1F2ZA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVAAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2zA00
1SYEA 3D8GA 5JOBA 2PZWA 4HMIA 4K2KA 2EY2A 1EY6A 3SK5A 2PZTA 3SR1A 5C5LA 3HEJA 1A3TA 2LKVA 4QMGA 4ZUJA 1EY7A 3E5SA 1JOKA 4KJNA 3TP7A 1F2MA 1SYFA 4K14A 3EROA 1EQVA 2EY6A 4TRDA 1A3UA 5DAUA 3NQTA 2EYJA 1SYDA 1EY0A 1SYCA 1SNOA 5F2DA 5IIFA 3LX0A 2EYOA 2F0JA 1ENAA 2F0HA 4N9TA 4R8NA 1II3A 1U9RA 5NUCA 3D4WA 2F0SA 3MXPA 2F3WA 5KYIA 4HTHA 3MVVA 4LAAA 5CV8A 1EY5A 3SK4A 5IOCA 1EYCA 1JOQA 1EY9A 2F0VA 3OSOA 4PNYA 3SHLA 2PZUA 2SNSA 2RBMA 2EY1A 3SXHA 5I6WA 4KHVA 5CV5A 5CV9A 5HGTA 5KEEA 5C6AA 4B9WA 5CV4A 4K5WA 5EKLA 4K8JA 4WRDA 1NSNS 1SYGA 3V2TA 2EYHA 3U9OA 5E1FA 2F0WA 3NXWA 1STHA 4KY7A 1KDAA 5EKKA 4J1MA 4DU9A 4I65A 5C4HA 4ODGA 4F7XA 4H7BA 5IGGA 2EYPA 4K6DA 3D6CA 5CC4A 1SNDA 4DGZA 1F2ZA 2F0LA 2M00A 3ERQA 3VA5A 3R3OA 1A3VA 5DEHA 4IZ8A 1STBA 4IALA 3DHQA 5CV7A 3RUZA 2SNMA 1SNCA 3EJIA 3NUCA 4KD3A 4EQOA 4EQPA 5KRUA 2EYFA 5KYLA 2EYLA 4PMCA 5J39A 3MZ5A 3OWFA 2SOBA 2EYMA 1SNPA 2QDBA 4HMJA 2OEOA 1A2TA 4QB4A 2F0PA 4RKBA 4YIJA 3SK6A 3D4DA 2KHSA 3BDLA 4KTAA 1A2UA 2F0KA 4ME5A 5IGCA 2PW5A 3NHHA 5HURA 4ID6A 1KDCA 1ENCA 4ZQ3A 5I9PA 5EGTA 5JAVA 3MHBA 4MIUA 1JORA 2F0UA 2EY5A 5KIXA 1EYAA 1EZ8A 3PMFA 3QB3A 1STAA 4QF4A 5C3WA 5CV6A 5C3XA 5C5MA 1SNMA 5J22A 4KJOA 4PMBA 1KABA 3T16A 3ITPA 2F0IA 2HQEA 4F8MA 1EZ6A 1TT2A 1STNA 2F0OA 4K8IA 5ISRA 4IUNA 1EY4A 1EY8A 1KAAA 1TQOA 2WACA 3P75A 4N9PA 2F3VA 3NP8A 4G57A 4B9XA 2OXPA 2NUCA 3C1FA 4OL7A 5IODA 4E6IA 5IGEA 2F0DA 3TP5A 4K5XA 5I6YA 4NP5A 3BDCA 4WORA 4ZUIA 1SYBA 2KQ3A 4DF7A 2F0GA 1STGA 3QOLA 4KY6A 2F0FA 2F0QA 1EYDA 2F0TA 1IHZA 