUA 4NHEA 4PS0A 1VB5A 4DIKA 1LTQA 2B6NA 3IPAA 1E7RA 1CYEA 2UVPB 3AF6A 2KPOA 3SZRA 2OXTA 3MJEA 3C1TA 3PFCA 1RYFA 1Q22A 2VTEA 2CMFA 5TQJA 1XQYA 4H3HB 3GLHA 2D59A 4OREX 3PHHA 2DVMA 1SKYB 2B25A 3T4EA 1KSHA 3MJVA 1OILA 1P5FA 1W93A 1L8QA 4LGVA 3BYZA 4MRRA 5BUCA 4XJVA 4PVCA 3AX6A 1ZJ4A 1AS3A 4D79A 2NXCA 5KHOC 4KGVA 1KRHA 4KMRA 4R0MA 3IHLA 3C5HA 2HMUA 1IOWA 4QPPA 4HZUA 2VHYA 5K8IA 1KHHA 3U7IA 2O54A 1KI6B 5AVQA 4CFYA 3HGTA 3EXFA 1GRQA 4QU0A 3BREA 3SFTA 4LZZA 4BHTA 2DYKA 4CMAA 4E14A 3GP8A 3K92A 3ZVLA 1UKAA 3H4TA 4B3TB 1Y42X 2C9OA 2RIPA 3ZE0B 1VL5A 2HC9A 2HPHA 2F9MA 2WM2A 1L4FA 4KXVA 4FIDA 2VBIA 1ZITA 1AS0A 1HTBA 1CUIA 3MIIA 2V4ZA 3E2PA 3JQ8A 4ZQBA 1C9MA 4PFQA 3M33A 1MF7A 3MELA 2NSDA 2ZWMA 4KYVA 4YAIA 4DYDA 5HKOA 2CEAA 2RARA 3R3YA 1GXSB 1JV2B 4R05A 2K7ZA 1Y3AA 2PWBA 5CXSA 2VJKA 3LIPA 3UW3A 1NBEA 1TMOA 2AOVA 3N2ZB 1ELOA 4CCSA 5HM6A 5IZCA 3MWEA 1YZ3A 1YI0A 1Y7PA 4CPDA 1VE6A 1RBZA 1XLTC 4TX1A 4U7JA 2BUCA 4UPDA 3ANTA 5DYYA 4DHEA 1B41A 1JIQA 2QE7A 4RW0A 2FUNB 3BC1A 2ZSIA 3KOWA 4HGNA 3ES9A 3UKJA 3BA1A 2IUYA 1HQKA 3FCUB 1T3LA 3FMIA 3BFJA 4MS4B 5TQVA 4XE5A 3R7SA 4YJ3A 1Y6ZA 1XJWA 1W4LA 4ZOAA 5JRDS 4KUGA 4TZTA 4CEHA 3EFBA 3TSOA 5KTKA 3DBHA 2ATEA 3O38A 5CA0B 2HK6A 1ZA2A 5C8VA 3VXKA 2DUNA 4YYEA 5CNIA 4DIDA 2D4AA 3JR7A 3VNAA 3N6VA 4RQUA 3E18A 3GDGA 4KXXA 4QXOA 5FI3A 1G3RA 1I1HA 2V7QD 1TVMA 4WX2B 4XM1A 5H70A 2PUAA 1U8AA 2Y1FA 1AV6A 2JCYA 4O63O 1RKBA 1K3UB 3BTSA 5AIBA 2J59A 1OW3B 2YWHA 1SULA 5HFAA 5JDIA 4CT0A 2IITA 1PZNA 2QRJA 3W8NA 3EDOA 4IQ0A 4KNWA 3ZLUA 9ATCA 1KXJA 1QJCA 1R4AA 1BCRB 1L7EA 3B7GA 4XDZA 1T1IA 4O2RA 3ZY5A 1QIDA 4I3FA 3PDWA 4WT7A 4YV1A 4FINA 