1F2TB

Crystal structure of atp-free rad50 abc-atpase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
AREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tB00
2FMXA 4M53A 4QBFA 3LQRA 2GESA 3UPUA 1WQ1R 1YRAA 3IILA 2X19A 4JLNA 3K0CC 2RKOA 4M8NE 4MUAA 2JJ2D 1XTKA 4NBSA 4HDQB 4PQYA 2VF7A 1W44A 3HU2A 4ZDIA 3L82B 1MT0A 2ZJZA 5IHPA 2VF8A 3X1YA 2BCGY 1ZIPA 5BN5A 1Z6GA 1P73A 4OJKA 3BIFA 3R20A 3CZQA 4Q4HB 1F48A 1S8FA 5BXQC 1N6LA 3CWQA 3QPWA 2GJSA 3QI2A 3TNFA 2IYXA 4ZI3A 3W6OA 3EIQA 2Z83A 2W83A 3BXZA 3U60B 1XD8A 3LW8A 5FOXA 3IEVA 1ELOA 3AKDA 3B1VA 3A37A 5J40A 1X8KA 2ZI3A 2QL6A 2AWOA 4DDWA 3OAAA 4CZ2A 4MYTA 1Z6TA 2JLWA 2W0MA 1T3LA 4DKXA 1SHZA 4A8JC 1U8YA 1XU4A 2MMCA 2ERXA 1XNJA 3QVVA 2QTFA 3Q85A 4LHZA 4M9SA 2WHXA 1Q20A 4QJ4A 1IXZA 5EE5B 2W58A 2QU8A 4XVQA 1VG1A 1AS0A 2ATXA 2CNWD 3TJZA 2OFWA 4RZ3A 2IS1A 3LD9A 3QQ5A 5KNDA 3R8FA 1KI3A 2VHJA 4LRWA 4DWJA 1M6NA 1NI3A 221PA 3GD7A 2P3SA 2W6ID 1E99A 2O8FB 3VX4A 2LKDA 2PEYA 2GJAA 3SFVA 2ZM5A 2G3YA 1GKUB 4U7DA 1ZC3A 2RGNC 1KOFA 5FTLA 1MH1A 3U7EB 1RRCA 2GK6A 4PAOA 1EFUA 1D9ZA 3AV0B 4KXFB 2YWHA 3OIUA 4D80A 1I2MA 1WDTA 3B9QA 4HSEA 3AGPA 4PSKA 3ADCA 2P67A 5FL3A 3CWZA 2QY9A 2FPMA 4PC6A 4O2RA 1N6OA 1RJ9B 5FFMA 3Q5DA 4AY2A 1TEXA 1G9XA 4EFMA 3HP1A 3GJ0A 4A2WA 1BOFA 1W5TA 2A5GA 1LF5A 4A36A 2F1JA 2AK2A 2D2FA 2NPIA 3AKCA 2HJVA 2PT5A 3EW9A 1TPZA 2WIBA 3UK6A 1T5LA 2ODBA 1UBGA 4D82A 4W9MC 1Z07A 3K53A 1R0YA 2FEMA 4DDTA 2OXRA 2RB4A 3JVUA 2JDIA 4C0LA 1OH8A 1M7BA 3CONA 1PVOA 2PZFA 4TTQA 1G20E 4OI0A 1W0KD 2ZSFA 4TLAA 3LBIA 4EPTA 4G5QA 3QXHA 4P4UA 3CLVA 4EPXA 1AGPA 4RCYA 4CF7A 1UDXA 2X77A 1NLZA 2C04A 3RRMA 1RC8A 4FINA 3EZ6A 4US2R 2ZRJA 1XEXA 3I8SA 3K1JA 3QPUA 3KKQA 1CKEA 1G7TA 2Q3FA 2YHSA 3WMGA 2MSDB 2AN9A 3RRNA 5EXPA 2DFNA 2FN4A 1SVMA 4G5SA 3WRYC 4CRWB 3QF7A 3K09A 4B74A 3NBFA 2IS6A 2JJ8A 5E7JA 2FSHA 2ZSBA 1R0XA 3AP2A 2OM2A 4KSCA 4TZ0A 5CB6A 3RWOA 3F5FA 4KFSA 2IXEA 4KI0A 5FOUA 2VYFA 4TSFA 4NCHA 2HDNB 5CK5A 2ZJYA 1HYQA 4IEIA 3LQQA 1UDWA 1T0HB 1EWRA 2V9PA 3BERA 3THWB 4MYUA 1GRQA 3SYLA 3TLXA 1TQ2A 2TMKA 1AGRA 2ZE5A 3W5JA 4IDHA 1E9EA 3AVVA 1DVRA 1RZ3A 1N0VC 3FGNA 3GLIA 1XPOA 2ZRMA 5B64A 4G5GA 4UNPA 5KO2A 3AM1A 2RGBA 1F2TB 4OK6A 4R2HA 1NRJB 4WVFA 5CJPA 1A2BA 5HZKA 3ICEA 1Z0IA 3KKNA 3U3RA 3OZXA 3I92A 2QA5A 3FKSA 3QE0A 4NP6A 1FX0A 3AP3A 3CX6A 1R0WA 2PLFA 3KXLA 4YONB 4LY6A 2PCLA 4LCBA 4V0NA 1Q21A 4AKHA 2ASEA 1Q57A 3WXMA 1A2KC 4US1R 1W7AA 1TQ6A 4LHYA 2NPFA 4IDPA 4JKIA 1FPMA 2XEXA 3QEJA 2IEZA 4P31A 2UVQA 3PQCA 3ZZUA 1DPFA 3CRVA 2ORVA 1E1QD 3WY9A 1W47A 2VHQA 5KOYA 3IHLA 5K8UA 1P3JA 1G8FA 4P3YA 1WMSA 3OIVA 2IYSA 2ZREA 2AD1A 3EXAA 1GITA 4XTCS 3SJCA 4ASUD 2WSSD 4XVUA 4Q00A 1RYHA 3U61B 1VHLA 1DAEA 1Z47A 4Q4HA 5EP4A 1W4RA 3CF2A 3LXXA 4NU0A 5C4GB 3WYGA 1CXZA 4DCSA 1KK3A 1E2QA 2CMKA 1ZNYA 3OHMA 1IQPA 3OEHD 5DO9A 2R6FA 4DCUA 2ZS7A 1Z5ZA 3U2QA 1G3QA 1JXOA 1UEIA 1KKMA 3K0EA 3PFIA 4P4TA 2RGAA 5GVRA 3THOA 4F4JA 2WWHA 1G41A 1VIYA 2GRJA 1OJLA 2YOHA 5KSOA 5M04A 1JAIA 2BDTA 4IFEA 1FMJA 2BMJA 5J4LA 4WA7A 2G1JA 1P2VA 2OXCA 3CNNA 5KSPA 2CEAA 3MG9A 2XB2A 1DEKA 2OESA 3MAAC 1R5NA 1GL9B 4MGYR 3CUEF 1NMXA 4PZLA 4KFTA 4JT2A 4C4PA 4C0JA 4N0EA 1R4AA 2CNWA 3RS2A 3CKLA 1P9RA 3TH5A 2AFIE 4HLQB 2O8FA 3H2YA 621PA 1IY0A 1XMSA 5EE0A 2VHTA 3FOZA 2IBMA 1WXQA 1US8B 2W6IA 3ZIAD 2OCBA 1P7CA 2JIZD 1AZSC 3WMEA 4B3GA 3D3QA 2PLRA 3KKOA 2J3EA 2O0JA 3ZYCA 3Q3JB 5BW8A 1GVNB 4Q02A 4TMTA 3WP1B 2YYZA 2QROA 2H5EA 5LD2B 1RJ9A 1RRFA 2KSQA 1KTVA 5CK4A 3X1XA 3HYRA 3QENA 2HT6A 4FN5A 3TQFA 2J7PD 2OILA 4DVGA 1UJ2A 1TF7A 3W90A 4LZZA 4FCWA 1Z08A 1T91A 4LV5B 4CVNA 1XZPA 1BO6A 1YZGA 3I32A 2A5DA 1PLKA 2X2FA 3KUDA 4LC0A 2P5SA 4QGFA 3VU9B 2ZU6A 3N5CA 4EPVA 3UANA 2NZ8A 3A4LA 1ZU5A 3LO5A 1G3IA 3P26A 1UKEA 1L8QA 1BS1A 1G4UR 4ILEA 5BWMA 1UM8A 3MJRA 5CIWA 1UEJA 1KKLA 4EAQA 1KJZA 3U7GA 2E87A 1P9WA 4PTLA 3BB3A 2GKSA 2DFLA 2FFHA 1KO1A 4ABYA 3ND8A 1DG1G 1DOAA 4M9ZA 3ZQJA 2CL6X 1GIAA 4GPTA 2EFCB 3VKGA 4QGAA 2WWIA 2B6HA 1SXJE 2ZVQX 1NJFA 1IJEA 2HEIA 4E22A 3A4MA 2YKGA 4HZIA 2W0SA 1EFCA 2RH5A 1M8PA 3K70C 2J41A 1XTQA 3PUWA 2D7CA 1Z2AA 4BFXA 1Z3IX 2HF9A 5TV2A 1TTTA 4C2UA 1PUIA 4BECA 2XZLA 3KXKA 4QFMA 2REOA 1R7RA 2BBWA 3SYNA 4XVRA 4HLCA 2P6RA 3CRMA 4P4SB 4KO8A 2WKPA 2V7QD 5EJEA 2F1HA 4AD8A 4GNKA 1ZD9A 4B71A 2NG1A 2QUZA 3MRSA 5EUQB 1Z06A 4FXPA 2GZDA 4V03A 4US0R 1HURA 3THWA 1SQ5A 3I73A 4UKDA 4YDSA 4TL9A 2IL1A 4HAXA 5DH9A 1GP2A 5LDDC 2DCUA 5DE3A 2R65A 3EARA 2QPAA 4FMDB 4FIDA 5TDHA 2PX0A 5FPSA 4AIIA 2EWWA 2D7DA 3ECCA 2HUPA 2YC2C 1E2KA 5G53C 4PXAA 5EXSA 1F2TA 5IK2A 3CB4A 4EKDA 3S1AB 3THYB 2GF9A 2C99A 2YOGA 3LH5A 2AKAB 2CK3D 3BFVA 5E7IA 3EG5A 1ZNWA 3KB1A 1FOEB 2FG5A 3U3MA 3SJBA 2QRNA 1XP8A 4Q4LA 3IGFA 3NVAA 1S4QA 1ZM2A 121PA 4WXPA 4ZPXA 3CIOA 4XWAA 4ZKDA 2B7CA 1ZBDA 4H1VA 4YMVA 1FUUA 1W36C 1EFRD 1YZQA 4XJXA 2P2LA 3WNDA 4DDUA 2OBLA 1JJ7A 2J0UB 4PC1A 4BLTA 1KK0A 4FMDF 4CGZA 3GP8A 1MO5A 1G8PA 2VO1A 5CDFA 4TLCA 4CYMA 4Y0AA 4TL8A 5F98A 2IHBA 2R6AA 4ACAA 3QY0A 3T61A 1WP9A 3MMPA 3NIBA 1X6VA 4HB3A 3KL4A 3NBXX 4NMMA 1G8HA 5BN4A 3SHFA 3D8BA 1QHYA 5F3WB 3RS7A 2AL7A 3VR3A 3EIEA 4MYHA 4GOXA 