3C1EA 3MEHA 3SK8A 4EQNA 2OF1A 1SNQA 1KDBA 1STYA 5C4ZA 5I9OA 3S9WA 1RKNA 3TP6A 3H6MA 3OMCA 3OMGA 5CR3A 5CGKA 2O4XA 2F0NA 3QOJA 4DFAA 2F0MA 1NUCA 4S3SA 2F0EA 4RKLA 5IGBA 1JOOA 5KGUA 1AEXA 4NDXA 5IGDA 2PYKA 5M9OA 5IGFA 2RKSA 4K5VA 2RDFA 3P1HA 2ENBA 3DMUA 4KV6A 3EVQA 2PQEA 4NMZA 4EVOA 4KD4A 2PW7A 3TP8A 1F2YA 5J1ZA 4KY5A 3T13A 1TR5A 5K5PA 3NK9A 4J6HA 5E3FA 2EXZA 3HZXA 3TMEA 4NKLA 4K2LA
chains in the Genus database with same CATH superfamily
4DPGA 2IY5B 3CRLC 1ZKOA 5AFWA 5C5LA 4DV4Q 2DNEA 2VNUD 4HIMA 1RTOA 3JC66 5I2YA 5ELDA 1F2MA 2L4NA 5D3IB 3EROA 3TZDA 2K03A 4TRDA 1VQ5A 2CW0C 3EA6A 1F9PA 5GROA 3S2DH 3TRZA 4HSVA 3UDFA 2UXDL 1X3GA 2DY8A 1DONA 1F9RA 2D62A 1JOQA 5DM73 3IFTA 2ICEC 3F2UA 5IYCH 1HNZQ 1RODA 2M2LA 1Y8PB 2Q2UA 4GKKL 4FYDA 2QEJC 4YHHQ 4GLVB 4WJ4A 2MFIA 1Y14B 1KIXA 3BZKA 4YY3Q 2V4DA 2B2YA 2I46A 1WTHA 5CC4A 1BNZA 2M00A 4CBVA 2CVRA 1L1OC 1P8LA 4DV5Q 2A69D 1I4HA 1TVXA 1NMGA 3PUXA 1GHKA 1V1QA 4GS3A 4IURA 4O0AA 2R93B 5HY6A 3CHBD 4RKBA 3GV3A 4A3CG 1GHJA 1HR0L 1MI2A 3VR5A 1HCZA 3UE0A 1W3SA 1K8GA 5EGTA 4NXML 1Q3LA 2Q2IA 1EYAA 4CHTB 4U673 4OEMB 2BA0A 4PMBA 1RF2D 4F8MA 5ISRA 1OXSC 1FYCA 3AYHB 3OIQA 1PZKD 1MHWC 5M5WH 1XTDA 1EIYB 1U4LA 3GTLB 1XNRQ 2K04A 1RL2A 3TP5A 2UUCL 1BBWA 1JE4A 1O7ZA 3T1HQ 4BBSH 1ZYRD 2QA4A 2YU9H 2XRSD 1IHZA 2C9OA 5I9OA 1JC7A 3BVGA 1I50H 4AYBG 2NZOA 2GVAA 5CR3A 3I4LA 1NUCA 1JOOA 4ILWA 5IGFA 4CDCC 5IP9G 4B3SQ 5CORA 3HOXG 3Q8DA 1WTWA 1N32L 3R8BA 1TWAH 1Y1VG 1JMCA 1SJED 3CCSA 1L1OA 2DN8A 4RGNA 1SE3A 1EWIA 3MWYW 1PTOD 4RMFA 2NTTA 2PI2A 5CBAE 4GN5A 3NWTA 4A3BH 3DLLA 4KN4C 3AQQA 4O42A 2NVYH 1JT8A 2MJ8A 2F0JA 3IL8A 2KHJA 1BBXC 3CMEA 1MD2D 