1F2YA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAAVYAPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2yA00
4HMJA 1SNMA 4QB4A 1EYAA 4EQOA 5IGBA 5JAVA 5KEEA 3EVQA 5J1ZA 4KD3A 2KQ3A 4EQNA 5IIFA 2F0IA 5IGDA 3TP6A 4G57A 1TR5A 4KY6A 3V2TA 3TP5A 3C1FA 1IHZA 4F7XA 4HTHA 1EY6A 4PMBA 5C6AA 3NXWA 2SNSA 3HEJA 3P75A 3MHBA 4KY7A 3NK9A 1STAA 4NDXA 2EY1A 1NUCA 3OMCA 5I6YA 3BDCA 5C5MA 1STGA 5C3WA 5K5PA 2RDFA 4J1MA 1SYDA 4NKLA 5IGCA 4MIUA 2F0OA 4K2KA 3P1HA 4KTAA 1A2TA 3RUZA 3ITPA 1A3VA 2F0QA 5IGEA 3S9WA 1STNA 3D8GA 5NUCA 4PNYA 3SHLA 4IALA 4K5VA 4R8NA 4K5WA 4NMZA 4ZQ3A 3T16A 4RKBA 2F0EA 3H6MA 2F0SA 3TP8A 3VA5A 5KYIA 1TQOA 4I65A 1EQVA 4KJNA 5C4ZA 4HMIA 4EQPA 3DMUA 1EYDA 2NUCA 4N9PA 4NP5A 3SXHA 3EJIA 3U9OA 5KYLA 2EY6A 4EVOA 4F8MA 5IGGA 2F0UA 1EY9A 4IZ8A 3DHQA 5F2DA 4ZUIA 5I6WA 5KIXA 4H7BA 5CC4A 1SNOA 1SYFA 4PMCA 1STHA 2F0WA 2O4XA 3TMEA 5I9OA 4RKLA 3QOJA 3NP8A 1F2MA 2F3VA 4KJOA 4ID6A 2F0TA 1JOOA 2EYLA 1EZ6A 3NQTA 3QB3A 4WORA 5C3XA 5IOCA 5IODA 2F0FA 2EYFA 1EY4A 3BDLA 3MVVA 2F0HA 3D4WA 3E5SA 3D6CA 3OSOA 4K14A 4K8JA 5EGTA 2EY2A 1KDAA 5JOBA 2F0LA 2EXZA 2SOBA 4KD4A 4KY5A 1KDBA 4IUNA 5ISRA 1II3A 2RKSA 2PW7A 1SNQA 2OEOA 5CV7A 1KDCA 1EY5A 4KHVA 2F0VA 1RKNA 3HZXA 1JOQA 1JOKA 5E3FA 1NSNS 1EY8A 4J6HA 1AEXA 2EY5A 5CV5A 5DEHA 4DGZA 1EY7A 5CGKA 2OF1A 3LX0A 1A3TA 3D4DA 5CV6A 5EKKA 2EYMA 4LAAA 2F3WA 3NUCA 5EKLA 1EYCA 4DF7A 2EYPA 3MXPA 2OXPA 1STBA 5CV4A 2M00A 5I9PA 2PZWA 1SYGA 3SR1A 1JORA 1SYCA 4DU9A 1A3UA 1SNDA 3SK8A 2HQEA 2PQEA 2EYJA 2PW5A 2LKVA 2QDBA 1EZ8A 4ODGA 2WACA 3ERQA 3OMGA 2SNMA 5E1FA 3QOLA 3PMFA 1EY0A 1TT2A 2F0DA 2F0JA 5CV9A 5C5LA 5HURA 4K2LA 2PZTA 3SK5A 1SNCA 5C4HA 2F0PA 2F0NA 3C1EA 5CR3A 1KABA 5J22A 1A2UA 1SYBA 1F2ZA 3EROA 4QF4A 3T13A 1SYEA 2KHSA 1F2YA 4KV6A 4ZUJA 4K6DA 1ENCA 2F0KA 2F0GA 5KGUA 3NHHA 5HGTA 4YIJA 1U9RA 2ENBA 3R3OA 4ME5A 5CV8A 4E6IA 4K8IA 5IGFA 5J39A 4TRDA 2PZUA 4N9TA 1KAAA 2PYKA 4WRDA 4B9XA 3OWFA 5KRUA 4K5XA 1ENAA 3MEHA 2EYOA 4QMGA 2RBMA 3MZ5A 4OL7A 2EYHA 2F0MA 5DAUA 3SK4A 1SNPA 3TP7A 3SK6A 4DFAA 5M9OA 1STYA 4S3SA 4B9WA
chains in the Genus database with same CATH superfamily
2MHVA 1JWUD 1SNMA 5KEEA 4KD3A 1KIXA 2NBFA 2FFKB 2L15A 3PO2B 1SE8A 1HH2P 5DM63 1EWIA 3M7GA 2YU9H 1YJ9A 1KQSA 5GADC 2KOLA 3MXUA 4A93H 3K7AB 4JI1L 1XWEA 1XXGA 4K2KA 5IGEA 1JE5A 2ZJRA 1ML0D 2K32A 5C4JH 2YU9B 3PO3G 4O0AA 3VR6A 4IFDJ 2KCCA 4V0BA 1K0SA 5C4JB 4QUCA 1VF5C 2JK8A 3JAMc 1NTGA 1PTOD 4EQPA 5IP7H 2DNEA 3DMUA 4A3CH 1FVIA 2NZ1D 4EVOA 1E22A 1YITA 4NPSA 2ICEC 1ESFA 3DHQA 2WV6D 2VQFQ 3Q24A 1EIFA 2O4XA 3UDGA 3J7AV 4DR5L 2WAQE 5GAHC 2F0TA 1JOOA 5AFWA 3NQTA 1KD1C 1JMCA 1PTOF 5I2YA 5GQOA 1J8IA 3NBHA 2SOBA 1KL9A 5IYCG 4G7HC 2WIIB 3I4MG 1V1PA 2RSOA 4POGA 1HNZQ 3N52A 1N9WA 1AEXA 1Q90A 1TWCH 1EY7A 1NCVA 4LFAQ 3D4DA 3GQBA 2B2UA 2WKCA 1P8LA 3KYHC 5ELBA 2NWGA 4HSVA 2OXPA 4IJLA 1LLRD 1D6EC 3S2HH 3SK8A 2DJGC 2CQAA 3S1NH 1EIYB 4CKBA 3KJPA 4A3EB 4CDCC 3I4NH 5C5LA 4DAVA 2L5TA 4X3TA 3S2HB 4ZLTF 4QJFA 3C1EA 5CR3A 3MTSA 2JA6H 4C3JH 1K3RA 2Z1CA 3WOFA 2MUYA 3I4NB 3PO2G 1UE1A 1LTSD 3CAMA 1U9RA 4YCUA 2K33A 3OW7A 1WFQA 4GOPC 5T1IA 3RLOA 4K8IA 3ICEA 1C7YA 4J15A 2YV5A 4P71A 4FXKC 3GTLH 4HCSA 2BH8A 1A0IA 4MHEA 4LF8Q 4R9WA 4A93G 1B2TA 5E4WC 4A3GB 2KCTA 2CWPA 1NJIC 3GTLB 2KQ3A 4EQNA 5IIFA 1PH9A 3F2UA 4G57A 2HQLA 4DNIA 2UUCQ 1G2SA 4CJ2C 5I6YA 4LF9Q 4NXMQ 1ET9A 4HIKA 1SYDA 5IP7G 2RA4A 4LFCL 2KUMA 4A3CG 3MFYA 2O5JC 1PDQA 3KBGA 4A75A 3V05A 2AQ2B 4RKBA 3SVMA 2GA4B 5JPMC 2CKZB 1TQOA 1GVPA 3S17H 2KEDA 3FMCA 4JV5L 1PH6A 1BQQT 4IZ8A 3GTPH 3A5ZB 2WAQB 2CFMA 2F0WA 1FR3A 3NEMA 1WTXA 1QOHA 1I3QH 2XWBB 2ZM6L 1PZJD 1VQDA 5IODA 1F77A 2ZJQA 4L63B 4KHPQ 5JOBA 1DGSA 2JP1A 5JJLA 3S1RH 3HOWH 1PZID 3U50C 1U4PA 5CV7A 1YJNA 3CCRA 3S1MB 1E2VA 4B08A 1EY8A 4C56C 3HOWB 1NR4A 3EN2A 5CORA 3I4NG 1WTWA 3NWTA 4RGTA 5J3BA 1FNUA 2R92H 1AFPA 4XQJA 1PLFA 2JA6G 4C3JG 2QDBA 3MC0B 2R92B 2HDLA 1XMOQ 1TVXA 1TT2A 2F0JA 1BXTA 2LMCB 4A3MB 3A54A 4RHRA 2NVXH 1IBMQ 3S2DH 4CDDC 3C46A 3NWSA 2Y0SE 3RR5A 5LHY1 1U4LA 1Q86C 1P16A 1BVSA 3QO2A 1HTPA 1JJCB 2NVXB 3HGBA 2PZUA 5ELCA 5GROA 2ES2A 3W5OA 5E4XA 3EIVA 4B3RQ 4DV6Q 1H9SA 4DFAA 2F3IA 1BCPB 3KLSX 4FDBA 3K81C 4HMJA 3BVMA 4DR6Q 4X62Q 3ER0A 3EVQA 3ZJYC 3TP6A 3K0YA 2R61A 1EQRA 1N36Q 2E5LQ 3D0FA 3I56A 1MKHA 3NXWA 1TKWB 1VMPA 1VCIA 4NDXA 1GUGA 2WAQG 4LK1C 3KDFA 1ICFB 2A6HC 3TN2A 1A2TA 1A3VA 4H0LC 1N34Q 4B3TQ 3CCSA 2F4IA 2L1BA 1V9PA 1Y8NB 4X65Q 4O42A 1M4VA 4ZQ3A 4X66Q 1SRUA 1PRTC 2CW0C 1QE6A 1HNWQ 4NXNL 1LTLA 2NUCA 5KYLA 5FLMH 5C0XI 3I3CA 5FJ8H 3R93A 5GAGC 2Q8TA 2K5DA 1WCMH 4AH6A 4WJ4A 1L0XB 1CZWA 5KIXA 1I4RA 3HOWG 5T1GA 4OONA 1LUZA 3PV0A 1WCMB 1BBXC 2OT2A 1EZ6A 1S40A 1LM0A 3K6OA 3NE5B 1J9OA 3LGJA 4IUNA 1II3A 1O80A 2VXWA 3W1GA 4JPBW 1BCPC 3JC66 2RSNA 4PMWA 5E3FA 3UE1A 2JE6I 1WTRA 3TZUA 4DGZA 3RN5A 1C48A 2ALYB 1B9NA 2VS1A 2VQFL 3MXPA 5JEAJ 1CZGA 1D8LA 5A2QE 4A3FB 4IOAA 2HQEA 2UUAQ 1HZBA 4DR1Q 2B2YC 1RL2A 3HOUH 1JT8A 3VR4A 1HR0Q 3E3XA 4HIDA 5C4HA 2F0PA 2F0NA 3HOUB 2OTJA 4DPGA 5J22A 2QF7A 5FKAC 3T13A 1Q7YC 2KHSA 3RN2A 3J81E 1K73C 1VQFA 3R3OA 3H3VH 1VQPA 1HNZL 1GUWA 1B3QA 4A3DH 3SGIA 1SAPA 4LFAL 1ENAA 4RGOS 4CGYB 3PIP3 3OW2A 1RIPA 2EJMA 1TY2A 2B3GA 2WB1B 2MJ8A 2HCIA 5EJWA 1STYA 3TS0A 2NZHA 2BA0A 2RVLA 4IOCA 4DK6C 4DK3C 1L1OB 3I70A 4GN5A 2K04A 4RWSC 4XXEA 2IHEA 4BA1I 1LYLA 2OCEA 5C3WA 2AUJD 2X6LA 1PV4A 5FLMG 5FJ8G 3AQQA 2QEJC 3D8GA 1WCMG 2WINB 5NUCA 3UDFA 4XDXA 2F1MA 2UU9Q 1EOVA 3GV6A 4LF8L 3G6JB 1QWYA 2FJ2A 3OIQA 1EY9A 3BZKA 2EJFC 4KMUC 4ZUIA 4BY7H 2UUCL 3JAME 1CHPD 3CC2A 5C44H 2XN9C 2E2JH 4LUZA 4KN7C 5M3FH 4ID6A 4LF9L 4NXML 3DWAA 1CKOA 3MXNA 1O7LA 1CI3M 3D6WA 3OSOA 4K14A 2E2JB 4DXGA 1HZAA 3H3VC 1F9QA 2J7ZA 1GUOA 4GKJQ 1SMXA 3J80c 4KHVA 3HOUG 1C9OA 4UP7A 3M85A 4RGNA 5IY0A 1A3TA 5CV6A 2B2WA 2EYMA 2QA4A 2Q2TA 2JYOA 2X69A 1CTMA 4J8QA 4YWKA 3OOCA 1OXUA 2EYJA 1DOKA 2GN5A 1EY0A 2RDGA 3G7LA 3S15H 2WB1G 1Y1WH 3A5UA 4A3DG 4EGVA 4KHPL 1A2UA 1I4GA 3GTKH 4QF4A 3A56A 5L37A 1F2YA 1Y1WB 1JJGA 1S5CD 1X32A 1R9TH 1I50H 1RODA 3E0JA 4E6IA 3T4AC 2DY8A 4WRDA 5KRUA 4OO1H 1XNRQ 2RBMA 2EYHA 2UXBQ 5DAUA 3SK4A 4OWTB 2KHIA 3M3YH 2I5MX 1OXTA 2R93H 1FL0A 4GLAC 1XMOL 2QDLA 4Q5VA 1H95A 3DM3A 2JA8H 5EBCA 3HOYH 3M3YB 2BDOA 1DZ1A 4DV5Q 1STAA 1IBML 1H9KA 5C5MA 3A74A 1N32Q 3BZCA 1VQGA 4BBSH 1I94Q 1X65A 4KTAA 5A2QL 2JA8B 4BY1H 1WYDA 2KCNA 1PTOH 4R4QA 4BY7G 1PHJA 3GP7A 5C44G 3TP8A 4BA2I 1FD7D 4DV6L 4B3RL 4L5TA 4HMIA 5M3FG 3CD6A 4JOIC 4DR6L 4X62L 2PO4A 1E2ZA 3KUPA 2EZVA 4JI3Q 1RF2D 3AYHB 3GTQB 4IUUA 1I6HH 4X64Q 1SNOA 1N36L 2E5LL 2B63B 4OX9Q 1K28A 1Y8OB 3LNNA 3NP8A 1F2MA 1VQ7A 5C4XB 2EOTA 1K83H 1MSHA 3BVZA 1N34L 3F2CA 4B3TL 4IUQA 4C2MH 1KDAA 1H9RA 4I7ZC 4UAIA 1ET6A 1NBWA 4FP5D 1I4HA 4X65L 1K83B 4X66L 4GNXB 3GD7A 1Z6HA 3A55A 3J80i 1YNNC 1HNWL 1ZYRC 1JOKA 3HKZE 2A69D 1W6JA 3K80C 1Y1WG 4LAAA 2QCPX 3H09A 1K3BC 3VA7A 1LTRD 1TS3A 3KLSA 4UHVA 1PH5A 1ASYA 3ULLA 1A6XA 4HJ7A 1SJHD 1O78A 1Z7TA 4TQUS 5E1FA 3J7YW 1V8QA 2PI2E 1TY0A 1NNXA 4G4KA 4PZ6A 2HIVA 4OO1G 1JE4A 3AFQA 3O13A 1VQIA 3KLRA 1PA6A 1ILQA 3JAML 1PTOC 3P7JA 3A7AB 4LF4Q 4ME5A 2R93G 2M9VA 3GTMB 4UPAA 3FRPB 4DN4M 3I4MH 1PFSA 2JA8G 3HOYG 2K6AA 1N33Q 1R4PB 3MAQA 1EYAA 2UUAL 4BBSG 4DR1L 3I4MB 4P75A 4DUZQ 4X6AH 3G4SA 4L5SA 3TP5A 1GO3E 1IHZA 1Z9FA 4BY1G 1HR0L 2VB2X 2Q8IB 1YIJA 1Q1BA 1GOZA 2O2LD 4IFDH 3DWPA 4J1MA 4XQNA 1VQ8A 1STNA 2K7VA 3M4OH 2DUDA 2R7DA 2ZT9C 4DR2Q 2EJGC 2E2HH 5KNCA 2F0EA 1QVGA 1YBYA 2A8VA 3PIPA 4NB3A 3M4OB 1BF4A 1EEID 4P73A 5KNBA 1G6ZA 5IP9H 2F03A 4LNQA 2IPKD 2OQ0A 2AHOB 4A3BH 2K4KA 1J5EQ 1WTPA 1KNEA 3KJOA 1IBKQ 3IRBA 4OELB 4C3IH 1DD2A 5DM73 4DAYB 3QOJA 1ZKOA 2N88A 1D7QA 2AWOA 2R6GA 1D5ZC 4A3BB 2EYLA 3QIAA 2Z6BA 1MJCA 5A35A 5HGQA 1HR0W 2EYFA 3HG9A 3J7AF 3CU7A 4A93B 2NYZD 1U0LA 3GTJH 1B7YB 1CM9A 2MPMA 4DV2Q 2UU9L 1SXTA 4YCVA 1Y8PB 3GTJB 4X3UA 4GOPB 4RHSA 2EPBA 2OF1A 1XPOA 2B2TA 2IL8A 1HJPA 1YNJD 2D0PA 3K57A 1TIID 1WD0A 2A68D 2JA9A 5D65A 1DM0B 3HOZH 3Q22A 1S5FD 2V1CC 4DUYQ 1Q12A 1FGUA 1VF7A 1U4RA 2MQHA 5LL6S 3EROA 4GKJL 5IYBH 2BCOA 3PGZA 2ZXRA 4YIJA 5JPNC 4BS9A 3E9HA 2RCNA 3VR3A 4OL7A 1TWCB 1V1OA 5ELOA 1SNPA 5BN4A 1NUCA 4IFDG 4B9WA 1SDFA 1ICWA 3CPFA 3BG3A 2F0IA 2NVQH 3DWQA 1TR5A 4KY6A 2VQEQ 1GUSA 3BU2A 3C1FA 4HTHA 3S1NB 5IT9c 2CHBD 2ZJPA 3VYTA 3BDCA 1UUPA 2L0CA 1T9HA 3RUZA 5IP9G 3SDZA 2J4XA 3ULJA 4C3JB 3T51B 2JA6B 4QQBX 2G5DA 3CCJA 1IZ6A 4A3BG 4KKTA 5LMUQ 1XNRL 1SMYD 5I2XA 4C3IG 5KYIA 2UXBL 2HUGA 1NE3A 2MGSA 5C4ZA 2DGYA 1E24A 4NP5A 1V43A 4APVA 3HKZG 2A6ED 2F0UA 1M90C 1HUNA 3I55A 3ERSX 2OTLA 4LUOA 4WJ3M 4DV5L 3TZDA 4B3SQ 1N32L 