1NIJA 2CC2A 1HETA 1JG4A 3NPAA 4OP1A 4IXWA 3PWTA 3O1LA 2V7PA 4UXHA 5SY9A 4E1VA 4XVCA 4RHUA 5JQGA 2VAVA 1TJ3A 2XUQA 3MGAA 2I9PA 2Y27A 4R5MA 1JHYA 2R7KA 3O84A 4IFIA 2X5JO 4FYPA 4KWTA 4FEAA 4L6AA 5EQTA 1AUOA 2B9VA 1KFBB 4B85A 2I67A 5IH7A 1KIAA 3DEKA 3TB4A 2NT4A 3DBIA 3W4JA 4X94A 2FWMX 1P2DA 2Q5IA 2BFAA 4N40A 5U4QA 1I4OA 4IJ6A 1B6TA 1XZNA 4Q1VA 5GPBA 4AJ2A 4MDHA 1FDSA 1H1DA 1ODFA 1JALA 1UMBB 1YOVA 1N2JA 1DBIA 3PX2A 3V2IA 3STWA 1UM8A 4R2KA 2C7VA 1MEOA 3CLVA 3ZZ1A 5JAOA 4G25A 4DCCA 1P7ZA 1XBTA 4IHJA 5DTQA 4K6OA 1WVIA 4U2EA 2JNWA 3EJWA 3QV2A 1ENZA 1LLUA 5HTOA 3E61A 2DX7A 3O47A 4L5CA 3TJMA 2BI8A 2NP6A 3MOSA 3VPDA 3HCWA 1DLJA 1SXJA 4J0KA 4P4GA 2QDXA 2EHJA 2X5NA 3HKBA 3HSSA 2I6TA 3Q3VA 5EG5A 4RIIA 4EYKA 5TMDA 2C2MA 1OYWA 3D2LA 2VPZA 4KQEA 3ZVNA 4OX9Y 3ANNA 4UXJA 2I71A 4JXXA 4JQOA 3UMBA 1GU0A 1GPDG 1YTUA 3FOEC 3CH4B 2NU7A 4JJ6A 3ZZUA 1QMGA 1EVZA 1M1YB 1P1HA 1VGVA 3SJUA 2X8WA 5GADl 1AQLA 5M29A 3EDQA 3VKFA 4TL7A 2C7RA 1U0HC 1EP9A 4BMYA 3OE7D 1H23A 1A7UA 1B8NA 1Q7RA 3PNKA 1J5PA 1E1QD 1RLJA 5KVVA 1SC3A 2PBFA 5TPWA 5JD5A 2PWAA 3UVEA 3KE8A 1CEEA 3O9VA 3I2IA 2HJGA 1Z17A 2RK4A 3UHPA 2HWYA 4B35A 4DSNA 2J5QA 5LZ5A 3HA3A 3VTKA 4BQQA 1PJLA 3LY8A 8MHTA 4X6LA 2V1UA 4YMIA 3RRZA 5DM60 3RFUA 1KP3A 3CE9A 4G0MA 5FTJA 3BIWA 3OPYI 4XI9A 4CG2A 2YVKA 5DYNA 4GHWA 3DKKA 4KYIB 1J0CA 3RU2A 1D2CA 1RJDA 1U9ZA 3HVJA 4LJSA 4EARA 5BV7A 3UAYA 2GZ3A 1GDTA 4LK2A 2IY8A 4IF4A 4JC4A 3OZIA 4TV9F 1UDBA 5G0UA 4BV3A 5G2OA 2DTXA 2WF8A 2OB1A 3EWNA 4EBFA 1TJPB 5AVYA 2I99A 1KFEB 2W9XA 3P0HA 1SVNA 1CZOA 3IBCA 3GHYA 4Q37A 1H2FA 5FBRB 5AUOB 4DCMA 2XA2A 2ZSBA 1JR3A 4HRAA 1GARA 2WRZA 3VV2A 1JMYA 