1WI5A 1Y8NB 3MVVA 4LAAA 4X66Q 1F77A 1EY9A 2F0VA 2JP1A 1HFGA 1YEZA 1A0IA 1WTOA 1U4PA 3UDGA 4J15A 3HFZB 3TQYA 3HOZH 1STEA 5LHY1 1LM0A 4BA2I 1RIPA 1MJEA 1YJ9A 4GOPC 4NW2A 3A56A 2N55A 3ULLA 3I8ZA 3ERQA 2CW0D 3IKJA 2JA5G 3UI2A 3EJIA 3CAMA 4LF7L 4PMWA 2B2TC 4DXFA 2X69A 3H0GG 2R7ZH 4LF4Q 4BY7G 1L1OB 1JWSD 3WOFA 4DUYL 1LTID 1CKMA 4DK3C 2UUAQ 3ZJYC 1KDCA 3STBC 2Z0SA 3MHBA 1XMOQ 5KIXA 2NVTB 5C3XA 5D3DA 1C9OA 2WFWA 4DKAC 3T16A 3I4MB 1RJTA 3HG9A 2UUBL 3BU2A 2F0OA 3IFDA 3DWQA 1CZGA 4ZYSA 1VQ4A 2NUCA 2AQ3B 5IODA 1S5CD 2FFKB 4JV5L 2KHIA 3DEPA 2K05A 5FO8B 2F03A 4X64Q 2TMPA 3DM1A 4KLKA 2VY3A 3OMCA 3GTPB 3LWUA 2KCNA 2JA6G 4DFAA 3CD6A 4AIMA 1D1IA 3H91A 5IGDA 1IBML 2XVSA 2RKSA 2ES2A 3PGZA 4JI5Q 5J1ZA 1VQ6A 3D6WA 4J6HA 2KBNA 3TMEA 1PYBA 4K2KA 2C35B 3HGBA 2NZ1D 1PRTC 5M5YH 2K33A 1TWHB 4QIWE 1CKOA 3DXJC 1EY0A 1HPCA 5IP7G 3H3VC 3ND9A 4N9TA 1Y8OB 4BXXH 1OXVA 3A7AB 3I3CA 1LTAD 2CH4W 1CA6A 5D14A 4A3CH 4PQXA 1CA5A 1UUPA 3CXCA 4CDDC 1I94L 2HCCA 4DR7Q 5G3LF 3FPUB 4DAPA 5I2XA 3CC7A 3HOYB 2Y0SB 3GP7A 2JXMB 1Q90A 4WFN3 1QNKA 3NXWA 1STHA 3HOVB 5E4XA 1PH5A 4YCWA 2RVLA 4H7BA 4DNTB 3QO2A 1SNDA 1BKBA 2QCPX 1STBA 5ELFA 4BBRB 1ASZA 5KYLA 1YNJC 4DN4M 1SFOH 2ZTDA 4GOPB 2UU9L 4NB3A 2F0PA 4GN3B 1WCMG 3DUZA 3RLNA 1B70B 2KHSA 2Q2HA 5EBDA 5IP9H 3HOXH 1IBKQ 1CSQA 1I4RA 2KOLA 1U0LA 1Y1VH 4LF8Q 1K3RA 4TSSA 4CGYB 5C3WA 3V96A 4DR4L 2E2IB 2HIXA 3JAME 5BN3A 4DV3L 2KUMA 2EQSA 4LNQA 4OL7A 3J7YW 4RGOS 4A3EB 1L0WA 4DR5L 4CJ2C 2F0FA 1WVLA 2RQXA 2OF1A 1SNQA 1TWFB 1F9QA 4JOIC 4JVZA 3CF5A 1I6HB 3LGJA 4HCSA 4G4KA 4P72A 4A3JB 5C4JB 3K7AB 1W2BA 1VQDA 4CKBA 4RCOA 3S2HH 1PTOF 4DV4L 1TR5A 1YHAA 1AE2A 1S40A 