3F1ZA 1PH3A 1I94L 3BS1A 1EY4A 2Q2HA 2R7FA 4LMQD 5DLQE 2OQKA 1HZCA 2F0LA 1TWHH 3VR5A 4R4TA 4KY5A 2KJXA 2RKSA 3RZDH 4OWWB 4YWMA 3AB9A 4DKAC 3HOZG 2L4NA 5CV5A 4LF7Q 4KKSA 3S17B 4JI3L 2F3WA 2EXDA 3J80E 4X64L 2K50A 2M00A 3F2BA 2H1EA 4OX9L 5IYBG 3GTPB 4JYAQ 3IFDA 1PH8A 3CCMA 1X6OA 1BBUA 4ODGA 2WACA 3ERQA 1WTOA 3OMGA 3H94A 1I3QB 1NY4A 4JG2A 3SEBA 2I5LX 4MNOA 2HIXA 4H13C 1SYBA 1TU2B 4KKUA 5TSSA 1ENCA 2HD3A 1YVCA 3S1RB 2TSSA 2BA1A 2Z4IA 1E7ZA 5JJZA 3L2PA 2PYKA 1S5BD 3RD4A 1JWMD 1MGSA 4KK7A 3TRZA 3NQIA 1PRTB 4CDEC 1TWGH 1WTQA 1PFNA 2WKDA 5M9OA 1Y1VH 4DAMA 3ONAB 4MTKA 1E2WA 4GN3B 1UE6A 3BYTB 4QL5A 1TWGB 1HXYD 5FLXc 1HA5A 1Y1VB 4FF3A 3CC4A 3I73A 3P75A 3MHBA 3E0EA 4FXGC 1Q82C 1BBWA 2JEBI 2SEBD 2EE1A 5K5PA 2RDFA 1HFNA 5IGCA 3S2DB 4LF4L 1SBBB 2F0QA 2BDNA 3S9WA 1EWCA 4HEDA 2K5HA 4JI6Q 1VS0A 4POFA 2V4DA 1M1KC 1EU4A 1Y14B 1QNKA 3QG1A 2PMZE 1EEFD 2IHFA 4DAPA 1N33L 3SXHA 1TS2A 2Z6KC 1XX8A 4F8MA 2BE5D 3UDIA 4F88A 4DUZL 1EU3A 1L0YB 1SYFA 3TMEA 3M7NA 4F87A 4DXFA 4V190 3Q6SA 2R7ZH 3KF8B 4OWXB 1L1OA 1LT6D 1QB5D 3H91A 1X56A 2IX0A 2BH2A 3C3LA 2K05A 2R7ZB 1KDBA 4DR2L 3EFXD 4TSSA 4OXPA 4JI2Q 1SNQA 5CYUA 4L6TB 4DV0L 1JB7A 1EY5A 5JEAH 1JOQA 1ESRA 2N55A 5C0XH 1K0RA 3IL8A 3UE0A 3FVQA 1J5EL 2EYPA 3V96A 2PQAB 3A8IE 1IBKL 1UEAB 1JORA 3I4OA 1SYCA 1EZ8A 2P5ZX 1TWAH 3VDYA 4CBVA 2VZAA 2IW3A 3BVGA 4A3KH 2B8FA 4PQXA 2CH4A 2K1BA 3X3MA 4R1JA 1M8AA 2G9HD 2ZXPA 4LUVA 4R4OA 3VYSA 4A3KB 4DV2L 5KGUA 2F0GA 1Y1VG 3KF6B 3NHHA 5H1SE 2ENBA 1C8CA 1KRSA 4NW2A 3PIO3 1IKLA 3MZ5A 3IAYA 1E3PA 3TP7A 1B9MA 4CJ0B 4IPHA 3KFUA 4IPGA 1UE5A 3TEHB 2Y0SB 5IGDA 4DUYL 5JJIA 3V2TA 1GJXA 4FVMA 2B8GA 1JICA 4YHHQ 3HEJA 5FO7B 3HOXH 1CHQD 4LWCA 2ZTCA 1D1KA 1UWVA 2I46A 3J80L 4NKLA 1QVFA 2F0OA 3P1HA 2C5CA 1RTNA 1OO9B 2IJ0A 1F9PA 2PMZB 1LT4D 2QW7A 1DJRD 4PNYA 3Q0AA 4Y52H 1VQHA 3U4VA 4A3DB 2AKWB 1XJVA 1HHVA 2R7ZG 2GVBA 1W3SA 4N9PA 1RHPA 1SROA 4XT3B 3T56B 4XQQA 4A4IA 5IGGA 4HCEA 1B44D 4N8FA 1N8RC 1G2TA 1IW7C 2VQEL 2D9UA 5I9OA 4AQYQ 4YY3Q 4R8IA 5JEAG 3QB3A 3GTGH 2F0FA 5C0XG 3D6CA 1C4QA 3DEPA 1G8ZD 4FYDA 3WOEA 4KD4A 2Z8LA 5LMUL 3S16H 1HFGA 1B1ZA 1FYCA 2G9DA 2B29A 1RKNA 2D0OA 4EQ5A 4HAEA 3K7UC 2QILA 3BJUA 4J6HA 1H9JA 5I4DA 1VMCA 3K8AA 3LX0A 3CMEA 4A3KG 3S16B 4P72A 2KECA 4UP8A 1K8MA 1EYCA 2A5HA 3NENA 3OWEB 5I9PA 1SYGA 3DEOA 2KEEA 1A3UA 4BY7B 2LKVA 4B3SL 2UXDQ 5C44B 1IXRA 2LY7A 5M3FB 5M3MH 3A0JA 1KC8C 1K8GA 4FF4A 2Y0SG 1KABA 3RLFA 3URYA 1SYEA 2L55A 4XT1B 4A3JH 3AU7A 2N49A 2A1AA 1NR2A 3IFTA 2LS01 1OXSC 4DR7Q 2Q8RE 1BCPF 1HTLD 1K8AC 1BDOA 4LF7L 1CK1A 2R3ZA 4GNXA 3OWFA 1I4PA 4WFN3 4A3JB 2C35B 4QMGA 1AP0A 4QY7A 5EBDA 1PXUA 3HOXG 1XPRA 1IBLQ 3S1QH 3D31A 1L2FA 4GKKQ 4JYAL 5JAVA 5IGBA 3PUZA 2NN6I 2TMPA 4ABNA 1IW7D 3TQYA 3J7ZC 4K6LA 4AYBE 3PF5A 3S15B 4FNFA 4JI8Q 1WOCA 4MIUA 1U4MA 5CBAE 3GTKB 1SE2A 2A69C 5D3DA 1YHQA 5LL6X 5IT9E 2XNAC 1SFOH 1HA6A 1R9TB 2PNHA 1I50B 3CCUA 3NELA 2F0SA 3T1YQ 4I65A 1EQVA 2NB0A 1GHJA 1Q81C 2ATWA 1SFOB 3PUVA 4HJ5A 4JBMA 4A3LH 1RCVD 4CHTB 4CKCA 4LFBQ 1I4QA 2FHTA 4MTNA 2IY5B 1STHA 2R93B 1A15A 4DNTB 1NAPA 1WTVA 3ULPA 1IKMA 3HOYB 5C3XA 2Z0SA 3BDLA 4RA8A 2K5WA 4DR4Q 2UXCQ 1VDZA 1MBYA 4JI6L 4BBSB 4M1UB 1PYSB 2QKIC 4DK1A 2XRSD 4K0KQ 4BY1B 1X55A 1PTOB 1CQFA 4ZRZA 5D3IB 1KTKA 4IUPA 5M3MG 3NUCA 4DV3Q 1S5DD 2AWNA 4TVAB 1RTOA 1GUTA 4UY8C 1IL2A 1SNDA 5KNDA 5LMNQ 4A3JG 1I6HB 3L3OC 1RJTA 1QILA 4WJWA 3C2PA 2C9OA 1PYBA 4JI7Q 4DR3Q 3D4RA 4DAYA 1Z47A 1CKMA 3ND9A 4TKOB 3G48A 3MWYW 4C2MB 1CSPA 4KV6A 1VQ4A 1JJ2A 4JI2L 4ZCKA 1G291 1QVCA 5JVG3 4TRDA 3A7LA 2RQXA 1TS5A 1SJED 1ILPA 4GZYC 2VB3X 4GOPA 2F0MA 3F8TA 2IWHA 4ZKCB 1JC7A 2JQOA 4P74A 1WTHA 3B6YA 1PMRA 5J1ZA 1KHIA 4F7XA 4DV4Q 3STBD 3FKIH 4KHZA 3CXCA 5C6AA 3W1BA 3CQZH 2SNSA 2WFWA 4Z9CB 3H15A 3FKIB 5FLXE 4A3LG 3ITPA 3NTKA 4O2DA 4DK0A 1YJWA 1IL8A 5CBEE 3PIOA 4K5VA 4K5WA 4NMZA 3CC7A 2K5QA 4RMFA 1YNJC 4A3IH 3VYUA 3CHBD 2A68C 1Q8IA 1Q1EA 5G3LF 2MO0A 3CKIB 5EKIA 1S5ED 3E6ZX 1LACA 4JI4Q 4YHHL 3CF5A 4JBKA 3PUWA 1BNZA 4IPCA 5ELNA 3T1HQ 1WD1A 1X3GA 4H44C 1E1OA 1PFBA 4ULLA 1RD9D 3I2ZA 5IYDG 4BBRH 4YWLA 5M5WH 3MVVA 3CRLC 5HY6A 3J81c 3CW2C 2PNRC 3ND8A 5IWAQ 1EUJA 4JW0A 4DV0Q 4BBRB 2JEAI 5M5WB 2FMMA 4RCNA 3DLLA 1DYQA 2E2HB 3RMHA 1TS4A 1Q3LA 4ZYSA 2JXMB 1XPUA 1XTDA 1LTBD 5DEHA 3EA6A 3AFPA 5EKKA 1WVLA 3BZDB 3PSIA 2VUMH 2E8GA 3L9AX 5IT9L 1EOTA 1LO5D 2PZWA 3WWVA 3SR1A 4AQYL 2RF4A 4YY3L 2VUMB 1FJGQ 3TSSA 4C3IB 4L8JA 3I91A 2QEXA 1UE7A 5EQ0A 1PZKD 3K7AH 4C1NK 3HKZB 3SE0A 4PV1C 4AYBG 1SMYC 2HHHQ 1LTAD 1VQJA 2LFNA 2UUBQ 2A6EC 1UAPA 4B9XA 1KXLA 1I5FA 3FKIG 4R4CA 3UI2A 2LXKA 5JVH3 2OWOA 3PF4A 5IE8A 4CJ1B 2D5DA 4QB4A 2UXDL 4XIGS 3RNUA 1SLJA 1B50A 1AN8A 1XYIA 3HOZB 4HJAA 1LT5D 1FNWA 3QWNA 1L0WA 1SR3A 2RCFA 5GAEC 4JK1C 1DCZA 3I90A 4CDFC 5FK9C 2I0QA 2LXJA 4A3IG 2K28A 2Z6KA 5BR8Q 3MEFA 4DR7L 1CKNB 3NPPA 4JC0A 2MNAA 1BOSA 3FPUB 3PQIA 3A8KE 1RDPD 4P2CB 1SN8A 2M2LA 2FINB 3H6MA 2VL6A 4XTCS 4KJNA 4C1NI 1IBLL 1FGBD 1JB3A 2DN8A 4GKKL 4JVZA 2EY6A 1OXVA 4BBRG 2KA7A 1QUQA 3RLNA 2B2VC 1Q46A 2Z4HA 3CMAA 1DOLA 4JBWA 2NVQB 4A3EH 1H9MA 4JI8L 2BOSA 4IN3A 3TBIB 1VQLA 4ZAIA 1B53A 1KAWA 3J81i 4OIJA 2VUMG 1D2BA 1LABA 2E75C 4IQZA 1EIGA 2YTVA 1O7IA 3T1YL 1EYGA 3S14H 1GHKA 1VQ6A 5K36H 2YTYA 1LTTD 4KI0A 1PYWD 4QGUA 3DXJC 4LFBL 1MD2D 1A62A 5FLXL 3S14B 4I7AA 3OIPA 2JSOA 3P20A 4A3GH 1K8OA 1CFMA 4DNRB 3OPOA 1SSOA 1HUMA 1KRTA 1GM5A 1LT3D 2XIWA 1JWSD 3ZYYX 2K75A 1ENFA 4KLKA 4DR4L 2DY7A 2UXCL 4IUVA 1HPCA 3KF8A 2B2YA 1AE2A 4JBJA 4OGQC 5D14A 2IT1A 3R2TA 3QJYA 4ZUJA 1TWHB 2N78A 2ICIA 4K0KL 4GS3A 1XTCD 4B3MQ 2K03A 3RZDB 5J39A 4N9TA 2BE5C 3NSWA 4C3HH 1YHAA 4XYOA 2EYOA 3U4ZA 1EQQA 4DV3L 1HQMC 2EDGA 1EQTA 4C3HB 5LMNL 3JAMi 1VQCA 3K58A 1I4XA 2PQAA 1S4ZA 4JI7L 4DR3L 4ZK9B 5M5XH 1W2BA 1QZHA 1S3OA 3FEWX 5BN3A 2D62A 2EY1A 1ASZA 3NBHB 5AJ3Q 5M5XB 2HDMA 4RG1A 1X3EA 2HCCA 1V1PB 3G71A 2RDHA 5M5YH 3S1MH 3SHLA 1QUQB 3KF6A 3CCQA 1XMQQ 2AUKA 1UEBA 4LF5Q 1MI2A 4XYQA 4A3EG 2EIFA 2K14A 4ME3A 5M5YB 1EYDA 1TXYA 1SEBD 4OEMB 5F2DA 1XNQQ 4H7BA 1VQEA 3M4PA 3CPWA 4DV4L 5LMNW 3BYYB 2LSSA 2ZXOA 1O7ZA 5ELDA 4Y7NH 2F3VA 4KJOA 2AMCB 4A3MH 5K36G 1A63A 4RFBA 1R4QB 4Y7NB 2EXZA 1X9NA 1U5KA 4A3GG 3OTOQ 2OEOA 2Q2IA 3W3AA 2B2TC 1Y69U 4RGMA 2EY5A 2E74C 2F4VQ 1FNVA 4LF6Q 3I7FA 1JQYD 4IO9A 5CV4A 3W2DA 3EQLC 2KHJA 4JI4L 4DU9A 2JA7H 2X6GA 3T1HL 3CRKC 2GVAA 4DV1Q 1ONLA 1X54A 1HNXQ 1F9RA 4JI5Q 4X3SA 2L12A 3GV3A 2F0DA 2WB1E 4C3HG 2JA7B 5HURA 2PZTA 3SK5A 5IWAL 4DV7Q 4GN4B 2B2UC 1F2ZA 4FO2A 3K5OA 2PPBC 4K6DA 2F0KA 3TREA 1A8VA 3M9BA 2O5IC 1OTCA 3GDEA 4K5XA 2JA5H 3HOVH 4LW1A 1QNUA 3A8JE 2JN4A 2A73B 2D2CC 1QZGA 2XWJB 3CCVA 4EQOA 3HOVB 2JA5B 1FJGL 2ID0A 4X3KA 1EFID 1BUVT 1CQVA 1S72A 1TWAB 4N8X1 2IX3A 3NK9A 1IYUA 3FDTA 2E2IH 1JR0D 3OMCA 3S24A 2HHHL 4U68A 3CCEA 2MO1A 2Z9HA 2VNUD 4Q0FA 4QIWE 1STEA 4ZKBB 4L5RC 2E2IB 3M4YA 3AMUA 4UP9A 1YI2A 2UUBL 4PG3A 2CVRA 2R92G 3VA5A 1MSGA 3CP0A 3U9OA 4A3MG 3EJIA 2MP1A 3E9IA 3KBXA 1HZ9A 1W6KA 1I6VC 4A3FH 5I6WA 3AEVA 1ZXTA 2RHQB 4ILWA 4JOIA 1VQ9A 3MXGA 1GXDC 1Q8KA 5C0XJ 5BR8L 2K01A 2N3SA 3HOXB 1EIHA 3J7A5 3E5SA 5EGTA 3LWUA 4HN7A 1YHBA 4PZ7A 1DXMA 1VQKA 1GKHA 4O1NA 5ISRA 3TS2A 2PW7A 4H02A 1IYVA 4UDUC 2JA7G 3NBIA 4IURA 4RAUC 3H3VI 1SE3A 2XGTA 2A6HD 2NVTH 1H9SB 1E0BA 1LTGD 5FO8B 2KVMA 4IPDA 5CGKA 3FHWA 4HJ8A 4JI0Q 1YZ6A 4DF7A 1PH4A 2NVTB 3J81j 1PRTD 2CW0D 1STBA 3Q23A 1KLUD 2PQEA 4MZ9A 2PW5A 3VR2A 2SNMA 4PZ8A 4ALPA 2VW9A 4QUFA 2KCMA 5CV9A 3KDFB 4K2LA 4OHJA 5CMDA 3GTGB 1SNCA 2JA5G 3HOVG 1V1QA 1X3FA 3PUXA 4L5QA 4JI1Q 1F2LA 3UDXA 1PRTF 4DA2A 3IKJA 3U58A 5HGTA 3EBEA 2F52A 2K5NA 1WI5A 2YYZA 2DNCA 3PO2H 3MA2B 1CA6A 1E1TA 3MEHA 5DNFA 4FF2A 1X3PA 3FPPA 3BDOA 1QCBD 3NTHA 2HT1A 1BCPD 4MN3A 5EPJA 2XTIA 3DUZA 3N6RA 2A19A 1BR9A 2ZTDA 5FO9B 1D5XC 1NMFA 3MFGA 4FXDA 1AH9A 4PMBA 4KY7A 4DR5Q 4QIWB 5M3MB 4BXXH 2N8NA 1D5MC 3L0OA 3KK7A 5EPKA 3G6EA 1VQMA 4B3ML 1QJOA 1T5XD 2KBNA 2ZTEA 2JJQA 2NTSA 4A3FG 3H0GH 4R8NA 2L9HA 1PH1A 3HFZB 3TDQA 4HJ9A 1MJEA 4QCLA 3PCOB 1PFMA 1O7YA 4BWGB 3H0GB 1IYJB 1ZEQX 5E7NA 2NN6H 3S1QB 3OYYA 5CC4A 5C3EH 1L1OC 1PVOA 4PMCA 4G7ZC 3X3NA 2QGQA 3HP3A 5AJ3L 5C3EB 4WORA 5IOCA 2F0HA 3D4WA 3K5MA 1NMGA 4HIOA 1EL0A 3LWEA 1XMQL 4LF5L 3HZXA 1NSNS 4RCOA 1VQNA 1AE3A 4OO1I 4GLXA 5JJKA 2K5VA 3HRZC 3STBC 5EKLA 1CSQA 1XNQL 2CWAA 1TWFH 2WP8J 1PH7A 2Q2UA 2E2DC 4YCWA 1X3QA 1YNXA 2AQ1B 1OXXK 2B39A 2XVSA 1TWFB 3PMFA 3R2IA 1DOMA 2EQSA 1PH2A 4GLVB 3HKSA 3OHXC 3OTOL 5IYDH 1EFWA 2CCZA 3NTIA 4IJHA 1VQAA 3GO5A 4LFCQ 3GTOH 2SDFA 5CV8A 3I72A 1EWHA 2H4OA 4LF6L 2F4VL 1CT1D 2J0TD 5ELFA 1T5EA 3GTOB 3Q8DA 1DONA 3I4LA 1BKBA 3FP9A 2AQ3B 3I8ZA 4G7OC 4OIKA 4BXXG 4M8AA 4JV5Q 1K9MC 3GTQH 3CCLA 2CQOA 2IX1A 4DV1L 2DJFC 2B63H 2CH4W 4JI5L 4AIMA 1LTID 1HNXL 4HR7B 3J81L 3MXNB 1EY6A 3H0GG 2YTXA 3R8BA 5C4XH 1G6PA 4DV7L 2ASBA 1B4OA 4HSPA 1STGA 4EX5A 1SE4A 2NVYH 2ZM6Q 1VQ5A 2B2VA 1MIUA 2NN6G 5EPLA 2FMCA 3D3RA 3QR8A 2NVYB 4IALA 5C3EG 3PUYA 3T16A 2L11A 3M4QA 1B8AA 2XRQD 3U9SA 3RZOH 4R4IA 4AYBB 2NZOA 5COYA 3PO3H 1JCKB 2H5XA 1J6QA 2PI2A 2FXQA 3KOJA 1LV9A 3RZOB 3WDNA 1VQOA 1HRJA 4RKLA 1YEZA 2I5HA 3PO3B 5G3LD 1AZPA 1QG7A 1HCZA 4LJZC 4CKEA 5EAYA 3K5LA 2EVBA 3CQZB 1KLGD 4FF1A 1UNSA 4K8JA 2EY2A 4RH6A 3F2DA 1G91A 2K52A 1MHWC 1AW7A 2I07B 5FOBB 4U673 4HIMA 1CKNA 4JCVE 1KDCA 2F0VA 3GTMH 2MFIA 1B3AA 1C0AA 3DM1A 4KN4C 1BO0A 4A3IB 2PCFB 3K59A 1KNAA 4A76A 1B70B 5BN5A 1GUNA 5IYCH 1VQBA 1D1IA 1AZQA 3QOLA 5ELEA 2VY3A 2NTTA 1CUKA 3HS0C 3L7ZC 2B2WC 4IFDI 3T53B 4GNXC 1GD7A 4IUTA 3VYRA 1F9SA 5IGFA 2B63G 1KAAA 1G51A 3KLWA 2KENA 2A74C 2RHSB 3K5NA 3K0XA 4JI0L 5C4XG 4NXNQ 1HQRD 1CA5A 3SK6A 1YNND 2E76C 4S3SA 2XSCA 1WJJA 1ZYRD
