1F2TB

Crystal structure of atp-free rad50 abc-atpase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
AREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
molecule keywords RAD50 ABC-ATPASE
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tB00
3L43A 1XEXA 1E0AA 3WBJA 1IJEA 1G18A 3ZS9A 2JDIA 1H8HA 2GF0A 4TMVA 3A36A 3OHMA 1II8B 1V43A 4LSGA 5DNYB 2C2HA 4DLYA 5GJVC 1LV7A 4RY2A 3AKYA 4JLPA 5EQTA 3VNVA 3KQNA 4A4DA 1N5IA 4RD1A 5AJWA 3SJZA 1NG9A 2BEJA 1ZU4A 4N1AA 1J90A 2Q21A 2ZITA 4RSGA 2DBYA 5CLLA 1ZYUA 2QA5A 3OAAA 4US1R 2A9KA 1XD2A 2YVUA 3MWKA 3SNHA 2FFAA 1GIAA 4LJ9A 4G5RA 2QG6A 3D6TB 4PHGA 4MUBA 2KBFA 3ZQ6A 1E9FA 4LJ5A 1G4AE 1M7GA 2IYSA 2P6NA 1T3HA 5JEEA 2VHUA 2AD1A 4PC3A 4HLUC 4WVFA 3K0FA 5J4HA 1NLYA 4ZDKA 1XJ0A 2O8FB 3MLEA 4KFTA 1W48A 2KI5A 2ODNA 3NG1A 1G8HA 3EZ2A 2NZJA 3W3ZB 3BGWA 4ARZB 3K0SA 5BYKA 3THYA 1UFQA 4G1UC 2IYVA 1KO5A 3AUXA 2FA9A 3T1OA 1OH6A 5SZHB 1D9ZA 2QP3A 3W8RA 4DUGA 2XTNA 2ZAMA 2ZJAA 4JKYA 3GMTA 1II0A 1VYTA 3PXGA 1E9EA 4ARZA 1GVNB 2CHVA 1CR1A 1R0YA 4Z51A 1VG8A 3LH5A 5FL3A 1C1YA 1Z2CA 4JLVA 1U90A 1H8HD 1HYQA 1X8JA 1R10A 3VQTA 4ESHA 1Q21A 1KDOA 2EU8A 4P4TA 4IDQA 1AKYA 2OXRA 4GDFA 2IYXA 3ZVNA 4DB2A 3CX8A 4LY6A 2RB4A 4OQMA 1X6VA 3I8SA 1G41A 4LYJA 5KDDA 1E69A 4H1VA 4XTCS 1AQYA 3A8TA 3UMSA 4AKEA 2X2FA 2K5UA 1GL6A 3BOSA 2LCFA 5KO2A 1H8EA 3H2YA 5IRCD 4TTPA 1XWIA 5CB6A 3U5ZB 4LJ8A 4FCVA 1VHTA 2IF0A 1ONBA 3BH6A 4PQFA 4P33A 3VR3A 3EPLA 5L3QA 4Q66C 1Y3AA 5BXQC 2JLQA 2ZTSA 4PPNA 1W47A 4Q1CA 1VKJA 1VG0B 2EYQA 2R6GA 3FKSD 2FPKA 2H57A 2J0QA 1KO8A 3W8NA 1RYFA 1Z0IA 1ZCBA 4UNNA 2OFWA 3IBYA 4KI0A 2XEXA 2VP4A 1Z5ZA 3G5UA 1QRAA 2F55A 4EFMA 3RS5A 4GOXA 4MRSA 4QC2A 5FPKA 2BMJA 3P27A 4FWIB 2EFHB 5HCNA 3U2QA 3SQWA 3BERA 1GOTA 4O25A 4KVAA 2KWIA 2W58A 2J41A 3KFVA 3WP0A 5JS8A 4BZXA 1Z6AA 2P6UA 3IQWA 3MWYW 4LPSA 1KNQA 1E9DA 1Q1ZA 3KXKA 4QHYA 3ZZ0A 1QBKC 1J2JA 4DLVA 2BBWA 5KOYA 3NH6A 3C15C 1D6JA 2A5FA 5LBIA 3PUWA 4FIDA 4P4SB 2ZSDA 1ZC3A 4HUQB 1XXHA 1Z8FA 2HJVA 2ZE7A 3THXA 3RC8A 2Z43A 1NP6A 4M1SA 4RJLA 5ANRB 2QRZA 4FI3C 4LRWA 2D62A 4RZXA 3CZPA 3PV0A 3B1VA 1Z0JA 2CHQA 4R2IA 4AD8A 3MRSA 4M1MA 3TH5A 1SVSA 4QBFA 5FUVA 4JBWA 2QSYA 2PCLA 2FSFA 4IKEA 3T06B 3K9GA 3ASYA 2JASA 1DAHA 2HJGA 5BWMA 2ZRAA 4RD4A 2O8DB 3QQ5A 4FINA 3HR7A 1N6OA 1W0KA 3EZ7A 4XIGS 2MSDB 2BHRA 1U9IC 4B32A 1IXZA 5BW8A 1AGPA 1TADA 5P21A 1SHZA 3I1FA 2YZ2A 2QENA 1IJFA 3CRQA 1CJVC 5AJVB 2VHTA 1VIYA 2GTPA 5FUYA 1XJCA 3KUDA 3UG7A 4JVLA 2A2ZA 1N0WA 1NY6A 4JVSB 2QPOA 2EFCB 3RAPR 4Q4HA 1KZ7B 2W2XA 2YWEA 1IM2A 2AX4A 4ABYA 1R8SA 4ITRC 3MJRA 1XFAA 4Q9KA 4IDNA 3VAAA 1YZTA 3I61A 4XH9B 3PITA 3PUVA 2QGNA 5G40A 3DKVA 1KK3A 4JYBA 4QHTA 4A0FA 5AUOB 3U60B 1UBFA 1W2GA 2DWQA 4MRRA 1E2LA 2ZRKA 1H65A 3IIMA 2OCYC 2X8AA 2Z6VA 1U0LA 3NHAA 4DWJA 2ZXUA 4YDHB 2DPXA 4FN5A 2ZU0C 1E99A 5AWFC 721PA 4FMCF 3FKSA 4TMTA 2WWFA 3VU9A 1IHUA 5DHFA 2Q6TA 5CK4A 5SZKB 3N2IA 2LKCA 1Z3IX 2WPDA 2WWHA 1QHGA 5BQ5A 3TBKA 1DO0A 3EX7C 3EZ9A 4D26A 3FHCB 4L15A 5FL7A 5LDDC 1E3MA 4L8GA 2V8OA 3WMEA 1ZNWA 1DPFA 2ZE5A 1OXSC 4LK2A 4XTRA 1G6OA 2R44A 4XOIA 4BFYA 3QVVA 2QGZA 2BCJQ 1KI6B 2CL0X 3KXLA 1NSFA 1PLKA 4V03A 4B76A 3LBHA 3RVBA 4B74A 5CLQA 1JAHA 3BC1A 3BWDD 1Q1EA 3S1AB 2BC9A 3BAFA 4C4PA 3QI2A 4M0LA 1KMHB 1MABB 2DY1A 1W5TA 3NEYA 5L3VA 4HB4A 1OW3B 3LV8A 3LXRA 4L4UA 4TT3D 4UNQA 3TW8B 3ZIAD 3VKHA 1N5JA 2NO1A 2OSBA 2CDNA 2GHIA 3LX8A 2UVQA 2NPFA 2OV2A 2WJJA 1KSGA 3U3RA 4TYWA 3U7FB 4HDOB 1KY3A 3LD9A 3AQ4A 4KSCA 1T8UA 2W2TA 4OI2A 2IUSA 4UQOA 1S3SA 3GLGB 1TAGA 1ZIOA 4XVQA 3K70C 3R9IA 2OCBA 2O0HA 3SHFA 3GEEA 1YE8A 2HT6A 1XNJA 5KU1A 5FPHA 4PZLA 2IK8A 1FOEB 1TUIA 1KKLA 2NMVA 2J1LA 3HWSA 5FL7D 1W4CA 5BN4A 5B64A 3THWB 2N42A 1KMQA 4M1YA 1ZUNB 2C99A 1SXJB 2IA5A 4OL0A 1ZVQA 3KQUA 2AWNA 4NTZA 4MRVA 1RVDA 2QPTA 3N2EA 4OQLA 4CEIA 4BFWA 1ZMXA 3VU9B 3CR7A 5TB5A 2VL7A 3W6NA 4JKIA 2HYDA 3LY5A 1XBTA 2X77A 1KKMA 3TNFA 1ETUA 2DWOA 1VECA 2F6RA 4JVNA 4URZR 2ASEA 2J3EA 4DEXA 5KNDA 4GZLA 2ODEA 1U98A 2PZFA 3CO5A 3EA0A 4RD2A 4JSTA 3L82B 1OJLA 4K8OA 4CIDA 5CITA 4BZQA 2OHFA 2P0EA 4RD6A 4HZUB 4RZ3A 5EP2A 5BN3A 1FX0B 3MWLA 4HUTA 3C7KA 5BYJA 1E2NA 2PBRA 1JQJC 4WZAE 1WMSA 2XZLA 2R6AA 3I92A 3F5FA 3FGNA 3VKWA 1KI6A 2GJ8A 4QJ3A 3GLFE 5FOSA 4LJYA 3MD0A 4BFUA 1SKYE 4BFZA 3GLFB 3FWYA 1BMFD 4PO9A 4MGIR 5CDFA 2P5TB 3CH4B 4LBYA 4FD2A 2OLKA 1R2QA 2QAJA 5G3ZA 1FUUA 4FCTA 1MR3F 2I4IA 3P4YA 4N0DA 3B5JA 4M1WA 5CYPA 3RS0A 4GP7A 4LJAA 1NF3A 3WYAA 1GL7A 1UJ2A 3SFVA 2H17A 3WRXC 4C3ZA 4YXWA 1Z0FA 3NHBA 4QBIA 4LV6A 3X1XA 3KFXA 5JJIA 3CNNA 3K53A 4Y0VA 4QRHA 1W5SA 2ZJ8A 5FR1A 4Z54A 4XSGA 2ANCA 1S3GA 2RGEA 1OE0A 2ZJYA 3KX2A 1OSNA 3CRW1 2B8TA 2AHOA 2PJRA 1CIPA 5AJXA 1OKKD 3SYKA 2HCJB 3PEVA 4B2PA 2MSEB 4AWXA 1DTSA 1CU1A 4MUAA 5EP4A 2VA8A 2ZRHA 1HA3A 1WRBA 4Q4JA 3K8YA 4URYR 3IHLA 2R8RA 2XTMA 2IXEA 3T1VA 1UBEA 3K70B 4TSFA 5G53C 2PEYA 4ZCIA 2A5DA 2GCPA 2O0JA 3B85A 3BFXA 1XTKA 3GJ7A 1GILA 2FNAA 3TAUA 1OT3A 3OEHD 1N6PA 2DWPA 1KJYA 5IDVA 1F2UA 1Q1QA 4JL5A 2O52A 3TSOA 4OJQA 2R6FA 3C41J 1OFUX 1P9NA 4WZBE 3SDZA 4NCNA 3ZGXA 1E4VA 1T0HB 1Z6XA 2GZHA 1NIPA 2HEIA 2FU5C 2QZ4A 1JEDA 2ZJBA 