2WTUA 1NVVQ 5EP1A 4MRRA 2GXSA 4C0BA 1XMVA 2VLIA 4GP7A 2BBTA 2ORWA 2WJIA 3OEHA 1S9DA 4CT5A 1Q1QA 3DKPA 3M0EA 2VSOA 3ONWA 2I1VB 1SZPA 2F9MA 3BB4A 3NTUA 2GNOA 1ZCBA 2CJWB 4BGDA 4LPSA 3UMFA 3KQKA 3B85A 1N5KA 3GJ8A 1SVLA 2IX3A 2OCPA 2Q3HA 1IN7A 2VHUA 5FUVA 4B44A 4DLYA 2OT3B 2DFTA 4OHZA 3MWJA 4AYXA 1DAGA 3BRWD 3HDTA 2X1VA 4B3FX 1KI4A 2QSYA 1GFIA 4V0OA 3CPEA 5JRJA 4B2IA 5KUTA 1US8A 2FPKA 2A9KA 4OQMA 2O0HA 3GEIA 1ZAKA 1R6BX 3I1FA 2OCYC 1II8B 2DBYA 1S96A 1Z0JA 3RRYA 3VFDA 1AS3A 3ZIAA 2XZPA 3VX3A 1MABB 3WRXC 3FMPB 1QG2A 1DE0A 1JJVA 1ETUA 4BZPA 3GPLA 4Q5IA 6Q21A 1IJFA 4HB4A 4BFYA 3TSWA 3DKVA 3A6PC 3VKHA 1ZUIA 1BMFD 5GJWC 2ZROA 1DAFA 4URZR 2ZSAA 2OFXA 3VHLB 3HPRA 4AKIA 3QG5A 3P4YA 1VTKA 3T5DA 3NEJA 3VU9A 1CULC 4MDFA 3DO6A 4LOAA 3L0IB 1CRQA 1D9XA 4V02A 1W4CA 2OCAA 5H1YA 1JR3E 2WWWA 4LK2A 2PJRA 2GEUA 4WXRA 3DEFA 4POAA 1SGWA 1E3MA 4XSGA 2OBNA 2OE2A 4D0NA 2ZI4A 3MWLA 5AJZA 4QBHA 2BWJA 3CF0A 1NVVR 1ZNXA 1FZQA 4LHXA 2KJQA 3QF4B 1KI7A 3T06B 3KUCA 2GK7A 4L9SA 4A0HA 1X8LA 3QBVA 4S35A 5KHOC 3QKTA 4YMUA 5DSZA 1OH7A 5K8LA 1E6CA 4HLUA 1S9HA 1ZM3A 1UBCA 4NYIQ 4AWXA 2F43B 1FMLA 2FJUA 2GJ8A 2JDID 1G4AE 1KYIA 2CHVA 1NLYA 4FWTA 1OIWA 3VQTA 4DSTA 3AVXA 3M4YA 3GCGA 3P27A 3I72A 2GXQA 3C4JA 4C30A 2RGDA 4V0MA 3GEHA 3SU8A 3IUYA 3KQUA 1RRPA 2FH5B 4BUJA 2REXB 5FBLB 4LGMA 1LV7A 5FL7D 4M9XA 1GOTA 1TADA 4Q9JA 1HQCA 3DVLA 4I81A 4P4SA 4FD2A 4IW3B 4NCJA 2YVUA 1E9SA 1EWQA 4D0GA 2EYQA 4FI3C 3HR7A 3SC3A 1KY2A 3LLUA 1C1YA 2OAP1 4BEBA 3LBHA 3V4FA 2V7QA 5G41A 3NBZC 2GAAA 2FGJA 2ZR7A 3DDCA 4DJTA 4BLSA 2WOOA 5C18A 3T1TA 4AKEA 5GJBA 4GI7A 2IUSA 3BAFA 2CHGA 3X1DA 1IBRA 4ON9A 5CM9C 4M4SA 3THXB 2CL0X 1X3SA 2IXFA 2KBEA 4N0DA 1ZMXA 2AWNA 2FSGA 2UZIR 4TSFD 3DOFA 3MLEA 4R2IA 5DIFA 3RS5A 2D3WA 3D31A 2IHYA 3S1AA 1KZGB 2KBFA 4PPQA 3THYA 3X1WA 1QHNA 3IO3A 4HLDA 3B2EA 3RDPA 2ZI5A 3BJIC 4L8GA 1XJQA 2QQ0A 4PPGA 3K0FB 2CK3A 3QUSA 4LYHA 2G77B 2AK3A 4B35A 1J8MF 5DLQC 1G3MA 4F7WA 4M1TA 4MDEA 3UIEA 4TMWA 2G0NA 1KZ7B 5E3HA 3WBKA 3SN6A 4PANA 3CRRA 4C7OB 1MRNA 1XCMA 4L15A 3HU1A 1F2UB 4FMBB 5A4JA 5EE9A 4DRZA 1DELA 1RYFA 4M1SA 4PC3A 2D06A 1NJGA 2F1RA 3K0AB 3PG5A 5SZIA 2HLDD 1UFQA 1ZNZA 2J0UA 4JLBA 4QL3A 1W48A 3AB3A 3WNBA 3AVUA 2BMEA 1QG4A 3CPJB 4GOJA 1OFHA 4BLQA 1ESMA 1MKYA 1U9IC 3DM5A 2IEYA 2O8BB 1HEIA 4IHQA 2H16A 1WA5A 2QI9C 4LI0A 3U4QB 1N2CE 1ZUHA 4JBWA 4LJ7A 4V0ME 5AUOB 4L9WA 3Q9LA 4LBZA 3V4RA 1NVXQ 1G7RA 1OPXA 1NG9A 1ZRHA 1EGAA 2OEPA 5LB4A 3TW8B 1HQYE 1H8ED 3V00A 1Q3TA 2YZ2A 3ASZA 5FOVA 1JQLB 4Z1MD 2EQBA 2UZ3A 3K0CA 5CLLA 5AR1A 4KFUA 2QP9X 2ZRHA 3NHBA 4PHGA 4WW0A 4OHWA 1MV5A 1IAQA 2BM1A 4EJSC 1ZD8A 3TAUA 3WMFA 4DSOA 4LYFA 3A1UA 1LY1A 1R5BA 2A5YB 4KHZA 4RZXA 4OQFA 5FOTA 2FSFA 1E0AA 3DPUA 3IPYA 2ZJ8A 1Q44A 1XTIA 5DI3B 2CJWA 1YZTA 1IOZA 3E70C 2ZJAA 4PHFA 2ZRFA 1XXHE 2NO7A 5TMPA 4PHHA 2IYVA 1GL6A 3OFND 1UADA 2ZIAA 3LVRE 2WIAA 3R9XA 3RS4A 4RD6A 5EE3A 2RGEA 2EFEB 2JA1A 2V1UA 4CW7A 1G6HA 4LUCA 2BCJQ 2ZU0C 1GAJA 1R2QA 1A5TA 1SXJD 4Q4AB 1N3BA 4ZDJA 2XGJA 3AF3A 1R5OA 1II8A 2ZJBA 3QXJA 4D4KA 4QBIA 1SXJB 1JI0A 2F9LA 1MABA 3A1SA 3P32A 2R6GA 4KVGA 2C9YA 3T15A 5FUWA 1E4YA 2F6RA 3B5JA 1KI9A 4IOMA 3R7WB 4G1UC 2R44A 1QRAA 2PEZA 2NO6A 2VH5R 3ZVNA 2CVHA 2GWHA 4MUBA 5D3QA 2O8DB 2QAGC 2YNMA 4C0HA 1FTSA 1BH2A 1Q22A 3IHWA 4MGKR 4P0TA 1NY6A 4JYBA 3LY5A 2Y8EA 4M1OA 5LPNA 1BMFA 4LSGA 3CX8A 4TYPA 2FSIA 3A1VA 3MCAA 4IKEA 1D2EA 2XTMA 2VP9A 3G82C 4TYYA 1H8HD 2XTNA 3BB1A 1OT3A 2G0TA 3H0KA 2BEKA 1EX7A 3DMDA 5LB2A 2LKCA 3K9NA 3EWAA 4KCGA 1GKYA 4HB0A 3W8RA 1SKQA 3TSOA 5JS8A 5EZ6B 4HEJA 4EUNA 5C4MA 2WWYA 2OLJA 3EZ2A 3QF4A 2GXAA 2WAYA 1DADA 2JLSA 1KAGA 3FYHA 4GBMA 4HAWA 4TWZA 2F43A 2QPOA 2JLYA 3P20A 3T12A 1G7CA 1IXRC 1Z28A 3UMSA 1E2DA 1E2GA 3CF6R 4RFSB 2B92A 3IKJA 1YZNA 2XSZD 3QPVA 2WMOB 3DMNA 1NP6A 1NNEA 3H86A 3VHXA 2GTPA 1P2SA 1FQKA 1ZIOA 1N0UA 2CLCX 2ZYUX 4D2IA 2ZEJA 3FE2A 2A30A 1XPRA 4JYCA 3FWYA 5FUYA 4AG5A 3U6KA 3NDBB 5JWOA 4HAZA 1NKSA 4YMWA 5FL7A 1XPUA 3TSZA 3VNUA 3U3OA 1DAKA 1OSNA 4M9QA 1U99A 5TARA 2FF7A 1XDBA 4OYHA 5K8IA 4JBYA 2GVZC 1TEVA 4LJ5A 5TB5A 4DCVA 3BD9A 1COWD 1J8YF 2YV5A 1EG7A 1QZXA 1G8GA 2BHRA 4OQNA 3KDSE 5FOSA 521PA 3THXA 3VR2A 2CHQA 2WJHA 3FFBA 3CW2A 4UNQA 3PR1A 4DEYA 1Z0AA 1AKEA 1XEFA 4I1UA 4M1KA 2WWGA 5CJ2A 2JAQA 2Q6TA 2J5XA 4JS0A 1YZKA 1E2PA 2XOKD 3RLFA 4Q9LA 4ZCIA 4Z54A 4R71A 2BBOA 4DLWA 3L2OB 1OXXK 1YU9A 4NCNA 4NYMQ 5JI2E 4LV6A 2J1LA 2WWFA 2EFDB 1WBDA 3K0FA 1DAHA 4R98A 4DB4A 1YRBA 3I8XA 3K09C 3IPXA 1U98A 2V4ZA 4QOSA 1XTRA 1GG2A 3RS3A 3SHWA 4C7OA 5IK2D 2JLVA 4FWIB 5FPHA 3F0TA 1F2UA 3KKPA 4RD4A 2R8RA 5B30A 1ZUNB 2ZE8A 3K0AA 1R8SA 2CE7A 1GWNA 3AKYA 3AVYA 1CU1A 1M7HA 4UJ5A 5D3MB 3FMOB 4HZUB 2G9NA 2IS4A 2DWOA 5DI9A 3KJGA 1NKTA 4MKFA 2HLDA 3KTAB 2FZLA 3UG6A 2A2ZA 2O8BA 4JVNA 3U4QA 1AIPA 2ZRAA 2V8OA 4OL0A 4RD3A 5G3ZA 3QJYA 1W36B 1R0ZA 2HCBA 1NSTA 1S3SA 1Z8FA 2P6UA 2QAJA 1T3SA 3KQHA 5DN6D 2HXYA 4LWZA 2FOLA 2BM0A 4HUTA 4L4UA 3U3KA 4YQFA 3AH8A 1H8EA 4QG7A 5JZVA 4Z1MA 4BZXA 4PAQA 5FBQB 2RHMA 3CR7A 3JVVA 3TMKA 1XEWX 1KK1A 2H18A 2ZYWX 2QEQA 1JR3D 4NL4H 3IDQA 1OXUA 2QG6A 4X8OA 2DWPA 3I5XA 4Q03A 