chains in the Genus database with same CATH topology
2MHVA 1JWUD 1SNMA 5KEEA 4KD3A 2NBFA 2FFKB 3PO2B 5DM63 3M7GA 2KOLA 3MXUA 3K7AB 1XWEA 1XXGA 4K2KA 5IGEA 1ML0D 2K32A 2YU9B 3VR6A 4IFDJ 2KCCA 4V0BA 5C4JB 4QUCA 1VF5C 1PTOD 4EQPA 2DNEA 3DMUA 2NZ1D 4EVOA 2ICEC 1ESFA 3DHQA 2WV6D 3Q24A 2O4XA 3J7AV 2F0TA 1JOOA 5AFWA 3NQTA 1PTOF 5I2YA 1J8IA 3NBHA 2SOBA 4G7HC 2WIIB 1V1PA 2RSOA 3N52A 1AEXA 1Q90A 1EY7A 1NCVA 3D4DA 3GQBA 2B2UA 2WKCA 5ELBA 2NWGA 4HSVA 2OXPA 1LLRD 1D6EC 3SK8A 2CQAA 4CKBA 4A3EB 5C5LA 4DAVA 2L5TA 4X3TA 3S2HB 4ZLTF 3C1EA 5CR3A 3MTSA 2Z1CA 3WOFA 2MUYA 3I4NB 1LTSD 1U9RA 2K33A 3OW7A 5T1IA 4K8IA 4FXKC 4HCSA 4MHEA 1B2TA 4R9WA 5E4WC 4A3GB 3GTLB 2KQ3A 4EQNA 5IIFA 3F2UA 4G57A 1G2SA 4CJ2C 5I6YA 1ET9A 1SYDA 2RA4A 2KUMA 3MFYA 2O5JC 1PDQA 3KBGA 3V05A 2AQ2B 4RKBA 3SVMA 2GA4B 5JPMC 1TQOA 2KEDA 3FMCA 1BQQT 4IZ8A 2WAQB 2F0WA 1FR3A 1WTXA 1QOHA 2XWBB 1PZJD 5IODA 1F77A 4L63B 5JOBA 2JP1A 1PZID 1U4PA 5CV7A 3S1MB 1E2VA 4B08A 1EY8A 4C56C 3HOWB 1NR4A 5CORA 1WTWA 3NWTA 4RGTA 1FNUA 1AFPA 4XQJA 1PLFA 4C3JG 2QDBA 3MC0B 2R92B 2HDLA 1TVXA 1TT2A 2F0JA 1BXTA 2LMCB 4A3MB 3A54A 4RHRA 3C46A 3NWSA 5LHY1 1U4LA 3QO2A 1HTPA 2NVXB 3HGBA 2PZUA 5ELCA 5E4XA 1H9SA 4DFAA 1BCPB 3KLSX 4HMJA 3BVMA 3EVQA 3TP6A 3K0YA 2R61A 3NXWA 1TKWB 1VMPA 1VCIA 4NDXA 1GUGA 4LK1C 2A6HC 3TN2A 1A2TA 1A3VA 4H0LC 2F4IA 2L1BA 1Y8NB 4O42A 1M4VA 4ZQ3A 1PRTC 2CW0C 1QE6A 2NUCA 5KYLA 5C0XI 3I3CA 3R93A 2Q8TA 2K5DA 1L0XB 1CZWA 5KIXA 1I4RA 5T1GA 3PV0A 1WCMB 1BBXC 2OT2A 1EZ6A 3K6OA 3NE5B 1J9OA 4IUNA 1II3A 1O80A 2VXWA 1BCPC 2RSNA 4PMWA 5E3FA 2JE6I 1WTRA 3TZUA 4DGZA 1C48A 1B9NA 3MXPA 5JEAJ 1CZGA 5A2QE 4A3FB 2HQEA 2B2YC 3VR4A 5C4HA 2F0PA 2F0NA 3HOUB 5J22A 2QF7A 5FKAC 3T13A 2KHSA 3J81E 3R3OA 1GUWA 1SAPA 1ENAA 4RGOS 4CGYB 3PIP3 2EJMA 1TY2A 2WB1B 2MJ8A 2HCIA 5EJWA 1STYA 2BA0A 2RVLA 3I70A 2K04A 4RWSC 4XXEA 4BA1I 5C3WA 2AUJD 2X6LA 2QEJC 3D8GA 2WINB 5NUCA 4XDXA 2F1MA 3GV6A 3G6JB 1QWYA 2FJ2A 3OIQA 1EY9A 2EJFC 4KMUC 4ZUIA 3JAME 1CHPD 2XN9C 4KN7C 4ID6A 3DWAA 3MXNA 1O7LA 1CI3M 3D6WA 3OSOA 4K14A 2E2JB 4DXGA 3H3VC 1F9QA 2J7ZA 1GUOA 4KHVA 3M85A 4RGNA 1A3TA 5CV6A 2B2WA 2EYMA 2JYOA 2X69A 1CTMA 4J8QA 3OOCA 1OXUA 2EYJA 1DOKA 1EY0A 2RDGA 3G7LA 4EGVA 1A2UA 1I4GA 4QF4A 3A56A 1F2YA 1Y1WB 1S5CD 1X32A 1RODA 3E0JA 4E6IA 3T4AC 2DY8A 4WRDA 5KRUA 4OO1H 2RBMA 2EYHA 5DAUA 3SK4A 1OXTA 4Q5VA 3M3YB 5EBCA 1DZ1A 2BDOA 1STAA 1H9KA 5C5MA 4KTAA 5A2QL 2JA8B 2KCNA 1PTOH 3GP7A 3TP8A 4BA2I 1FD7D 4HMIA 2PO4A 1E2ZA 3KUPA 2EZVA 1RF2D 3GTQB 4IUUA 1SNOA 2B63B 1Y8OB 3LNNA 3NP8A 1F2MA 5C4XB 2EOTA 1MSHA 3BVZA 4IUQA 1KDAA 1H9RA 4I7ZC 4UAIA 1ET6A 4FP5D 1I4HA 1K83B 3A55A 1Z6HA 3GD7A 1YNNC 1ZYRC 1JOKA 2A69D 1W6JA 4LAAA 2QCPX 3H09A 3VA7A 1LTRD 1TS3A 3KLSA 1A6XA 1SJHD 1O78A 1Z7TA 4TQUS 5E1FA 3J7YW 1V8QA 1TY0A 4G4KA 4OO1G 1JE4A 3O13A 3KLRA 1ILQA 3JAML 1PTOC 3P7JA 3A7AB 4ME5A 2M9VA 3GTMB 3FRPB 4DN4M 2K6AA 1R4PB 3MAQA 1EYAA 3I4MB 3TP5A 1IHZA 2VB2X 2Q8IB 1Q1BA 1GOZA 2O2LD 4IFDH 3DWPA 4J1MA 4XQNA 1STNA 2K7VA 2ZT9C 2EJGC 5KNCA 2F0EA 3M4OB 1BF4A 1EEID 5KNBA 1G6ZA 2F03A 2IPKD 1WTPA 1KNEA 1DD2A 5DM73 3QOJA 1ZKOA 2N88A 2AWOA 2R6GA 1D5ZC 4A3BB 2EYLA 3QIAA 5A35A 2EYFA 3HG9A 3J7AF 3CU7A 4A93B 2NYZD 1CM9A 2MPMA 1SXTA 1Y8PB 3GTJB 4X3UA 4RHSA 2EPBA 2OF1A 2B2TA 2IL8A 1YNJD 3K57A 1TIID 1WD0A 2A68D 5D65A 1DM0B 3Q22A 1S5FD 1Q12A 1VF7A 1U4RA 5LL6S 3EROA 2BCOA 2ZXRA 4YIJA 5JPNC 4BS9A 3VR3A 4OL7A 1TWCB 1V1OA 1SNPA 5BN4A 1NUCA 4IFDG 4B9WA 1SDFA 1ICWA 3BG3A 2F0IA 3DWQA 1TR5A 4KY6A 1GUSA 3C1FA 3S1NB 4HTHA 2CHBD 3VYTA 3BDCA 1UUPA 2L0CA 3RUZA 2JA6B 3SDZA 2J4XA 4C3JB 3T51B 4KKTA 1SMYD 5I2XA 4C3IG 5KYIA 2HUGA 2MGSA 5C4ZA 4NP5A 1V43A 2A6ED 2F0UA 1HUNA 3TZDA 3BS1A 1EY4A 4LMQD 2F0LA 3VR5A 4KY5A 2KJXA 2RKSA 3AB9A 2L4NA 5CV5A 4KKSA 3S17B 2F3WA 3J80E 2M00A 2H1EA 3GTPB 3IFDA 4ODGA 2WACA 3ERQA 1WTOA 3OMGA 3H94A 1I3QB 3SEBA 4H13C 1SYBA 1TU2B 4KKUA 5TSSA 1ENCA 3S1RB 2TSSA 2BA1A 2Z4IA 5JJZA 2PYKA 1S5BD 3RD4A 1JWMD 1MGSA 4KK7A 3NQIA 1PRTB 1WTQA 1PFNA 2WKDA 5M9OA 3ONAB 1E2WA 3BYTB 1TWGB 1HXYD 1HA5A 1Y1VB 4FF3A 3I73A 3P75A 3MHBA 4FXGC 2JEBI 2SEBD 2EE1A 5K5PA 2RDFA 1HFNA 5IGCA 3S2DB 1SBBB 2F0QA 2BDNA 3S9WA 1EWCA 4HEDA 2V4DA 1EU4A 1QNKA 3QG1A 1EEFD 4DAPA 3SXHA 1TS2A 1XX8A 4F8MA 2BE5D 4F88A 1EU3A 1L0YB 1SYFA 3TMEA 3M7NA 4F87A 4DXFA 4V190 3Q6SA 1QB5D 1LT6D 3H91A 2IX0A 3C3LA 2K05A 2R7ZB 1KDBA 3EFXD 4TSSA 1SNQA 5CYUA 4L6TB 1EY5A 5JEAH 1JOQA 1ESRA 2N55A 5C0XH 3IL8A 3FVQA 2EYPA 3V96A 3A8IE 1UEAB 1JORA 1SYCA 1EZ8A 4CBVA 2IW3A 3BVGA 2B8FA 4PQXA 2K1BA 3X3MA 1M8AA 2G9HD 2ZXPA 3VYSA 4A3KB 5KGUA 2F0GA 3NHHA 2ENBA 1C8CA 4NW2A 3PIO3 1IKLA 3MZ5A 3IAYA 3TP7A 1B9MA 4CJ0B 2Y0SB 5IGDA 3V2TA 1GJXA 4FVMA 2B8GA 1JICA 3HEJA 5FO7B 1CHQD 1D1KA 3J80L 2I46A 4NKLA 2F0OA 3P1HA 2C5CA 1RTNA 1OO9B 2IJ0A 1F9PA 2PMZB 1LT4D 1DJRD 4PNYA 3Q0AA 4A3DB 1HHVA 4N9PA 1RHPA 4XT3B 3T56B 4XQQA 5IGGA 1G2TA 4HCEA 1B44D 1IW7C 2D9UA 5I9OA 4R8IA 5JEAG 3QB3A 2F0FA 5C0XG 3D6CA 1C4QA 3DEPA 1G8ZD 4FYDA 3WOEA 4KD4A 2Z8LA 1HFGA 1B1ZA 1FYCA 2G9DA 1RKNA 4HAEA 2QILA 4J6HA 1H9JA 5I4DA 1VMCA 3LX0A 3S16B 2KECA 1K8MA 1EYCA 2A5HA 3OWEB 5I9PA 1SYGA 3DEOA 2KEEA 1A3UA 4BY7B 2LKVA 5C44B 2LY7A 5M3FB 4FF4A 3RLFA 1KABA 3URYA 1SYEA 2L55A 4XT1B 3AU7A 1NR2A 3IFTA 2LS01 1OXSC 2Q8RE 1BCPF 1HTLD 1BDOA 1CK1A 2R3ZA 3OWFA 1I4PA 4WFN3 4A3JB 1AP0A 4QMGA 5EBDA 1PXUA 3D31A 5JAVA 5IGBA 3PUZA 2NN6I 2TMPA 4ABNA 1IW7D 4K6LA 3S15B 4FNFA 4MIUA 1U4MA 5CBAE 3GTKB 1SE2A 2A69C 5D3DA 5LL6X 5IT9E 2XNAC 1HA6A 1R9TB 1I50B 2F0SA 4I65A 1EQVA 2NB0A 1GHJA 1SFOB 3PUVA 1RCVD 4CHTB 4CKCA 1I4QA 2FHTA 1STHA 2R93B 1A15A 4DNTB 1NAPA 1WTVA 1IKMA 3HOYB 5C3XA 3BDLA 4RA8A 2K5WA 1VDZA 1MBYA 4BBSB 4M1UB 2QKIC 4DK1A 2XRSD 4BY1B 1PTOB 1CQFA 4ZRZA 5D3IB 1KTKA 4IUPA 3NUCA 1S5DD 2AWNA 1RTOA 1GUTA 1SNDA 5KNDA 1I6HB 3L3OC 1RJTA 1QILA 4WJWA 3C2PA 2C9OA 3D4RA 4DAYA 1Z47A 3ND9A 4TKOB 3MWYW 4C2MB 4KV6A 1G291 5JVG3 4TRDA 3A7LA 2RQXA 1TS5A 1SJED 1ILPA 4GZYC 2VB3X 2F0MA 2IWHA 4ZKCB 1JC7A 5J1ZA 1PMRA 4F7XA 4KHZA 5C6AA 2SNSA 4Z9CB 3FKIB 5FLXE 3ITPA 3NTKA 4DK0A 1IL8A 5CBEE 4K5VA 4K5WA 4NMZA 2K5QA 1YNJC 3VYUA 3CHBD 2A68C 1Q8IA 1Q1EA 5G3LF 3CKIB 5EKIA 1S5ED 3E6ZX 1LACA 3PUWA 1BNZA 1WD1A 4H44C 1PFBA 4ULLA 1RD9D 3MVVA 3CRLC 2PNRC 3ND8A 4BBRB 2JEAI 5M5WB 2FMMA 4RCNA 1DYQA 2E2HB 3RMHA 1TS4A 1Q3LA 4ZYSA 2JXMB 5DEHA 1LTBD 3EA6A 5EKKA 1WVLA 3BZDB 3L9AX 5IT9L 1EOTA 1LO5D 2PZWA 3SR1A 2VUMB 3TSSA 4C3IB 4L8JA 3I91A 5EQ0A 1PZKD 4C1NK 3HKZB 3SE0A 4PV1C 1SMYC 1LTAD 2LFNA 2A6EC 1UAPA 4B9XA 3UI2A 5JVH3 4CJ1B 2D5DA 4QB4A 4XIGS 1B50A 1AN8A 1XYIA 3HOZB 1LT5D 1FNWA 3QWNA 4JK1C 1DCZA 3I90A 5FK9C 2K28A 3NPPA 1BOSA 3A8KE 3FPUB 1RDPD 4P2CB 2M2LA 2FINB 3H6MA 4XTCS 4KJNA 4C1NI 1FGBD 1JB3A 2DN8A 2EY6A 1OXVA 2KA7A 2B2VC 2Z4HA 1DOLA 4JBWA 2NVQB 1H9MA 2BOSA 4IN3A 3TBIB 4ZAIA 1B53A 4OIJA 1D2BA 1LABA 2E75C 4IQZA 1EIGA 1GHKA 5K36H 1LTTD 4KI0A 1PYWD 3DXJC 1MD2D 5FLXL 3S14B 3OIPA 2JSOA 3P20A 1K8OA 1CFMA 4DNRB 3OPOA 1SSOA 1HUMA 1LT3D 2XIWA 1JWSD 3ZYYX 1ENFA 2DY7A 4IUVA 1HPCA 3KF8A 2B2YA 5D14A 4OGQC 2IT1A 3R2TA 3QJYA 4ZUJA 1TWHB 2ICIA 1XTCD 2K03A 3RZDB 5J39A 4N9TA 2BE5C 3NSWA 4XYOA 2EYOA 1HQMC 2EDGA 1EQTA 4C3HB 3K58A 1I4XA 1S4ZA 4ZK9B 5BN3A 3FEWX 2D62A 2EY1A 5M5XB 2HDMA 2HCCA 1V1PB 2RDHA 3SHLA 2AUKA 1MI2A 4XYQA 5M5YB 1EYDA 1SEBD 5F2DA 4H7BA 3BYYB 2ZXOA 1O7ZA 5ELDA 2F3VA 4KJOA 5K36G 4RFBA 1R4QB 4Y7NB 2EXZA 2OEOA 2B2TC 3W3AA 1Y69U 4RGMA 2EY5A 2E74C 1FNVA 1JQYD 5CV4A 3W2DA 3EQLC 4DU9A 2X6GA 3CRKC 1ONLA 1F9RA 4X3SA 2L12A 3GV3A 2F0DA 4C3HG 2JA7B 5HURA 2PZTA 3SK5A 2B2UC 1F2ZA 4FO2A 3K5OA 