5JEAJ 1YBYA 5JPMC 3J80L 3E9IA 2UXBQ 2MO0A 3ULJA 2N88A 1DXMA 4R4OA 1M90C 1TY0A 2K4KA 3FHWA 3NTIA 3NQTA 4LF6Q 4R1JA 1TXYA 4C2MB 3H0GH 3D4WA 1VQFA 5BN4A 1EFID 1PRTB 3S1NH 4QL5A 3VR3A 1XPUA 4BY7H 3WOEA 2YTYA 2Q8IB 2HHHQ 2QDLA 5HGTA 4YY3L 1B9NA 4OO1I 4K0KQ 4LJZC 1GUSA 5I4DA 2R7DA 4KKUA 5E1FA 1JJGA 5K36G 1JWMD 4ALPA 5LMUQ 1VCIA 1T5EA 1PRTD 2XGTA 3EN2A 5IT9L 2O5IC 5IGGA 1WOCA 2EYPA 3BYTB 2XTIA 2WB1G 5T1IA 2NB0A 1CI3M 3OOCA 1FGUA 1E1TA 1L2FA 2NN6I 3J80c 1WTPA 2NTSA 3A8JE 4ABNA 2PNRC 1HQRD 4LWCA 4CKEA 4EQPA 4EQOA 4X65Q 5IYBG 4LF9Q 1GM5A 2QKIC 4Y52H 2JA6H 1PV4A 3M4OH 1EQRA 4KTAA 1I6VC 3A54A 3PV0A 1PFBA 1EWCA 1B44D 1UE7A 5COYA 2A1AA 4HSPA 1KNAA 2DJGC 3TN2A 1N34Q 2XRQD 3T4AC 4MHEA 1H95A 4YWKA 2VXWA 1B50A 5LMNW 3PO3B 5M5XB 4N8X1 2R3ZA 3M3YB 2BE5C 2VL6A 1EZ6A 4J8QA 1SRUA 4N9PA 2WACA 2QEXA 2F3VA 3CCRA 3SDZA 1J5EQ 4C3JH 1YNJD 4A3MG 4DNIA 4K5XA 4NP5A 1SYBA 5IP7H 4O2DA 1MIUA 4A3FB 1CKNB 3FKIG 2GN5A 1AZQA 4K6LA 1KDBA 4B3SL 3NQIA 3K80C 4HN7A 4DK0A 5CYUA 4C56C 1PLFA 4UP8A 3I90A 2D0PA 2O4XA 1VQMA 1LTGD 1AEXA 2CFMA 2HIVA 4X3UA 5FLXc 1ZEQX 1EOVA 3W5OA 4NMZA 3FEWX 3NK9A 3VA7A 2MNAA 1JB7A 1HQMC 4A93B 2R93G 3G7LA 2DGYA 4LUOA 2E2HH 3F2BA 4A3KG 3SEBA 4C3HG 3GTKB 2LSSA 2B8GA 1G6PA 4ZLTF 4HEDA 2E74C 2P5ZX 2F3WA 1K73C 3UE1A 1WCMH 2PPBC 3MTSA 4F88A 1EQQA 1XJVA 3S16H 3KUPA 1AFPA 1Q81C 3CCMA 1LACA 2R7FA 1S5FD 3U4ZA 3RZDB 2FXQA 1S5ED 5C4XH 5JVH3 1K0RA 2IHFA 3T56B 1IYUA 4LFBQ 1G91A 1XTCD 3P20A 1SDFA 1EIGA 4OELB 1RD9D 3MFYA 2JK8A 3CU7A 2UUAL 1RCVD 4ZAIA 3CCEA 3RLFA 3G6EA 1K83B 1XMOL 3GTJB 4Q5VA 1F2LA 4DV6Q 2F1MA 3PIO3 3PIPA 2JA8G 4TQUS 4JI2Q 1TWGB 1G291 3B6YA 2EZVA 2JA7B 2PCFB 1SNMA 