1Z63A 5JWRA 3NC0C 5DYIA 2Q21A 3ASYA 3A1WA 4Q9HA 5DI3A 2C5LA 1HH4A 4JLKA 1AA9A 5FTKA 1JR6A 1RRGA 4XWOA 1VYVA 4C0QC 5C2JB 1G16A 3NH6A 4NZYA 1O87A 2ZRNA 3FTQA 3NEYA 4DXAA 5EE1A 1GILA 4B2PA 1T5IA 2BJWA 2KWIA 3QKUA 2OFOA 2P5TB 1YKSA 3BGWA 2JLUA 1SKYB 3OFNA 4NYMR 3KX2A 4HYYA 4MRVA 4Q4AA 1E2LA 1BYUA 4TMXA 2D74A 2Z4SA 5FTMA 4CEHB 1T8UA 4MGIR 1F6BA 1YR8A 2PH1A 4II7A 4XH9B 5SZKB 3NDPA 2ONKA 1SXJA 2NIPA 2I3BA 1PLLA 3KKMA 4NCIA 2PZGA 4HAYA 3T5GA 2YWEA 1KHTA 2IWHA 3I62A 2ZI7A 1XFAA 2JASA 3DZDA 4PHTA 5FI1B 4C9BA 3R7WA 4RVCA 4HUQB 3PEWA 2NQ2C 1UF9A 4B33A 4KV9A 3U3JA 1NIJA 4MRNA 2VTKA 2C98A 4TYNA 2ZI9A 2ZTSA 2O8DA 3PEVA 3QNUA 1D6JA 3IQWA 2G6BA 4DDVA 4TN1A 5C1BA 2NOAA 4IOKA 3QOFA 4XOIA 1Z0FA 1OH5A 2GZAA 5JS7A 4UNSA 1UBEA 4P32A 5H68A 4ZI2A 3QXSA 2C9OA 4BWYA 1UKYA 1VECA 4X8HA 2IUUA 2IT1A 1H8HA 1ZC4A 4N3NA 2WBLC 4DBLC 2C8VA 2H17A 1YHNA 3CBQA 1N0WA 1T4GA 1T3HA 2CVFA 1TF5A 4JMPA 2BMDA 2ANBA 1EFHA 3PUYA 1WRBA 1PLJA 1VPLA 3SS8A 3NH9A 2VPPA 1N6KA 2QRZA 1N6PA 3MFYA 4XSHA 4A4DA 1F5NA 3GLFB 4QBGB 3A4NA 4Q9IA 5CIQA 5TVKA 1MR3F 4RFVA 3RANA 2HCJB 4G01B 1SVIA 2W2XA 1RFLA 4G3XA 3X2SA 1G18A 2B7BA 4RFSA 4RZ2A 4IDOA 3Q7QA 5BYKA 2VRWA 5AUNB 1OXVA 4DLRA 2XITA 1V5WA 5FBRB 2J0SA 2XSZA 2W2TA 3KFVA 5JSZB 1VCMA 1WF3A 4BFSA 1M1YE 4I1SA 2REBA 4I99A 2J9RA 3UWOA 1Q0UA 1YJ5A 1Z6AA 4UXJA 1FTNA 1A4RA 1X8JA 2WJGA 1N25A 2D2EA 4NDZA 4KYUA 2FZ4A 3GMTA 2B21A 2IF2A 2OLKA 4LBWA 4GFDA 2CLSA 4A0GA 1H65A 1U8AA 2ORIA 3L43A 3M6AA 4A0FA 1WB9A 1Q1EA 4MA4A 3HR8A 4PO1A 1W1WA 3WBJA 2N46A 1COWA 1DTSA 1ZCAA 1P62B 4HATA 3JZMA 2F3RA 2RMKA 4GOKA 2GCNA 2OV2A 3C5HA 1ZM9A 3GLHB 3PUZA 5HPYB 4NH0A 1VIAA 1KO7A 4JT4A 2EVWX 2GAOA 1GNPA 2XOKA 3U44B 2DFKB 2RHDA 4IVPA 3WNCA 1W4AA 2VSFA 5FPTA 4BLOA 2C03A 2FFAA 4GP6A 2QT1A 3EZFA 1OFIA 4PSAA 3E2IA 2YC4C 1JEEA 1XXHB 4TZ6A 4DLUA 3K9LA 2V3CC 5G40A 3W6NA 4M0LA 4B76A 2PMDA 2ANCA 3ZGXA 4M2LA 5SZJA 4F4CA 5A5GA 1ZINA 1TNDA 1YR6A 2QGZA 1NVWQ 2YOFA 4KJZA 2CCKA 2FE4A 4OQLA 2RAPA 5D3MA 3LX5A 3GJ4A 1GSIA 4HZUA 3UWKA 1NIPA 2GF0A 3UG7A 1M74A 4UXHA 3KTAA 2XB4A 4RZUA 1IONA 4NONA 5AJYA 1E2EA 3GQBA 4A6XA 5JEEA 3VNVA 1E79A 2ZUCA 2BKUA 4MRSA 4B73A 2H57A 1C4OA 3T34A 2WVJA 2AX4A 3B82A 1Z0DA 3Q7PA 2R62A 2FFQA 4F92B 5FR2A 1AN0A 3WYAA 1XX6A 2XX3A 2NO9A 4ZDKA 2IYLD 2GBLA 4JIMA 3SBDA 5DN6A 4Z8XA 1SVOA 5F2EA 2HYDA 1L2TA 1XWIA 1D5CA 2GETA 1CTQA 1WCV1 4NTZA 4Q7LA 4RJLA 721PA 4TLBA 1HUQA 3SFZA 2OSBA 1JXMA 3IIJA 3GJ5A 1JR3A 4QM7A 5LBIA 1XB2A 4QGHA 2BEJA 1U81A 2PX3A 2ERYA 1I4LD 3M1IA 4PO9A 2ZS9A 3BORA 2GJ9A 4GZMA 3IEUA 4PAMA 4I4LA 4U02A 2FA9A 2C78A 2YINC 1NLFA 4CEHA 5TY0A 2ZRDA 3B7GA 1AJEA 1A82A 4B3BA 4B6FA 3AF4A 2PT7A 2FGKA 1O3YA 4TTPA 4KVAA 4DLXA 1GRNA 1U0HC 1FW6A 3EPHA 1G5PA 1ODFA 4HUQA 1JNYA 3TW4A 1PUJA 2C77A 2H1LA 1XBTA 3RSLA 4JKYA 1OB2A 2JLZA 3CPHA 4IRUB 2QGNA 2XTZA 1KMHB 2PCJA 5BQ5A 2QENA 1CJMA 1Z22A 2PZEA 4KSBA 4TTRA 1JBKA 4A8JB 2G1KA 4G0NA 4KYIB 3OESA 1Y3AA 3OEED 1GTVA 1KK2A 1G21E 1ZJ6A 1UKZA 4O2LA 5AJVB 1L7VC 5CYOA 1CRPA 1G291 1FP7A 4JL5A 3KB2A 4EPYA 2ZQ5A 4Q9KA 5J4HA 2QAGB 2FWRA 1II0A 4ZDWA 1XRJA 3L8YA 4MRPA 5BYJA 3BE4A 5KSZA 2QSZA 2BVNA 3Q72A 2ODNA 4YLGA 4JL6A 2P0EA 4CT4B 1HE8B 1CLUA 5KU1A 3AVOA 1U94A 2WJVA 3I3SR 4FCTA 3GLFA 1JB1A 1E98A 4DB2A 4LX0A 4B47A 4TMVA 5HZHA 2QMOA 2DWQA 3T1OA 3QKSB 3PJRA 1TAGA 4IVRA 4RD0A 3RVBA 1QHXA 3QBTA 4U00A 4BQSA 2IF0A 3RWMB 4EIWA 4KBGA 4K8OA 2IXGA 5FTJA 5CM8B 2ZYVX 5B58C 2EW1A 1KJYA 2WPDD 2FPLA 4YMTA 2DY1A 4ITRC 2ZRIA 5KPJA 1NN5A 4URXR 3CRQA 5JSZA 3AVQA 1B23P 1OKKD 1FNMA 2Q0HA 1UPTA 4LYAA 4Z51A 4QRHA 1SKYE 2ZSEA 2OG2A 1PJRA 2D4HA 4BRUA 1PV4A 3B13B 4A0RA 5CB8A 4A92A 1CBUA 3FHOA 3TK1A 2BJVA 1FNNA 3PXGA 2GZHA 4LDJA 4OI4A 5P21A 3LBNA 2ZI6A 3C14C 3ZS9A 3KQLA 1DO2A 3HPQA 3MSXA 5H70A 5JCPA 1HV8A 3QXCA 4C0KA 1OHHD 2Q9AA 2QN6A 2BIFA 2GEDA 1OFTA 3EZ7A 1D8TA 4TQAA 1QF9A 3LAWA 2OAQ1 1QVRA 3TGPA 3KQNA 1KDRA 4PR0A 4HI0E 4F38A 4TQUS 4B75A 2Q3MA 4WZBE 4PQFA 2GVDC 3GLHA 3HU3A 3NC1C 4Q1EA 4Q7MB 5JJIA 4GL2A 2X8AA 1Z6YA 2VSXA 3RNLA 3GJ3A 3EIHA 3U44A 1E2FA 1R10A 1VG0B 2P65A 4B32A 1VG9B 2PMKA 2VBCA 2F1IA 4M1MA 2MMGA 1OLOA 4V0LA 1XXHA 3KJEA 5B2ZA 1HT2E 1XD2B 1EK0A 2EU8A 4MKGA 4MKIA 1TQDA 1ZVQA 3C15C 3LW7A 3LRPA 5E4FA 3I4LA 2WZQA 3GLFE 1E0JA 4TT3D 2PL3A 1OIXA 2ZETA 1E9CA 1E0SA 2C9CA 3HWSA 4C0SA 5UKDA 2A5JA 3W9YA 4ARZB 4ZV4A 4BFTA 5EXTA 4D4LA 2ZR0A 2CCJA 2R6DA 2FU5C 3OIYA 4OI2A 1RIFA 3WYFA 3TIFA 4JZKA 3SQXA 1MO4A 1N6IA 4UXIA 2LWIA 2ZPTX 3N2IA 4JLMA 3IBGA 3BH7A 2V54A 3OIWA 4ESVA 4W7SA 4BFZA 4RD1A 3QSYA 1X1SA 1E94E 4BLRA 5J4KA 4RKFA 2QE7D 3UATA 2AKYA 3T1QA 2J0QA 4OHYA 3QIAA 3REFA 3VR5A 3RC8A 1XMJA 4GZLA 4ZIRB 4DZZA 3NHAA 1YVDA 2OHFA 5AJWA 1QHSA 1Y63A 1WBBA 2J87A 2ZRCA 2DR3A 5EP3A 1OIVA 2J46A 1KO8A 3B1YA 3TUJC 3X1ZA 2VL7A 2QNRA 2H7VA 3FKQA 3OE7D 2IYZA 4JLOA 4Q1DA 1RVDA 3BH6A 3GLHE 2DYKA 4QGGA 2WKRA 2A5FA 5DHFA 4DSUA 3ZH9B 2CLDX 3R8CA 5KDLA 3ZVMA 1VYTA 4LV8B 4HDCA 1GDDA 421PA 1KNQA 2Q9CA 4WIAA 3PEYA 1E69A 3VMFA 3IIKA 3TAHA 3ZD7A 3RS0A 1K5DA 4L5BA 4B34A 5HR5A 4TYWA 2QORA 2B8TA 1J90A 1KO4A 1KMHA 2F3TA 821PA 3KJHA 2JATA 2QZ4A 1CIPA 4I1OA 5KYKA 3SI7A 