2PPBC 4K6DA 2F0KA 2O5IC 4K5XA 1QNUA 3A8JE 2A73B 2D2CC 2XWJB 4EQOA 3HOVB 2JA5B 2ID0A 4X3KA 1EFID 1BUVT 1CQVA 1TWAB 2IX3A 3NK9A 1IYUA 3FDTA 1JR0D 3OMCA 4U68A 2VNUD 4Q0FA 1STEA 4ZKBB 2E2IB 3M4YA 3AMUA 2CVRA 3VA5A 1MSGA 3U9OA 3EJIA 2MP1A 3KBXA 1W6KA 1I6VC 5I6WA 1ZXTA 4ILWA 3MXGA 1GXDC 5C0XJ 2K01A 3HOXB 1EIHA 3E5SA 5EGTA 3LWUA 4HN7A 1DXMA 4O1NA 5ISRA 2PW7A 1IYVA 4UDUC 3NBIA 4IURA 4RAUC 1SE3A 2A6HD 1H9SB 1E0BA 1LTGD 5FO8B 2KVMA 5CGKA 4DF7A 2NVTB 1PRTD 2CW0D 1STBA 3Q23A 1KLUD 2PQEA 2PW5A 3VR2A 2SNMA 4QUFA 5CV9A 5CMDA 4K2LA 4OHJA 3GTGB 1SNCA 3PUXA 1F2LA 1PRTF 4DA2A 3IKJA 5HGTA 2YYZA 2DNCA 3MA2B 1CA6A 3MEHA 5DNFA 4FF2A 1X3PA 3FPPA 3BDOA 1QCBD 3NTHA 1BCPD 4MN3A 5EPJA 3DUZA 3N6RA 1BR9A 5FO9B 1D5XC 3MFGA 4FXDA 4PMBA 4KY7A 4QIWB 5M3MB 1D5MC 3KK7A 5EPKA 1QJOA 1T5XD 2NTSA 4R8NA 2L9HA 3TDQA 4QCLA 1PFMA 1O7YA 4BWGB 3H0GB 1ZEQX 2NN6H 3S1QB 5CC4A 4PMCA 4G7ZC 3X3NA 3HP3A 5C3EB 4WORA 5IOCA 2F0HA 3D4WA 3K5MA 1EL0A 3LWEA 3HZXA 1NSNS 4RCOA 4OO1I 3HRZC 5EKLA 2WP8J 2E2DC 1X3QA 2AQ1B 1OXXK 2B39A 2XVSA 1TWFB 3PMFA 3R2IA 1DOMA 3OHXC 3NTIA 3GO5A 2SDFA 5CV8A 3I72A 1EWHA 2H4OA 1CT1D 2J0TD 5ELFA 1T5EA 3GTOB 1DONA 3I4LA 4G7OC 2AQ3B 3I8ZA 4M8AA 2IX1A 1LTID 4HR7B 3J81L 1EY6A 3R8BA 1B4OA 4HSPA 1STGA 1SE4A 2B2VA 2NN6G 5EPLA 2FMCA 3D3RA 2NVYB 4IALA 3PUYA 3T16A 2L11A 2XRQD 3U9SA 4AYBB 5COYA 1JCKB 1LV9A 3RZOB 3WDNA 1HRJA 4RKLA 3PO3B 5G3LD 1AZPA 1QG7A 1HCZA 4LJZC 4CKEA 3K5LA 2EVBA 3CQZB 1KLGD 4FF1A 1UNSA 4K8JA 2EY2A 4RH6A 1G91A 1AW7A 2I07B 5FOBB 4U673 1KDCA 2F0VA 1B3AA 3DM1A 4KN4C 1BO0A 4A3IB 2PCFB 3K59A 1KNAA 5BN5A 1GUNA 1D1IA 1AZQA 3QOLA 5ELEA 2NTTA 3HS0C 3L7ZC 2B2WC 4IFDI 3T53B 4IUTA 3VYRA 1F9SA 5IGFA 1KAAA 2A74C 3K5NA 1HQRD 1CA5A 3SK6A 1YNND 2E76C 4S3SA 2XSCA 4OIKA 1ZYRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HMJ A;  1SNM A;  4QB4 A;  1EYA A;  4EQO A;  5IGB A;  5JAV A;  5KEE A;  3EVQ A;  5J1Z A;  4KD3 A;  2KQ3 A;  4EQN A;  5IIF A;  2F0I A;  5IGD A;  3TP6 A;  4G57 A;  1TR5 A;  4KY6 A;  3V2T A;  3TP5 A;  3C1F A;  1IHZ A;  4F7X A;  4HTH A;  1EY6 A;  4PMB A;  5C6A A;  3NXW A;  2SNS A;  3HEJ A;  3P75 A;  3MHB A;  4KY7 A;  3NK9 A;  1STA A;  4NDX A;  2EY1 A;  1NUC A;  3OMC A;  5I6Y A;  3BDC A;  5C5M A;  1STG A;  5C3W A;  5K5P A;  2RDF A;  4J1M A;  1SYD A;  4NKL A;  5IGC A;  4MIU A;  2F0O A;  4K2K A;  3P1H A;  4KTA A;  1A2T A;  3RUZ A;  3ITP A;  1A3V A;  2F0Q A;  5IGE A;  3S9W A;  1STN A;  3D8G A;  5NUC A;  4PNY A;  3SHL A;  4IAL A;  4K5V A;  4R8N A;  4K5W A;  4NMZ A;  4ZQ3 A;  3T16 A;  4RKB A;  2F0E A;  3H6M A;  2F0S A;  3TP8 A;  3VA5 A;  5KYI A;  1TQO A;  4I65 A;  1EQV A;  4KJN A;  5C4Z A;  4HMI A;  4EQP A;  3DMU A;  1EYD A;  2NUC A;  4N9P A;  4NP5 A;  3SXH A;  3EJI A;  3U9O A;  5KYL A;  2EY6 A;  4EVO A;  4F8M A;  5IGG A;  2F0U A;  1EY9 A;  4IZ8 A;  3DHQ A;  5F2D A;  4ZUI A;  5I6W A;  5KIX A;  4H7B A;  5CC4 A;  1SNO A;  1SYF A;  4PMC A;  1STH A;  2F0W A;  2O4X A;  3TME A;  5I9O A;  4RKL A;  3QOJ A;  3NP8 A;  1F2M A;  2F3V A;  4KJO A;  4ID6 A;  2F0T A;  1JOO A;  2EYL A;  1EZ6 A;  3NQT A;  3QB3 A;  4WOR A;  5C3X A;  5IOC A;  5IOD A;  2F0F A;  2EYF A;  1EY4 A;  3BDL A;  3MVV A;  2F0H A;  3D4W A;  3E5S A;  3D6C A;  3OSO A;  4K14 A;  4K8J A;  5EGT A;  2EY2 A;  1KDA A;  5JOB A;  2F0L A;  2EXZ A;  2SOB A;  4KD4 A;  4KY5 A;  1KDB A;  4IUN A;  5ISR A;  1II3 A;  2RKS A;  2PW7 A;  1SNQ A;  2OEO A;  5CV7 A;  1KDC A;  1EY5 A;  4KHV A;  2F0V A;  1RKN A;  3HZX A;  1JOQ A;  1JOK A;  5E3F A;  1NSN S;  1EY8 A;  4J6H A;  1AEX A;  2EY5 A;  5CV5 A;  5DEH A;  4DGZ A;  1EY7 A;  5CGK A;  2OF1 A;  3LX0 A;  1A3T A;  3D4D A;  5CV6 A;  5EKK A;  2EYM A;  4LAA A;  2F3W A;  3NUC A;  5EKL A;  1EYC A;  4DF7 A;  2EYP A;  3MXP A;  2OXP A;  1STB A;  5CV4 A;  2M00 A;  5I9P A;  2PZW A;  1SYG A;  3SR1 A;  1JOR A;  1SYC A;  4DU9 A;  1A3U A;  1SND A;  3SK8 A;  2HQE A;  2PQE A;  2EYJ A;  2PW5 A;  2LKV A;  2QDB A;  1EZ8 A;  4ODG A;  2WAC A;  3ERQ A;  3OMG A;  2SNM A;  5E1F A;  3QOL A;  3PMF A;  1EY0 A;  1TT2 A;  2F0D A;  2F0J A;  5CV9 A;  5C5L A;  5HUR A;  4K2L A;  2PZT A;  3SK5 A;  1SNC A;  5C4H A;  2F0P A;  2F0N A;  3C1E A;  5CR3 A;  1KAB A;  5J22 A;  1A2U A;  1SYB A;  1F2Z A;  3ERO A;  4QF4 A;  3T13 A;  1SYE A;  2KHS A;  1F2Y A;  4KV6 A;  4ZUJ A;  4K6D A;  1ENC A;  2F0K A;  2F0G A;  5KGU A;  3NHH A;  5HGT A;  4YIJ A;  1U9R A;  2ENB A;  3R3O A;  4ME5 A;  5CV8 A;  4E6I A;  4K8I A;  5IGF A;  5J39 A;  4TRD A;  2PZU A;  4N9T A;  1KAA A;  2PYK A;  4WRD A;  4B9X A;  3OWF A;  5KRU A;  4K5X A;  1ENA A;  3MEH A;  2EYO A;  4QMG A;  2RBM A;  3MZ5 A;  4OL7 A;  2EYH A;  2F0M A;  5DAU A;  3SK4 A;  1SNP A;  3TP7 A;  3SK6 A;  4DFA A;  5M9O A;  1STY A;  4S3S A;  4B9W A; 
#chains in the Genus database with same CATH topology
 2MHV A;  1JWU D;  1SNM A;  5KEE A;  4KD3 A;  1KIX A;  2NBF A;  2FFK B;  2L15 A;  3PO2 B;  1SE8 A;  1HH2 P;  5DM6 3;  1EWI A;  3M7G A;  2YU9 H;  1YJ9 A;  1KQS A;  5GAD C;  2KOL A;  3MXU A;  4A93 H;  3K7A B;  4JI1 L;  1XWE A;  1XXG A;  4K2K A;  5IGE A;  1JE5 A;  2ZJR A;  1ML0 D;  2K32 A;  5C4J H;  2YU9 B;  3PO3 G;  4O0A A;  3VR6 A;  4IFD J;  2KCC A;  4V0B A;  1K0S A;  5C4J B;  4QUC A;  1VF5 C;  2JK8 A;  3JAM c;  1NTG A;  1PTO D;  4EQP A;  5IP7 H;  2DNE A;  3DMU A;  4A3C H;  1FVI A;  2NZ1 D;  4EVO A;  1E22 A;  1YIT A;  4NPS A;  2ICE C;  1ESF A;  3DHQ A;  2WV6 D;  2VQF Q;  3Q24 A;  1EIF A;  2O4X A;  3UDG A;  3J7A V;  4DR5 L;  2WAQ E;  5GAH C;  2F0T A;  1JOO A;  5AFW A;  3NQT A;  1KD1 C;  1JMC A;  1PTO F;  5I2Y A;  5GQO A;  1J8I A;  3NBH A;  2SOB A;  1KL9 A;  5IYC G;  4G7H C;  2WII B;  3I4M G;  1V1P A;  2RSO A;  4POG A;  1HNZ Q;  3N52 A;  1N9W A;  1AEX A;  1Q90 A;  1TWC H;  1EY7 A;  1NCV A;  4LFA Q;  3D4D A;  3GQB A;  2B2U A;  2WKC A;  1P8L A;  3KYH C;  5ELB A;  2NWG A;  4HSV A;  2OXP A;  4IJL A;  1LLR D;  1D6E C;  3S2H H;  3SK8 A;  2DJG C;  2CQA A;  3S1N H;  1EIY B;  4CKB A;  3KJP A;  4A3E B;  4CDC C;  3I4N H;  5C5L A;  4DAV A;  2L5T A;  4X3T A;  3S2H B;  4ZLT F;  4QJF A;  3C1E A;  5CR3 A;  3MTS A;  2JA6 H;  4C3J H;  1K3R A;  2Z1C A;  3WOF A;  2MUY A;  3I4N B;  3PO2 G;  1UE1 A;  1LTS D;  3CAM A;  1U9R A;  4YCU A;  2K33 A;  3OW7 A;  1WFQ A;  4GOP C;  5T1I A;  3RLO A;  4K8I A;  3ICE A;  1C7Y A;  4J15 A;  2YV5 A;  4P71 A;  4FXK C;  3GTL H;  4HCS A;  2BH8 A;  1A0I A;  4MHE A;  4LF8 Q;  4R9W A;  4A93 G;  1B2T A;  5E4W C;  4A3G B;  2KCT A;  2CWP A;  1NJI C;  3GTL B;  2KQ3 A;  4EQN A;  5IIF A;  1PH9 A;  3F2U A;  4G57 A;  2HQL A;  4DNI A;  2UUC Q;  1G2S A;  4CJ2 C;  5I6Y A;  4LF9 Q;  4NXM Q;  1ET9 A;  4HIK A;  1SYD A;  5IP7 G;  2RA4 A;  4LFC L;  2KUM A;  4A3C G;  3MFY A;  2O5J C;  1PDQ A;  3KBG A;  4A75 A;  3V05 A;  2AQ2 B;  4RKB A;  3SVM A;  2GA4 B;  5JPM C;  2CKZ B;  1TQO A;  1GVP A;  3S17 H;  2KED A;  3FMC A;  4JV5 L;  1PH6 A;  1BQQ T;  4IZ8 A;  3GTP H;  3A5Z B;  2WAQ B;  2CFM A;  2F0W A;  1FR3 A;  3NEM A;  1WTX A;  1QOH A;  1I3Q H;  2XWB B;  2ZM6 L;  1PZJ D;  1VQD A;  5IOD A;  1F77 A;  2ZJQ A;  4L63 B;  4KHP Q;  5JOB A;  1DGS A;  2JP1 A;  5JJL A;  3S1R H;  3HOW H;  1PZI D;  3U50 C;  1U4P A;  5CV7 A;  1YJN A;  3CCR A;  3S1M B;  1E2V A;  4B08 A;  1EY8 A;  4C56 C;  3HOW B;  1NR4 A;  3EN2 A;  5COR A;  3I4N G;  1WTW A;  3NWT A;  4RGT A;  5J3B A;  1FNU A;  2R92 H;  1AFP A;  4XQJ A;  1PLF A;  2JA6 G;  4C3J G;  2QDB A;  3MC0 B;  2R92 B;  2HDL A;  1XMO Q;  1TVX A;  1TT2 A;  2F0J A;  1BXT A;  2LMC B;  4A3M B;  3A54 A;  4RHR A;  2NVX H;  1IBM Q;  3S2D H;  4CDD C;  3C46 A;  3NWS A;  2Y0S E;  3RR5 A;  5LHY 1;  1U4L A;  1Q86 C;  1P16 A;  1BVS A;  3QO2 A;  1HTP A;  1JJC B;  2NVX B;  3HGB A;  2PZU A;  5ELC A;  5GRO A;  2ES2 A;  3W5O A;  5E4X A;  3EIV A;  4B3R Q;  4DV6 Q;  1H9S A;  4DFA A;  2F3I A;  1BCP B;  3KLS X;  4FDB A;  3K81 C;  4HMJ A;  3BVM A;  4DR6 Q;  4X62 Q;  3ER0 A;  3EVQ A;  3ZJY C;  3TP6 A;  3K0Y A;  2R61 A;  1EQR A;  1N36 Q;  2E5L Q;  3D0F A;  3I56 A;  1MKH A;  3NXW A;  1TKW B;  1VMP A;  1VCI A;  4NDX A;  1GUG A;  2WAQ G;  4LK1 C;  3KDF A;  1ICF B;  2A6H C;  3TN2 A;  1A2T A;  1A3V A;  4H0L C;  1N34 Q;  4B3T Q;  3CCS A;  2F4I A;  2L1B A;  1V9P A;  1Y8N B;  4X65 Q;  4O42 A;  1M4V A;  4ZQ3 A;  4X66 Q;  1SRU A;  1PRT C;  2CW0 C;  1QE6 A;  1HNW Q;  4NXN L;  1LTL A;  2NUC A;  5KYL A;  5FLM H;  5C0X I;  3I3C A;  5FJ8 H;  3R93 A;  5GAG C;  2Q8T A;  2K5D A;  1WCM H;  4AH6 A;  4WJ4 A;  1L0X B;  1CZW A;  5KIX A;  1I4R A;  3HOW G;  5T1G A;  4OON A;  1LUZ A;  3PV0 A;  