4HJ9A 3RN5A 2ALYB 3ITPA 3KK7A 4A3IG 2MO1A 3DWAA 4HR7B 1XMQQ 1XNQQ 3GTGB 3ZYYX 2Z6BA 2VW9A 1STGA 4FF3A 1CHQD 1EYDA 3SK8A 5BR8Q 3ER0A 1RKNA 3I56A 2A8VA 2LXKA 5IGBA 1JB3A 1HTLD 4DR6Q 2IHEA 2AUKA 2VUMG 5FLMG 3EVQA 5H1SE 4TKOB 1TS5A 2RDHA 4BS9A 3I7FA 2FINB 4IQZA 3HZXA 1CT1D 4HMIA 1YNNC 2OT2A 2LKVA 4ZUJA 4DV1Q 1YJWA 5GQOA 1JOKA 3CMAA 3VDYA 4FO2A 5LMNQ 1M1KC 2EYOA 5NUCA 1MSGA 2K5VA 2B2VC 5IYBH 2HT1A 1PXUA 4DR7L 4R9WA 4IFDH 4O1NA 2R92G 2YV5A 4Z9CB 5C0XJ 2A19A 4DK6C 5C3EH 3SHLA 5EPJA 4A3DG 3PUZA 4WJWA 3Q23A 5CV5A 1GUOA 3GTMB 2E5LQ 4JBWA 1PRTF 1PH9A 3U50C 1CSPA 1WYDA 2QGQA 4CKCA 3KJOA 2KCCA 2PMZB 1CQVA 3D4RA 4RGMA 2Z4IA 1OXUA 3G6JB 2J0TD 4JI4Q 1OO9B 1UNSA 4YWMA 2Q8RE 4JI0L 3M9BA 3I72A 1Y1WG 2BCOA 1SMYC 1TY2A 4A3MH 2Z9HA 4IZ8A 5C0XI 1D1KA 5CV7A 1Z47A 3BVMA 1R9TH 1V1PA 1IYJB 4IJHA 3R2IA 3FKIH 4LF5L 3S1MB 5IT9E 2B39A 3I4NG 1IBKL 3EIVA 5ELOA 1GUWA 1EUJA 1GXDC 4LF8L 2WINB 3T1YL 2HDLA 3E0JA 2NVXH 3T53B 1BOSA 2M9VA 3HOUB 1D5MC 1SE8A 1VQLA 3K7UC 2JQOA 2N3SA 1CQFA 3SE0A 1VQJA 1QNUA 2B2VA 4C3IB 1TQOA 2MPMA 4GKJQ 3S2DB 2CH4A 2OXPA 3FVQA 4A3KH 1VQOA 4C3HH 3MA2B 1IL8A 3BDCA 4DF7A 4OWWB 2F4VQ 4DV7Q 3HOYG 1LT3D 1YHBA 1AE3A 4XT3B 5CGKA 1N33Q 5KGUA 1UE5A 3J7ZC 4HIOA 1NJIC 1UE1A 4DR2Q 2JEAI 3HKZB 2NZHA 4HJ8A 2LMCB 4RHRA 4EVOA 4R4IA 4BBRG 2IPKD 2X6GA 4KY5A 2EE1A 5JEAG 1H9JA 4MTNA 1FVIA 4AQYL 5BN5A 3D8GA 1V1PB 4A75A 3JAMi 4LF6L 1PTOH 3PF4A 2TSSA 4IN3A 3TDQA 4OO1G 5LL6X 1TWCH 4H02A 1FL0A 4QJFA 4KJNA 3S17H 2VQFQ 4FF4A 1GUGA 3N6RA 4NXNQ 1WTRA 1CTMA 3EFXD 4HJ5A 2NN6G 4IOAA 1KD1C 2K6AA 3HKSA 1HNXL 4XYOA 4C1NK 2JA8H 5LMUL 1U4RA 2DUDA 1PYWD 4EX5A 4G7HC 2I0QA 1YNND 1JJCB 1K8OA 4BBSB 