1VDZA 5AJXA 1NY5A 3DZ8A 4WAUA 1E9AA 2NO1A 1P4SA 4A8JA 4FMCB 3SE0A 5BN3A 4JLVA 4PFSA 3O8DA 2B8WA 4Q66C 1EXMA 2ZJ2A 1VHTA 3OEEA 2EWVA 2Q9BA 4UNNA 5JECA 4G5RA 4O0MA 5KSYA 3B60A 2QAGA 4Q1BA 3L8ZA 2ZS8A 1KI8A 2FV8A 4OJQA 4RCZA 3AUXA 1N5IA 3LXRA 1DS6A 1F60A 2ECKA 1CF4A 4MKHA 5IF9A 1S2MA 2RGNA 4QHSA 1E2JA 4YXWA 1IY1A 3LNCA 3ZD6A 4DC9A 1NMYA 5A0FA 3TVTA 2W00A 1D2MA 2GXUA 4URYR 1L4YA 4GT1A 3QKSA 4WOPA 2WV9A 2QTVB 1EESA 3GLGE 3LFUA 4FMCF 4PC2A 4GMXA 1KSFX 3U6BA 3CH5A 2VP4A 1JQJC 4EFLA 3I5YA 3U7FB 4YDHB 3LX8A 1T8TA 4TLDA 2IUTA 3ZJYA 1BYIA 1FL9A 2WPDA 4EPRA 5L3SB 4DIDA 5ELXA 4PQRA 3O8CA 2BKEA 2KE5A 1AKYA 1W4BA 3HYTA 1M2OB 3K9HA 3SJAA 1OKKA 5GJVC 8OHMA 4H9GA 4IJMA 1A1VA 1E0KA 1IN6A 1XTJA 3IO5A 4S2EA 2IWRA 4ESHA 5L8VA 1KSJA 1HTWA 2ZRLA 4DSNA 3BS4A 3LVQE 3UXMA 4JLDA 3C5CA 4C0AC 3I61A 2Z5FA 5J4VA 1II9A 3SYKA 3FB4A 1HE1C 2JLQA 3IBYA 4URVR 1K5GA 4J0QA 1LS6A 2W6JD 2DPXA 2Z43A 4DCTA 4X8LA 2VA8A 1OHHA 4JJKA 1N5LA 4R9UC 4HB2A 2A78A 3K70D 1IN8A 3P4XA 3SBEA 4OBEA 1FP6A 2IYQA 3T1VA 2E9SA 4QHYA 3KFXA 4LBYA 3WHLA 3K70B 2VQSA 4L16A 2JCSA 4JBXA 4MH0R 4B43A 4D6PA 4F4IA 2RGXA 3RSOA 1AZTA 1P72A 1P9NA 4DCNA 1OB5A 1G8YA 2XNDA 4XTRA 2FEOA 1NSFA 3FFAA 4QXAA 1NBMA 4C3ZA 4CEJB 4CEIB 4AKGA 1HA3A 2W2VA 1XD2A 1ZU4A 1QHHB 3CNOA 4IXNA 1VCNA 1FFHA 4GMDA 1CP2A 4B48A 3TUZC 4PPFA 1XF9A 3SJZA 3SR0A 4DIEA 3AEZA 4QJ3A 1P5ZB 1N5JA 3CX7A 3IIMA 3FPAA 2JLXA 4Q1FA 1NN1A 1Q12A 1Z0KA 3B1WA 3EC1A 1DARA 4GRAA 4TT3A 1W5SA 1NF3A 2QMHA 4ARZA 1RE0A 3A36A 1G1MA 2BC9A 2OZEA 2IS2A 1HT1E 2ZJ5A 1UBFA 4WBSA 1YE8A 2WM9B 1GL7A 2IYYA 2QT0A 1KJWA 3H84A 1T0JB 4PX9A 4Q1CA 1LNZA 5DYGA 2R9VA 3H1TA 1E9BA 4M22A 2AR7A 4LJ4A 4QC2A 1D2NA 2A7QA 2P6NA 2RCNA 5EXXA 2GILA 4E07A 1E79D 2HJGA 4BZQA 1KAOA 2GCOB 2QE7A 2ZR9A 3ZLJA 1GUAA 2VP0A 2L0XA 3ZDQA 1W36D 3W3ZB 4KAXA 3KXIA 2VHCA 4Y0VA 1G7SA 4TL6A 1XMIA 2FNAA 4ZIRA 1J99A 4DLVA 1G3RA 3GFOA 4IDNA 1K6MA 4PSVA 1NL3A 1I4TD 1V43A 1J2JA 1IN5A 1ANKA 3BFKA 2ZXUA 4BPBA 3OF5A 5IDVA 1E2MA 4BE7B 2VP2A 3B6EA 3ICQB 5HKKD 3FMFA 2AD5A 2WWXA 1OW3B 4FW9A 1DAIA 4IOJA 2RGGA 3EASA 3OE7A 3O8BA 4LJYA 4Q18A 5GJCA 1AK2A 3LLMA 3ETLA 3J81k 2ZITA 4OHVA 1JPJA 3QXXA 3AQ4A 2K5UA 2QQEA 1QDEA 1ESNA 3Q8XB 3ADKA 2WKQA 1NBME 4A15A 4DT1B 1NN0A 3O47A 1AQYA 3ZZ0A 4TMKA 1U0JA 1KSGA 1TF2A 3VAAA 2C96A 1DBSA 3UKDA 3ND9A 1SVSA 1DG3A 3BH0A 4BFWA 2WSMA 1EFTA 4B3CA 4A2PA 5GADl 4LYJA 2XAUA 2JJ2A 3C8UA 3TBKA 1SHKA 5HCIA 2HXSA 3GFPA 5HTKA 5JWHA 1YR7A 1N6NA 2V1XA 3C16C 4M1WA 1G64A 3ZS8A 2EFHB 2YJTD 3RABA 4UNRA 5DGXA 3B1XA 1R8QA 1E2IA 3D6TB 4E5UA 2HF8A 3L0OA 1XCPA 2ZYTX 4AI6A 2H8KA 3TKLA 2ZRPA 1OYWA 1TQ4A 1KSHA 1T6NA 2SHKA 1W0JD 1L4UA 3RC3A 2KI5A 3AP1A 3EZ9A 2J7KA 4RD2A 4Q4JB 1WE2A 2QMUA 3C7KA 4W5JA 3RRZA 5J5CA 1MO6A 2IYWA 1N6RA 4LJ9A 1SXJC 4LPKA 2C2HA 2HYIC 4OK5A 3NKVA 4YC7A 1CS4C 1KNXA 3VTKA 1Z83A 3GLIE 2CDNA 1Z29A 3NXSA 5B57C 3G0HA 1OYYA 5JJKA 1U8ZA 1E32A 2I4IA 2QMEA 3TQCA 3VKWA 1E2NA 3BC1A 5FI0B 4EQ6B 1J70A 1BIFA 5JMTA 3EC2A 5L3SA 2LCFA 1KO5A 2NTYC 4BFUA 2AFHE 2VP5A 2XNSA 3TR5A 2WMNB 4EPWA 3HJNA 5F9FA 5CLQA 2Z6VA 4KBFA 3QEOA 2R2AA 3LV8A 1RKBA 3DOEA 3ADDA 3CM0A 1KGDA 2IYUA 4WZAE 2GDJA 4JLPA 4UJ3A 3LA6A 4MGZR 4LHVA 4W5WA 5CITA 5KNCA 3N2EA 1U2RA 2BBSA 5JBQA 1ZW6A 3E5HA 2W6JA 2XJ9A 4QM6A 5JLJA 2JJ1D 3PUVA 3VR4A 2GA8A 3B78A 4MYCA 4HAUA 5G3YA 1IY2A 3B1ZA 3CRW1 5JFGA 2H92A 3GFTA 1P6XA 4D4JA 2O8CB 4K81B 3P1JA 1G17A 4URUR 4D0LB 1P2UA 2ZAMA 4PC7A 5JHGB 3EPKA 4UQOA 1JEDA 1P61B 2CXXA 4XIGS 2F7SA 2WICA 3GJXC 4EFNA 1W0KA 3PIRA 4URWR 3ADBA 5L3RA 4CEIA 4CEJA 2QM7A 5FUXA 3R9WA 1QHHA 4GSYA 2G83A 2V6JA 4DLTA 4NKRA 2NZJA 4IOLA 1MOZA 1JPNA 5K8TA 1E1RD 2VIIA 3TE6A 3O8RA 1OXSC 1GNQA 1CJVC 4OQXA 1Q1ZA 3W5IA 5C46F 3C41J 4CIDA 4WZ6A 2IK8A 3QKRB 2O0KA 4JVSB 2QP3A 1TUIA 3GJ7A 3W3AA 5CYPA 5L3VA 1RPZA 1W2HA 1KDTA 4P33A 4ZO4A 3TVDA 1M34E 3W6PA 1LTQA 1Q1BA 2WJJA 2QBYB 2J45A 1Z6XA 4IFBA 1QHIA 1IHUA 1XTSA 4RY2A 1U0LA 2IW3A 4D81A 2OBMA 1LW7A 4BLPA 2NGRA 2X2EA 5HCNA 2GCOA 1OF1A 1YZUA 1KY3A 5ANRB 1KI6B 4A2QA 5J4YA 1AM4D 1TL7C 2CE2X 4M1YA 4O3MA 2HV8A 3GEEA 3PUXA 2ZE7A 4NYJQ 3K8YA 4LJ8A 5EZ5A 5JEDA 2BMFA 1VG8A 1KMQA 4Q7JB 1TU4A 2XJ4A 2QP4A 4NPHA 1QVAA 1RW4A 4ZKEA 4AYTA 3AVWA 3A58B 2GEVA 3MJHA 4DEXA 2ZVPX 1G19A 2AHOA 3LWNA 1SVKA 2CL7X 3KJIA 3H4MA 3VR1A 4TMZA 1GKIA 4TQ9A 4DUGD 5HKKA 5IRCD 2UKDA 5EUMA 2RGCA 3TUIC 4O25A 2XXAB 3N70A 4QJ5A 4X8MA 1KDPA 3VR6A 4PZYA 4B3DA 3RYTC 5DISB 3GLGB 1ZP6A 1GNRA 1KDOA 4AK9A 2QM8A 4ACBA 5L3QB 2JLRA 4OHXA 3K0SA 2HT1A 5JHHB 4DT1A 4QHTA 3B8HA 3MWYW 5GVSA 2E1RA 3BFXA 4JJZA 1TU3A 1KIMA 1LFDB 1P75A 4A6PA 4JLJA 1SULA 4A1FA 3DL0A 4EJSB 1IXSB 2O8EB 4XWKA 3BBPA 4JSYA 2GBLC 4ZCMA 1G6OA 4D4MA 1KI2A 1QHGA 4Q1AA 4YMSA 1Z2CA 1E1QA 3ZVRA 1JALA 2D62A 5KPDA 2NMVA 3EX7C 1ZM7A 4XD7D 5EP2A 5JI3E 2R6CA 2EFGA 5JJLA 3MUFA 1VKJA 4ASUA 4LJAA 2WSSA 3QG1A 1E9DA 2AXNA 4I1VA 2WAXA 1UKVY 4NE2A 4NHOA 1W46A 1CJUC 5FPKA 4QKQA 1F3OA 1S1CA 1E96A 2I1QA 4JLAA 2GHIA 2NO0A 2Z0MA 1E2HA 3PV0A 2MSEB 4TYQA 3FDIA 3FMIA 1U90A 5JCZA 3D7MA 4DLSA 1I4DD 1MRSA 4GDFA 1ZYUA 4V0KA 1XZQA 3PCRB 4Q4JA 3MWKA 1W0JA 3QVUA 5HE8A 1LF0A 3AUYA 4NCKA 3V9PA 