1WCM B;  1BBX C;  2OT2 A;  1EZ6 A;  1S40 A;  1LM0 A;  3K6O A;  3NE5 B;  1J9O A;  3LGJ A;  4IUN A;  1II3 A;  1O80 A;  2VXW A;  3W1G A;  4JPB W;  1BCP C;  3JC6 6;  2RSN A;  4PMW A;  5E3F A;  3UE1 A;  2JE6 I;  1WTR A;  3TZU A;  4DGZ A;  3RN5 A;  1C48 A;  2ALY B;  1B9N A;  2VS1 A;  2VQF L;  3MXP A;  5JEA J;  1CZG A;  1D8L A;  5A2Q E;  4A3F B;  4IOA A;  2HQE A;  2UUA Q;  1HZB A;  4DR1 Q;  2B2Y C;  1RL2 A;  3HOU H;  1JT8 A;  3VR4 A;  1HR0 Q;  3E3X A;  4HID A;  5C4H A;  2F0P A;  2F0N A;  3HOU B;  2OTJ A;  4DPG A;  5J22 A;  2QF7 A;  5FKA C;  3T13 A;  1Q7Y C;  2KHS A;  3RN2 A;  3J81 E;  1K73 C;  1VQF A;  3R3O A;  3H3V H;  1VQP A;  1HNZ L;  1GUW A;  1B3Q A;  4A3D H;  3SGI A;  1SAP A;  4LFA L;  1ENA A;  4RGO S;  4CGY B;  3PIP 3;  3OW2 A;  1RIP A;  2EJM A;  1TY2 A;  2B3G A;  2WB1 B;  2MJ8 A;  2HCI A;  5EJW A;  1STY A;  3TS0 A;  2NZH A;  2BA0 A;  2RVL A;  4IOC A;  4DK6 C;  4DK3 C;  1L1O B;  3I70 A;  4GN5 A;  2K04 A;  4RWS C;  4XXE A;  2IHE A;  4BA1 I;  1LYL A;  2OCE A;  5C3W A;  2AUJ D;  2X6L A;  1PV4 A;  5FLM G;  5FJ8 G;  3AQQ A;  2QEJ C;  3D8G A;  1WCM G;  2WIN B;  5NUC A;  3UDF A;  4XDX A;  2F1M A;  2UU9 Q;  1EOV A;  3GV6 A;  4LF8 L;  3G6J B;  1QWY A;  2FJ2 A;  3OIQ A;  1EY9 A;  3BZK A;  2EJF C;  4KMU C;  4ZUI A;  4BY7 H;  2UUC L;  3JAM E;  1CHP D;  3CC2 A;  5C44 H;  2XN9 C;  2E2J H;  4LUZ A;  4KN7 C;  5M3F H;  4ID6 A;  4LF9 L;  4NXM L;  3DWA A;  1CKO A;  3MXN A;  1O7L A;  1CI3 M;  3D6W A;  3OSO A;  4K14 A;  2E2J B;  4DXG A;  1HZA A;  3H3V C;  1F9Q A;  2J7Z A;  1GUO A;  4GKJ Q;  1SMX A;  3J80 c;  4KHV A;  3HOU G;  1C9O A;  4UP7 A;  3M85 A;  4RGN A;  5IY0 A;  1A3T A;  5CV6 A;  2B2W A;  2EYM A;  2QA4 A;  2Q2T A;  2JYO A;  2X69 A;  1CTM A;  4J8Q A;  4YWK A;  3OOC A;  1OXU A;  2EYJ A;  1DOK A;  2GN5 A;  1EY0 A;  2RDG A;  3G7L A;  3S15 H;  2WB1 G;  1Y1W H;  3A5U A;  4A3D G;  4EGV A;  4KHP L;  1A2U A;  1I4G A;  3GTK H;  4QF4 A;  3A56 A;  5L37 A;  1F2Y A;  1Y1W B;  1JJG A;  1S5C D;  1X32 A;  1R9T H;  1I50 H;  1ROD A;  3E0J A;  4E6I A;  3T4A C;  2DY8 A;  4WRD A;  5KRU A;  4OO1 H;  1XNR Q;  2RBM A;  2EYH A;  2UXB Q;  5DAU A;  3SK4 A;  4OWT B;  2KHI A;  3M3Y H;  2I5M X;  1OXT A;  2R93 H;  1FL0 A;  4GLA C;  1XMO L;  2QDL A;  4Q5V A;  1H95 A;  3DM3 A;  2JA8 H;  5EBC A;  3HOY H;  3M3Y B;  2BDO A;  1DZ1 A;  4DV5 Q;  1STA A;  1IBM L;  1H9K A;  5C5M A;  3A74 A;  1N32 Q;  3BZC A;  1VQG A;  4BBS H;  1I94 Q;  1X65 A;  4KTA A;  5A2Q L;  2JA8 B;  4BY1 H;  1WYD A;  2KCN A;  1PTO H;  4R4Q A;  4BY7 G;  1PHJ A;  3GP7 A;  5C44 G;  3TP8 A;  4BA2 I;  1FD7 D;  4DV6 L;  4B3R L;  4L5T A;  4HMI A;  5M3F G;  3CD6 A;  4JOI C;  4DR6 L;  4X62 L;  2PO4 A;  1E2Z A;  3KUP A;  2EZV A;  4JI3 Q;  1RF2 D;  3AYH B;  3GTQ B;  4IUU A;  1I6H H;  4X64 Q;  1SNO A;  1N36 L;  2E5L L;  2B63 B;  4OX9 Q;  1K28 A;  1Y8O B;  3LNN A;  3NP8 A;  1F2M A;  1VQ7 A;  5C4X B;  2EOT A;  1K83 H;  1MSH A;  3BVZ A;  1N34 L;  3F2C A;  4B3T L;  4IUQ A;  4C2M H;  1KDA A;  1H9R A;  4I7Z C;  4UAI A;  1ET6 A;  1NBW A;  4FP5 D;  1I4H A;  4X65 L;  1K83 B;  4X66 L;  4GNX B;  3GD7 A;  1Z6H A;  3A55 A;  3J80 i;  1YNN C;  1HNW L;  1ZYR C;  1JOK A;  3HKZ E;  2A69 D;  1W6J A;  3K80 C;  1Y1W G;  4LAA A;  2QCP X;  3H09 A;  1K3B C;  3VA7 A;  1LTR D;  1TS3 A;  3KLS A;  4UHV A;  1PH5 A;  1ASY A;  3ULL A;  1A6X A;  4HJ7 A;  1SJH D;  1O78 A;  1Z7T A;  4TQU S;  5E1F A;  3J7Y W;  1V8Q A;  2PI2 E;  1TY0 A;  1NNX A;  4G4K A;  4PZ6 A;  2HIV A;  4OO1 G;  1JE4 A;  3AFQ A;  3O13 A;  1VQI A;  3KLR A;  1PA6 A;  1ILQ A;  3JAM L;  1PTO C;  3P7J A;  3A7A B;  4LF4 Q;  4ME5 A;  2R93 G;  2M9V A;  3GTM B;  4UPA A;  3FRP B;  4DN4 M;  3I4M H;  1PFS A;  2JA8 G;  3HOY G;  2K6A A;  1N33 Q;  1R4P B;  3MAQ A;  1EYA A;  2UUA L;  4BBS G;  4DR1 L;  3I4M B;  4P75 A;  4DUZ Q;  4X6A H;  3G4S A;  4L5S A;  3TP5 A;  1GO3 E;  1IHZ A;  1Z9F A;  4BY1 G;  1HR0 L;  2VB2 X;  2Q8I B;  1YIJ A;  1Q1B A;  1GOZ A;  2O2L D;  4IFD H;  3DWP A;  4J1M A;  4XQN A;  1VQ8 A;  1STN A;  2K7V A;  3M4O H;  2DUD A;  2R7D A;  2ZT9 C;  4DR2 Q;  2EJG C;  2E2H H;  5KNC A;  2F0E A;  1QVG A;  1YBY A;  2A8V A;  3PIP A;  4NB3 A;  3M4O B;  1BF4 A;  1EEI D;  4P73 A;  5KNB A;  1G6Z A;  5IP9 H;  2F03 A;  4LNQ A;  2IPK D;  2OQ0 A;  2AHO B;  4A3B H;  2K4K A;  1J5E Q;  1WTP A;  1KNE A;  3KJO A;  1IBK Q;  3IRB A;  4OEL B;  4C3I H;  1DD2 A;  5DM7 3;  4DAY B;  3QOJ A;  1ZKO A;  2N88 A;  1D7Q A;  2AWO A;  2R6G A;  1D5Z C;  4A3B B;  2EYL A;  3QIA A;  2Z6B A;  1MJC A;  5A35 A;  5HGQ A;  1HR0 W;  2EYF A;  3HG9 A;  3J7A F;  3CU7 A;  4A93 B;  2NYZ D;  1U0L A;  3GTJ H;  1B7Y B;  1CM9 A;  2MPM A;  4DV2 Q;  2UU9 L;  1SXT A;  4YCV A;  1Y8P B;  3GTJ B;  4X3U A;  4GOP B;  4RHS A;  2EPB A;  2OF1 A;  1XPO A;  2B2T A;  2IL8 A;  1HJP A;  1YNJ D;  2D0P A;  3K57 A;  1TII D;  1WD0 A;  2A68 D;  2JA9 A;  5D65 A;  1DM0 B;  3HOZ H;  3Q22 A;  1S5F D;  2V1C C;  4DUY Q;  1Q12 A;  1FGU A;  1VF7 A;  1U4R A;  2MQH A;  5LL6 S;  3ERO A;  4GKJ L;  5IYB H;  2BCO A;  3PGZ A;  2ZXR A;  4YIJ A;  5JPN C;  4BS9 A;  3E9H A;  2RCN A;  3VR3 A;  4OL7 A;  1TWC B;  1V1O A;  5ELO A;  1SNP A;  5BN4 A;  1NUC A;  4IFD G;  4B9W A;  1SDF A;  1ICW A;  3CPF A;  3BG3 A;  2F0I A;  2NVQ H;  3DWQ A;  1TR5 A;  4KY6 A;  2VQE Q;  1GUS A;  3BU2 A;  3C1F A;  4HTH A;  3S1N B;  5IT9 c;  2CHB D;  2ZJP A;  3VYT A;  3BDC A;  1UUP A;  2L0C A;  1T9H A;  3RUZ A;  5IP9 G;  3SDZ A;  2J4X A;  3ULJ A;  4C3J B;  3T51 B;  2JA6 B;  4QQB X;  2G5D A;  3CCJ A;  1IZ6 A;  4A3B G;  4KKT A;  5LMU Q;  1XNR L;  1SMY D;  5I2X A;  4C3I G;  5KYI A;  2UXB L;  2HUG A;  1NE3 A;  2MGS A;  5C4Z A;  2DGY A;  1E24 A;  4NP5 A;  1V43 A;  4APV A;  3HKZ G;  2A6E D;  2F0U A;  1M90 C;  1HUN A;  3I55 A;  3ERS X;  2OTL A;  4LUO A;  4WJ3 M;  4DV5 L;  3TZD A;  4B3S Q;  1N32 L;  3F1Z A;  1PH3 A;  1I94 L;  3BS1 A;  1EY4 A;  2Q2H A;  2R7F A;  4LMQ D;  5DLQ E;  2OQK A;  1HZC A;  2F0L A;  1TWH H;  3VR5 A;  4R4T A;  4KY5 A;  2KJX A;  2RKS A;  3RZD H;  4OWW B;  4YWM A;  3AB9 A;  4DKA C;  3HOZ G;  2L4N A;  5CV5 A;  4LF7 Q;  4KKS A;  3S17 B;  4JI3 L;  2F3W A;  2EXD A;  3J80 E;  4X64 L;  2K50 A;  2M00 A;  3F2B A;  2H1E A;  4OX9 L;  5IYB G;  3GTP B;  4JYA Q;  3IFD A;  1PH8 A;  3CCM A;  1X6O A;  1BBU A;  4ODG A;  2WAC A;  3ERQ A;  1WTO A;  3OMG A;  3H94 A;  1I3Q B;  1NY4 A;  4JG2 A;  3SEB A;  2I5L X;  4MNO A;  2HIX A;  4H13 C;  1SYB A;  1TU2 B;  4KKU A;  5TSS A;  1ENC A;  2HD3 A;  1YVC A;  3S1R B;  2TSS A;  2BA1 A;  2Z4I A;  1E7Z A;  5JJZ A;  3L2P A;  2PYK A;  1S5B D;  3RD4 A;  1JWM D;  1MGS A;  4KK7 A;  3TRZ A;  3NQI A;  1PRT B;  4CDE C;  1TWG H;  1WTQ A;  1PFN A;  2WKD A;  5M9O A;  1Y1V H;  4DAM A;  3ONA B;  4MTK A;  1E2W A;  4GN3 B;  1UE6 A;  3BYT B;  4QL5 A;  1TWG B;  1HXY D;  5FLX c;  1HA5 A;  1Y1V B;  4FF3 A;  3CC4 A;  3I73 A;  3P75 A;  3MHB A;  3E0E A;  4FXG C;  1Q82 C;  1BBW A;  2JEB I;  2SEB D;  2EE1 A;  5K5P A;  2RDF A;  1HFN A;  5IGC A;  3S2D B;  4LF4 L;  1SBB B;  2F0Q A;  2BDN A;  3S9W A;  1EWC A;  4HED A;  2K5H A;  4JI6 Q;  1VS0 A;  4POF A;  2V4D A;  1M1K C;  1EU4 A;  1Y14 B;  1QNK A;  3QG1 A;  2PMZ E;  1EEF D;  2IHF A;  4DAP A;  1N33 L;  3SXH A;  1TS2 A;  2Z6K C;  1XX8 A;  4F8M A;  2BE5 D;  3UDI A;  4F88 A;  4DUZ L;  1EU3 A;  1L0Y B;  1SYF A;  3TME A;  3M7N A;  4F87 A;  4DXF A;  4V19 0;  3Q6S A;  2R7Z H;  3KF8 B;  4OWX B;  1L1O A;  1LT6 D;  1QB5 D;  3H91 A;  1X56 A;  2IX0 A;  2BH2 A;  3C3L A;  2K05 A;  2R7Z B;  1KDB A;  4DR2 L;  3EFX D;  4TSS A;  4OXP A;  4JI2 Q;  1SNQ A;  5CYU A;  4L6T B;  4DV0 L;  1JB7 A;  1EY5 A;  5JEA H;  1JOQ A;  1ESR A;  2N55 A;  5C0X H;  1K0R A;  3IL8 A;  3UE0 A;  3FVQ A;  1J5E L;  2EYP A;  3V96 A;  2PQA B;  3A8I E;  1IBK L;  1UEA B;  1JOR A;  3I4O A;  1SYC A;  1EZ8 A;  2P5Z X;  1TWA H;  3VDY A;  4CBV A;  2VZA A;  2IW3 A;  3BVG A;  4A3K H;  2B8F A;  4PQX A;  2CH4 A;  2K1B A;  3X3M A;  4R1J A;  1M8A A;  2G9H D;  2ZXP A;  4LUV A;  4R4O A;  3VYS A;  4A3K B;  4DV2 L;  5KGU A;  2F0G A;  1Y1V G;  3KF6 B;  3NHH A;  5H1S E;  2ENB A;  1C8C A;  1KRS A;  4NW2 A;  3PIO 3;  1IKL A;  3MZ5 A;  3IAY A;  1E3P A;  3TP7 A;  1B9M A;  4CJ0 B;  4IPH A;  3KFU A;  4IPG A;  1UE5 A;  3TEH B;  2Y0S B;  5IGD A;  4DUY L;  5JJI A;  3V2T A;  1GJX A;  4FVM A;  2B8G A;  1JIC A;  4YHH Q;  3HEJ A;  5FO7 B;  3HOX H;  1CHQ D;  4LWC A;  2ZTC A;  1D1K A;  1UWV A;  2I46 A;  3J80 L;  4NKL A;  1QVF A;  2F0O A;  3P1H A;  2C5C A;  1RTN A;  1OO9 B;  2IJ0 A;  1F9P A;  