1SMXA 4A3IH 1FNUA 2YU9B 3J7AV 3HOWG 2F0LA 3VA5A 4A3JG 1I50B 2ZXPA 3E9HA 4LF9L 1U5KA 2EJFC 2BH8A 5M3FB 2KA7A 5KRUA 1PVOA 2G5DA 1E24A 2KEEA 3MZ5A 1HTPA 2WAQE 1FJGQ 1TWAB 3BDLA 4ME5A 4JI7Q 1DCZA 1HXYD 3NHHA 2VUMH 1MGSA 5FLMH 4OX9Q 4IPGA 3CQZH 3W1BA 4DUZQ 1EYGA 4KHPQ 1IBLQ 4A3BB 2L1BA 4FP5D 5HGQA 1TS4A 2RSNA 1J5EL 4JI6Q 1UE6A 1UWVA 2NVYB 2HQEA 3GV6A 1SMYD 1BQQT 2IWHA 2CQAA 2WKCA 3ICEA 2EOTA 4B9XA 4QUCA 2L15A 1YVCA 3RD4A 1HA5A 1O7IA 4QQBX 3J81E 4KY6A 4FVMA 4IPDA 1Q82C 5C4ZA 1O7LA 3K5OA 2R92H 2A6EC 2L55A 1NY4A 3HOZB 2HCIA 1HR0W 3OW7A 4A3DH 4B3MQ 1PZJD 3WDNA 2RDFA 1WFQA 4R4QA 4JI1L 2B63B 4RG1A 1L0YB 3T13A 2LFNA 4LFAQ 5FO7B 2YYZA 4GNXC 3LNNA 1Y1WH 3HEJA 4FXGC 2AWOA 4XYQA 2R7ZB 3AFPA 2WV6D 5EPKA 4GZYC 4A3LG 2RDGA 5F2DA 1SNOA 1NR4A 2GA4B 4V190 3I4NH 3MXPA 1PYSB 3RN2A 1VQEA 3A8IE 3SK4A 1BCPB 1GUTA 2BDNA 2J4XA 1M8AA 4PNYA 5IWAL 2PZUA 2SNSA 3Q0AA 3CC2A 1TWHH 5I6WA 2E2DC 4B9WA 4B3TL 4MTKA 3V2TA 2ZJPA 4A3FG 4LFBL 3SVMA 2XWBB 2ZM6Q 1ET9A 4I65A 4ODGA 2PNHA 1ICFB 3D6CA 5IY0A 1ENFA 4H0LC 3NSWA 2UXCQ 2LS01 2KENA 1ESRA 3HOYH 4OXPA 4YWLA 1SNPA 4JI2L 4Q0FA 4FF1A 1H9RA 4A4IA 4A93G 4YIJA 2WB1E 2KEDA 3QJYA 5IGCA 4GNXA 3BZCA 4JC0A 4DV2Q 4IUQA 1G8ZD 5EBCA 4ID6A 5HURA 4DXGA 4OIKA 4BBRH 1E2ZA 2WAQG 5JEAH 2F0UA 3BG3A 2KCTA 4EQ5A 1PH8A 2IT1A 3GD7A 4X62Q 4OIJA 2D5DA 5J22A 1XNQL 3BDOA 2KJXA 4FDBA 4OO1H 4JYAL 4RA8A 1FNVA 3NP8A 1HNWL 5JJZA 2NYZD 5BR8L 1W6JA 3CPFA 1UAPA 1JE5A 3R2TA 3OWEB 1C0AA 1MBYA 1EIFA 4JPBW 4DR6L 1Q46A 1LLRD 4EQNA 4P73A 3L9AX 2NN6H 4HJAA 3M4QA 1F9SA 2F0NA 2HQLA 1X55A 1X3FA 3NBHA 2H4OA 3F8TA 2PQAA 1SE2A 3S14B 1ML0D 4L63B 2ENBA 3M7GA 4IUPA 2PQEA 4KD4A 1I3QB 