5F2EA 3OEED 1OXUA 4O2RA 2V7QA 2QTVB 1EGAA 1TPZA 4P0TA 2VP6A 4R2HA 5J5CA 4CW7A 3EWSA 1VG1A 2BBTA 2DB3A 1UKZA 3QBVA 5EZ6B 4URVR 2JJ8A 5HZKA 4MYUA 5FPSA 4A2PA 2IYWA 5AJZA 3T35A 4KFSA 3CW2A 5CJ2A 2O5VA 2I1QA 2G77B 4QFMA 3H86A 3VR6A 5JLJA 3HYTA 2FSIA 4HDQB 5EXTA 5GVRA 3GCGA 2J0UA 2XITA 2ZS8A 3L0PA 1R5NA 3THYB 1IXSB 4OI1A 2QMEA 1OPXA 3PUYA 5J40A 4JBYA 2IW3A 1IN4A 4MDFA 4DIEA 4UXHA 5JI2E 1NJGA 4WBSA 3ADBA 1S1CA 1DARA 2AL7A 4UXIA 3BB1A 2W0MA 4GMXA 4JJZA 2WWXA 4U00A 3NC0C 3AP3A 1NJFA 2WIAA 3CNOA 1R5BA 2J7KA 1L4UA 2FGKA 2WAXA 4B71A 1Z22A 1CJUC 2I1VB 3TE6A 3KQLA 2NPIA 2C8VA 3KJEA 1E9AA 1R8QA 4EPYA 3SQXA 2IF2A 3NBXX 2DCUA 1WCV1 3RS2A 4BEBA 4XD7A 2IXFA 1YR7A 2ZUBA 4QJ4A 4OHVA 1COWA 3W9YA 2RHMA 5AK0A 2ZJOA 2WSSD 4UKDA 3AVQA 5TVKA 2GILA 1MKYA 3IBGA 4TN1A 1A2KC 4XD7D 3W90A 3OIVA 4MKGA 3CWZA 2W6JD 1Q12A 3QKTA 4P31A 3EPHA 3QKRB 4QBHA 1JBKA 1OH8A 4YC7A 1E98A 3FFBA 1TEVA 2R65A 4AIIA 2ZSEA 1Q3HA 2CHGA 3R9XA 2WAYA 4Q5IA 4Q18A 2REXB 2YWFA 4OJKA 5JSZA 2QBYA 1TTTA 2PL3A 4LWZA 4KLNA 1U8AA 1TQ4A 1WP9A 1QVAA 4Q1BA 2L0XA 3KQKA 5FTKA 3DHWC 5KPJA 4PAQA 4GNKA 2YC4C 2PMDA 4Z1MA 3O8BA 4CEIB 1J7KA 3JVUA 3OIYA 4FMDB 2RCNA 2WSMA 4CVNA 4QXAA 5DI3A 1N6RA 1U0HC 2FH5B 2GJAA 1IN7A 1M7HA 1G6HA 2P67A 4DCTA 1MRSA 4DEYA 2OXCA 4HLQB 2CCJA 1AZSC 2WIBA 1PJRA 1G291 2NZ8A 4E5UA 1KJZA 3WYGA 3H84A 2J0UB 3LO5A 3SI7A 2CK3A 3CPEA 3BS4A 5FPYA 4Q9IA 3ZS8A 3BBPA 2XXAB 2QPAA 1G5TA 1MO5A 2WV9A 4A1FA 3LDAA 2GCNA 4NP6A 1YR6A 3LX5A 1GSIA 2IYUA 1KHTA 4GRAA 2JLSA 2ZS9A 4WOPA 4NBSA 1Z08A 1Z47A 3KJGA 3BE4A 1JQLB 5IF9A 5AR1A 2PEZA 3IIJA 4B6FA 521PA 1E96A 2VBCA 4W5WA 2QM7A 4PANA 1W4AA 1UADA 4B34A 2QUZA 3QIAA 2BBOA 3QENA 1A2BA 1UPTA 1HE8B 1GZSA 4IDOA 1UBCA 4UJ3A 2OUKA 1J70A 4WXRA 4M1TA 3U7EB 4I81A 3K70D 2F43B 2OT3B 2VLIA 3UWOA 1W2HA 2ZRGA 4J0QA 3CKLA 2XZOA 3F8TA 2G88A 4KCGA 3FMFA 1YU9A 4A82A 4B3GA 2QTFA 3GJ6A 1FP7A 5EJEA 3IUYA 1LVGA 1XTJA 5EE9A 4C2UA 4Q1AA 1FL9A 1XX6A 1NY5A 2QQEA 1RE0A 5HR5A 2F1HA 1R4AA 1JR3A 1KSHA 4QNMA 4Q4HB 5IK2A 2D7DA 2DYKA 3ZZUA 1TQ2A 1VHLA 4I1VA 2B21A 3KJIA 2QRNA 3KB2A 4HB0A 2ZANA 2WWGA 3BH0A 2BVNA 4HZIA 4JLDA 1A5TA 1CLUA 1M1YE 4C0LA 2ZUDA 3FFAA 4TLDA 3ZYCA 5JZVA 2BKEA 2AFHE 4RVCA 3N70A 2J0VA 1LS1A 2EFDB 1Y63A 3AF2A 4IOJA 1E0SA 1L4YA 4Q4AB 4TWZA 1JNYA 3B82A 4F7WA 5AUNB 1UDXA 4AC9A 5JEDA 4MKFA 1G64A 1S1MA 2A7QA 4ZI2A 1NKSA 3CB4A 1QHSA 4OK6A 4R7ZA 1ESNA 1ZJ6A 5AUQA 2AN9A 1NVUQ 2JCSA 1RC8A 2QBYB 2V54A 2N1BA 2NO9A 2D3WA 4XSHA 4Q21A 1S9DA 4YMSA 3U44B 1I4TD 1TQ6A 4DZZA 1YHNA 4K81B 1ZBDA 1J99A 4A0GA 1Z6YA 3QPVA 1E9RA 1G16A 1UKEA 4LZZA 2HYIC 4D6PA 3IIKA 3RS4A 4OI0A 3OFNA 4KYUA 1IQPA 3D3QA 4TYPA 4A8JC 4NHOA 4HUQA 1CRQA 1WQ1R 2HUPA 5GJCA 5J4KA 4DIDA 3TUZC 1NNEA 3W6PA 3I73A 4DCVA 1NVXQ 5JCZA 2F9MA 1X1RA 2RHDA 3AF0A 3DMNA 1G3RA 2WWWA 3L8ZA 4IHQA 4CEHA 3EZ6A 2EWWA 1NI3A 2BJVA 5C46F 5HKKD 2BMDA 3H0KA 4MKIA 5KUTA 1YQTA 1M2OB 4FMDF 1VYUA 4DLXA 3CONA 3AF1A 2UKDA 3FPAA 4ZIRA 4EQ6A 3ASZA 5AJYA 4I99A 2XJ4A 4MA4A 5JFGA 1NLZA 5H8WA 1W49A 4C0HA 2XB2A 1U81A 2ZIAA 1XF9A 4QBGB 1KAOA 1QDEA 2CBZA 5CJPA 5DH9A 5CDFE 4LBWA 4OYHA 4B3XA 1G3QA 3QE0A 5JJKA 1PVOA 1SULA 3MUFA 1K5GA 2B8WA 4RZUA 2ZE6A 2IUTA 2FDCA 2JAQA 4BLTA 3K9NA 3F3YA 4LGMA 3RHFA 3AGPA 2GNOA 1XZQA 4JBXA 5FOUA 1P2VA 1JPNA 5DI9A 2BM1A 3PFIA 1JR3D 4LBZA 3ECCA 1R6BX 1ELOA 2FX3A 4C7OA 3FHTA 4V0OA 2C78A 1CEEA 4NL4H 1F60A 1XD9A 3L0IB 1IXRC 3ICEA 1HUQA 1M6NA 2CLDX 4PSAA 5EUQB 3V00A 3WNDA 4M1OA 1G3IA 2RGXA 2RGCA 3EIEA 3X1YA 2F1IA 3VR1A 2V4ZA 1BH2A 4CZ2A 1SZPA 2G9NA 2AKYA 2QMHA 3UK6A 2C5LA 2GXAA 1ZM7A 2PX3A 3IILA 1EWRA 4B3DA 4LI0A 5IT5A 2V1XA 4O3MA 4HAXA 4W7SA 2XXAA 1N3BA 3NDPA 4WAUA 1MH1A 1VTKA 2JJ2D 3PIRA 4RFVA 1W46A 1E79A 2YWGA 3CF0A 3W34A 4DSUA 2JDID 3EAQA 3FMOB 1G20E 1P6XA 1EX7A 1Z83A 3QUSA 2HXYA 1VG9B 3K0AB 5C2JB 2OBLA 5HE9A 4H9GA 4DT1B 3AEZA 4X8LA 4GT1A 2QROA 3E70C 3X1ZA 1NBME 3RLFA 3NIBA 3R8CA 3LFUA 3MJHA 4KHZA 4YMUA 3SN6A 1HT1E 5CM9C 2XOKD 4DT1A 1CXZA 1ZINA 1TUEA 1Q57A 1OKKA 1NSTA 4R9UC 1I4DD 1KI9A 3WNCA 3RS7A 5DISB 3A4MA 2CE7A 4AYTA 5DSZA 1ANKA 1E79D 1T5LA 2XTZA 2VF8A 4PC1A 3TVTA 2YOFA 1NL3A 4B47A 3AVVA 2IYZA 4TQAA 3B9PA 2WWIA 1E2FA 3OIWA 3QF4A 1G17A 2IXGA 3LQRA 4BZPA 2H16A 5D3QA 1XEFA 4CT4B 3Q7QA 1BIFA 1DBSA 4IVPA 1YZLA 1Q20A 4Q9HA 3TSZA 1BS1A 1DAEA 2RGNA 2GF9A 2GJKA 5F9FA 1DAFA 3A4NA 3AM1A 4GBMA 4UNRA 1ZM9A 1KTVA 4ILEA 1E1QD 2YC2C 2YYZA 1AQUA 1E2GA 1FNMA 2HF9A 1WF3A 2YNMA 3IPYA 4TLAA 3CX7A 3V9PA 1XEWX 2XNSA 2Z83A 3ZIAA 4D4KA 4MDEA 2VTKA 4L9WA 1SXJA 1CJKC 2VH5R 2FFHA 4EJSA 2IS1A 3EC2A 2HF8A 2NO6A 2H18A 1MO3A 1DG3A 1XMVA 4WIAA 1G4UR 4XWKA 2O0KA 1JAIA 3P20A 1NMZA 5GJBA 1Z2AA 2XZPA 3WP1B 1QHXA 1WBDA 2ZE8A 4JT4A 4LJ6A 5M04A 4JLOA 1PZNA 3RRYA 3KKMA 3VR5A 4X8HA 2D2EA 1J8YF 3M4YA 4TYQA 1I4LD 1ZRHA 3GJ8A 3UMFA 2GEUA 1FPMA 4RKEA 2FFBA 2WWYA 2GVDC 1XXHB 2ZRCA 1QHHB 4YMTA 1N6KA 2ZRBA 5JS7A 4TLCA 1P75A 3CRMA 2QE7D 1T0JB 1GKIA 4B48A 4QM7A 4CYMA 2LWIA 4MKHA 2AKAB 4RFSA 2ATVA 4NU0A 5H68A 4D81A 1LNZA 5CK5A 1LFDB 1N6IA 1XU4A 3CLVA 4C0QC 4DSNA 1PLLA 2G6BA 1GFIA 2VPPA 2QAGA 2WICA 1HY3A 5EE1A 4CDGA 5TMPA 5DN6D 2ZR9A 1KI2A 3LBNA 4MGYR 3QKSA 4IFBA 