4EDHA 5IT5A 2XZOA 2PBRA 5F9HA 4PPNA 4M21A 4RSGA 2DHRA 2N1BA 4NYJR 4F91B 3ZZTA 4AURA 4E09A 1GZSA 1NVUQ 1JAHA 2N42A 4IVQA 3T35A 4BEJA 3OAAD 5FH9A 4EQ6A 5FBWB 4YXWD 2YWFA 1S1MA 1T9HA 1X86B 3Q5EA 4B3XA 1XJCA 3E1SA 2A3RA 4LBVA 5FR1A 3TRFA 1YQTA 3CZPA 2CCGA 1CJTC 1MO3A 4IDQA 3EAQA 5AUQA 4PO8A 1XD9A 2YWGA 3AF0A 5SZHB 2JIZA 2Z4RA 1B0UA 2G88A 2OO7A 1GRRA 3L0PA 3NWJA 2BV3A 1M7GA 5J47A 3EWSA 1Q3HA 5DHAA 1TUEA 2EYUA 4KU4A 5HE9A 2ZE6A 3EPLA 2ZANA 5LD2C 3B9PA 2GJKA 1G5RA 3WP0A 1HY3A 4Z8YA 2PJZA 4IEEA 1IN4A 2KB0A 2J7PA 3KZ1E 4QNRA 3R9IA 2FFBA 4KITB 1E4VA 3BWDD 4KFRA 5H8WA 1E9RA 2V6IA 5KDDA 5CDFE 1A7JA 1PZNA 4CDGA 1C9KA 3SQWA 3DM9B 2F55A 2BOVA 3ZQ6A 1P2TA 2JJ1A 4OKSA 2ZRBA 1XEWY 5DNYB 2O8CA 4A82A 2IYRA 4LHWA 3PENA 2O5VA 3F3YA 3PEUA 1GM5A 1LB1B 3UMRA 4FCVA 3TR0A 2J59A 2ZUDA 1TMKA 5JRZA 3SDZA 3ZVLA 3PITA 4B2LA 1DO0A 5AK0A 2FDCA 2AXPA 4DLZA 3FHTA 2IYTA 4IXMA 3MGCA 4LJ6A 1SVWA 4KODA 3F8TA 4ZCLA 5EQTA 3A8TA 3A1TA 4HLUC 4A9AA 4QNMA 5KNBA 2OUKA 1LS1A 3NBYC 1E1RA 2XNDD 1X1RA 3FHCB 1G5TA 3QKRA 1NBMD 2J0VA 1IM2A 1I2DA 3MD0A 4Q47A 3U5ZB 1CR4A 1NG1A 1VCOA 2IC5A 2ODEA 4OI1A 2ONJA 2QBYA 3GJ6A 4F93B 1TX4B 1FUKA 4PZZA 4W5HA 4C2TA 4G5OA 1W49A 1XEXB 5E7MA 1XCGB 3LDAA 2CBZA 1P60A 2WJYA 3U7HB 5E95A 1JECA 3W34A 2ZRGA 1CR1A 3RAPR 4AG6A 1VMAA 2ZSDA 4MQBA 3NG1A 4OK3A 4TL7A 1KI6A 3AF2A 4Q7KA 5FPYA 2DB3A 3SNHA 4Q21A 4RKEA 1OV4A 5TXGA 3EA0A 4K46A 1AQUA 1CR2A 1VCIA 1YR9A 3CNLA 1N6HA 2VEDA 2IA5A 5FBVB 5KTYA 1OH6A 4H1UA 4JVLA 4N1AA 4B6EA 1G3UA 4AYWA 1OFUX 1LVGA 1CJKC 2WOJA 1BKDR 4E03A 1E9FA 3EPJA 3K9GA 2FX3A 4BRWA 2O52A 3REGA 3AVTA 5KDOA 4HDOB 1U9IA 3CO5A 3G5UA 2ATVA 4HAVA 4AC9A 3FVQA 2ZRKA 3AKEA 2XXAA 4Q01A 3CR8A 4DUGA 2V55B 2MSCB 3AGQA 1ONBA 2JEOA 4KLZA 3SZRA 3SEAA 1FQJA 4JL8A 1W2GA 2ZJOA 3W8NA 4DHEA 1KI1A 1OXTA 2GCPA 3BK7A 4BFVA 4TLEA 3GLGA 1DAMA 3GLIB 5L3QA 2QTHA 4D26A 1NMZA 1XJ0A 4LC1A 1VYUA 4KLNA 5FTNA 3RHFA 1CEEA 1ZM4A 3EA5A 4NYIR 1AS2A 4JSTA 4ERNA 2VP6A 4EJSA 3JZAA 5AUPB 1S3GA 4R7ZA 4U5XA 1K8RA 1EFRA 2ZAOA 2ODWA 3FKSD 3SOPA 2O8EA 4JVMA 3L0SA 1EX6A 3AF1A 2C95A 1QBKC 3IQXA 1FX0B 3BOSA 5FOWA 2QPTA 2JGNA 1S0UA 3DHWC 4BASA 1YZLA 3AVPA 3CH4B 1OE0A 2ZUBA 1UAAA 1NN3A 1ZD1A 3PVSA 3WHKA 1CR0A 4D25A 4Q19A 4MITA 5AWFC 1J7KA 4Q48A 4XD7A
chains in the Genus database with same CATH superfamily
3G5AA 1RNLA 4B8ZA 5BPFA 5M2QA 1P8JA 2HSEA 2BLNA 2E6UX 4E51A 5FNVF 3KSAC 2J48A 4HEA1 4ZYTA 3IILA 5EJ8A 2J31A 3DPSA 1PTJC 3BN3A 4PQYA 2QLNA 4GF5A 2ID4A 1W44A 3HWWA 3HU2A 4LVUA 1BD4A 2XQKA 1JZTA 3PQEA 1U1DA 3HA7A 2LE0A 3GT0A 3GDOA 2Y76A 3H3FA 2QYTA 4RV4A 3HXMA 2VF8A 3ACBA 3GWZA 1ZIPA 3KALA 4LMPA 3DT9A 1WKBA 2MYPA 1TJ4A 3BIFA 5DVZA 4C7MA 1DZ3A 1S8FA 5BXQC 1OYVA 3MS4A 4XYGA 1EPUA 2GB4A 2Z98A 3WG9A 1K6XA 1SUSA 4R5MA 5FDFA 3GIWA 2JAUA 2DBRA 3ANXA 3CISA 4Z9XA 1L5QA 5EPEA 3UQYS 4D02A 4CL0A 2HQOA 3JYOA 1BCSA 2C00A 1UIMA 4UEJA 4RULA 2VSNA 1ELOA 9ABPA 3AKDA 3ABRB 1M1UA 3D6AA 2BSXA 3HVUA 2FSVA 1PBTA 2AWOA 1T0PA 4BKOA 1SY7A 1KZ4A 2XYGA 4CZ2A 1ZCFA 1BNCA 3NOXA 3LUKA 2W0MA 4BVGA 4ER6A 3NEPX 2J4CA 5ALVA 2DPMA 2MMCA 5KOYA 1WXHA 3DYBA 1XNJA 3ZHCA 5I45A 5IMSA 3GVXA 3IAFA 3Q85A 1KA9H 1IXZA 5KAPA 4XVQA 1GAQA 5AVKA 3DFZA 3EZLA 3TJZA 2PGAA 2YV1A 3LD9A 2UUBB 3T9CA 4UOZA 1KI3A 2GD0A 3KP1A 5KNDA 1IEQA 1RXSA 4MQLA 3IHTA 5ER6A 3RTAA 1NI3A 3QFFA 2FLVA 4K6FA 2ATEA 4CV2A 2P3SA 2W6ID 2OBBA 2XBUA 3VX4A 2CD9A 2DWCA 4JC8A 3VPAA 2QVBA 1NUQA 4MJ7A 1JG2A 3ROPA 2G0AA 2IH2A 3UT5A 1C1DA 1PNOA 4DCCA 3D3WB 4WOJA 3JRNA 4CN8A 5JAIA 1OI3A 1T1IA 2XA1A 3AIOA 3NJ4A 1XCBA 3LX6A 3U7EB 3ZKWA 1RRCA 4ZGWA 3FTFA 4D80A 1WDTA 3B9QA 5E2IA 3MWDB 5J2TB 3NO4A 4MV9A 1XHLA 4BFCA 4JJ6A 1WU7A 2VXCA 5JXJA 2O3UA 1GA6A 1U3CA 1A9SA 1XP5A 2JI6A 3HGMA 3K0BA 5T41A 3RSCA 3SG0A 1E77A 4A2WA 3DCYA 4YHHB 1XDWA 1BOFA 3BE5A 2JANA 4IDFA 5IYZF 1W5TA 1H3EA 2VF5X 1BH6A 1GZ3A 4MUXA 3AKCA 1VJ0A 1TO1E 4EJFA 3FCXA 1NUAA 3EW9A 3Q0IA 4NU8X 1TPZA 2WIBA 4DMUB 1T5LA 2AC7A 5HNKA 2FW6A 2ODBA 1G55A 4FHGA 2HA5A 4L85A 4W9MC 1RWQA 4GPIB 3P52A 4WN3A 3GRKA 1C9MA 4DDTA 1YULA 3H13A 2JDIA 2K4MA 3FJYA 1E5XA 3WZMA 5K0SA 4ZZ1A 5I4CA 4R84A 3CONA 5TT1A 3GP5A 1FEZA 2BONA 4R4JA 1L4EA 2ZSFA 4DCGA 2K2WA 2E55A 2PPVA 3W8DA 3LBIA 5K6AA 3GK3A 3KTFA 3R7DA 2ZBDA 4RGYA 4IUCS 4P4UA 4F4HA 4ZOLB 3T5PA 2XE6A 4JI1B 4CF7A 1HR0B 3GG2A 4MVJP 2I91A 2AKEA 3CVXA 3UA3A 4TV9F 3INGA 1WUHS 1HC7A 3AEUB 1MN6A 1K7YA 2YJ3A 4PWYA 5A0TA 3K8QA 3KKQA 4RVGA 3VO2A 2FTKE 1Q1GA 3HP7A 1HLFA 5LZ9A 3C3WA 4G4JA 2MJLA 5EHXA 2AN9A 4WGFA 4KIUA 2FN4A 1EUCA 2GPYA 3WRYC 3SC4A 4CRWB 4EJ0A 4HVCA 2AVDA 5C8ZA 3L8FA 1T5DX 3L4BA 3QF7A 4OHBA 5JXGA 3W5AA 2WTAA 4G36A 1O7JA 1EXNA 5AESA 1EGVB 2QD2A 3NBFA 4PG6A 3TZHA 2O50A 4DY4A 1GZ4A 2X7JA 3GJZA 1GPMA 4BDTA 1E62A 2I3GA 4IQ0A 4NBKA 1AT1A 3KV1A 1H2BA 3G02A 3ZWMA 3AP2A 2FPPA 3V4ZA 5CB6A 3EBOA 5KTOA 3F5FA 3TIVA 4V2UA 1W25A 3N2ZB 2IXEA 3PE6A 3BQMB 4QJIA 1U0OC 4MVXA 4X20A 5CDUA 3LIPA 5FOUA 3FF4A 3RU7A 4CDNA 1ZHFA 4QYTA 1P7VA 4NCHA 3IAAA 5BV1A 1HYQA 4IEIA 2GZMA 4DMRA 1T0HB 2IY8A 5K3DA 2HUNA 2Y9MB 4KKXB 4MQUA 1EWRA 3QEKA 3ZY6A 1DBQA 3H2HA 5FLXA 3BERA 5K03A 2X42A 4Q4DA 3ICVA 3SYLA 3CF4G 