2PMZ B;  1LT4 D;  2QW7 A;  1DJR D;  4PNY A;  3Q0A A;  4Y52 H;  1VQH A;  3U4V A;  4A3D B;  2AKW B;  1XJV A;  1HHV A;  2R7Z G;  2GVB A;  1W3S A;  4N9P A;  1RHP A;  1SRO A;  4XT3 B;  3T56 B;  4XQQ A;  4A4I A;  5IGG A;  4HCE A;  1B44 D;  4N8F A;  1N8R C;  1G2T A;  1IW7 C;  2VQE L;  2D9U A;  5I9O A;  4AQY Q;  4YY3 Q;  4R8I A;  5JEA G;  3QB3 A;  3GTG H;  2F0F A;  5C0X G;  3D6C A;  1C4Q A;  3DEP A;  1G8Z D;  4FYD A;  3WOE A;  4KD4 A;  2Z8L A;  5LMU L;  3S16 H;  1HFG A;  1B1Z A;  1FYC A;  2G9D A;  2B29 A;  1RKN A;  2D0O A;  4EQ5 A;  4HAE A;  3K7U C;  2QIL A;  3BJU A;  4J6H A;  1H9J A;  5I4D A;  1VMC A;  3K8A A;  3LX0 A;  3CME A;  4A3K G;  3S16 B;  4P72 A;  2KEC A;  4UP8 A;  1K8M A;  1EYC A;  2A5H A;  3NEN A;  3OWE B;  5I9P A;  1SYG A;  3DEO A;  2KEE A;  1A3U A;  4BY7 B;  2LKV A;  4B3S L;  2UXD Q;  5C44 B;  1IXR A;  2LY7 A;  5M3F B;  5M3M H;  3A0J A;  1KC8 C;  1K8G A;  4FF4 A;  2Y0S G;  1KAB A;  3RLF A;  3URY A;  1SYE A;  2L55 A;  4XT1 B;  4A3J H;  3AU7 A;  2N49 A;  2A1A A;  1NR2 A;  3IFT A;  2LS0 1;  1OXS C;  4DR7 Q;  2Q8R E;  1BCP F;  1HTL D;  1K8A C;  1BDO A;  4LF7 L;  1CK1 A;  2R3Z A;  4GNX A;  3OWF A;  1I4P A;  4WFN 3;  4A3J B;  2C35 B;  4QMG A;  1AP0 A;  4QY7 A;  5EBD A;  1PXU A;  3HOX G;  1XPR A;  1IBL Q;  3S1Q H;  3D31 A;  1L2F A;  4GKK Q;  4JYA L;  5JAV A;  5IGB A;  3PUZ A;  2NN6 I;  2TMP A;  4ABN A;  1IW7 D;  3TQY A;  3J7Z C;  4K6L A;  4AYB E;  3PF5 A;  3S15 B;  4FNF A;  4JI8 Q;  1WOC A;  4MIU A;  1U4M A;  5CBA E;  3GTK B;  1SE2 A;  2A69 C;  5D3D A;  1YHQ A;  5LL6 X;  5IT9 E;  2XNA C;  1SFO H;  1HA6 A;  1R9T B;  2PNH A;  1I50 B;  3CCU A;  3NEL A;  2F0S A;  3T1Y Q;  4I65 A;  1EQV A;  2NB0 A;  1GHJ A;  1Q81 C;  2ATW A;  1SFO B;  3PUV A;  4HJ5 A;  4JBM A;  4A3L H;  1RCV D;  4CHT B;  4CKC A;  4LFB Q;  1I4Q A;  2FHT A;  4MTN A;  2IY5 B;  1STH A;  2R93 B;  1A15 A;  4DNT B;  1NAP A;  1WTV A;  3ULP A;  1IKM A;  3HOY B;  5C3X A;  2Z0S A;  3BDL A;  4RA8 A;  2K5W A;  4DR4 Q;  2UXC Q;  1VDZ A;  1MBY A;  4JI6 L;  4BBS B;  4M1U B;  1PYS B;  2QKI C;  4DK1 A;  2XRS D;  4K0K Q;  4BY1 B;  1X55 A;  1PTO B;  1CQF A;  4ZRZ A;  5D3I B;  1KTK A;  4IUP A;  5M3M G;  3NUC A;  4DV3 Q;  1S5D D;  2AWN A;  4TVA B;  1RTO A;  1GUT A;  4UY8 C;  1IL2 A;  1SND A;  5KND A;  5LMN Q;  4A3J G;  1I6H B;  3L3O C;  1RJT A;  1QIL A;  4WJW A;  3C2P A;  2C9O A;  1PYB A;  4JI7 Q;  4DR3 Q;  3D4R A;  4DAY A;  1Z47 A;  1CKM A;  3ND9 A;  4TKO B;  3G48 A;  3MWY W;  4C2M B;  1CSP A;  4KV6 A;  1VQ4 A;  1JJ2 A;  4JI2 L;  4ZCK A;  1G29 1;  1QVC A;  5JVG 3;  4TRD A;  3A7L A;  2RQX A;  1TS5 A;  1SJE D;  1ILP A;  4GZY C;  2VB3 X;  4GOP A;  2F0M A;  3F8T A;  2IWH A;  4ZKC B;  1JC7 A;  2JQO A;  4P74 A;  1WTH A;  3B6Y A;  1PMR A;  5J1Z A;  1KHI A;  4F7X A;  4DV4 Q;  3STB D;  3FKI H;  4KHZ A;  3CXC A;  5C6A A;  3W1B A;  3CQZ H;  2SNS A;  2WFW A;  4Z9C B;  3H15 A;  3FKI B;  5FLX E;  4A3L G;  3ITP A;  3NTK A;  4O2D A;  4DK0 A;  1YJW A;  1IL8 A;  5CBE E;  3PIO A;  4K5V A;  4K5W A;  4NMZ A;  3CC7 A;  2K5Q A;  4RMF A;  1YNJ C;  4A3I H;  3VYU A;  3CHB D;  2A68 C;  1Q8I A;  1Q1E A;  5G3L F;  2MO0 A;  3CKI B;  5EKI A;  1S5E D;  3E6Z X;  1LAC A;  4JI4 Q;  4YHH L;  3CF5 A;  4JBK A;  3PUW A;  1BNZ A;  4IPC A;  5ELN A;  3T1H Q;  1WD1 A;  1X3G A;  4H44 C;  1E1O A;  1PFB A;  4ULL A;  1RD9 D;  3I2Z A;  5IYD G;  4BBR H;  4YWL A;  5M5W H;  3MVV A;  3CRL C;  5HY6 A;  3J81 c;  3CW2 C;  2PNR C;  3ND8 A;  5IWA Q;  1EUJ A;  4JW0 A;  4DV0 Q;  4BBR B;  2JEA I;  5M5W B;  2FMM A;  4RCN A;  3DLL A;  1DYQ A;  2E2H B;  3RMH A;  1TS4 A;  1Q3L A;  4ZYS A;  2JXM B;  1XPU A;  1XTD A;  1LTB D;  5DEH A;  3EA6 A;  3AFP A;  5EKK A;  1WVL A;  3BZD B;  3PSI A;  2VUM H;  2E8G A;  3L9A X;  5IT9 L;  1EOT A;  1LO5 D;  2PZW A;  3WWV A;  3SR1 A;  4AQY L;  2RF4 A;  4YY3 L;  2VUM B;  1FJG Q;  3TSS A;  4C3I B;  4L8J A;  3I91 A;  2QEX A;  1UE7 A;  5EQ0 A;  1PZK D;  3K7A H;  4C1N K;  3HKZ B;  3SE0 A;  4PV1 C;  4AYB G;  1SMY C;  2HHH Q;  1LTA D;  1VQJ A;  2LFN A;  2UUB Q;  2A6E C;  1UAP A;  4B9X A;  1KXL A;  1I5F A;  3FKI G;  4R4C A;  3UI2 A;  2LXK A;  5JVH 3;  2OWO A;  3PF4 A;  5IE8 A;  4CJ1 B;  2D5D A;  4QB4 A;  2UXD L;  4XIG S;  3RNU A;  1SLJ A;  1B50 A;  1AN8 A;  1XYI A;  3HOZ B;  4HJA A;  1LT5 D;  1FNW A;  3QWN A;  1L0W A;  1SR3 A;  2RCF A;  5GAE C;  4JK1 C;  1DCZ A;  3I90 A;  4CDF C;  5FK9 C;  2I0Q A;  2LXJ A;  4A3I G;  2K28 A;  2Z6K A;  5BR8 Q;  3MEF A;  4DR7 L;  1CKN B;  3NPP A;  4JC0 A;  2MNA A;  1BOS A;  3FPU B;  3PQI A;  3A8K E;  1RDP D;  4P2C B;  1SN8 A;  2M2L A;  2FIN B;  3H6M A;  2VL6 A;  4XTC S;  4KJN A;  4C1N I;  1IBL L;  1FGB D;  1JB3 A;  2DN8 A;  4GKK L;  4JVZ A;  2EY6 A;  1OXV A;  4BBR G;  2KA7 A;  1QUQ A;  3RLN A;  2B2V C;  1Q46 A;  2Z4H A;  3CMA A;  1DOL A;  4JBW A;  2NVQ B;  4A3E H;  1H9M A;  4JI8 L;  2BOS A;  4IN3 A;  3TBI B;  1VQL A;  4ZAI A;  1B53 A;  1KAW A;  3J81 i;  4OIJ A;  2VUM G;  1D2B A;  1LAB A;  2E75 C;  4IQZ A;  1EIG A;  2YTV A;  1O7I A;  3T1Y L;  1EYG A;  3S14 H;  1GHK A;  1VQ6 A;  5K36 H;  2YTY A;  1LTT D;  4KI0 A;  1PYW D;  4QGU A;  3DXJ C;  4LFB L;  1MD2 D;  1A62 A;  5FLX L;  3S14 B;  4I7A A;  3OIP A;  2JSO A;  3P20 A;  4A3G H;  1K8O A;  1CFM A;  4DNR B;  3OPO A;  1SSO A;  1HUM A;  1KRT A;  1GM5 A;  1LT3 D;  2XIW A;  1JWS D;  3ZYY X;  2K75 A;  1ENF A;  4KLK A;  4DR4 L;  2DY7 A;  2UXC L;  4IUV A;  1HPC A;  3KF8 A;  2B2Y A;  1AE2 A;  4JBJ A;  4OGQ C;  5D14 A;  2IT1 A;  3R2T A;  3QJY A;  4ZUJ A;  1TWH B;  2N78 A;  2ICI A;  4K0K L;  4GS3 A;  1XTC D;  4B3M Q;  2K03 A;  3RZD B;  5J39 A;  4N9T A;  2BE5 C;  3NSW A;  4C3H H;  1YHA A;  4XYO A;  2EYO A;  3U4Z A;  1EQQ A;  4DV3 L;  1HQM C;  2EDG A;  1EQT A;  4C3H B;  5LMN L;  3JAM i;  1VQC A;  3K58 A;  1I4X A;  2PQA A;  1S4Z A;  4JI7 L;  4DR3 L;  4ZK9 B;  5M5X H;  1W2B A;  1QZH A;  1S3O A;  3FEW X;  5BN3 A;  2D62 A;  2EY1 A;  1ASZ A;  3NBH B;  5AJ3 Q;  5M5X B;  2HDM A;  4RG1 A;  1X3E A;  2HCC A;  1V1P B;  3G71 A;  2RDH A;  5M5Y H;  3S1M H;  3SHL A;  1QUQ B;  3KF6 A;  3CCQ A;  1XMQ Q;  2AUK A;  1UEB A;  4LF5 Q;  1MI2 A;  4XYQ A;  4A3E G;  2EIF A;  2K14 A;  4ME3 A;  5M5Y B;  1EYD A;  1TXY A;  1SEB D;  4OEM B;  5F2D A;  1XNQ Q;  4H7B A;  1VQE A;  3M4P A;  3CPW A;  4DV4 L;  5LMN W;  3BYY B;  2LSS A;  2ZXO A;  1O7Z A;  5ELD A;  4Y7N H;  2F3V A;  4KJO A;  2AMC B;  4A3M H;  5K36 G;  1A63 A;  4RFB A;  1R4Q B;  4Y7N B;  2EXZ A;  1X9N A;  1U5K A;  4A3G G;  3OTO Q;  2OEO A;  2Q2I A;  3W3A A;  2B2T C;  1Y69 U;  4RGM A;  2EY5 A;  2E74 C;  2F4V Q;  1FNV A;  4LF6 Q;  3I7F A;  1JQY D;  4IO9 A;  5CV4 A;  3W2D A;  3EQL C;  2KHJ A;  4JI4 L;  4DU9 A;  2JA7 H;  2X6G A;  3T1H L;  3CRK C;  2GVA A;  4DV1 Q;  1ONL A;  1X54 A;  1HNX Q;  1F9R A;  4JI5 Q;  4X3S A;  2L12 A;  3GV3 A;  2F0D A;  2WB1 E;  4C3H G;  2JA7 B;  5HUR A;  2PZT A;  3SK5 A;  5IWA L;  4DV7 Q;  4GN4 B;  2B2U C;  1F2Z A;  4FO2 A;  3K5O A;  2PPB C;  4K6D A;  2F0K A;  3TRE A;  1A8V A;  3M9B A;  2O5I C;  1OTC A;  3GDE A;  4K5X A;  2JA5 H;  3HOV H;  4LW1 A;  1QNU A;  3A8J E;  2JN4 A;  2A73 B;  2D2C C;  1QZG A;  2XWJ B;  3CCV A;  4EQO A;  3HOV B;  2JA5 B;  1FJG L;  2ID0 A;  4X3K A;  1EFI D;  1BUV T;  1CQV A;  1S72 A;  1TWA B;  4N8X 1;  2IX3 A;  3NK9 A;  1IYU A;  3FDT A;  2E2I H;  1JR0 D;  3OMC A;  3S24 A;  2HHH L;  4U68 A;  3CCE A;  2MO1 A;  2Z9H A;  2VNU D;  4Q0F A;  4QIW E;  1STE A;  4ZKB B;  4L5R C;  2E2I B;  3M4Y A;  3AMU A;  4UP9 A;  1YI2 A;  2UUB L;  4PG3 A;  2CVR A;  2R92 G;  3VA5 A;  1MSG A;  3CP0 A;  3U9O A;  4A3M G;  3EJI A;  2MP1 A;  3E9I A;  3KBX A;  1HZ9 A;  1W6K A;  1I6V C;  4A3F H;  5I6W A;  3AEV A;  1ZXT A;  2RHQ B;  4ILW A;  4JOI A;  1VQ9 A;  3MXG A;  1GXD C;  1Q8K A;  5C0X J;  5BR8 L;  2K01 A;  2N3S A;  3HOX B;  1EIH A;  3J7A 5;  3E5S A;  5EGT A;  3LWU A;  4HN7 A;  1YHB A;  4PZ7 A;  1DXM A;  1VQK A;  1GKH A;  4O1N A;  5ISR A;  3TS2 A;  2PW7 A;  4H02 A;  1IYV A;  4UDU C;  2JA7 G;  3NBI A;  4IUR A;  4RAU C;  3H3V I;  1SE3 A;  2XGT A;  2A6H D;  2NVT H;  1H9S B;  1E0B A;  1LTG D;  5FO8 B;  2KVM A;  4IPD A;  5CGK A;  3FHW A;  4HJ8 A;  4JI0 Q;  1YZ6 A;  4DF7 A;  1PH4 A;  2NVT B;  3J81 j;  1PRT D;  2CW0 D;  1STB A;  3Q23 A;  1KLU D;  2PQE A;  4MZ9 A;  2PW5 A;  3VR2 A;  2SNM A;  4PZ8 A;  4ALP A;  2VW9 A;  4QUF A;  2KCM A;  5CV9 A;  3KDF B;  4K2L A;  4OHJ A;  5CMD A;  3GTG B;  1SNC A;  2JA5 G;  3HOV G;  1V1Q A;  1X3F A;  3PUX A;  4L5Q A;  4JI1 Q;  1F2L A;  3UDX A;  1PRT