4RFSB 1RW4A 1WDTA 1ZD9A 1YJ5A 3EA5A 5DO9A 3QF7A 1P62B 3WHLA 4EJSC 4AG6A 3LNCA 4IOLA 3ZQJA 4KSBA 2RAPA 3U7HB 3RANA 3VX3A 4M8NE 2IWRA 4WXPA 1P73A 2J7PA 1XMJA 5K8IA 4AK9A 4EDHA 3BB4A 4MH0R 4GPTA 4KU4A 2Q9BA 2FZLA 2DHRA 2OILA 3IPXA 4DSOA 4MRNA 4BWYA 2ZRMA 2GZDA 3NVAA 1W4BA 3A58B 2IYLD 4TYNA 2JLXA 1OB2A 3GJ4A 5L3QB 3OFND 1KI7A 3AF3A 5FFMA 3UIEA 4BLSA 4B33A 1IBRA 3DEFA 3UXMA 3K09C 3W3AA 4PPGA 2Q9CA 421PA 5B58C 3W6OA 4V0LA 1UKYA 3U3KA 1PUJA 4TLBA 4AYWA 2EW1A 3LWNA 1P3JA 2Y8EA 5KYKA 3K9HA 3Q8XB 1CR2A 4BRUA 3AVUA 1TL7C 4ZI3A 3O8CA 1VCMA 3CH5A 3HPQA 1R0WA 3KKNA 4LCBA 2G1JA 4IXNA 5TV2A 1Q0UA 4F91B 2HT1A 1P2TA 3LQQA 2OEPA 1W0JD 4BFSA 1XZPA 3IKJA 2JLYA 1OFHA 4MGKR 3F0TA 5FI1B 1FP6A 3LLMA 2REOA 2A78A 2ZJ2A 4D2IA 2WZQA 4L5BA 1T5IA 2QQ0A 1OH5A 3WHKA 3C8UA 1GG2A 3FE2A 5KSPA 1KK0A 3O8RA 2JLVA 1XD8A 3P26A 2FSGA 1HURA 1Q1BA 1R0XA 3MWJA 3OE7D 3TW4A 5A0FA 3SBDA 2J46A 2QMOA 4PR0A 2WOOA 3QBTA 4LYHA 3UATA 1G7TA 4ZIRB 1UM8A 4OBEA 3V4RA 2J59A 3LAWA 3BORA 1AS3A 2CLCX 2ECKA 4A6PA 4KBFA 1SHKA 2Z4SA 1C4OA 2QAGB 5JJLA 1SKQA 4D82A 1NBMA 1QHYA 2BMEA 2ZRLA 4D4JA 2V3CC 1G7CA 1QVRA 3ZDQA 3AV0B 4JSYA 3O8DA 5KNCA 1OFTA 3A37A 1LY1A 1MABA 2VHQA 3X2SA 1ODFA 2NO7A 3ZZTA 3L0OA 3K0AA 1QG2A 2AFIE 4BASA 1Z63A 3TVDA 3GJXC 4HAZA 3OAAD 5LPNA 5L3RA 1E2JA 3B1XA 4TMKA 1ZCAA 3P32A 2EFEB 2BOVA 4HLDA 3TLXA 1MO6A 1OXXK 4A2QA 2GKSA 1YR9A 3THXB 4PX9A 2B92A 2ZETA 4GL2A 1U8ZA 2ZRJA 1CP2A 2JJ2A 1D2EA 1Z0DA 1D8TA 1FX0A 4DDTA 1P4SA 4PSKA 1AA9A 2NG1A 4JS0A 4AG5A 1DOAA 1X8LA 2O8CB 1EFRD 2ZQ5A 5DI3B 4OK5A 2F1JA 1DADA 2FG5A 4HEJA 1KDTA 2ZRDA 3ZD7A 4F4CA 2OESA 2IBMA 4C0JA 4YMWA 3HJNA 1AGRA 4EUNA 2ZRFA 3B6EA 4QGAA 1G5PA 4ZDIA 3LW7A 3EZFA 1V5WA 2GK6A 3AH8A 3T1QA 1S9HA 2FN4A 1K6MA 3EG5A 4EFNA 4Q4LA 1KK2A 3GLHA 3ZVLA 1NMXA 1ZM4A 3CBQA 1GRNA 1HQYE 1M7BA 2CK3D 3CR8A 2YOGA 3IQXA 2F7SA 4HAYA 5L8VA 3RDPA 4BGDA 1KO4A 2KSQA 2GBLA 5TXGA 4X8OA 5FBLB 4IEEA 5CIQA 1RRCA 3D7MA 4BLRA 2ANBA 3VMFA 4B75A 3QSYA 1CF4A 4G3XA 4A15A 2CCGA 4Z8YA 1F3OA 1T8TA 3QY0A 1S96A 1FTSA 2G83A 1FQKA 4D25A 4QHSA 2VSOA 2GK7A 2OAQ1 1EFTA 4IJMA 1XTRA 2F1RA 4M2LA 2D4HA 4ZCLA 4OK3A 3MMPA 2ZRNA 1W44A 3R8FA 2CLSA 3AVWA 1OIVA 2IYYA 1E1QA 3TSWA 1JPJA 621PA 5JHGB 4PQYA 5KDOA 2XJ9A 3VNUA 2VP5A 1G8YA 5K8UA 1FQJA 1GITA 3B8HA 5KTYA 3BXZA 3RS3A 4KO8A 4B3CA 4BECA 1VCNA 3VX4A 1GL9B 4MYCA 4ASUA 1EESA 4PHHA 4KXFB 4KVGA 3QVUA 2J7PD 4V0ME 2CNWA 3LXXA 4A9AA 3Q85A 1KDRA 3VHXA 2ZI4A 4Q01A 2GDJA 4DCNA 1GNPA 4GI7A 121PA 1E2KA 4HSEA 3SJAA 2CVFA 1I2DA 1XEXB 2G0NA 4LV8B 2PJZA 3FHOA 3Q5EA 4JIMA 3SBEA 2VSFA 1NKTA 3EIQA 1K8RA 4BPBA 1Z06A 2WMOB 3TK1A 1G7RA 2JLWA 4TZ6A 1AKEA 1PV4A 1JALA 3K0FB 2X2EA 3AGQA 3PEUA 4LHYA 1BMFA 3JVVA 5TDHA 1G3UA 4IVQA 4DJTA 4LUCA 4G0NA 4B35A 2FEMA 2ZPTX 4BLOA 3B9QA 4FWTA 5C4GB 4NYIR 5JWHA 1NG1A 4JLKA 4Q1DA 2EVWX 4JLJA 2A5JA 3I4LA 2AK2A 1XP8A 4I1OA 5EP3A 3TQFA 4X8MA 2QSZA 4C30A 1RFLA 2QT1A 3Q72A 4C0SA 2DFTA 3GLGE 1L8QA 2BIFA 1SVIA 1NVWQ 1E94E 2EQBA 2Q3HA 2AXNA 4DDUA 1BYUA 1QG4A 1EFUA 2D06A 2Z0MA 4A2WA 3ZD6A 4B43A 2DFKB 4PC7A 1DELA 1Z0KA 3MSXA 1F2TA 5E4FA 5JRZA 2F9LA 2JGNA 4I4LA 2BKUA 4QNRA 1MT0A 4TMWA 2KBEA 3HU3A 2ZI6A 1EWQA 3OF5A 2PH1A 3A1VA 3Q3JB 4IXMA 3A6PC 2J9RA 4UNPA 3E5HA 4Q1FA 3C5HA 1CRPA 3CF6R 4AKHA 1E2HA 3T61A 2V6IA 3HU1A 4EQ6B 4OQNA 1E4YA 2HDNB 1N6NA 1XTQA 4NH0A 1S4QA 1AIPA 2IYQA 1IAQA 3E1SA 4NYJR 4RD3A 3CM0A 2ZRPA 4D0LB 1XRJA 1NVVR 4PC2A 1KK1A 3L2OB 4PHTA 2W00A 2HLDD 2W0SA 4PQRA 2R9VA 2AD5A 5JHHB 4HDCA 5JBQA 1YVDA 2ZVQX 2OE2A 4M9QA 1MV5A 1XTIA 1KIMA 3JZMA 2XNDA 4PPFA 2FEOA 2JIZD 2H92A 1T4GA 2ZS7A 5D3MB 3QEJA 2YJTD 2FGJA 3ND9A 3DZ8A 3RNLA 4TLEA 1F2TB 4P3YA 3RWOA 1A1VA 3NDBB 4JLMA 3WRYC 3G82C 4QKQA 4E09A 1CS4C 3AKCA 1WE2A 4Q1EA 4ZO4A 5E3HA 4DBLC 3EW9A 5FOXA 2WJYA 4ZV4A 4NZYA 4YXWD 1LF5A 1KI1A 3SZRA 1VPLA 1AK2A 1EFCA 6Q21A 1ZAKA 1N5KA 5FUWA 1AJEA 4AI6A 5EXXA 2V1UA 4F92B 1E32A 4JLBA 2ERYA 1LF0A 1KI3A 1YRAA 3N5CA 4NYMR 1U0JA 2AWOA 4HB3A 4NCKA 1OLOA 4NONA 3ND8A 4MYTA 4M9ZA 2QNRA 1HV8A 3I5XA 3HU2A 4LDJA 2FPLA 2B7CA 2BBSA 1HE1C 2A5GA 4Q7MB 3QPWA 5HTKA 3NBFA 5SZIA 1OIXA 1GRQA 1CKEA 2WPDD 3LBIA 2YV5A 2W6JA 1FZQA 1G9XA 2WKRA 2ZVPX 5LB4A 1NMYA 4JT2A 4BLPA 3GQBA 3ZH9B 1OH7A 3SYNA 4TTRA 3FB4A 2OO7A 1CULC 1GNQA 1ZM3A 1A82A 3GLFA 4V02A 1XTSA 4C0BA 4G5SA 4QGFA 4RD0A 3I3SR 4NE2A 4GP6A 4MITA 1ZC4A 2WKPA 2YWHA 2ZSBA 1YRBA 1Z29A 4ZDWA 2BEKA 1S2MA 2GWHA 2R2AA 2C9YA 3IEVA 4US2R 3U44A 1CBUA 1E9SA 1BYIA 1T6NA 2EFGA 1TQDA 4Q03A 4Y0AA 1W36B 3ICQB 4HATA 1RYHA 3CWQA 3GJ0A 3K09A 4NCJA 3BD9A 1N2CE 1IN6A 1TF5A 2RKOA 3IHWA 4OKSA 1L7VC 3HDTA 2OBMA 2GBLC 4LV5B 2IHYA 3KZ1E 4K46A 1SXJD 3QG1A 2FF7A 4IVRA 2GJSA 5TY0A 1E2MA 5FUXA 1LS6A 1YZUA 4BQSA 4RKFA 3B1ZA 5FR2A 1OFIA 1JECA 2GXQA 1F5NA 5JSZB 3DVLA 4M22A 4NKRA 2ZAOA 1YKSA 2H7VA 2Z4RA 3EASA 4F4JA 4L16A 4A8JB 1KO7A 2ZI3A 4TZ0A 1II8A 4KYIB 4Z8XA 4M9XA 2WTUA 1KYIA 2RH5A 3OEEA 3U3JA 1CJTC 5EZ5A 4ACAA 3TAHA 3B60A 1E2PA 2G0TA 4FMCB 2GAAA 5KDLA 2GEDA 1GP2A 1KI4A 1DAKA 1XPUA 3NBYC 3ZVMA 2CNWD 4XWAA 1YZNA 1UF9A 2BJWA 2IC5A 4FCWA 2VSXA 3SS8A 5K8LA 3ETLA 3BIFA 3AP2A 4KAXA 5E7MA 2Q0HA 5H1YA 1DG1G 4TT3A 3NXSA 