1CK1A 4DV1L 1M4VA 5AJ3L 1MJCA 3FPPA 4UAIA 2JA9A 3VR4A 1VQGA 3H09A 1MKHA 1SFOB 3A5UA 3Q6SA 3HOWH 2SDFA 3C2PA 1QOHA 1K3BC 1YHQA 2K5HA 4AYBB 3K7AH 1IL2A 1EEID 3VR2A 1B53A 1A3UA 1A62A 4GKKQ 1QCBD 1SXTA 4GNXB 3BS1A 2A6ED 2RSOA 1ENAA 1D7QA 5GADC 3STBD 3OTOQ 2JA7G 3KYHC 1Y1VB 5C0XG 1AZPA 5IOCA 4DAVA 1VQPA 1FD7D 1IKLA 2Q8TA 3KF6A 2RBMA 3SXHA 2A6HC 5CV9A 1IKMA 2RF4A 1E2WA 1HUMA 2ZTEA 2N49A 4ULLA 3KJPA 3QR8A 4R8IA 4C2MH 1GVPA 1VQHA 1VS0A 4DU9A 4Y7NH 2JA5H 2K28A 3PCOB 1LT5D 4L6TB 2K01A 5DEHA 3OHXC 1QUQA 3DHQA 1PZID 1HNZL 2JJQA 2EPBA 1DGSA 2PQAB 2IL8A 5J39A 4YHHL 1G6ZA 1K9MC 4PZ8A 1DM0B 3S15B 2OEOA 3E3XA 2E2JH 1LTRD 1A2UA 2ASBA 3J7AF 1PA6A 2L9HA 3D0FA 4KN7C 4DV5L 2L12A 3PO2B 4HCEA 2AMCB 4GKJL 3QB3A 2AQ1B 1X3EA 1VQKA 3VYUA 4G7OC 4DV7L 1KAAA 4LK1C 1KHIA 3S1NB 5FLXL 1HHVA 4BY7B 1N32Q 5I6YA 1N33L 4A3LH 3ND8A 1VF5C 2JE6I 2F0QA 3MEHA 3K5NA 2RHQB 2YTXA 5KNBA 5FJ8G 1VQNA 1E22A 1S3OA 1XWEA 1KLUD 1QZGA 3DMUA 1XNRL 3O13A 1F2YA 3T1HL 1BBUA 5K5PA 4A3FH 3RLOA 1QUQB 3ONAB 1G51A 2VZAA 1TS3A 2JYOA 5JJKA 2VQFL 5JOBA 1PH3A 2KECA 2EJMA 1S72A 4QMGA 2ZJQA 1AH9A 2XSCA 5E4WC 4X3SA 4F87A 3S1QB 3W1GA 1PMRA 1UEAB 4LUVA 3DEOA 5DAUA 1A6XA 4FNFA 2EYJA 1N36Q 5LL6S 1VQAA 5C44B 3HOUG 4KI0A 1FGBD 3NBIA 2WKDA 3PUWA 2K5NA 3OW2A 3BJUA 4A93H 4P74A 2DY7A 5CV8A 1KRTA 4C3IG 4KHVA 1EEFD 4OGQC 5C6AA 4LF7Q 2PI2E 3H3VI 4K8JA 1KC8C 4C3JB 2VS1A 4KY7A 3HRZC 5EKKA 1FNWA 4N8FA 4X66L 3CC4A 4DGZA 1F2ZA 1OXTA 4JI3Q 1Z6HA 3KFUA 1I4PA 1SR3A 4DR1Q 3FDTA 4G7ZC 4ZCKA 3NUCA 2JEBI 3X3NA 1I4QA 2A73B 3CW2C 3A55A 1DD2A 3KDFA 3BVZA 2K5QA 4UP7A 2OQKA 1SLJA 2UUBQ 4OX9L 3RZOH 4DUZL 4A3GB 4KHPL 3D4DA 1IBLL 2A6HD 1ICWA 4HIDA 