F;  4DA2 A;  3IKJ A;  3U58 A;  5HGT A;  3EBE A;  2F52 A;  2K5N A;  1WI5 A;  2YYZ A;  2DNC A;  3PO2 H;  3MA2 B;  1CA6 A;  1E1T A;  3MEH A;  5DNF A;  4FF2 A;  1X3P A;  3FPP A;  3BDO A;  1QCB D;  3NTH A;  2HT1 A;  1BCP D;  4MN3 A;  5EPJ A;  2XTI A;  3DUZ A;  3N6R A;  2A19 A;  1BR9 A;  2ZTD A;  5FO9 B;  1D5X C;  1NMF A;  3MFG A;  4FXD A;  1AH9 A;  4PMB A;  4KY7 A;  4DR5 Q;  4QIW B;  5M3M B;  4BXX H;  2N8N A;  1D5M C;  3L0O A;  3KK7 A;  5EPK A;  3G6E A;  1VQM A;  4B3M L;  1QJO A;  1T5X D;  2KBN A;  2ZTE A;  2JJQ A;  2NTS A;  4A3F G;  3H0G H;  4R8N A;  2L9H A;  1PH1 A;  3HFZ B;  3TDQ A;  4HJ9 A;  1MJE A;  4QCL A;  3PCO B;  1PFM A;  1O7Y A;  4BWG B;  3H0G B;  1IYJ B;  1ZEQ X;  5E7N A;  2NN6 H;  3S1Q B;  3OYY A;  5CC4 A;  5C3E H;  1L1O C;  1PVO A;  4PMC A;  4G7Z C;  3X3N A;  2QGQ A;  3HP3 A;  5AJ3 L;  5C3E B;  4WOR A;  5IOC A;  2F0H A;  3D4W A;  3K5M A;  1NMG A;  4HIO A;  1EL0 A;  3LWE A;  1XMQ L;  4LF5 L;  3HZX A;  1NSN S;  4RCO A;  1VQN A;  1AE3 A;  4OO1 I;  4GLX A;  5JJK A;  2K5V A;  3HRZ C;  3STB C;  5EKL A;  1CSQ A;  1XNQ L;  2CWA A;  1TWF H;  2WP8 J;  1PH7 A;  2Q2U A;  2E2D C;  4YCW A;  1X3Q A;  1YNX A;  2AQ1 B;  1OXX K;  2B39 A;  2XVS A;  1TWF B;  3PMF A;  3R2I A;  1DOM A;  2EQS A;  1PH2 A;  4GLV B;  3HKS A;  3OHX C;  3OTO L;  5IYD H;  1EFW A;  2CCZ A;  3NTI A;  4IJH A;  1VQA A;  3GO5 A;  4LFC Q;  3GTO H;  2SDF A;  5CV8 A;  3I72 A;  1EWH A;  2H4O A;  4LF6 L;  2F4V L;  1CT1 D;  2J0T D;  5ELF A;  1T5E A;  3GTO B;  3Q8D A;  1DON A;  3I4L A;  1BKB A;  3FP9 A;  2AQ3 B;  3I8Z A;  4G7O C;  4OIK A;  4BXX G;  4M8A A;  4JV5 Q;  1K9M C;  3GTQ H;  3CCL A;  2CQO A;  2IX1 A;  4DV1 L;  2DJF C;  2B63 H;  2CH4 W;  4JI5 L;  4AIM A;  1LTI D;  1HNX L;  4HR7 B;  3J81 L;  3MXN B;  1EY6 A;  3H0G G;  2YTX A;  3R8B A;  5C4X H;  1G6P A;  4DV7 L;  2ASB A;  1B4O A;  4HSP A;  1STG A;  4EX5 A;  1SE4 A;  2NVY H;  2ZM6 Q;  1VQ5 A;  2B2V A;  1MIU A;  2NN6 G;  5EPL A;  2FMC A;  3D3R A;  3QR8 A;  2NVY B;  4IAL A;  5C3E G;  3PUY A;  3T16 A;  2L11 A;  3M4Q A;  1B8A A;  2XRQ D;  3U9S A;  3RZO H;  4R4I A;  4AYB B;  2NZO A;  5COY A;  3PO3 H;  1JCK B;  2H5X A;  1J6Q A;  2PI2 A;  2FXQ A;  3KOJ A;  1LV9 A;  3RZO B;  3WDN A;  1VQO A;  1HRJ A;  4RKL A;  1YEZ A;  2I5H A;  3PO3 B;  5G3L D;  1AZP A;  1QG7 A;  1HCZ A;  4LJZ C;  4CKE A;  5EAY A;  3K5L A;  2EVB A;  3CQZ B;  1KLG D;  4FF1 A;  1UNS A;  4K8J A;  2EY2 A;  4RH6 A;  3F2D A;  1G91 A;  2K52 A;  1MHW C;  1AW7 A;  2I07 B;  5FOB B;  4U67 3;  4HIM A;  1CKN A;  4JCV E;  1KDC A;  2F0V A;  3GTM H;  2MFI A;  1B3A A;  1C0A A;  3DM1 A;  4KN4 C;  1BO0 A;  4A3I B;  2PCF B;  3K59 A;  1KNA A;  4A76 A;  1B70 B;  5BN5 A;  1GUN A;  5IYC H;  1VQB A;  1D1I A;  1AZQ A;  3QOL A;  5ELE A;  2VY3 A;  2NTT A;  1CUK A;  3HS0 C;  3L7Z C;  2B2W C;  4IFD I;  3T53 B;  4GNX C;  1GD7 A;  4IUT A;  3VYR A;  1F9S A;  5IGF A;  2B63 G;  1KAA A;  1G51 A;  3KLW A;  2KEN A;  2A74 C;  2RHS B;  3K5N A;  3K0X A;  4JI0 L;  5C4X G;  4NXN Q;  1HQR D;  1CA5 A;  3SK6 A;  1YNN D;  2E76 C;  4S3S A;  2XSC A;  1WJJ A;  1ZYR D; 
#chains in the Genus database with same CATH homology
 2MHV A;  1JWU D;  1SNM A;  5KEE A;  4KD3 A;  2NBF A;  2FFK B;  3PO2 B;  5DM6 3;  3M7G A;  2KOL A;  3MXU A;  3K7A B;  1XWE A;  1XXG A;  4K2K A;  5IGE A;  1ML0 D;  2K32 A;  2YU9 B;  3VR6 A;  4IFD J;  2KCC A;  4V0B A;  5C4J B;  4QUC A;  1VF5 C;  1PTO D;  4EQP A;  2DNE A;  3DMU A;  2NZ1 D;  4EVO A;  2ICE C;  1ESF A;  3DHQ A;  2WV6 D;  3Q24 A;  2O4X A;  3J7A V;  2F0T A;  1JOO A;  5AFW A;  3NQT A;  1PTO F;  5I2Y A;  1J8I A;  3NBH A;  2SOB A;  4G7H C;  2WII B;  1V1P A;  2RSO A;  3N52 A;  1AEX A;  1Q90 A;  1EY7 A;  1NCV A;  3D4D A;  3GQB A;  2B2U A;  2WKC A;  5ELB A;  2NWG A;  4HSV A;  2OXP A;  1LLR D;  1D6E C;  3SK8 A;  2CQA A;  4CKB A;  4A3E B;  5C5L A;  4DAV A;  2L5T A;  4X3T A;  3S2H B;  4ZLT F;  3C1E A;  5CR3 A;  3MTS A;  2Z1C A;  3WOF A;  2MUY A;  3I4N B;  1LTS D;  1U9R A;  2K33 A;  3OW7 A;  5T1I A;  4K8I A;  4FXK C;  4HCS A;  4MHE A;  1B2T A;  4R9W A;  5E4W C;  4A3G B;  3GTL B;  2KQ3 A;  4EQN A;  5IIF A;  3F2U A;  4G57 A;  1G2S A;  4CJ2 C;  5I6Y A;  1ET9 A;  1SYD A;  2RA4 A;  2KUM A;  3MFY A;  2O5J C;  1PDQ A;  3KBG A;  3V05 A;  2AQ2 B;  4RKB A;  3SVM A;  2GA4 B;  5JPM C;  1TQO A;  2KED A;  3FMC A;  1BQQ T;  4IZ8 A;  2WAQ B;  2F0W A;  1FR3 A;  1WTX A;  1QOH A;  2XWB B;  1PZJ D;  5IOD A;  1F77 A;  4L63 B;  5JOB A;  2JP1 A;  1PZI D;  1U4P A;  5CV7 A;  3S1M B;  1E2V A;  4B08 A;  1EY8 A;  4C56 C;  3HOW B;  1NR4 A;  5COR A;  1WTW A;  3NWT A;  4RGT A;  1FNU A;  1AFP A;  4XQJ A;  1PLF A;  4C3J G;  2QDB A;  3MC0 B;  2R92 B;  2HDL A;  1TVX A;  1TT2 A;  2F0J A;  1BXT A;  2LMC B;  4A3M B;  3A54 A;  4RHR A;  3C46 A;  3NWS A;  5LHY 1;  1U4L A;  3QO2 A;  1HTP A;  2NVX B;  3HGB A;  2PZU A;  5ELC A;  5E4X A;  1H9S A;  4DFA A;  1BCP B;  3KLS X;  4HMJ A;  3BVM A;  3EVQ A;  3TP6 A;  3K0Y A;  2R61 A;  3NXW A;  1TKW B;  1VMP A;  1VCI A;  4NDX A;  1GUG A;  4LK1 C;  2A6H C;  3TN2 A;  1A2T A;  1A3V A;  4H0L C;  2F4I A;  2L1B A;  1Y8N B;  4O42 A;  1M4V A;  4ZQ3 A;  1PRT C;  2CW0 C;  1QE6 A;  2NUC A;  5KYL A;  5C0X I;  3I3C A;  3R93 A;  2Q8T A;  2K5D A;  1L0X B;  1CZW A;  5KIX A;  1I4R A;  5T1G A;  3PV0 A;  1WCM B;  1BBX C;  2OT2 A;  1EZ6 A;  3K6O A;  3NE5 B;  1J9O A;  4IUN A;  1II3 A;  1O80 A;  2VXW A;  1BCP C;  2RSN A;  4PMW A;  5E3F A;  2JE6 I;  1WTR A;  3TZU A;  4DGZ A;  1C48 A;  1B9N A;  3MXP A;  5JEA J;  1CZG A;  5A2Q E;  4A3F B;  2HQE A;  2B2Y C;  3VR4 A;  5C4H A;  2F0P A;  2F0N A;  3HOU B;  5J22 A;  2QF7 A;  5FKA C;  3T13 A;  2KHS A;  3J81 E;  3R3O A;  1GUW A;  1SAP A;  1ENA A;  4RGO S;  4CGY B;  3PIP 3;  2EJM A;  1TY2 A;  2WB1 B;  2MJ8 A;  2HCI A;  5EJW A;  1STY A;  2BA0 A;  2RVL A;  3I70 A;  2K04 A;  4RWS C;  4XXE A;  4BA1 I;  5C3W A;  2AUJ D;  2X6L A;  2QEJ C;  3D8G A;  2WIN B;  5NUC A;  4XDX A;  2F1M A;  3GV6 A;  3G6J B;  1QWY A;  2FJ2 A;  3OIQ A;  1EY9 A;  2EJF C;  4KMU C;  4ZUI A;  3JAM E;  1CHP D;  2XN9 C;  4KN7 C;  4ID6 A;  3DWA A;  3MXN A;  1O7L A;  1CI3 M;  3D6W A;  3OSO A;  4K14 A;  2E2J B;  4DXG A;  3H3V C;  1F9Q A;  2J7Z A;  1GUO A;  4KHV A;  3M85 A;  4RGN A;  1A3T A;  5CV6 A;  2B2W A;  2EYM A;  2JYO A;  2X69 A;  1CTM A;  4J8Q A;  3OOC A;  1OXU A;  2EYJ A;  1DOK A;  1EY0 A;  2RDG A;  3G7L A;  4EGV A;  1A2U A;  1I4G A;  4QF4 A;  3A56 A;  1F2Y A;  1Y1W B;  1S5C D;  1X32 A;  1ROD A;  3E0J A;  4E6I A;  3T4A C;  2DY8 A;  4WRD A;  5KRU A;  4OO1 H;  2RBM A;  2EYH A;  5DAU A;  3SK4 A;  1OXT A;  4Q5V A;  3M3Y B;  5EBC A;  1DZ1 A;  2BDO A;  1STA A;  1H9K A;  5C5M A;  4KTA A;  5A2Q L;  2JA8 B;  2KCN A;  1PTO H;  3GP7 A;  3TP8 A;  4BA2 I;  1FD7 D;  4HMI A;  2PO4 A;  1E2Z A;  3KUP A;  2EZV A;  1RF2 D;  3GTQ B;  4IUU A;  1SNO A;  2B63 B;  1Y8O B;  3LNN A;  3NP8 A;  1F2M A;  5C4X B;  2EOT A;  1MSH A;  3BVZ A;  4IUQ A;  1KDA A;  1H9R A;  4I7Z C;  4UAI A;  1ET6 A;  4FP5 D;  1I4H A;  1K83 B;  3A55 A;  1Z6H A;  3GD7 A;  1YNN C;  1ZYR C;  1JOK A;  2A69 D;  1W6J A;  4LAA A;  2QCP X;  3H09 A;  3VA7 A;  1LTR D;  1TS3 A;  3KLS A;  1A6X A;  1SJH D;  1O78 A;  1Z7T A;  4TQU S;  5E1F A;  3J7Y W;  1V8Q A;  1TY0 A;  4G4K A;  4OO1 G;  1JE4 A;  3O13 A;  3KLR A;  1ILQ A;  3JAM L;  1PTO C;  3P7J A;  3A7A B;  4ME5 A;  2M9V A;  3GTM B;  3FRP B;  4DN4 M;  2K6A A;  1R4P B;  3MAQ A;  1EYA A;  3I4M B;  3TP5 A;  1IHZ A;  2VB2 X;  2Q8I B;  1Q1B A;  1GOZ A;  2O2L D;  4IFD H;  3DWP A;  4J1M A;  4XQN A;  1STN A;  2K7V A;  2ZT9 C;  2EJG C;  5KNC A;  2F0E A;  3M4O B;  1BF4 A;  1EEI D;  5KNB A;  1G6Z A;  2F03 A;  2IPK D;  1WTP A;  1KNE A;  1DD2 A;  5DM7 3;  3QOJ A;  1ZKO A;  2N88 A;  2AWO A;  2R6G A;  1D5Z C;  4A3B B;  2EYL A;  3QIA A;  5A35 A;  2EYF A;  3HG9 A;  3J7A F;  3CU7 A;  4A93 B;  2NYZ D;  1CM9 A;  2MPM A;  1SXT A;  1Y8P B;  3GTJ B;  4X3U A;  4RHS A;  2EPB A;  2OF1 A;  2B2T A;  2IL8 A;  1YNJ D;  3K57 A;  1TII D;  1WD0 A;  2A68 D;  5D65 A;  1DM0 B;  3Q22 A;  1S5F D;  1Q12 A;  1VF7 A;  1U4R A;  5LL6 S;  3ERO A;  2BCO A;  2ZXR A;  4YIJ A;  5JPN C;  4BS9 A;  3VR3 A;  4OL7 A;  1TWC B;  1V1O A;  1SNP A;  5BN4 A;  1NUC A;  4IFD G;  4B9W A;  1SDF A;  1ICW A;  3BG3 A;  2F0I A;  3DWQ A;  1TR5 A;  4KY6 A;  1GUS A;  3C1F A;  3S1N B;  4HTH A;  2CHB D;  3VYT A;  3BDC A;  1UUP A;  2L0C A;  3RUZ A;  2JA6 B;  3SDZ A;  2J4X A;  4C3J B;  3T51 B;  4KKT A;  1SMY D;  5I2X A;  4C3I G;  5KYI A;  2HUG A;  2MGS