2ONKA 1XXHE 2LKDA 4F93B 3UG6A 3GEIA 2GXUA 1N5LA 3B7GA 3UANA 5KSOA 3J81k 5LD2B 5A5GA 3EPKA 4ZCMA 1P7CA 2RGNC 2FJUA 5SZJA 5DYIA 3MFYA 1N0UA 4DLRA 4MRPA 3U61B 4E03A 1KZGB 1YZGA 3BFVA 2OBNA 1RRFA 2AR7A 2GETA 1VMAA 3UPUA 2QU8A 2R6CA 3W5IA 2GA8A 4I1SA 4B3BA 4E07A 4PO1A 2ZYVX 4V0NA 3MCAA 3SFZA 1ZP6A 1T91A 3VKGA 1U2RA 1NBMD 2VP2A 1E0KA 4TL6A 5EP1A 2C9OA 4OQXA 1G8GA 3WBKA 1B0UA 2E9SA 3KTAB 5FOVA 1EK0A 4ESVA 2RGAA 1G1MA 4ZKDA 3BFKA 4Q7KA 4D80A 4HAVA 2O8BB 2QEQA 4EKDA 4NDZA 821PA 4QGHA 4BFTA 1F2UB 3MGCA 3U3OA 4KFUA 5KSYA 4PAOA 4ZDJA 5FBVB 1BKDR 2YKGA 1A4RA 1OYWA 3KDSE 3AKEA 4R98A 4UJ5A 1TF7A 3K1JA 3WMFA 1KSFX 2H5EA 2OFXA 3MAAC 3REFA 4DVGA 1E2IA 1EFHA 4C0KA 2JIZA 4DRZA 4PO8A 4ERNA 3LW8A 1X8KA 4MGZR 4OI4A 3SR0A 2C95A 5FTLA 4S2EA 4O0MA 4Q7LA 3NWJA 2J45A 4A92A 4ZPXA 1CR0A 2VRWA 5JMTA 2WM9B 2WMNB 4DC9A 3AVOA 3GEHA 2QT0A 1JR3E 2XX3A 4N3NA 4CF7A 1GKUB 4IOMA 5F9HA 5F98A 1RIFA 2R6DA 2XNDD 1O3YA 2I3BA 2ZR7A 5GJWC 1XB2A 4GMDA 2ZUCA 2ZYWX 2ODBA 5UKDA 4MQBA 3SE0A 4OHZA 1KAGA 1R5OA 1VDZA 3DPUA 2NQ2C 1WA5A 3U3MA 2MMCA 4QGGA 5DHAA 1GAJA 3SEAA 3SJBA 1M8PA 4Q4AA 2IUUA 5KNBA 4DLTA 2QMUA 3K0CA 4BLQA 3E2IA 1W36C 1QHHA 5DYGA 3I72A 3ADCA 4JJKA 1UBGA 2HXSA 3AVTA 1LTQA 1HEIA 1Q44A 4FXPA 4Q02A 2MMGA 2ZREA 5DIFA 1JI0A 1IN8A 2C98A 5FOTA 5G3YA 4Q7JB 3RC3A 3V4FA 3BH7A 5DN6A 1RJ9B 4G5GA 2ZM5A 1P2UA 4BFXA 2WJIA 2ZJZA 1SGWA 2PLFA 4P4SA 1EG7A 2NOAA 1IY1A 1E9CA 4EIWA 4WW0A 1E9BA 5LB2A 5IK2D 1XPRA 2GCOB 4CEJA 1QHIA 1FFHA 2GXSA 1JXOA 3PG5A 4TYYA 3TR5A 5C4MA 3PR1A 2F43A 3H4MA 3PUXA 2P2LA 4A6XA 2ZU6A 2RMKA 5ELXA 5B30A 4B3FX 3DL0A 5FTJA 4URUR 4DLUA 3QXCA 2VO1A 3CX6A 4NYIQ 1GRRA 1S8FA 2NTYC 4U5XA 1H8ED 1ZD8A 4PXAA 3GPLA 1FMLA 2FFQA 3FVQA 4O2LA 2QN6A 3GJ3A 4LPKA 2GJ9A 4POAA 2ZRIA 3Q9LA 2PLRA 1CTQA 5EXSA 4G5QA 1Q22A 2CE2X 1COWD 2X19A 4A36A 3ONWA 3HP1A 3BK7A 1A7JA 2BCGY 3LA6A 2C03A 5KSZA 1MOZA 1HH4A 3IEUA 3QOFA 2ZI5A 3CRVA 2PT5A 1IY2A 4FMBB 4TMZA 1GM5A 4HLUA 3CRRA 4DDVA 4P32A 4TL7A 3CUEF 5JWOA 2D74A 3A1TA 4DLZA 3FYHA 5B2ZA 3IDQA 5EE3A 2XB4A 3AKDA 4URWR 1U8YA 2H1LA 4YQFA 3RWMB 2VP9A 2OAP1 2CCKA 4PFSA 2IL1A 1QZXA 1IN5A 1PUIA 3AUYA 4JL6A 2QM8A 3LVQE 3QKUA 3RSLA 3H1TA 4KJZA 1GKYA 3A1SA 4NYJQ 5HPYB 1WB9A 3B13B 3EC1A 1SQ5A 3T12A 1T3SA 2ZSFA 4YDSA 1E6CA 2OFOA 3WY9A 2E87A 2QP4A 1NN5A 4H1UA 3CZQA 2GRJA 3I62A 3A4LA 3TKLA 2GZAA 5HE8A 3QKRA 3P1JA 4PAMA 3GLIA 3PQCA 3QG5A 3W5JA 2PZGA 4M4SA 1RJ9A 3TQCA 1KI8A 2JEOA 3OEHA 4DHEA 1TX4B 2W6IA 4GFDA 2CJWA 1OV4A 3TUJC 1YR8A 3DOFA 4GOKA 3DO6A 3CF2A 2ZI9A 3KUCA 4G01B 2RGDA 4HLCA 4DDWA 1FW6A 4D0GA 1DO2A 3GLHE 1XJQA 5FH9A 3HR8A 3GLHB 2Q3FA 4ON9A 1ZIPA 2ZYUX 1RZ3A 4D4LA 5BN5A 1OHHD 3PEYA 1DS6A 4OHYA 2BMFA 1W7AA 1P61B 3TJZA 4TTQA 5J47A 2D7CA 3PEWA 4PPQA 2IYRA 5JRJA 3LLUA 1T9HA 2O8DA 2B6HA 5DGXA 1AS2A 3ADKA 1GTVA 3VHLB 2BV3A 3IO5A 3R7WB 4PTLA 2R62A 4F4IA 1D9XA 2CXXA 1M34E 3L0SA 3VTKA 2GCOA 3FMPB 2DFLA 2TMKA 4NMMA 5FBQB 4CEJB 1HTWA 2WJGA 2ZROA 3KKPA 1JB1A 3KB1A 4EPVA 2PT7A 2QP9X 4LC1A 2CJWB 3MG9A 1P2SA 1NN3A 4B6EA 2ODWA 4DKXA 3EPJA 3A1UA 1AZTA 5B57C 2UZIR 3GLIE 3TR0A 4RCYA 3VR2A 1ZNYA 1ESMA 3GLIB 4JL8A 1T3LA 2QTHA 4Q4JB 2SHKA 3RABA 1IY0A 3T5GA 4GZMA 4BEJA 2WJHA 3X1DA 2QAGC 4TL9A 1KOFA 2NGRA 4BUJA 3A1WA 2C9CA 3JZAA 3OE7A 2J0SA 3VFDA 2DR3A 1JJ7A 5EXPA 2KB0A 8OHMA 4DB4A 1VCIA 3CNLA 1E0JA 1NIJA 3AB3A 1US8A 3I8XA 1XCGB 1TF2A 1AS0A 4LJ4A 3GD7A 1ZNZA 2FPMA 3C4JA 3B78A 1N25A 2IS6A 4KODA 1R0ZA 1Z0AA 2CVHA 4DSTA 3B1WA 2P5SA 1AM4D 1OF1A 1ZD1A 2V7QD 4IDPA 4RCZA 4PZZA 5IHPA 3AF4A 1W1WA 2FZ4A 4WA7A 4E22A 4B44A 3TMKA 3UWKA 1I2MA 4IEIA 5E7IA 3WXMA 3R20A 4DCSA 5G41A 4B2LA 5JI3E 5FOWA 2G1KA 4LHVA 4M9SA 2G3YA 1CR4A 2FV8A 3EIHA 4Q47A 3D8BA 4LBVA 3Q5DA 3BJIC 4IRUB 2H8KA 4LHZA 2IS4A 5FTNA 3G0HA 2FOLA 2YOHA 1N6LA 3EXAA 3PUZA 4QG7A 1KY2A 2BWJA 2RGBA 1EX6A 5L3SB 2ORWA 1ZM2A 1OB5A 2XSZA 4AKIA 4NCHA 5EUMA 3FOZA 1MO4A 4U7DA 1D2MA 2KJQA 4P4UA 3TIFA 4R71A 1U94A 3M1IA 4FW9A 1LB1B 2ZYTX 1P9RA 1RRGA 2A5YB 1Z28A 2E1RA 2AXPA 2V6JA 4AKGA 4QL3A 2C77A 1SVLA 1KDPA 2CEAA 2ZEJA 1JEEA 1J8MF 2PMKA 1X1SA 3NEJA 4QOSA 3T34A 4DLSA 2GAOA 3GP8A 1UEJA 2P6RA 1SVMA 4MYHA 3GJ5A 3NBZC 1BO6A 2QE7A 3AVYA 1UAAA 2ERXA 1G3MA 2WSSA 4CRWB 4LHXA 2W2VA 4PC6A 1P72A 5FBRB 3FTQA 3TRFA 3WMGA 4DUGD 1FNNA 1FUKA 2YINC 4EPRA 2GVZC 3K9LA 5JCPA 3OESA 2JLZA 1G8PA 5FTMA 5GADl 4U02A 3GFTA 1U99A 3DM9B 3PENA 3RYTC 4CT5A 5KPDA 5D3MA 4W5JA 2IEZA 2ORVA 3DZDA 3GFPA 2ONJA 3SU8A 2JATA 1S0UA 1P5ZB 4B73A 3FKQA 3SYLA 1WXQA 3TUIC 1NLFA 4QM6A 2KE5A 2BM0A 1DVRA 2VP0A 5TARA 1BOFA 1C9KA 4V0KA 4XWOA 4URXR 1JXMA 1PLJA 4OQFA 1F48A 2CMKA 3EARA 3O47A 4A0RA 2O8EA 1ZUHA 2OLJA 5E95A 2VEDA 4DLWA 1JJVA 1NN1A 4XVRA 1NRJB 2IX3A 1GDDA 1OIWA 4HAWA 2OCAA 4JZKA 4KLZA 2VF7A 4LX0A 3RRZA 1KO1A 1US8B 2IYTA 1RRPA 1P9WA 1KMHA 1OXVA 3C14C 3T1TA 3RRNA 4Q9JA 2NIPA 3CPJB 5LD2C 5EE5B 2P3SA 2VQSA 3NKVA 3S1AA 3DOEA 4KBGA 5L3SA 3PJRA 3AP1A 3U4QB 2QORA 3OZXA 3FMIA 1KGDA 5FPTA 4YMVA 1YZQA 3C16C 3QEOA 4LC0A 3U6KA 2OM2A 2IS2A 3QNUA 4YONB 2AK3A 3EWAA 4M1KA 2WOJA 1SXJC 3GLGA 5CYOA 2ZJ5A 1FMJA 2HCBA 1E2DA 4A0HA 1OHHA 4GOJA 3D31A 4US0R 4BRWA 5AUPB 4HI0E 2ZR0A 2P65A 2JJ1A 