1MGOA 3NHJA 3TLXA 1EXVA 4WUVA 1AGRA 2FX5A 4S0ZA 3EF3A 3V4OA 3WZLA 5L4LA 4WNAA 1K8QA 1DVRA 1RZ3A 4F71A 4CWAA 1XPOA 5B64A 1U4SA 3CRNA 3HZRA 2WM8A 4CQLA 3AF6A 1XDSA 1BXGA 4IDDA 4KW7A 1JG4A 3DPIA 4MTCA 4E7OA 1F2TB 3PIIA 4P36A 4ER3A 4NFLA 2RH8A 1LLDA 2EWMA 2VDMB 3W04A 2GLXA 1GZUA 1CRWG 4QDZA 5HZKA 2AYYA 2HMAA 3I92A 2ONZA 5CR9A 2NSLA 2PKEA 5CHEA 2I6UA 3V8EA 1AQLA 4HY3A 2VJAA 2AJ8A 2GDZA 4OBXA 3VSCA 3WLSA 1POWA 1E4OA 1HDOA 4BB5A 5FP0A 4LCBA 3UB3A 2DHEA 1L4LA 5GM1A 3ZHSA 1SO8A 3F3MA 4WZAA 1A9RA 1IOVA 2FQ1A 1MJHA 3WXMA 2XVMA 1TQ6A 4KB5A 1SWWA 4I9HA 2O3SA 4NBVA 3GUVA 1QYRA 2CVZA 4TV8F 3DUWA 5D6OA 1LKZA 4JKIA 2G40A 3RTEA 2XEXA 3IV7A 1L1EA 3UYKA 1E1QD 1LPBB 1DMRA 1W47A 3SFTA 4BLVA 5IHXA 5KIAA 1P3JA 4YJ3F 1ZGBA 5LKAA 1Y9AA 4CXMA 1T4CA 4RANA 2AD1A 2ZJ1A 1AN9A 1K3UB 4PYIA 3QX7A 1VHLA 1DAEA 3EZXA 2YIJA 5GONF 1W4RA 2F2TA 3LXXA 4J9UE 1XQVA 3GGGA 4KIWA 1CXZA 3E5MA 3QKWA 1KR5A 4E5MA 2NACA 3KOYA 4I66A 2HWUA 1NONA 1FXUA 1TMYA 1GTL1 1GQQA 3T6KA 1PG2A 1DJQA 2XUHA 4A8HA 1Z4IA 3K0EA 3PFIA 4FU0A 2RGAA 3IQIX 3KVOA 4P81A 2WWHA 4TVBA 4F4JA 1G41A 5M04A 2GRJA 4QIHA 5KSOA 2H3HA 2LR0A 2UZ1B 4RY8A 5J4LA 3KD3A 5MF6A 3FNQA 1P2VA 2J6CA 3GXBA 4MGHA 1G98A 3ST7A 2CEAA 4IQFA 5K99A 1BCRA 3DOJA 4KLRA 5FWYA 1G6KA 3MAAC 1N1DA 5JDIC 1GQFA 3EQ8A 5H80A 4KE8A 4X3CA 1GL9B 1DBWA 2JGFA 3KEOA 1NMXA 3MZ0A 3NWPA 4JT2A 4MGYR 4PZLA 2YWXA 4H35A 3VU8A 4MCIA 2CNWA 2P6OA 4HNAB 1H69A 3CKLA 2I8CA 1W75A 2AFIE 3I05A 2Z2YA 3FHLA 2XBMA 5L7WA 2XZTA 2XE4A 1FA9A 2YMQA 5HRUA 2GJ4A 3AR4A 3LA8A 1UC8A 2OCBA 2FUKA 2OKCA 2JIZD 3LHKA 2BN4A 4JQSA 3WMEA 4CDRA 1ACMA 2CNKA 2P9BA 4OFBA 5J47A 1ONPA 2PIDA 4BCBA 1MX3A 1H2AS 3FCOA 4TMTA 1VDMA 2H07A 2Q7DA 1PEDA 2YYZA 3SSMA 3VPDA 3KQWA 2H5EA 3I04A 5BP7A 5LD2B 4U3JB 1KTVA 3C3XA 2DGDA 1EFVB 2HT6A 2NV0A 4KLCA 4RXUA 5JNUA 2ZIXB 4HDKB 2OILA 4DVGA 6REQA 5EIXA 2Q5IA 3AUKA 3W90A 1NDUA 1PWYE 3O03A 4I4TF 3EG9A 3UGQA 4DR7B 1WMAA 1YKGA 3B12A 3D59A 4PQGA 1USUA 1QLJA 1VI6A 2QJRA 1YZGA 2HDHA 4YQYA 3UHFA 4LC0A 1P4RA 3KJNA 1T2EA 1I1NA 4KXXA 4YV2A 2CV2A 3MHPA 4EPVA 5AVVA 2YJNA 1HG1A 3LCRA 3LRXA 5ALGA 4S1NA 1Z33A 4UVIA 3BF7A 5A4DA 5JATA 3LO5A 5CFOA 1WKCA 3BGIA 3QX9A 4HH4A 1UKEA 2Q3DA 2IXBA 3SYTA 3V55A 3FR8A 1UEJA 2JZCA 2I7DA 5JQWA 2ZTUA 5LYJA 1M2EA 1P9WA 1MV8A 2X6QA 1OA1A 3B3FA 1NW7A 4JT8A 3DFUA 1O95D 3E8MA 3VC2A 4CMIA 2O7NA 2EKQA 3ETDA 3MWEB 3ONFA 4ABYA 1KZ9A 3PXBA 4ZAGA 3L01A 4WOCA 2DG2A 3OQPA 4KX3A 3EGVA 2C7BA 4QWWA 3ZQUA 4HGRA 1UDAA 4PPYA 4AXBA 2ZCUA 3QEBZ 2IBTA 1T26A 2GVNA 4E22A 2HEIA 3CN7A 3DTYA 4ZVUA 1UM9A 4IVNA 1DWQA 4GUDA 2ADMA 5CIYA 4OJYA 2RH5A 3C5EA 4UFNA 3HBJA 3EAFA 4BKUA 3LY7A 1KC3A 3E5NA 4DIKA 4ZHSA 3E23A 1XTQA 4CI9A 2C2GA 3LCUA 4B6OA 3OLZA 1Y5IA 2X5XA 3A2KA 2CZQA 5AXDA 4QBKA 1TD1A 2O59A 4LF6B 4QFMA 3DA8A 2REOA 3G5TA 3I3OA 4DW8A 1E6LA 1DCMA 1CS0A 2F8SA 3GZ4A 4HLCA 5LA6B 3CRMA 4RH0A 5ALNA 1OBVA 4KO8A 3AK4A 4KTTE 2WKPA 2WM2A 3A4TA 3MMXA 3PQ4A 3B6ZA 3X0DA 3EYAA 5EJEA 4S1OA 2ZK7A 2GPWA 3EW7A 1MXFA 1M5UA 3NS7A 3FX2A 3P8ZA 5EUQB 2YXEA 1CDOA 1R8XA 4B71A 4F3NA 4KE7A 2UYOA 1TJ5A 4FXPA 3ITEA 1VL6A 2CUZA 4V03A 3SOZA 2AE1A 3DTVD 3WLQA 4RTQA 4YRBA 4EKIA 3IERA 1SQ5A 1QTQA 5B7PA 3I73A 4UKDA 2XCQA 2FDRA 3W7BA 1DFIA 3LCJA 1A1SA 4QBTA 1UXJA 1O6GA 3A70A 3I2JA 4HAXA 1XT6A 1GP2A 2GEKA 2ZBQA 4ANFA 2PUVA 1AF4A 1TYCA 7ABPA 2C7PA 4UZSA 5JJBA 2NU6B 3A3YA 4FIDA 4FMDB 3WA7A 5IARA 1K6IA 4RE6A 4C7OA 5IK2A 4EKDA 1ZD4A 1ONOA 3KQYA 1QX4A 1EK6A 4PEVA 2C99A 1TYZA 2YOGA 3KSBC 1SEPA 1N2GA 2X0IA 3MMSA 4E5PA 4A5OA 3K0KA 5LKRA 3DBRA 4G8CA 3UCXA 4RA9A 5DW3A 2WZBA 1S02A 3B1KA 1Q0QA 2XT6A 1LQUA 1B00A 3DEYX 5BVHA 1XP8A 1EX9A 1URPA 3N8KA 3QGMA 1Y4ZA 2AEJA 3Q3GE 2C61A 4ZD6A 3NVAA 1J33A 1H05A 4R3UC 1B14A 5D00A 3WYBA 2CHFA 2QOEA 4XWAA 2HJRA 2D6FA 2B7CA 5C1IA 3DC2A 4S1PA 3S4YA 1YZQA 3N3AC 3HKEA 1IZ9A 4X95A 1Z2DA 2P2LA 5LLDA 3CVUA 1USKA 3MGGA 2OBLA 4MUMA 1MJNA 2PBZA 2J0UB 3WB1A 1TT5A 1KK0A 3PA6A 5HS4A 1D2HA 2O7VA 2JGMA 4OSEA 5IC4A 1MP0A 2JD2A 1KEKA 3GP8A 1G8PA 5DBGA 3MRVA 3QVXA 5CDFA 3P9ZA 3P4UA 3SHOA 2YWRA 1SJ9A 4TL8A 4MUHA 2R6AA 3MRTA 4ACAA 2PKQP 1SCJA 4M99A 2VAXA 4ZREA 2NP6A 4DZRA 3FWZA 3MOSA 1PP4A 3MMPA 4HB3A 4LF7B 1EBFA 4KIJA 4S1VA 2QYOA 3N2KA 5BN4A 1A27A 2HRCA 2IKQA 2QI9F 1LEHA 3SHFA 3ZW7A 3D8BA 1QHYA 2E85A 5F7XA 4N48A 1JG3A 2CHEA 1NBIA 3IQGX 5AKYA 3PHLA 1FBTA 3RVPA 1B6RA 2VWPA 4GOXA 2H06A 4J16C 3SLKA 4BNVA 5EQJB 4C4AA 4C0BA 3CW9A 3WHPA 2VLIA 3PQDA 2CNBA 2C8KA 4GP7A 3ZNOA 2NZUG 3OEHA 1HEUA 1G4HA 1X7DA 2NVBA 3UA4A 5TR9A 3DKPA 3T7SA 4MW9A 1E60A 1PEAA 1KEPA 3ONWA 2CC2A 2BH2A 2I1VB 3NTXA 4ZQFA 2F9MA 1U7PA 3NTUA 3OJWA 4TXJA 1ZCBA 2CJWB 1PZMA 5GP1A 3UMFA 3DFMA 1KH3A 2W2OA 2FCAA 3GJ8A 1SVLA 1UQUA 1XN4A 2EJUA 3GROA 1RYDA 3V4PB 1ZO8A 3W3AH 3MELA 4ZOCA 3MWJA 4JP1A 3JV7A 4LOKA 4B79A 4EY8A 2Q5FA 2X1VA 4BO2A 1H22A 3H6GA 3PJDA 3NWEA 3E7PA 4ZTUB 1A7KA 1UWKA 3GVIA 1LK7A 2A9KA 1HLDA 2O0HA 1ZAKA 1OZAA 1R6BX 3OG9A 1II8B 2DBYA 1ISPA 1S96A 2PGJA 1UMKA 1ZN9A 2MOKA 2V7UA 1DIGA 4QQNA 3ZCPA 5KYXA 2BTQA 3SM3A 2I3ZA 3BQ9A 4Q9NA 4QOGA 2AN5A 2OWEA 1JEQA 4D0RA 3NETA 4RIGA 1GSAA 3DNFA 1ETUA 3V7UA 4F1WA 3DZIA 