A;  5C4Z A;  4NP5 A;  1V43 A;  2A6E D;  2F0U A;  1HUN A;  3TZD A;  3BS1 A;  1EY4 A;  4LMQ D;  2F0L A;  3VR5 A;  4KY5 A;  2KJX A;  2RKS A;  3AB9 A;  2L4N A;  5CV5 A;  4KKS A;  3S17 B;  2F3W A;  3J80 E;  2M00 A;  2H1E A;  3GTP B;  3IFD A;  4ODG A;  2WAC A;  3ERQ A;  1WTO A;  3OMG A;  3H94 A;  1I3Q B;  3SEB A;  4H13 C;  1SYB A;  1TU2 B;  4KKU A;  5TSS A;  1ENC A;  3S1R B;  2TSS A;  2BA1 A;  2Z4I A;  5JJZ A;  2PYK A;  1S5B D;  3RD4 A;  1JWM D;  1MGS A;  4KK7 A;  3NQI A;  1PRT B;  1WTQ A;  1PFN A;  2WKD A;  5M9O A;  3ONA B;  1E2W A;  3BYT B;  1TWG B;  1HXY D;  1HA5 A;  1Y1V B;  4FF3 A;  3I73 A;  3P75 A;  3MHB A;  4FXG C;  2JEB I;  2SEB D;  2EE1 A;  5K5P A;  2RDF A;  1HFN A;  5IGC A;  3S2D B;  1SBB B;  2F0Q A;  2BDN A;  3S9W A;  1EWC A;  4HED A;  2V4D A;  1EU4 A;  1QNK A;  3QG1 A;  1EEF D;  4DAP A;  3SXH A;  1TS2 A;  1XX8 A;  4F8M A;  2BE5 D;  4F88 A;  1EU3 A;  1L0Y B;  1SYF A;  3TME A;  3M7N A;  4F87 A;  4DXF A;  4V19 0;  3Q6S A;  1QB5 D;  1LT6 D;  3H91 A;  2IX0 A;  3C3L A;  2K05 A;  2R7Z B;  1KDB A;  3EFX D;  4TSS A;  1SNQ A;  5CYU A;  4L6T B;  1EY5 A;  5JEA H;  1JOQ A;  1ESR A;  2N55 A;  5C0X H;  3IL8 A;  3FVQ A;  2EYP A;  3V96 A;  3A8I E;  1UEA B;  1JOR A;  1SYC A;  1EZ8 A;  4CBV A;  2IW3 A;  3BVG A;  2B8F A;  4PQX A;  2K1B A;  3X3M A;  1M8A A;  2G9H D;  2ZXP A;  3VYS A;  4A3K B;  5KGU A;  2F0G A;  3NHH A;  2ENB A;  1C8C A;  4NW2 A;  3PIO 3;  1IKL A;  3MZ5 A;  3IAY A;  3TP7 A;  1B9M A;  4CJ0 B;  2Y0S B;  5IGD A;  3V2T A;  1GJX A;  4FVM A;  2B8G A;  1JIC A;  3HEJ A;  5FO7 B;  1CHQ D;  1D1K A;  3J80 L;  2I46 A;  4NKL A;  2F0O A;  3P1H A;  2C5C A;  1RTN A;  1OO9 B;  2IJ0 A;  1F9P A;  2PMZ B;  1LT4 D;  1DJR D;  4PNY A;  3Q0A A;  4A3D B;  1HHV A;  4N9P A;  1RHP A;  4XT3 B;  3T56 B;  4XQQ A;  5IGG A;  1G2T A;  4HCE A;  1B44 D;  1IW7 C;  2D9U A;  5I9O A;  4R8I A;  5JEA G;  3QB3 A;  2F0F A;  5C0X G;  3D6C A;  1C4Q A;  3DEP A;  1G8Z D;  4FYD A;  3WOE A;  4KD4 A;  2Z8L A;  1HFG A;  1B1Z A;  1FYC A;  2G9D A;  1RKN A;  4HAE A;  2QIL A;  4J6H A;  1H9J A;  5I4D A;  1VMC A;  3LX0 A;  3S16 B;  2KEC A;  1K8M A;  1EYC A;  2A5H A;  3OWE B;  5I9P A;  1SYG A;  3DEO A;  2KEE A;  1A3U A;  4BY7 B;  2LKV A;  5C44 B;  2LY7 A;  5M3F B;  4FF4 A;  3RLF A;  1KAB A;  3URY A;  1SYE A;  2L55 A;  4XT1 B;  3AU7 A;  1NR2 A;  3IFT A;  2LS0 1;  1OXS C;  2Q8R E;  1BCP F;  1HTL D;  1BDO A;  1CK1 A;  2R3Z A;  3OWF A;  1I4P A;  4WFN 3;  4A3J B;  1AP0 A;  4QMG A;  5EBD A;  1PXU A;  3D31 A;  5JAV A;  5IGB A;  3PUZ A;  2NN6 I;  2TMP A;  4ABN A;  1IW7 D;  4K6L A;  3S15 B;  4FNF A;  4MIU A;  1U4M A;  5CBA E;  3GTK B;  1SE2 A;  2A69 C;  5D3D A;  5LL6 X;  5IT9 E;  2XNA C;  1HA6 A;  1R9T B;  1I50 B;  2F0S A;  4I65 A;  1EQV A;  2NB0 A;  1GHJ A;  1SFO B;  3PUV A;  1RCV D;  4CHT B;  4CKC A;  1I4Q A;  2FHT A;  1STH A;  2R93 B;  1A15 A;  4DNT B;  1NAP A;  1WTV A;  1IKM A;  3HOY B;  5C3X A;  3BDL A;  4RA8 A;  2K5W A;  1VDZ A;  1MBY A;  4BBS B;  4M1U B;  2QKI C;  4DK1 A;  2XRS D;  4BY1 B;  1PTO B;  1CQF A;  4ZRZ A;  5D3I B;  1KTK A;  4IUP A;  3NUC A;  1S5D D;  2AWN A;  1RTO A;  1GUT A;  1SND A;  5KND A;  1I6H B;  3L3O C;  1RJT A;  1QIL A;  4WJW A;  3C2P A;  2C9O A;  3D4R A;  4DAY A;  1Z47 A;  3ND9 A;  4TKO B;  3MWY W;  4C2M B;  4KV6 A;  1G29 1;  5JVG 3;  4TRD A;  3A7L A;  2RQX A;  1TS5 A;  1SJE D;  1ILP A;  4GZY C;  2VB3 X;  2F0M A;  2IWH A;  4ZKC B;  1JC7 A;  5J1Z A;  1PMR A;  4F7X A;  4KHZ A;  5C6A A;  2SNS A;  4Z9C B;  3FKI B;  5FLX E;  3ITP A;  3NTK A;  4DK0 A;  1IL8 A;  5CBE E;  4K5V A;  4K5W A;  4NMZ A;  2K5Q A;  1YNJ C;  3VYU A;  3CHB D;  2A68 C;  1Q8I A;  1Q1E A;  5G3L F;  3CKI B;  5EKI A;  1S5E D;  3E6Z X;  1LAC A;  3PUW A;  1BNZ A;  1WD1 A;  4H44 C;  1PFB A;  4ULL A;  1RD9 D;  3MVV A;  3CRL C;  2PNR C;  3ND8 A;  4BBR B;  2JEA I;  5M5W B;  2FMM A;  4RCN A;  1DYQ A;  2E2H B;  3RMH A;  1TS4 A;  1Q3L A;  4ZYS A;  2JXM B;  5DEH A;  1LTB D;  3EA6 A;  5EKK A;  1WVL A;  3BZD B;  3L9A X;  5IT9 L;  1EOT A;  1LO5 D;  2PZW A;  3SR1 A;  2VUM B;  3TSS A;  4C3I B;  4L8J A;  3I91 A;  5EQ0 A;  1PZK D;  4C1N K;  3HKZ B;  3SE0 A;  4PV1 C;  1SMY C;  1LTA D;  2LFN A;  2A6E C;  1UAP A;  4B9X A;  3UI2 A;  5JVH 3;  4CJ1 B;  2D5D A;  4QB4 A;  4XIG S;  1B50 A;  1AN8 A;  1XYI A;  3HOZ B;  1LT5 D;  1FNW A;  3QWN A;  4JK1 C;  1DCZ A;  3I90 A;  5FK9 C;  2K28 A;  3NPP A;  1BOS A;  3A8K E;  3FPU B;  1RDP D;  4P2C B;  2M2L A;  2FIN B;  3H6M A;  4XTC S;  4KJN A;  4C1N I;  1FGB D;  1JB3 A;  2DN8 A;  2EY6 A;  1OXV A;  2KA7 A;  2B2V C;  2Z4H A;  1DOL A;  4JBW A;  2NVQ B;  1H9M A;  2BOS A;  4IN3 A;  3TBI B;  4ZAI A;  1B53 A;  4OIJ A;  1D2B A;  1LAB A;  2E75 C;  4IQZ A;  1EIG A;  1GHK A;  5K36 H;  1LTT D;  4KI0 A;  1PYW D;  3DXJ C;  1MD2 D;  5FLX L;  3S14 B;  3OIP A;  2JSO A;  3P20 A;  1K8O A;  1CFM A;  4DNR B;  3OPO A;  1SSO A;  1HUM A;  1LT3 D;  2XIW A;  1JWS D;  3ZYY X;  1ENF A;  2DY7 A;  4IUV A;  1HPC A;  3KF8 A;  2B2Y A;  5D14 A;  4OGQ C;  2IT1 A;  3R2T A;  3QJY A;  4ZUJ A;  1TWH B;  2ICI A;  1XTC D;  2K03 A;  3RZD B;  5J39 A;  4N9T A;  2BE5 C;  3NSW A;  4XYO A;  2EYO A;  1HQM C;  2EDG A;  1EQT A;  4C3H B;  3K58 A;  1I4X A;  1S4Z A;  4ZK9 B;  5BN3 A;  3FEW X;  2D62 A;  2EY1 A;  5M5X B;  2HDM A;  2HCC A;  1V1P B;  2RDH A;  3SHL A;  2AUK A;  1MI2 A;  4XYQ A;  5M5Y B;  1EYD A;  1SEB D;  5F2D A;  4H7B A;  3BYY B;  2ZXO A;  1O7Z A;  5ELD A;  2F3V A;  4KJO A;  5K36 G;  4RFB A;  1R4Q B;  4Y7N B;  2EXZ A;  2OEO A;  2B2T C;  3W3A A;  1Y69 U;  4RGM A;  2EY5 A;  2E74 C;  1FNV A;  1JQY D;  5CV4 A;  3W2D A;  3EQL C;  4DU9 A;  2X6G A;  3CRK C;  1ONL A;  1F9R A;  4X3S A;  2L12 A;  3GV3 A;  2F0D A;  4C3H G;  2JA7 B;  5HUR A;  2PZT A;  3SK5 A;  2B2U C;  1F2Z A;  4FO2 A;  3K5O A;  2PPB C;  4K6D A;  2F0K A;  2O5I C;  4K5X A;  1QNU A;  3A8J E;  2A73 B;  2D2C C;  2XWJ B;  4EQO A;  3HOV B;  2JA5 B;  2ID0 A;  4X3K A;  1EFI D;  1BUV T;  1CQV A;  1TWA B;  2IX3 A;  3NK9 A;  1IYU A;  3FDT A;  1JR0 D;  3OMC A;  4U68 A;  2VNU D;  4Q0F A;  1STE A;  4ZKB B;  2E2I B;  3M4Y A;  3AMU A;  2CVR A;  3VA5 A;  1MSG A;  3U9O A;  3EJI A;  2MP1 A;  3KBX A;  1W6K A;  1I6V C;  5I6W A;  1ZXT A;  4ILW A;  3MXG A;  1GXD C;  5C0X J;  2K01 A;  3HOX B;  1EIH A;  3E5S A;  5EGT A;  3LWU A;  4HN7 A;  1DXM A;  4O1N A;  5ISR A;  2PW7 A;  1IYV A;  4UDU C;  3NBI A;  4IUR A;  4RAU C;  1SE3 A;  2A6H D;  1H9S B;  1E0B A;  1LTG D;  5FO8 B;  2KVM A;  5CGK A;  4DF7 A;  2NVT B;  1PRT D;  2CW0 D;  1STB A;  3Q23 A;  1KLU D;  2PQE A;  2PW5 A;  3VR2 A;  2SNM A;  4QUF A;  5CV9 A;  5CMD A;  4K2L A;  4OHJ A;  3GTG B;  1SNC A;  3PUX A;  1F2L A;  1PRT F;  4DA2 A;  3IKJ A;  5HGT A;  2YYZ A;  2DNC A;  3MA2 B;  1CA6 A;  3MEH A;  5DNF A;  4FF2 A;  1X3P A;  3FPP A;  3BDO A;  1QCB D;  3NTH A;  1BCP D;  4MN3 A;  5EPJ A;  3DUZ A;  3N6R A;  1BR9 A;  5FO9 B;  1D5X C;  3MFG A;  4FXD A;  4PMB A;  4KY7 A;  4QIW B;  5M3M B;  1D5M C;  3KK7 A;  5EPK A;  1QJO A;  1T5X D;  2NTS A;  4R8N A;  2L9H A;  3TDQ A;  4QCL A;  1PFM A;  1O7Y A;  4BWG B;  3H0G B;  1ZEQ X;  2NN6 H;  3S1Q B;  5CC4 A;  4PMC A;  4G7Z C;  3X3N A;  3HP3 A;  5C3E B;  4WOR A;  5IOC A;  2F0H A;  3D4W A;  3K5M A;  1EL0 A;  3LWE A;  3HZX A;  1NSN S;  4RCO A;  4OO1 I;  3HRZ C;  5EKL A;  2WP8 J;  2E2D C;  1X3Q A;  2AQ1 B;  1OXX K;  2B39 A;  2XVS A;  1TWF B;  3PMF A;  3R2I A;  1DOM A;  3OHX C;  3NTI A;  3GO5 A;  2SDF A;  5CV8 A;  3I72 A;  1EWH A;  2H4O A;  1CT1 D;  2J0T D;  5ELF A;  1T5E A;  3GTO B;  1DON A;  3I4L A;  4G7O C;  2AQ3 B;  3I8Z A;  4M8A A;  2IX1 A;  1LTI D;  4HR7 B;  3J81 L;  1EY6 A;  3R8B A;  1B4O A;  4HSP A;  1STG A;  1SE4 A;  2B2V A;  2NN6 G;  5EPL A;  2FMC A;  3D3R A;  2NVY B;  4IAL A;  3PUY A;  3T16 A;  2L11 A;  2XRQ D;  3U9S A;  4AYB B;  5COY A;  1JCK B;  1LV9 A;  3RZO B;  3WDN A;  1HRJ A;  4RKL A;  3PO3 B;  5G3L D;  1AZP A;  1QG7 A;  1HCZ A;  4LJZ C;  4CKE A;  3K5L A;  2EVB A;  3CQZ B;  1KLG D;  4FF1 A;  1UNS A;  4K8J A;  2EY2 A;  4RH6 A;  1G91 A;  1AW7 A;  2I07 B;  5FOB B;  4U67 3;  1KDC A;  2F0V A;  1B3A A;  3DM1 A;  4KN4 C;  1BO0 A;  4A3I B;  2PCF B;  3K59 A;  1KNA A;  5BN5 A;  1GUN A;  1D1I A;  1AZQ A;  3QOL A;  5ELE A;  2NTT A;  3HS0 C;  3L7Z C;  2B2W C;  4IFD I;  3T53 B;  4IUT A;  3VYR A;  1F9S A;  5IGF A;  1KAA A;  2A74 C;  3K5N A;  1HQR D;  1CA5 A;  3SK6 A;  1YNN D;  2E76 C;  4S3S A;  2XSC A;  4OIK A;  1ZYR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...