3BRWD 2O8BA 3K0EA 1X86B 3HYRA 3KXIA 2FWRA 1GUAA 2A30A 1N6HA 1D2NA 4OHWA 2WVJA 2XOKA 1Z07A 2XAUA 1O87A 2FSHA 2J87A 2XGJA 1LW7A 1RPZA 1W0KD 3THWA 3P4XA 3X1WA 4TQUS 2YHSA 2N46A 4B2IA 4EAQA 2C96A 2REBA 5FBWB 3UKDA 3I32A 3QF4B 2OCPA 4Q48A 3DKPA 3T15A 1EFRA 1TU4A 1W0JA 2BDTA 1XMSA 3WNBA 5DE3A 3DDCA 3SJCA 3RSOA 4JMPA 3KKQA 1DAIA 1GNRA 4NPHA 2OG2A 1IONA 4EJSB 2RGGA 2WJVA 4Q00A 2O8FA 3QPUA 3OIUA 1TMKA 1SVKA 3QXXA 3U6BA 3CIOA 4D0NA 3FDIA 4WZ6A 2EWVA 5C1BA 1G7SA 4N0EA 4ASUD 4PHFA 3VR4A 1IOZA 1DEKA 1HQCA 2XSZD 1XD2B 5KHOC 4TSFD 5K8TA 1II9A 4Q9LA 2B7BA 5CIWA 2VIIA 3KKOA 3M0EA 4AURA 1UEIA 1GWNA 2CL7X 2JLUA 2IWHA 3KL4A 2V55B 2OZEA 4D4MA 3TGPA 1G19A 3SC3A 1G21E 4JLAA 1DAGA 2QY9A 2WKQA 3UMRA 2PCJA 4UNSA 1VCOA 3AVXA 3R9WA 2HV8A 1Z6GA 3NH9A 3U4QA 3ZLJA 1RKBA 1R7RA 2PZEA 5HZHA 4IDHA 3IGFA 2WHXA 1WBBA 3K0CC 4S35A 3DMDA 5CB8A 1NN0A 1Q3TA 3ZJYA 3I5YA 1EXMA 3LVRE 4KFRA 4HYYA 1VYVA 5A4JA 4W9MC 2F3TA 2JA1A 3QKSB 1TEXA 2VHJA 3T5DA 1W36D 4PSVA 1UKVY 1G5RA 1XMIA 3SHWA 1VIAA 221PA 2CL6X 2FMXA 3REGA 1F6BA 3SOPA 2ZI7A 1AN0A 4CEHB 4C2TA 4I1UA 5E7JA 2O8CA 1SKYB 5J4LA 4BFVA 4EPWA 2A3RA 2QL6A 4C9BA 4LJ7A 2WBLC 1XPOA 2VHCA 4G5OA 2Q3MA 1E1RD 2VYFA 3PCRB 3GFOA 4QJ5A 3B2EA 3NC1C 1XCMA 4EFLA 4AYXA 1G8FA 2GEVA 4II7A 3M6AA 1DAMA 3KJHA 1CJMA 1X3SA 1QF9A 2GESA 2FE4A 3QXHA 2DFNA 5H70A 1XDBA 4KITB 3WYFA 2ATXA 2F3RA 4DXAA 4HB2A 4V0MA 1XEWY 1KJWA 4HAUA 1OYYA 4BE7B 5C18A 1N0VC 3C5CA 4TMXA 2IHBA 4NCIA 5JECA 4LOAA 3B1YA 1MRNA 3Q7PA 1NVVQ 3QXSA 5CM8B 4PZYA 2UZ3A 4LYAA 4ZKEA 4XJXA 3ZVRA 2W6ID 1E2EA 1HT2E 1Z6TA 4M21A 1SVWA 2NO0A 2HLDA 2Q9AA 1TU3A 2Z5FA 4JVMA 4TQ9A 4UXJA 4C7OB 3R7WA 4IFEA 4EPXA 1SVOA 2IT1A 3QJYA 1E1RA 2C04A 2D2FA 1YZKA 3DM5A 2O8EB 4JYCA 2QI9C 1K5DA 1ZW6A 5HKKA 4JLNA 2ORIA 2JLRA 3BB3A 5J4VA 3KQHA 4F38A 1SXJE 3NTUA 1W4RA 5J4YA 1TNDA 1D5CA 3THOA 4IW3B 5EE0A 5JWRA 4EPTA 1L2TA 2EYUA 4L9SA 3L8YA 1OXTA 1UDWA 3HPRA 3CPHA 4TL8A 4ACBA 4CGZA 4AY2A 4M53A 4Q19A 1ZUIA 2V9PA 5HCIA 2ZSAA 4XVUA 4YLGA 4NYMQ 1U9IA 3IO3A 4RZ2A 4Z1MD 4DCUA 4IOKA 5DLQC 4A8JA 4LHWA 2PX0A 4HZUA 5F3WB 1XCPA 5FI0B 1P60A 1KSJA 1B23P 1KNXA 1FTNA 3LRPA 2JJ1D 3RRMA 1QHNA 4OHXA 1DE0A 1E2QA 2J5XA 1ZU5A 4GSYA 2IEYA 4W5HA 1JR6A 2MSCB 5GVSA 3PVSA 3KTAA 2X1VA 1M74A 4KV9A 4LYFA 4C0AC 3ADDA 3AVPA 3U7GA 2W83A 3QXJA 1ZNXA
chains in the Genus database with same CATH superfamily
2FMIA 1XEXA 4J7XA 4L0CA 1IJEA 3BGIA 1VLHA 4RKRA 3IQGX 4BO1A 1E0AA 1NUTA 3LOUA 1H8HA 2GF0A 2MCFA 1PFWA 5KX5F 1M76A 2YY7A 4KDCA 4X45A 1V43A 5JLAA 4MV6A 3U7QA 3VSBA 4PY2A 1WUJS 1RPTA 3AF5A 4LF7B 1FUIA 4IJUA 1SBYA 1YS9A 2GSDA 3AKYA 4O4JB 4RVDA 4TTSA 5ALDA 4A4DA 1Q0PA 3UBTA 2NVUB 5EPOA 1ESZA 2OGZA 1I4EB 3IR5A 3ZZNA 5JNSA 3O3MB 1L5FA 1NX6A 3Q3EA 4XJVA 5CLLA 1OVMA 2Q3DA 4WKNA 4M7PA 2IZOA 3OAAA 3HY4A 1W9HA 3E05A 4GQIA 3UK1A 1QH8B 3DDZX 1SU6A 4G5RA 1CEXA 2X13A 2V7WA 3GJRA 3OLQA 4FYMA 1JW9B 4LJ5A 3IVXA 5K99A 3FROA 2IYSA 1X7GA 2IUFA 5BNTA 1T3HA 3UHOA 5CTAA 2VHUA 3FYUA 5EYPB 1E4OA 5G0SA 3QMMA 2P68A 4ES6A 2OZKA 2FCRA 4DWWA 2R8PA 3MD9A 3L7OA 4E5PA 1JMYA 4MWDA 1XJ0A 4BMVA 3OPQA 1FNDA 4FYPA 1Y5NA 2GZRA 4JU9A 2KI5A 2ODNA 3HJTA 4N39A 3EZ2A 2V3VA 1TM3E 2NZJA 3H99A 4P4NA 2BGWA 1NQXA 3BGWA 1GGMA 3W3AH 4N5LA 4AP9A 1X70A 4CM3A 2P9YA 2WUWE 1UBMS 5GWXA 2AUMA 2IYVA 3AEYA 1B76A 3JR7A 2BD0A 3MQFA 3DHVA 2XTNA 4GH5A 3CISA 4DYDA 2NYRA 4REOA 1QRRA 1TYEB 4YN3A 1II0A 1OILA 1WU7A 4Q4CA 3PXGA 1F6WA 3QA3E 2B9EA 4YPVA 4B4WA 2ZOSA 1IZYA 1VG8A 3E7PA 3G2JA 4KTTE 2FWJA 4LOIA 1Z2CA 4JLVA 2PGIA 1I10A 1U90A 3E15A 3EVCA 1NW7A 1HYQA 2ACKA 1R10A 3B6MA 3IQDB 4FGJA 1J0AA 4R40A 4BQNA 1Q21A 2MIIA 2YW9A 4UW9A 4ESHA 4BXOA 1YJ8A 2OXRA 3IDAA 1VQ1A 2H48A 2Q45A 2RG1A 2X9QA 3BFPA 1OGJA 3BSWA 3CX8A 4LZAA 4DB2A 4E88A 3WC4A 4BVKA 1AUOA 1QHFA 1E69A 5KNBH 2D5LA 4RSHA 4UTRA 1BVRA 3A8TA 2FSSA 5FBZA 1VJTA 3OJWA 4ERXA 2I80A 3P2KA 7REQB 4YAUA 2O59A 2F48A 1TKRA 4M7RA 4RTJA 4K9NA 3AF6A 3WK6A 4FCVA 4XPZA 1ZCZA 4YMIA 1RZRD 3WNZA 3FZNA 1GQRA 3NBQA 3LUCA 5F5NA 1IIBA 5JD4A 3ONNA 1SA0B 3BH6A 4PQFA 5CXQA 3H1PA 4ER0A 5I8WA 3VBCA 5DSTA 5I51A 1KJ8A 4XWTA 4JNKA 3RRFA 2F64A 4KX5A 3OM9A 3EHEA 3SYTA 2ZJ1A 2B4TO 3GRVA 3A25A 5KQSA 1W47A 1PJLA 2YV1A 4Q1CA 4B4UA 4B31A 3WV4A 1N2OA 3H8JA 4QUJA 2PY6A 2R6GA 5IZCA 3LE8A 2FPKA 3RUPA 2H57A 5CNIA 1SCDA 1EEXB 2V03A 2P69A 1Z0IA 2O3UA 1LWNA 4UNNA 4WKCA 4KI0A 3UB2A 1CY1A 1QRAA 3R6DA 3ERCA 1AX9A 4QC2A 2CUTA 3P27A 1AB6A 4FWIB 1RZVA 5HCNA 3U2QA 1EG2A 4KVAA 3WK5A 4O2BF 3NVKI 3WP0A 2HU5A 1GU1A 3C6KA 4L27A 1ECBA 2P6UA 4BZXA 5JS8A 2SNIE 4HGQA 3BMQB 3Q7TA 1Y6GA 2G72A 3JPYA 2GBGA 4YUWA 1M3SA 1Q1ZA 3JWJA 3KXKA 3N2KB 4XD2A 3GARA 5AI6A 3C3PA 3OMWA 3WGYA 4DLVA 5KINB 3D6MA 1P2FA 5KOYA 4LKRA 1RXWA 2X6TA 1J5XA 2D7JA 3OQJA 3DWGA 1C3EA 1GO2A 4JN6B 1FDSA 3JAWB 1BQEA 3AL3A 4FIDA 1MRZA 3L8CA 1ZC3A 3TSAA 4UOZA 2VWHA 1U5CA 3JTMA 4PIVA 2ZE7A 4YUVA 4K0RA 3THXA 5K4GA 1Q74A 1DKPA 1YMVA 3CNQS 5I4BA 5ANRB 2M98A 3R6LA 1MPTA 2X7XA 3BFJA 1DX4A 1Z4KA 3D6AA 3HCEA 4K6CA 1AVTA 4FI3C 2UXCB 2P9EA 3PPYA 2D62A 2Q99A 3CZPA 3PV0A 4HDKA 3NHFA 3QVKA 1KY4A 4POOA 1Z0JA 3KEGA 3L04A 2CHQA 2YJ6A 1OX5A 2VH2A 4FEEA 4QWWA 3MRSA 4R2IA 