3H97A 4JJ4A 4INZA 4PYRA 1GUZA 1DGQA 1IBSA 3E82A 1L3CA 1SC4A 4JSTA 4AZ0B 3P20A 2AKEA 4HQOA 4P2GA 3ZGLA 5C2JB 4RVDA 1M10A 1JDSA 3A70A 3HSKA 3WQBA 2GZ1A 4G89A 4MVJE 1FP2A 2JAQA 3OCZA 3Q15C 4PPNA 5ESDA 5CJJA 1M2VB 3SXPA 3U3XA 3PDJA 4D6XA 5IASA 1IZ7A 1G9XA 3U7QA 5B6PA 5BPFA 1JX6A 1GA6A 2IKQA 4EG0A 2ERCA 4JYBA 3NHLA 3F6EX 4RABA 5JARA 4J07A 4G4IA 2GRJA 1BG6A 3EF0A 3AIOA 1BS2A 4YP7A 1VJRA 2IA5A 2L2QA 3U40A 4UCQA 1UEJA 3LPCA 1WB4A 2ILTA 4WZBA 3LW7A 1CULC 4N3GA 2GXAA 4K81B 2JFXA 3A1DA 2HEIA 1X1AA 3E03A 4CKEB 5BRAA 1LH0A 1NZFA 3CZCA 1U3UA 2O1XA 3N7TA 4KZKA 1HNNA 2FPGB 3OLXA 4UBJA 2NYUA 4BVLA 2FRDC 5FBKA 1YBVA 2I4TA 1N6OA 3FUUA 3RVNA 5A4IS 1KYQA 1ATZA 4ODIA 3DTYA 1SOMA 4ZEVA 3RVOA 2G9ZA 3G0DA 1O54A 3M1YA 2GK6A 3GRFA 1RABA 4U9HS 4YJFA 5SZKB 3PXXA 3KPVA 2R11A 3ZV5A 1PFVA 4BKPA 4E5DA 4GGMX 4GIBA 1DWOA 1QTRA 2PLNA 1M6NA 3UXMA 2ZJ5A 3EH1A 1WSBA 2YXDA 3CH7A 5DN6A 3NBKA 1LPPA 3FHOA 3GVCA 4D43A 4OGFA 3TZHA 3ZCRA 1O94D 3TJRA 1L7PA 3ZIAD 4CMGA 3DZIA 5JMWA 1EFKA 1TA0A 3EE6A 4TVOA 1OX5A 4BEVA 3ER9A 2YFYA 1NW8A 5F2OA 1Y3DE 3EIUA 5KYYB 2CNKA 1XEFA 4GRDA 3JASB 3TH5A 5LSAA 1K7CA 3LCJA 2E2WA 4HF7A 5FOXA 3G8YA 2EBHX 2WWWA 3SF8A 3V8MA 1SBHA 3LBHA 4FX2A 1SG0A 4E5PA 3HJFA 1QCZA 1SUCA 3AKDA 1QQTA 4D1YA 1YVRA 4IO1A 2OFOA 4QWMA 4PBSA 4NENA 3PX7A 3KEMA 2YUIA 1EE2A 4XXHA 1D4FA 4RGVA 3AJAA 4D42A 2CYCA 1PS8A 5LP6C 1I01A 1JQAA 2FMXA 2HBQA 2A0YA 4WA8A 2VDVE 2GEDA 3IE2A 3ZY2A 1JXAA 2EATA 3BN3A 4XWWA 3PPYA 1J0BA 1OXXK 4X20B 1ODJA 5DLDA 5GJVC 3B70A 5KREA 4K7JA 2WUWE 4KO2S 5F3RA 1WS6A 2WMYA 4F3RA 3UJ7A 3DP7A 3OPMA 3UFBA 2WUEA 1HMYA 1W1UA 2ZTSA 5PGMA 1N2IA 3RUEA 1E3EA 1NT2A 