2FAXA 3SBOA 1P2BA 1RAEA 5DT9A 1H4VB 2HBYA 3M6FA 4BFYA 4YRDA 3TOVA 4AZ3B 1JDBC 5K0NA 3VKHA 1AXEA 1ZUIA 5GJWC 2B4YA 1DAFA 4TOIA 2OM6A 5IEJA 3H75A 2I4TA 1CUFA 1DV2A 1A7AA 4W9RA 4EP1A 3NEJA 4LJSA 1CULC 1GUYA 3VISA 1O0CA 4MDFA 1E92A 3DO6A 4V0RA 1CRQA 2YXNA 1E7MA 1HRKA 1W4CA 1JR3E 2XNHA 3L93A 3D4NA 3PHCA 2A1TR 2XTJA 3N86A 3OTQA 4LYGA 2OXIA 4POAA 1SGWA 4DJEC 3SHQA 3SMVA 4XSGA 2CF5A 5C1DA 3SY8A 2OFPA 4LG1A 2QTNA 3K6SB 4NOMA 2VJOA 3GGJA 4CHTA 1ACLA 5IZ4A 1DSSG 3CF0A 1NVVR 4QUGA 3ER6A 2KJQA 3GAZA 3QF4B 1QIDA 4FBGA 2GK7A 2WTEA 4G0MA 2Y0CA 1X8LA 1YC5A 4PGHA 4S35A 2QG9A 3QKTA 1KOJA 4YMUA 5KYWA 2B4TO 4B3MB 3OU6A 1AB5A 4Y2GA 1INLA 1KJ8A 5C32A 2M6RA 4AWXA 3DL7A 1JUDA 5JV5A 1FMLA 2HFKA 3OUUA 4Q82A 1OC2A 3SYMA 5CRIA 3IQDB 4GRIA 4FWTA 3I1JA 3VQTA 4BAGA 2BEWB 5LZ2A 4JP8A 2BYTA 3TZKA 5F73A 1GU7A 3IL2A 2GXQA 1S7CA 4IDBA 4C30A 4B4VA 5K6TA 2XOEA 5BSWA 2PV7A 4C7JA 2AZTA 3WGUA 3SVTA 3VHXB 1JU4A 3OX1A 3ROFA 4CNQA 1BWRA 3IDOA 3IUYA 4RJJA 4AX8A 2FH5B 2BJHA 2NV2B 3CSSA 4HGNA 4M38A 4BUJA 4YCDA 3KQUA 2G5PA 4GKKB 3E0QA 1LV7A 4LGMA 5MN4A 3AJEA 3KR2A 4IP0A 4UUBA 4NMHA 1HYHA 3L8DA 1V39A 5T4BA 4QXPA 5BW6B 4NCJA 3JCZA 3FVWA 5BY2A 1SRQA 2I1WA 3NZEA 4Y18A 4FI3C 1T9KA 3BMXA 3HK2A 1YC2A 4PBSA 3LBHA 5B3AA 2V7QA 2HDWA 5G41A 2ECFA 1E5LA 3DDCA 3D3NA 4GBJA 3WGVA 3EQ6A 3VR2D 5C18A 2R8ZA 1TZMA 4RDHA 1LWNA 2Y27A 4TUYB 1QVZA 3BAFA 2WDPA 2ZOSA 3REQA 4Z4HA 1I4EB 1GGHA 2X1LA 4PYOA 5AVOA 4M4SA 5H3HA 2CL0X 4UUQA 4FM9A 3RUAA 5L6LB 4BS9A 1ZMXA 1DBRA 1VE3A 3M8KA 4RTJA 3FVVA 4YHBA 4GPZA 5IXJA 3DOFA 1FFAA 2WY2D 2FKNA 3MK31 3P0HA 2D3WA 3RS5A 4BMPB 3D31A 2IHYA 4JR2A 3WLHA 3THYA 5ALJA 5EQDA 1QHNA 4QUIA 4QRIA 1SB8A 1BS9A 2IHUA 3B2EA 5LZ4A 1Q84A 3DDWA 2ZI5A 3ZZNA 1GR1A 1VZ3A 2JFVA 3EXG2 3K0FB 2CK3A 4Q3BA 3PFKA 5G1NA 3DTTA 1J24A 1HX7A 1GPLA 1VGVA 1XZAA 2AMVA 3G8YA 1G3MA 4O4LB 1U8FO 3E81A 4F7WA 1BKYA 1FYXA 4II2A 4D97A 1NW6A 2PJUA 4JOSA 4K28A 4L15A 2E5FA 4CLHA 1BC5A 5EE9A 2EIXA 2AFIB 1DELA 4MULA 1BWQA 4AXXA 2C7QA 1NJGA 5SZIA 4ALNA 1SBIA 3UM9A 1CUEA 5ER9A 2YVLA 3OZEA 1C8KA 3PDJA 4QL3A 1BX0A 3O92A 2WZCA 3L6CA 4JUCA 4LTMA 3IOBA 1V8BA 4AUNA 4YPVA 4G0UA 2CXSA 4MWOA 1NBOA 4QOEA 1LX7A 2IZ0A 4JB0A 4L6AA 6NULA 3DZFA 3F98A 5CTAA 2YV3A 3H7AA 1RMQA 2H16A 1AUOA 1CZUA 4AIRA 3HXQA 4LJ7A 5AUOB 3UJ9A 2DQSA 3V4RA 1O57A 1YDWA 4EYGA 1ZOLA 4TKMA 1L8AA 1EGAA 5D3ZA 2Q5JA 2OEPA 4GIBA 5EYPB 4I0WB 5HF8A 4ZC8A 3V00A 3WS7A 3VZRA 3ZXSA 4RVSA 3IUMA 4JAVC 5FOVA 1JQLB 3N58A 4IDCA 4QDOA 2FHSA 2I03A 4RDXA 1JHRA 4KFUA 5DCYA 1MV5A 3TTSA 4CKEA 5LOVA 5D5PA 4EJSC 1ZD8A 3TAUA 5KQGA 2F62A 1IXYA 2PGNA 3PL5A 1R5BA 2A5YB 4FE7A 4LYFA 5JMPA 4OQFA 1EE2A 3MSCA 2FSFA 2O3RA 1IRIA 3BHMA 3LNTA 5I9SA 3BXGA 4FT4A 3BE8A 5ICMA 4IV8A 4GOND 1BXRA 1CK4A 2DERA 4CTNA 3LFTA 2BFFB 4Z9AA 1PJSA 4KRYA 2ZJAA 3DBIA 2C31A 1G20A 1JE0A 2NO7A 2FHPA 1DKPA 1WDWB 2OXTA 4JA0A 2DBQA 2C20A 1PGPA 2BI4A 1UADA 5E6SB 3LVRE 2WIAA 1JVNA 4RD6A 3OZ7A 2EFEB 3U7QA 2V1UA 4NPCA 4F11A 3VTFA 1R2QA 3BRWA 4Q4AB 2CXQA 4J43A 1J0DA 2X9VA 1JXAA 3VZDA 2PTGA 5I7OA 1JQBA 4HDAA 1WMDA 4KQ6A 4D4KA 3G1UA 3WAGA 1JI0A 2N3ZA 3HXPA 3KOZA 3A1SA 3BTVA 5K09A 5BSTA 5ICSA 5HF6A 2Q6VA 3GOHA 5EN4A 1F3LA 1B3BA 2EBFX 1BCRB 1I6KA 2VJMA 3DLTA 1Z73A 3R7WB 2IHKA 3IP3A 4G1UC 1P0PA 4KQJA 1DGQA 4O1MA 4BNNA 2WHYA 4EGJA 4J6FA 2VH5R 1DX9A 5E0OA 4F4UA 5K0BA 4IMRA 4KAAA 3CW8X 5D3QA 3WK9A 1NE2A 4R1NA 4WLEA 2O8DB 4B3JA 2DSNA 5JNTA 3DZBA 4P0TA 2IV3A 1R6TA 1D03A 4UHCA 3PX7A 3GJTA 3ONDA 4I50B 4JR1A 2A4KA 2LDBA 2Y8EA 1E3DA 3O95A 4M1OA 1C41A 2OHVA 4OXYA 5LC1A 1FPQA 1OQAA 3WLMA 3MCAA 3WAKA 3R7NA 3ADPA 4TYYA 2VT6A 3CG0A 4ER5A 2XTNA 3BB1A 3GGDA 1MOSA 1LSOA 1KH2A 2E18A 3BIXA 4IGIA 2E4XA 5I7AA 5TQ2B 1YJQA 3AR3A 3FIUA 3K9NA 3VR5H 3GJSA 5F1OA 4UUNA 1C0LA 3DE3X 3BD7A 3EXFA 2DE0X 4IXDA 4OREX 1PFGA 2XECA 3QNWA 2AR9A 4HEJA 2HA7A 4EUNA 3WJAA 4FQ7A 2OLJA 4MV4A 2XYRA 4LXXA 4O4JF 4B46A 4RTKA 1KYYA 2WFMA 3PNPA 3W1VA 2JIQA 3ZGLA 1KAGA 4M8IA 5CDTA 4L6IA 5G0VA 1UOQA 4HAWA 4WDQA 4REOA 5M3BA 3WYDA 5LJLA 2QPOA 2JLYA 3W79A 5HXAA 3T12A 4YCLA 4UD6A 1K8YB 2COEA 4D9GA 3PRKE 3CZ9A 3QUAA 1SUIA 4RSHA 3E61A 4LDAA 4WINA 4XQGA 3HKDA 3WLNA 1UP7A 1NNEA 3O8QA 2GTPA 1Q92A 4JROA 1WY7A 3CN9A 1P3Y1 1TIBA 3ASVA 4U2CA 2WJPA 2RG1A 4DLBA 1VJGA 2PSEA 3C3KA 5TT0A 4D2IA 3FE2A 2A30A 1VLVA 3T0FA 4F3RA 4UPEA 1YQXA 2DY0A 3B38A 3D5QA 3E22B 4W8GA 5AI6A 3VYWA 3FWYA 5FUYA 1CUAA 2BUBA 2O5RA 5JWOA 3NDBB 3Q3CA 4HAZA 4YMWA 5FL7A 5JZ9A 3TSZA 2QTBA 3VNUA 1F7UA 4AN1A 1OSNA 1H2YA 1C3JA 3RVKA 1PWEA 2FF7A 3KVNA 1ZIDA 3LUPA 3C24A 4QRDA 3AI3A 4NENB 2BFMA 1TUBA 3ZZMA 4CMAA 1YCHA 4U8HA 5CH5A 2RHGB 5EJIA 4DCVA 4E4RA 3R4VA 4QVKA 1G8GA 2BHRA 4OQNA 521PA 1Y81A 2CHQA 2LPMA 3OTOB 1L5OA 1BA2A 4DJ5X 3LZCA 2Z8YA 1Z0AA 5CHYA 1VKHA 2WWGA 5KVAA 2JAQA 4LY0A 2ILTA 5CA0B 1N9ZA 5F7ZA 1YZKA 1ZCZA 3DKRA 4M1EA 5I9NA 1P1JA 5IT9A 3RLFA 5HJ7A 3G17A 4XX0B 4IV5A 2P3QA 1UAYA 3V34A 4COOA 1SUEA 3DDUA 3GCXA 4YYEA 4WCFB 4Z54A 4DLWA 3L2OB 1OXXK 2HMTA 4CGYA 5EIEA 2X40A 2AN1A 3IKLA 4IHJB 1WBDA 2EEPA 5IM4F 2AF3C 2NZXA 3JD4A 1HMPA 4G09A 2H2AA 4KMOA 3ZXIA 1BWSA 3I8XA 1R9GA 1L4MA 3VPGA 5F51A 4YRIA 2B8NA 