4WXMA 4DM4A 5A04A 5CCEA 4RPKA 4Y2QA 1FRQA 3L7IA 2O5CA 2V7VA 1ZJYA 1CZLA 2C1EA 4QBFA 3W7AA 4JBWA 1U2PA 1QYIA 2PCLA 2QSYA 4O63O 2EBFX 3JAKB 1ZH0A 1V5FA 5DDIP 1YULA 4KNVA 5TPWB 2JASA 1HX7A 2JFUA 3I05A 1NR7A 1FLVA 1I1NA 5ALRA 5LZ5A 5ALKA 1MQSA 3DMHA 4RD4A 4DY6A 3C6ZA 2O8DB 4FINA 1SG0A 4XDZA 2QRQA 3SR3A 2Y9PB 1W0KA 4C4RA 4EGSA 1HNNA 1QC5B 1VBFA 3K9BA 4WXYB 3TSCA 1U9IC 2YHUA 4NAHA 4OKIA 3VPSA 4B32A 4LQLA 1AGPA 3ODGA 5EMJA 4TPKA 2YZ2A 2QENA 3SOZA 4BNGA 2P8JA 4AJOA 4DXHA 2D3TA 4HH1A 1XNRB 3TZBA 1XJCA 1P7VA 1SUEA 3F9IA 2COUA 4E5MA 2E21A 4JVLA 4BO7A 4IV8A 3EPRA 5IBCA 3UFBA 1N0WA 3DC2A 4PAGA 2ODAA 3D6NB 1JRLA 2H31A 1RLTA 4Q4HA 2W2XA 3R5XA 3TPCA 3MC1A 3ZHCA 4C03A 4IJQA 3U19A 5DTEA 3H9EO 1F9AA 4ITRC 4QREA 3MJRA 1XFAA 4DV2B 1K8XB 5B53A 1E7QA 4DE5A 8LDHA 3F5SA 2QGNA 3JYNA 1D5WA 1CF2O 3RI3A 1KK3A 3VC2A 4JYBA 1RYDA 3MIIA 1NYQA 2POCA 1GKLA 4KXLA 3BMNA 4OOEA 3UJ6A 3U60B 5A0TA 1NDUA 1UBFA 3NKLA 3O8QA 3OZIA 4PTYA 4KMMA 1E2LA 1XZKA 1E1DA 3MS7A 4LQCA 2Z3ZA 4RIGA 1DV2A 2QAIA 1TIBA 2AGVA 4M37A 4X92A 1P1HA 4XPIA 3FKSA 4TMTA 3KT0A 1CUGA 2C8JA 1IHUA 1BWSA 3I01M 4Z2AA 5BSFA 4JJ7A 4NBRA 1NOJA 3IB3A 1Q0TA 3E82A 1OXKB 4ITUA 4PLPA 1P1JA 3Q15C 13PKA 2QMYA 3AVUA 3F1KA 4D26A 3FHCB 1MV8A 3CHYA 3PDWA 4C76A 5LDDC 1T0PA 3AJEA 1S2IA 1KOLA 3EN0A 1UKAA 3F7TA 1DPFA 2W48A 3KLOA 3K1AA 3UT5A 1DJOA 4GVXA 2R44A 4XOIA 1WCYA 4BFYA 1XQXA 1OBOA 1QP8A 3H2SA 3NHLA 1RYNA 4ZO9A 1QPGA 5EG5A 3EOAI 3KXLA 5EZYB 4FFNA 2WJPA 2C9ZA 2OYSA 3DAOA 1Z7YA 1NUHA 2CLEB 4PCUA 4NULA 4EF6A 1KMCA 4JC5A 4KK4A 4TUYF 4XIYA 3S1AB 3GA7A 5IWCA 4N5HX 2BC9A 4AO8A 4P22A 5AM3A 2G9QA 2YV4A 3BAFA 1B8NA 3QI2A 1ZY2A 4QQKA 4ZI7B 1KMHB 2WTEA 5TSDA 3ZWYA 5A4FS 1WB6A 4R83A 2PRYA 4RE6A 3LBYA 4UE6A 4PSCA 1OW3B 3LV8A 1ZD4A 1OZGA 3LXRA 4L4UA 4INJA 2PG3A 4X6XA 2C7OA 3VKHA 1N5JA 4ETMA 5B3KA 3JXEA 2HB6A 3FXAA 3RIGA 2YXEA 4PLHA 4XRRA 3NR2A 1OZFA 3C43A 5DB4A 3LD9A 4NX2A 1T8UA 3QA9A 4LMPA 2DT8A 1ZN7A 1S3SA 4UBMA 1ZIOA 4L8FA 2X7JA 2B61A 4E4RA 1H3EA 3CVXA 4A3SA 1ZH6A 2BEUB 2HT6A 3LUJA 1BZYA 3MINB 1XNJA 4JP3A 4NENA 3BQNB 3EQZA 2FLKA 3HDQA 3RSGA 3KWLA 1XTPA 1G60A 3HC7A 3KZVA 3RYCA 2PX5A 3NYWA 3BHMA 5B2EA 2J1LA 3HWSA 4L6AA 5FL7D 1W4CA 1TJ3A 1YA8A 5ECWA 2N42A 4XLLA 3AJ9A 4M1YA 5BORA 4JLUA 1R0BA 5CG1A 2FX2A 1ZX1A 3D2CA 4L74A 3BK2A 4U3JB 2QPTA 3ORYA 2NXNA 5A05A 3RFCA 5JNLA 1X80A 3VU9B 2C3MA 5TB5A 1JFFA 3GIWA 4JKIA 3S81A 2HYDA 4RIIA 1GD1O 1CSEE 2F4NA 3TNFA 5BMVF 3I53A 1VECA 2FLVA 5ALEA 4URZR 2NUAB 1IQ0A 2ASEA 2UVPB 4ZQGA 3JZDA 4M0DA 2EKDA 4GZLA 1Q50A 2XT0A 4LY0A 5KNDA 5FA5A 2PMFA 3TRJA 1OJLA 4P5DA 4BZQA 2BL4A 1QCDA 1ZRSA 3WGVA 4V0SA 4HZUB 4RZ3A 2F8SA 4DN6A 1YOVB 2I7CA 3MWLA 3RK4A 4NOLA 1HC7A 3HBFA 2XZLA 5A0VA 2VQEB 1X1TA 1V16A 2G1AA 3DEJA 1KI6A 4DTCA 3PUHA 3AUJB 3ESCA 4HDNA 3V42A 4EKIA 1XK7A 1C3JA 4QOEA 5DM1A 1T5DX 2I66A 3MD0A 4LJYA 3EXHA 3T6KA 3GLFB 1DMSA 1WDMA 3DP7A 4PO9A 4MGIR 2PGDA 2P5TB 2W6OA 2R5NA 3CH4B 3CMMA 3NPAA 5CDFA 4ANFA 2XGSA 1OLUA 2VQFB 3W2HA 2PWYA 3I6MA 3L0CA 2ZBGA 4FCTA 4FNMA 2DTXA 4M0CA 3X44A 1MZVA 2HDHA 1MEJA 2I4IA 2V58A 3AHHA 3D5TA 4PX5A 4N0DA 3UUEA 1UOOA 1DQRA 3GD5A 4YP6A 3UV6A 3FG9A 4J0FA 4U0JA 3AHJA 4GP7A 1NJ5A 4U7PB 1PEDA 4XWWA 1NF3A 1T1IA 3Q3CA 4ZRNA 2XAAA 2H17A 3GJZA 4D4IA 5TMDA 4NESA 4UM9D 3T1HB 5E8RA 1Z0FA 2XRYA 4LV6A 4YV7A 5JCXA 1JJBA 4D98A 3FNRA 1SXPA 1OR8A 3CNNA 2JKYA 4HTFB 3O73A 3K53A 1EGHA 4CMIA 1W5SA 3X2EA 2IJGX 1GGHA 2AEFA 2EBWA 2O7NA 5AICA 2NU9B 3M2PA 4DQDA 5J2TF 1S3GA 3CGGA 2A4KA 3JYPA 5DBEX 2ZJYA 4WLFA 2XCQA 1JEQB 3VZQA 4W7HA 3VMMA 2FQXA 4JJFA 1WVMA 1M2WA 2YIDA 1CIPA 4FK8A 5A4DA 5AI4A 3LQKA 3K3PA 1YBHA 3H9UA 5AJXA 1KQFA 3DKKA 4B2PA 1EZ4A 1SUAA 1ULZA 5D1HA 1EVIA 1HDCA 1OLSB 2ZVDA 2PLWA 2ZRHA 3GL9A 4Y1FA 1ZI6A 4Q4JA 4TTTS 3K8YA 3IHLA 2G4CA 3T38A 3T3DA 4EF5A 5EJ6A 4QTUB 4BNWA 1T0UA 3ZLUA 3AZQA 3D81A 1JN0A 2A5DA 1BA2A 3AR7A 1QHEA 1ODJA 2CXRA 1V3VA 3KE8A 2IYNA 1P8JA 4EB0A 3ESZA 3KQQA 5BY2A 2XVZA 3F3KA 3O6VA 1N5OX 4X95A 5IN4A 3W06A 3OEHD 4M6WB 2G7ZA 9ABPA 3WI7A 3M5WA 3HCFA 2BW0A 4JL5A 5KSWB 2O52A 3STXA 4MOWA 3SDZA 2CNBA 3PQEA 1E4VA 1T0HB 2GZHA 5MHTA 4GUAA 3SEFA 1KVSA 1Y4UA 4AULA 5DT9A 1Z2OX 1JEDA 2EG9A 5CR9A 2B3DA 3A3NA 2IOFA 5F2EA 3D3WA 5J1TB 1Q7RA 3OEED 4BX3A 4UHEA 2I4LA 4TTIA 4O2RA 5CIYA 3M5DA 4P0TA 1TPZA 5D85A 1BCRA 1L5KA 5LMCA 1AV6A 2VP6A 2QLBA 1RYMA 2Q62A 3MF4A 2SECE 4I2NA 1I9GA 2BBTA 3WMRA 3MMZA 3QBVA 1JJFA 1VLLA 2J4CA 1F2DA 1SAYA 2A9QA 2LDBA 5AJZA 3T35A 3C48A 1LKZA 5CJ2A 1X1EA 2I1QA 4R1QA 3H86A 5IAJA 3VNAA 3VR6A 5IBPA 4HDQB 4FE4A 5GVRA 3FTCA 3GCGA 2J0UA 3L0PA 1JA1A 2AOXA 2IQIA 4BB6A 4DUPA 4KN8A 1IN4A 1K0FA 4ETWA 4E5YA 3TEMA 4F97A 1S1CA 1DARA 1SC6A 1MIHA 2KX7A 1MW9X 3BB1A 4JB0A 4K6OA 5F7XA 4KXXA 2WWXA 4O4IA 4BUCA 5HJEA 3H83A 4WBNA 1R5BA 4LDAA 3GMIA 4UHCA 1JIKA 1DMRA 1VYHA 1Y4AE 5JPDA 1CYEA 2I1VB 1CJUC 3OPVA 5TPWA 2W42A 2G09A 4R54A 2RARA 2OKGA 4ZU1X 2AN3A 1MEEA 2QL7A 2VHWA 1E9AA 3HYSA 1R8QA 3IOYA 4XFJA 4ALNA 4EPYA 2IF2A 3A31A 3DO8A 4PRZA 3RS2A 1WCV1 1J25A 5EIAA 3ESAA 5HSGA 1MENA 3HKDA 4HX5A 5DJ5A 4D8TA 4FBLA 4OXIA 4JP8A 3N2NA 3P7MA 2RHMA 1SO8A 2ZJOA 5AK0A 2B0JA 3TZEA 5DNUA 4UKDA 