1TAHA 2G9VA 3AHGA 1JQ3A 1CUWA 2WZCA 4CIVA 1JLHA 4OGLA 1HFJA 3AEUA 1DLIA 3HB4X 4GM0A 4GYYA 2JH3A 1XVAA 2FR8C 4KMSA 4BQFA 2R6ZA 1WF3A 1TDJA 3RJTA 3EPRA 4C3VA 2EFHB 1FTNA 1E3SA 1SVLA 1PK7A 2C3YA 1WEHA 3LOQA 4M9ZA 2HR1A 2IH4A 4FNAA 5BSFA 4KXLA 3LVBA 4G0QA 2SCUA 4NCAA 1O5OA 1R8SA 1TC1A 5LA6F 2O8DA 1XI2A 4N8EA 1RTKA 4BJ1A 3KSBC 4W1QA 2FXIA 3ISVA 5L3ZA 3IAEA 4WXYB 4Y7CA 3BMNB 4C7KA 5FO1A 3U7EB 3MK31 3WWCA 3F46A 2ZI4A 4R1LA 3DV9A 1V4BA 1WDMA 4ES6A 5CHYA 4YAOA 5JASA 3D6UA 1EA7A 4DNXA 2QLJA 3ZVMA 5DTMA 3AMVA 4DJDC 3KX2A 4OSPA 2ZSEA 2GJAA 1OU0A 4QBHA 1NG9A 1H0HA 3EDMA 3U39A 1GFZA 3RUCA 4KTVE 4ZKEA 1QKKA 2QMZA 3EIXA 3PI7A 4J6EA 1V16A 3TIGA 1BH6A 5GONA 3GLRA 4IDHA 3GJRA 1SELA 1TRHA 1V71A 1RQ7A 2IYLD 4RIGA 1V5GA 1DG1G 2ACWA 3VR6A 4IXTA 3KPWA 1ZHHA 2ZVQX 4E2FA 1RHKA 4KR9A 4I9UA 4JC0A 3R5XA 4Z7QB 3E5MA 2CZGA 3G5MA 3Q1KA 3RAJA 1T0HB 4MLPA 4N6GA 2BKUA 4R1OA 3O2JA 4BE7B 2D00A 5EJ6A 4BIIA 3OM9A 2Z30A 1PR6A 1DAMA 1AXRA 5JVDA 2PZBA 3IEUA 4CLDA 4G67A 3DL7A 5EFOA 1N7GA 3GH3A 3IVGA 3K0FA 3EQ6A 1DPFA 1SN7A 1P1JA 4H3VA 1XXHA 5DB4A 3VHXA 1B42A 1VM6A 2YDXA 3MUOA 4DLTA 1GYQA 3MRVA 2EW2A 2K2QB 2NZJA 3GL9A 2AB0A 1Z5OA 4LX8A 5F64A 5AFSA 1ORTA 4NOKA 3QMWA 3EZ6A 4Z4QA 1JR6A 1LK0A 1MEEA 4V0KA 4DM4A 5JSFA 4M8NE 1RZRA 5F23A 4TZ0A 1M2NA 4WJZA 1XZLA 4HGZA 5JJKA 4ER7A 3A2LA 1XMSA 3EXAA 4Y1RA 1D4OA 3ZXUB 4PCUA 2AOTA 2FPWA 5J2UA 4PPGA 2VNKA 2G67A 1DV1A 3BK7A 2B3DA 4PVDA 1US8B 4TMYA 4RMGA 4AS1A 2HDWA 2V96A 2NTJA 2PSFA 1G8YA 2I87A 1JVNA 5EZYB 4EKYA 2ALJA 2RAUA 1LB1B 2ZIWB 3DR5A 4Q4HB 3TYXA 1BEZA 5LXTB 1YVPA 3K0AB 1SJ9A 4IM7A 4S35A 1HORA 1ZN2A 2GUGA 2G9NA 5JAHA 5HNKA 1GFIA 2IYSA