2GYUA 1M6EX 2V4ZA 1FQWA 1P1CA 1XTRA 3L7CA 4GRDA 3OZRA 1X15A 4O4IA 1UK8A 3LQYA 5J1TB 5CB4F 3RSZA 4KLAA 4EI9A 2JLVA 3WK5A 3EUEA 2YQ4A 2QU7A 3HBFA 5FPHA 1F2UA 5FEUA 2B7LA 4B7CA 2R8RA 3LECA 3SSAA 4AX4A 1NQUA 1M1NB 2D0PB 2NU7B 4BVHA 3IDFA 1CU1A 4UJ5A 1X7XA 4HNGA 1EEXB 3S68A 1L1FA 2G9NA 1OZ0A 2CMHA 1PL6A 3Q6IA 4HOYA 5M5BA 4IH1A 1YZFA 2HWYA 4I4CA 2E4VA 3UG6A 3ZJTA 4JVNA 4WOBA 5ICCA 3IRVA 3U4QA 1V1RB 2A6PA 4P93A 2V8OA 3ZHQA 3RU2A 1R0ZA 4CCAA 5HQJA 5F64A 2HCBA 1Z8FA 3TW8A 1Z88A 3KQHA 1PI3A 2D2VA 2FOLA 4K9QA 1UJ5A 4H1HA 2B98A 1QKJA 2M6KA 3WHIA 2EGHA 2W4MA 3NALA 1CCWA 4MIKA 5K4GA 3AH8A 1FJGB 4LZPA 3GGOA 4Z1MA 1QJ4A 4PAQA 4BZXA 1FNCA 3CR7A 1E2BA 3EOAI 3TMKA 4RDIA 2H18A 3DEIA 2ZYWX 3VKVA 3OF3A 1RWNA 3FMVA 4ARAA 2ZWIA 2QG6A 2QTCA 1FSFA 1NULA 3D2LA 3ZUGA 2FZGA 3NFRA 2Q21A 3ASYA 4ZCRA 4OHUA 3C4QA 5LL6P 4ZPJA 4PICA 4Q9HA 2QV0A 1RRVA 2C5LA 2HWXA 1IC6A 4TZTA 1HH4A 5JD3A 4O3FA 3N05A 1AA9A 4AU1A 2AC2A 1JR6A 1GTSA 1VYVA 5ESWA 2CW5A 3G85A 3TEMA 5C7IO 5BURA 1G16A 3OCUA 4N3CA 1TA9A 2ZRNA 3NEYA 5EE1A 5JG7A 1T5IA 2KWIA 4PF1A 2OFOA 3BGWA 1TK9A 1YKSA 5F5LA 5C35A 5KS2A 1QP0A 1SKYB 3BVPA 4NYMR 3VTAA 4QPCA 4IZ6A 5BYBA 1E2LA 3UPDA 4FEEA 4TMXA 4CEHB 4EK9A 4MGIR 4I2NA 1WULS 1YR8A 2PH1A 4BJ1A 3NDPA 3C3PA 4E7PA 1Z4QA 2I3BA 1RHRA 5C34B 2PZGA 3T5GA 1R0SA 3CEAA 1U4OA 2YWEA 4DXDA 2IWHA 1UMDB 1CQJA 4F60A 2JPDA 2ATIA 2VNSA 2JASA 4PHTA 1VJ5A 1KPGA 2P78A 3AR7A 4HUQB 1ULHA 3MGBA 1J4AA 4B33A 3B1JA 4KV9A 1KQ3A 5ENVA 3RK0A 3U3JA 1I9CA 4MRNA 5IBPA 4TYNA 4DDMA 4MLDA 1FLNA 3PLRA 3IQWA 3E3OA 4TN1A 4ZYVA 4HQOA 2A88A 2A94A 5C1BA 1NQXA 5JVDF 1JLHA 1EVIA 3AB8A 2PJDA 1OBCA 1E3QA 3PRJA 2WTXA 3EVDA 3SXUA 5EG5A 3PGLA 4ZI2A 2OO5A 4WD3A 3WFJA 4WK0B 4I9GA 4K87A 1YQWA 1Z35A 2R7LA 4HTAA 2IUUA 3DHNA 2C8VA 1P39A 2H17A 3CBQA 1H6AA 3GL9A 2YUTA 1GDHA 2ZBUA 4JMPA 3G9QA 2M1ZA 5A71A 4AN0A 2WFLB 3MN1A 4ABTA 2IUYA 2J3DA 2VH2A 3BE6A 3E1KA 3INNA 4ID3A 3NH9A 3WLKX 4OSOA 3MFYA 1F5NA 3GLFB 4QBGB 3PFNA 3UPTA 4R3WA 5IJ9B 5TVKA 3GFRA 1DC5A 2I6XA 2ZIEA 4BVBA 2AFVA 2LIPA 2P62A 2J07A 4DG8A 3MJCA 1VKZA 3ITNA 5E6UB 1G18A 2AG5A 3K05A 4RFSA 4M0CA 3LDHA 4BDSA 3RU3A 4BN5A 4IDOA 3CZRA 2K6GA 4M87A 5G4KA 1IBCA 1TM7E 5FBRB 4MJXA 1TK3A 2XSZA 1H1LA 2FRXA 1NP7A 5FA6A 1VCMA 4BFSA 1N77A 1P5RA 1Q5PA 1CUWA 1F4VA 3DAGA 3F8WA 3ZLUA 4Q9DA 4BNIA 2PZLA 2J9RA 3UWOA 1Q0UA 1G5HA 5AICA 2YVKA 5DNWA 5BRAA 3WYCA 1PSZA 1QE5A 4CIYA 2GASA 1VKRA 3DL2A 1Z45A 3VJRA 1ODLA 2FZ4A 3DE7X 5D51S 3U4MA 1Y8QB 4QG3A 2OAGA 1BHJA 3GMTA 4C07A 1U0RA 1B8VA 1A2OA 2OLKA 4OXKA 1G8JA 1H65A 1XI2A 1U2DA 2LD4A 2Y1GA 4GX2A 1TZJA 2GGSA 2V0CA 4DWVA 1COWA 4DUYB 2YASA 4HATA 1X1DA 2ZZKA 4XGQA 2F3RA 2QX7A 2RMKA 4XWYA 1BTOA 3HCWA 5HPYB 3PUZA 4A10A 2IY9A 1DTEA 2WSIA 3AERB 3FPGA 2PUAA 4FCCA 4H7DA 2XOKA 2ZB7A 4X64B 4RIHA 3U44B 3AC0A 4LQDA 2JG3A 3NVKI 2RHDA 3TVYA 2B1GA 4IVPA 4ZVVA 1AO0A 1W4AA 2RKWA 2WD7A 4WJZA 4I55B 1KEEA 4JX8A 1NVEA 3L05A 2VYQA 1OFIA 2NYUA 3IDAA 3IEIA 3NJRA 2YC4C 5K0TA 2QR5A 3GR6A 4DLUA 2HLHA 4N5LA 4Y2RA 4G1VA 1QV7A 3AR8A 3BSWA 3FW1A 2ANCA 4OGKA 5EZYF 2FSSA 4UFPA 3BZUA 4M2LA 4XYEA 5K3FB 5SZJA 4F4CA 2PUDA 2YZNA 4QUJA 1OTXA 2WIFA 1JWBB 3NVMB 2OO3A 1P2FA 5F1PA 3TI9A 3TINA 4ES6A 1NVWQ 2B4QA 3P9RA 2HHCA 4UBOA 5D3MA 3I8OA 3Q7IA 3P96A 3DVQX 4HZUA 4MO2A 4TSRA 2GF0A 4H60A 4YRLA 4ZI5A 1HG0A 1GV1A 1M74A 5JIBA 2P27A 4M88A 2W70A 2HU8A 3FNHA 2R97A 1MDBA 2ZUCA 1DC4A 1YZHA 2BKUA 4TTJA 4LXYA 1QPZA 4G0WA 2H57A 2H5IA 3ODGA 1IQ0A 2IPMA 1U2PA 4PX5A 4YUWA 3ZGZA 2MDTA 3KR0A 2WVJA 4L1KA 2XCRB 2JLBA 3HXLA 2H4WA 3S99A 1RLMA 5LYYA 4NFHA 2H4JA 1YJBA 2PTHA 4QE3A 3EEIA 3PHJA 1UKAA 3RTGA 1XX6A 1JLLA 1R64A 1EFAA 4D5EA 1IZZA 4JY7A 2LDXA 2VF2A 1UH5A 2G9ZA 2I2BA 1RQRA 3EXHA 3B6IA 2XF8A 3N5KA 3QYJA 3WLLA 2W2LA 5JFOA 2D0DA 1EFPB 2XV1A 3HM2A 2HYDA 2VDNB 1L2TA 2YXLA 3GMSA 3QW2A 3EWIA 7AT1A 5EJ6A 1CTQA 4NTZA 4RJLA 4V3BA 1QLHA 1UKCA 2C94A 3B3QA 4JBLA 5AMXA 3IIJA 1JXMA 2DPLA 5CAEB 1RI2A 3U4GA 2DEUA 3WGIA 2WD8A 4QM7A 1PKEA 4I3GA 4HF7A 1U81A 1PNTA 1O9GA 4AM8A 2XMBA 1RKUA 2VJPA 1NP3A 2Y99A 4BKMA 4WASA 1JWAB 4E1AA 2IKSA 4KO1S 3H1EA 2XLCA 1YZ3A 1SUAA 2WYIA 1TEHA 4I4LA 3UJPA 2X76A 4K9OA 5HP4A 1E4EB 1PNQA 2XUZA 4PM4A 2DR0A 2Q1XA 3AUUA 2C4TA 2YINC 3H5AA 5ALLA 4PZ9A 1WZCA 4ZI7F 2AMYA 1GZ5A 3U4DA 1O03A 3NIDB 3V6LA 4XKJA 3B7GA 3H1PA 3RGWS 1FU8A 4YASA 4ZYWA 1LU9A 4IH4A 2ST1A 4CM4B 4GSKA 5DTQA 1K98A 3BCRA 5CUQA 3Q7EA 5I5EA 1FW6A 4JI0B 2SICE 2NQ8A 3H9JA 1XMQB 1G5PA 1XRNA 3ME5A 4NMWA 1CZOA 3A1NA 3EFOB 2B0CA 5ERYA 2D7JA 4U2GA 2H1LA 3UK1A 2PV0A 5HDBB 3RSLA 2J3LA 4JKYA 1F0KA 3CPHA 1V71A 1BOOA 2VUIB 4JLWA 5AW1A 5BQ5A 1NTRA 2DVMA 3G2IA 4KSBA 5JFTA 2GEFA 4P7BA 2G5TA 3GW8A 4A8JB 5CA1F 3M4XA 4MCJA 4CM8A 2E4UA 1IXKA 1Z9BA 3WRXA 1Y3AA 5BN3B 4O2LA 1P44A 3ONNA 1WM1A 3IV9A 2SBTA 2QLLA 4YJHB 3BDVA 4HKTA 1V16A 4PNPA 3LM8A 4XZ3A 3VVLA 3TNYA 4D57A 2AMFA 4MVJD 2BRUC 3BL8A 2BD0A 4PCAA 2ZQ5A 4Q9KA 2JGDA 4KOAA 4KZPA 4N7JA 5AW7A 3R3UA 5J4HA 2XMGA 2IUFA 3DJYA 4LCEA 5IH7A 2AJDA 5BYJA 5IVDA 1EGMB 1H6CA 1TJPB 1XA3A 2QSZA 4EKEA 3ONVA 4AZVA 3T5AA 4AF7A 4BVJA 4INZA 4CT4B 1HE8B 5GMOA 5KU1A 4TL9A 5IAAA 4FCTA 3DYVA 3MJFA