3IPRA 1HL3A 2GMWA 3N0XA 3S2EA 5LIPA 1MKYA 2E4UA 3DUFB 1UBNA 5ER9A 4RDHA 4X64B 4D46A 3UMMA 4EJMA 2D1SA 1JBKA 1OH8A 5FLYA 1E98A 1BHSA 4Y2TA 3WQQA 4I3HA 3W2IA 2ZSEA 3GZ4A 3OP1A 5IAAA 4Q5IA 2BLNA 3IUMA 4HJXA 4OJKA 3DEHA 4RA6B 3VAZA 1SBTA 2DXIA 2QBYA 5K05A 3WKBA 1EGVB 1CUJA 1PQPA 2X8LA 3OZ7A 4BMNA 3DWFA 5IYZA 2PL3A 4S2UA 2CJPA 3C3CA 3AKZA 4JXZA 1TQ4A 1QVAA 1BHO1 4QUDA 2IIVA 5FTKA 3TLEA 2P6PA 2BFCB 4PAQA 4XM1A 4WHMA 4GNKA 1A8SA 2WFZA 3O7MA 1SCIA 4JLWA 3TPFA 4Z1MA 2HA7A 3O8BA 5CGQB 1G0OA 3HJFA 1PJCA 4OX9B 3OIYA 1NBWB 1JDJA 4RZSA 2WSMA 4YCDA 2GHRA 3UAVA 5DI3A 5NULA 4O4IB 3PFNA 1IN7A 4HDMB 4LW8A 4DEYA 5C8YF 2OXCA 2GPTA 4XR4A 4WL0A 4DDHA 1NC3A 2GD0A 2WIBA 3LQ4A 1QNLA 2P2CA 4LXTA 3TW6A 1KJZA 3NO4A 2GZSA 4TKLA 4YAFA 4YECA 4DLKA 2RH9B 3BS4A 4Q9IA 1CRWG 2V7BA 3BBPA 4ZT7A 5ARBA 4A1FA 1Q19A 4H7EA 4QOIA 3LDAA 4NP6A 3SZOA 1YR6A 3SZLA 1KHTA 2WUGA 1O6CA 5G0UA 1Z08A 3N86A 3BE4A 4FDVA 3ZJTA 1KPGA 3LDHA 3VPXA 521PA 2VBCA 1V37A 4QOFA 2QVBA 5DNVA 4E5VA 4EZBA 2DE0X 3P19A 1Q3KA 2PX2A 4HNAB 4EENA 1QS0B 2QRLA 3QENA 2BI7A 4ZYVA 1HE8B 5AK4A 4P93A 9LDTA 4HQKA 4IDOA 5TGDA 4QQNA 2C4MA 5DOVA 2WVGA 3T9AA 4UJ3A 2W4QA 1J70A 4R7GA 3SHQA 3PR2B 3GPIA 2VDOB 1SCJA 3U7EB 3TLJA 2UYQA 3LM8A 3A9CA 4G23A 1E5TA 2VLIA 3L9XA 4HNAA 4J0QA 1HLDA 2QVZX 4CV1A 5CGZA 4DR4B 4JP1A 1Y4ZA 2VHZA 4FSXA 4YV0A 1GAEO 4N18A 1NJ2A 4C6RA 4B3GA 2OWEA 2Z58A 2EHDA 3GJ6A 3M6UA 2ZIGA 1LVGA 1XTJA 2ZQZA 5EE9A 3RYHA 5JS2A 3H4TA 2FPRA 2OHHA 3FCEA 3I12A 2E49A 4U7WA 3LTNC 1Z0UA 1JAXA 3ZWKA 1PV1A 3D3EA 4UUQA 1XMXA 1PT6A 3INRA 3OKPA 3GBPA 3L7JA 1NVFA 3TCXB 1N1EA 2DYKA 1TGYA 4MI9A 5AI9A 4WKPA 1TQ2A 4PLZA 3KJIA 5F12A 3MHTA 1MOSA 4C6SA 2OB1A 5J2UB 3KB2A 3B52X 2WWGA 4FUQA 2VHYA 3Q0TA 4HZIA 4AZ0B 3K2BA 4BRSA 1H0SA 4C0LA 4CV0A 4G6ZA 3ZYCA 5B4TA 1MB3A 4RVCA 2AFHE 3IAFA 5JBIA 1A9ZA 3N70A 1FZTA 2DY0A 1YB7A 3AF2A 3CGWA 3CCCA 1WB4A 1CUFA 3EVTA 3LGAA 1KYYA 3NHPA 3PR3A 4QQRA 3RKUA 1BE6A 3DFIA 1UJMA 1Z73A 3KQYA 4TWZA 4F7WA 4DV5B 5AW1A 3ORSA 5GINE 2A7QA 1NKSA 4OK6A 2HMWA 3C87A 1ESNA 4ROTA 1QMGA 4FJ2A 4H08A 3GBVA 3TE7A 3DNMA 1MX9A 3KELA 3GXBA 1NVUQ 4YJKA 1T5OA 3NT4A 1QZUA 3WYDA 5KVCA 4X93A 3LTEA 4YUZA 4KPEC 4Q21A 1S9DA 4KREA 1ZR2A 4L8LA 3ES9A 4G25A 3V2UA 2DHDA 2PRJA 4CKWA 2WYHA 3IVAA 4X66B 2VK2A 3LDUA 4DZZA 2I4RA 4UVDA 3RO7A 1Z6YA 2ZBRA 4IFIA 5FO1A 1GZ5A 1E9RA 5JNRA 2BKLA 2ZKIA 1UKEA 3RBXA 4BKUA 2HYIC 3BWXA 1QYXA 4D6PA 5JY6A 2NU6B 3COVA 1IQPA 5D8DA 5TQJA 4R1SA 4DWOA 1JIIA 4A8JC 1WQ1R 2HUPA 1GTJ1 2PGNA 1X1DA 3FWHA 3W6PA 3I73A 3MTQA 1GRCA 1F0NA 1JTVA 2RHDA 3AF0A 2ZCVA 3ZKAA 4FUTA 2V0CA 1WKCA 2JZOA 1JQBA 4TV9B 5I5GA 1W96A 3W5DA 5H3CA 5KX5B 5DK6A 2RH8A 3WGUA 4CEHA 4KOEC 5IANA 1O96A 1AURA 1EMDA 4MKIA 5JQGF 3QVMA 2HNAA 1FLAA 3UXEA 2AQHA 2X42A 2QIPA 3F8SA 1CPYA 4TRRA 6PFKA 4AB1A 1RT9A 4INPA 4KC0A 2HK6A 5JC1A 2I2FA 3U9LA 3JU3A 3GDHA 2Q07A 3CONA 4GVPA 3PHCA 3FPAA 4Z4QA 3QVTA 2KM1A 3O31A 1QZZA 1G5IA 4QD3A 3SBXA 4EQ6A 5IKEA 5AJYA 4DV4B 4I99A 3HUTA 2XJ4A 1B2LA 4FFDA 2JBAA 4WY2A 5KYWA 1LSUA 3DVQX 3I5MA 3Q12A 3UAZA 2PDAA 1XF9A 4F4HA 1TYAE 2PQ2A 2CBZA 1QDEA 4GBJA 1CS0B 2PZLA 5CDFE 4LBWA 3U09A 2I4OA 2AJCA 2O50A 1VKZA 2O48X 2YZKA 1M6VA 4BO8A 2JHPA 2OQRA 2GM4A 5I48A 2GHTA 1VJ1A 1O97D 1WR8A 1SULA 3LT1A 4FOLA 3PPWA 4O4HB 2IDKA 1K5GA 2CW5A 4IMJB 5KYWB 1NXTA 1H3NA 5ENDA 3DPIA 4LVNA 1U0TA 2QZSA 2QLLA 4J90A 3W78A 3K9NA 4NOMA 2FMFA 3EUWA 3L7AA 2QYHA 2GNOA 1XZQA 1FMCA 3LZCA 4I4TF 1L5HB 3KRTA 5FOUA 4YRPA 3AQIA 3SAJA 3NMUF 3ROQA 4G5HA 5LLDA 3HSSA 4NCXA 4QXPA 3PFIA 2B8NA 1JR3D 2V6GA 3ECCA 3R7BA 2FX3A 4NZPA 4L5IA 5MN4A 3QMVA 1DP4A 4LXQA 4C7OA 1Y8QA 2FX5A 3FHTA 3CLTD 5KVQA 1GPKA 1SWVA 1FUYB 1K6IA 1TM4E 2ZSKA 1N2JA 1P1RA 1GT91 4LNUA 4OGGA 3TJMA 1IOWA 3CJTA 3AI7A 4M1OA 2OORA 4CGYA 3TJRA 2UVDA 1BH2A 1L8AA 1SC4A 3PDIA 1UQUA 2G9NA 5CFPA 5TMBA 3ZXUB 2GXAA 2PKYX 1R12A 4UVIA 5J2TA 3M82A 5KHLB 4LE2A 4S0XA 4BV3A 4YRAA 3I2JA 5CCXA 3ZJVA 2XPCA 2XXAA 1N3BA 3QBDA 4UMFA 5AFSA 1MH1A 1VTKA 3A1CA 2R8ZA 4X6LA 2YWGA 5HIJA 5BT8A 2QRPA 3OZTA 3DHEA 4DIMA 1BGXT 1PK8A 2IZ1A 1V8DA 3CZAA 4LOHA 3LY9A 1ORIA 1QANA 5TX7A 3QJGA 3IXLA 3WWEA 4EVRA 1JG6A 4MZXA 5KVAA 1AD2A 2G5PA 1VG9B 3K0AB 3HY3A 5AKEA 2Y3IA 4IXDA 2W2LD 2AS0A 3FN4A 2PRIA 4GT1A 3U4CA 2LZ0A 3E9NA 5JZBA 3E70C 5DRYA 3UENA 2G71A 3X1ZA 4TV9F 1NBME 4LIPD 2DPHA 3NIBA 3LFUA 2ZBFA 2X8BA 4YMUA 2HR1A 1PNQA 1YBVA 4X1OA 3S4YA 3MAGA 4R4JA 3KKLA 4R2JA 5CM9C 3O7WA 5K0LA 3DOHA 4O02B 1TUEA 3A4YA 2AOVA 4BXOB 1I4DD 3HABA 2OP0A 1A96A 3H7AA 4RGYA 2QN2A 3KQVA 5DISB 3RS7A 2MYNA 1PL0A 1UODA 2WAAA 3MWEA 4DMKA 4LA4A 3SS9X 1T5LA 2XTZA 3TM4A 5CLFA 2G5TA 3TVTA 1LSOA 4RJIA 3ASVA 1L7XA 4R0NA 3CUVA 3PXEA 1NL3A 3NM5A 4W7IA 2HOQA 2PMCA 3AY0A 4N5IX 5KTPA 3LQRA 2QTTA 2X58A 1JDPA 1GZ7A 2AQIA 4UBJA 4R16A 5CNMA 4EKEA 1JZTA 2I78A 2VPTA 3C3BA 4JX8A 3QUTA 4CT4B 1AG9A 1DBSA 5TMEA 3TSZA 2QB5A 3OCWA 3DEYX 4ZAVA 2NV0A 1UIMA 2RGNA 1C3OA 1CRZA 1NVEA 1JE1A 2BEWA 3IP6A 5C3UA 1RJFA 3A4NA 3I37X 1AQJA 2EZ9A 2POQX 3OIDA 4U2KA 4WESA 4YIHA 1NUQA 4BNTA 2BFFB 2HF7A 2JH9A 2YC2C 2YYZA 1E2GA 2YX1A 5AVKA 1WF3A 5KKAA 4JBLA 1R00A 4MVJP 1XEWX 2R66A 1HZJA 4PLGA 3ET4A 2DULA 4MEAA 4MDEA 2NTJA 1NVAA 4MZDA 1B1CA 1SD1A 3B12A 3H16A 2N1MA 4ZYLA 5CFOA 1BNCA 4TTJA 4FZRA 5DNWA 4AJHA 5JAOA 3BXPA 2G7MC 4HNGA 4NBVA 2E82A 2D2VA 2H18A 3T7EA 4XWKA 2IS1A 2A9VA 1ADYA 4RPLA 4UBKA 4MP3A 4BX2A 4JU8A 3S70A 4BYMA 1Y3BE 4DA4A 1Z2AA 2XZPA 2ZIXA 5JSHA 1K06A 1OA1A 3FWNA 4LJ6A 3ICCA 4FHZA 2ROQA 5F3RA 1ZXLA 3LBFA 1PZNA 4JLOA 4EVSA 4DAOA 3VR5A 1HT0A 1JLKA 5GGXA 3M4YA 5ALOA 2JCGA 3AUTA 1BGWA 3EVEA 1I7PA 2LVBA 2AXEA 1PT7A 1YQWA 4RKEA 5BPFA 3JQFA 2GVDC 3MVEA 1RM3A 3IQHX 2VYVA 4WQMA 3RVRA 3SZGA 1YGYA 1LBHA 4TLCA 4YEDA 1LPBB 1DBVO 4AZWA 2QE7D 4PTZA 3B38A 3U81A 4QM7A 5DYNA 1Y82A 2X22A 4EI7A 3LUDA 1CE8B 5H68A 1U2TA 1LNZA 1X3LA 4PZAA 2VJDA 1GGFA 1N6IA 5JPCA 2O3RA 4MW5A 1BX1A 4WDQA 3PYMA 4B4KA 4DSNA 1GFIA 4CDGA 2QAGA 3X43A 5A1JA 2BGTA 3AW9A 2ZR9A 1E5QA 1ONNA 2A0UA 3JQ6A 2HH9A 3QKSA 2CFSA 4QECA 1JS1X 3CLRC 3KQOA 1ZD9A 3CUSA 2L82A 5BUQA 3EA5A 3QF7A 4YJGA 1WEKA 3E5NA 2QE6A 5DKFA 3UYKA 3WHLA 4AG6A 2J5QA 4GSLA 3KWMA 4IOLA 4KSBA 2YN4A 5GGYA 5IC5A 1WCXA 2ZZKA 4JENA 4OH7A 2H08A 1ZVKA 1DB3A 1CDZA 2Q1XA 1EBFA 3HJAA 4INAA 5HJ2A 3WICA 2JHGA 3UUWA 4PXSA 5AK5A 4CLEA 4Q1VA 2XCUA 1QQAA 2CB9A 4ZYXA 1CYDA 2OILA 4MRNA 3WKAA 4BWYA 1UP6A 1W4BA 1ZK4A 5FNZA 3PTAA 4Z53A 1OB2A 5AVZA 3DMTC 1U9ZA 4R41A 2JI6A 4I50A 3CZ5A 5GOZA 4BLSA 4B33A 2JK1A 4JXKA 4X0EA 2HO4A 4L8WB 2HA3A 4C6TA 3S44A 4YA6A 1BMDA 2AFIB 3DCNA 4FBMA 4RZHA 3IP1A 1EP2B 3OZSA 3RK0A 2QN3A 2RHOA 4AYWA 3LWNA 3FDXA 3WL6A 1WL8A 4NY1A 5KYKA 3QH4A 3K9HA 4ZREA 4ZI3A 5A5DA 3UAXA 4F3CA 1TRHA 3HPQA 4LCBA 2G1JA 1O5TA 4GZ6A 5HGXA 3STUA 1GFSA 1P2TA 1P4GA 3HY6A 1NP7A 3LPMA 1J1UA 1KVUA 4JJIA 3LX4A 2EZ4A 1VKNA 3R7DA 1WO8A 2JLYA 1BA3A 4LISA 1YUBA 3DF7A 4JQYA 1FP6A 3LLMA 3IEXA 1SWWA 1ZA1A 5AVJA 3ABZA 1ISSA 1T5IA 2H2WA 3L8EA 3NTXA 3RREA 2NTVA 3FOAA 4QYIA 4ZT2A 3AI1A 2GLTA 3WHKA 1KARA 3RVOA 2TMYA 4M0PA 1KK0A 4LYYA 5CT8A 2EKZA 4O5OA 1DIOB 2FSGA 3E9DA 1Q1BA 3MWJA 3EPPA 1T35A 5HGJA 5GZ1A 3L1IA 3G0BA 4JOCA 3G2QA 1A5SB 4RHUA 2WOOA 3QBTA 4LDNA 5JIBA 3UATA 5CVCA 1T2UA 1VRVA 4OBEA 4XB1A 4HDMA 4N49A 4CMCA 2EW2A 3SX0A 2I8LA 4ICIA 4IZIA 2CLCX 1A8PA 4A6PA 4KRFA 1GADO 1EJ0A 1SKQA 3IQIX 3VZRA 1TT5B 1QHYA 1Y89A 2YVQA 4ZZ0A 1RWKA 4E11A 1QFZA 2FRVA 4MQMA 2V3CC 3MELA 2H11A 5U4XA 2QSUA 3AV0B 2WTXA 1ORHA 1TAHA 3MNFA 1QE0A 3F67A 1Z6QA 1G5FA 3MT9A 3M6WA 4HG2A 1OFTA 3BRWA 3S29A 2VYQA 4R1TA 3UWMA 3R5JA 3G8CA 1ODFA 2NO7A 3ZZTA 3L0OA 1JTFA 3K0AA 4RIFA 4BASA 3VYSB 3TVDA 4FD3A 4AW9A 2H54A 3GQVA 5CFZA 1Z63A 5K3SA 3KTOA 3OAAD 3RVJA 2YHIB 4BP1A 1FYWA 4F9TA 1YJQA 4TMKA 1ZCAA 2CLLB 3KVOA 1K27A 2A7XA 3JVDA 4HNVA 3WHIA 4OGWA 3THXB 5K0TA 3NP9A 4ND4A 4REMA 2ZETA 1U8ZA 4Q4DA 3PFFA 3BA6A 4U7TB 2HX1A 3BWCA 5LXTA 4URFA 3QI7A 4Q12A 1CZOA 1FX0A 2QRMA 3FKJA 1AA9A 4JS0A 2D5IA 3QU2A 4QXRA 4RACA 1K2WA 4AG5A 5DN9A 4LWPA 4LMRA 4OK5A 4FFPA 4D92A 2F1JA 1CUWA 2ON6A 5JRDS 1KJJA 1KDTA 2ZRDA 4HEJA 4HX2A 2OESA 4RNDB 3NVMB 2V74B 4XX1A 5DPMA 4G4GA 4GAEA 5HX7A 1CZRA 5HP4A 2VI5A 1AGRA 1JU3A 1P9LA 1PN3A 2E4WA 4AJLA 4D02A 4Y1RA 2Z9CA 3EZFA 3RFFA 3MGKA 5LKAA 1S9HA 1L7DA 1QH8A 1K6MA 2JL1A 2ZB2A 1NPTO 3EG5A 3C85A 4EFNA 4OMUA 3HM2A 1ESDA 3GLHA 4D43A 1VL6A 1NQWA 3ED1A 1J0XO 1Z5GA 5DIZA 3TTVA 2J9FB 3EZYA 3IQXA 2R48A 2YOGA 4LMBA 2F7SA 4IZOA 1UC9A 3V3KA 5KJCA 2Q2VA 1E7RA 1AOXA 4X8OA 4ZTZB 4J49A 3B5IA 4L28A 3D7MA 2ANBA 3EIOA 4B75A 3QSYA 2HQRA 4G3XA 4A15A 2IPOA 3AIIA 1P5FA 2J3KA 2VC2B 3JZFA 1QV9A 1T8TA 8ATCA 5J2TB 1S96A 3SEQA 5CDUA 4QVIA 2C2MA 3IPLA 5G0VA 2G83A 2BF7A 3NFYA 4WXHA 4Y2PA 3ZE9A 4TS9A 5CDHA 4D25A 3GGJA 2VSOA 5HBGA 3CSDA 1EFTA 2WFAA 4GE0A 1RMTA 3T94A 1XTRA 3UPDA 1DJPA 1RWPA 4C6HA 2WD7A 3RGGA 3H1FA 3MMPA 4HDRB 1M1UA 1M54A 1USIA 1FY2A 1E1QA 3NV9A 3SXJA 1JPJA 3C4QA 2C8KA 4L85A 4EOGA 2DJIA 1PHRA 3P0EA 1GR0A 1ZLXA 4FGWA 5K8UA 3B8HA 1XNQB 3KXPA 2ZUEA 3F5DA 3O9VA 1UPUA 3J7AC 2YMPA 4KO8A 3WK7A 2AMJA 1JG4A 4FC7A 4A10A 1KYTA 1J6UA 1U2EA 1VMKA 2ZWIA 1BEUB 5E4TA 3W1EA 3AEQA 2J7PD 3KAJA 2CNWA 1Y6JA 1A95A 1Y1KE 4MVJA 3WWCA 3CKKA 3GEPA 3Q85A 3SZUA 4DG8A 1RJWA 2ECQA 4DCNA 2I54A 4DR7B 5B7QA 1A9OA 3AG6A 1IFXA 1SD2A 1J07A 1NXVA 2CVFA 4GRIA 2NZUG 5LP1A 3BCSA 5CVUA 5K4AA 3C1TA 3H0EA 3Q5EA 3LPNA 2R1VB 4LV8B 3D54D 4NZZA 4QU0A 4YLGA 1NKTA 4EYEA 4BPBA 1NJ8A 3O8LA 2QVCA 3ZGOA 2IY9A 3HBAA 2J85A 4LHYA 5DM0A 4TZ6A 2OV4A 2QL5A 3Q7IA 4ZOQI 3P45A 3OLVA 1TVEA 2WHYA 3ABQB 4LYGA 4AKSA 4B35A 1ZXXA 5C4GB 1UBKS 3H5VA 2J09A 1R6VA 4NYIR 4OYLA 4M0EA 1Z12A 4FEAA 4Q1DA 4RK5A 4JLJA 2BKAA 1R1DA 1R4NB 2AK2A 1UFOA 2VXBA 3GT4A 4I1OA 3QSGA 5H5JA 4ZXFA 4G0ZA 3D3JA 5CXXA 3WLFA 1T6BY 1K5HA 1UKCA 2QSZA 4KRGA 3R5HA 4BMYA 4D79A 1POXA 3GLGE 2UYCA 1U6JA 1IDN1 1RI5A 3KG2A 3ICWA 2XNHA 4WCFB 3AINA 2I2CA 2D06A 2EV9A 2JGMA 1PJZA 4F60A 2GD6A 3TYXA 2DFKB 5IAOA 1RHMA 1K7YA 5C7OO 5CVDA 4R81A 1V1JA 2IUYA 5JRZA 2X6QA 2JGNA 4QNRA 3X1MA 1MT0A 1QYCA 2B4YA 2KBEA 1N4AA 2O8VA 1PFUA 3JRWA 3KUUA 4IXMA 4X9XA 3A6PC 2IXTA 1EE9A 1GFWA 4UNPA 4I9FA 5KVVA 1CRPA 2YMQA 3UWSA 2WG1A 2Y68A 2Q41A 1P29A 2PXAA 3TLGB 4W1PA 4JAVC 3W6UA 1GQYA 3U40A 4OQNA 2QSJA 3SIPA 1XTQA 4E32A 1GQQA 2PKRA 2QDXA 2IYQA 4V1CB 1IK4A 1E3QA 4B3HA 1BROA 1GZUA 3CM0A 6GPBA 4J7CA