4XQNA 3A74A 3KLRA 3H94A 4ZK9B 5EQ0A 4R4TA 1WTVA 2ZXRA 4LMQD 3I70A 1QG7A 4L5TA 4EGVA 3PUYA 2E2HB 2IX3A 3K0XA 3NENA 4LF4L 1ILPA 3P75A 3TP6A 1C7YA 1G2TA 2MHVA 4QUFA 2G9HD 1WCMB 3C1FA 4E6IA 4GN4B 1SAPA 2L11A 5A2QL 4I7ZC 2B2WA 2VQEQ 3D31A 4B3ML 3TEHB 1D6EC 2Z8LA 3VYSA 4DA2A 5JVG3 2JA7H 5EJWA 2R6GA 4RAUC 3H6MA 3I4OA 1X9NA 5C0XH 1EL0A 4H13C 1OTCA 4BBSG 1ZXTA 4S3SA 2I5HA 5C4XB 2EDGA 2YTVA 1U4MA 3GTGH 5FK9C 4BY1B 1Q8KA 2Y0SE 4X3TA 4DR3Q 5M3FG 1GUNA 1HZ9A 4X64L 2CWAA 4NKLA 1QJOA 4QGUA 2PZTA 3KDFB 4CDEC 1WJJA 3TS0A 2NVQH 3PQIA 2BOSA 1SYFA 3J81i 2K75A 4APVA 1I4XA 1AN8A 3W3AA 4JI5L 4H44C 2F0SA 5KYIA 4PZ6A 1DOLA 4IO9A 3MAQA 5GAHC 3M4YA 2BE5D 5K36H 2D2CC 3WWVA 5EKLA 2IW3A 4PG3A 4C1NI 4K6DA 1LTTD 3J80E 1PH4A 4QIWB 1Q1EA 3GTMH 2JSOA 2B63G 3NTKA 3I4MG 1PTOC 2EYLA 1VQ7A 1K0SA 1SBBB 5ELCA 1HJPA 3A8KE 3I91A 3GTOB 4HMJA 5FJ8H 5M3MB 2K5DA 3NEMA 4JBKA 3MC0B 4DV3Q 4X62L 4KHZA 3S1RB 3KBXA 4ZRZA 1JR0D 3F2CA 1EZ8A 5IYDG 1PH6A 3NELA 4JW0A 1I4GA 5C5MA 4IOCA 3GTQB 4IUNA 1LO5D 2EJGC 3C46A 1J9OA 2ZT9C 4FXKC 5C3EB 2IX0A 1TIID 1X54A 4XT1B 2WP8J 4M1UB 3HOUH 3PF5A 5D65A 2EVBA 2OQ0A 1B1ZA 2F4IA 3CKIB 4OONA 4U68A 2F0MA 5FLXE 4C3IH 4NDXA 1V9PA 2PYKA 3V05A 4RWSC 1KTKA 2N78A 1LTSD 2R93H 1SN8A 4XQJA 1EFWA 4R4CA 4A3MB 1PHJA 1B7YB 2D0OA 4HIKA 1BDOA 2E75C 1R9TB 1EY6A 3FKIB 1A3TA 3HS0C 3TZUA 5JJLA 2V1CC 2Y0SG 5G3LD 3OTOL 1V43A 4IUUA 3PSIA 4MN3A 3HOVG 1DZ1A 4UY8C 1LTBD 3K6OA 2LY7A 2F0HA 1II3A 2DJFC 1GOZA 2NVXB 1DOMA 1VQ9A 1VF7A 3GTLH 1DYQA 1K8MA 3RR5A 2UXBL 1WTXA 3F2DA 4B08A 3HP3A 4BXXG 1L0XB 4IFDJ 5ELNA 2QW7A 5CV4A 3TREA 1AP0A 3KBGA 3JAML 2SEBD 4MNOA 4A3KB 4V0BA 4C3HB 4HJ7A 3VR6A 4XQQA 1BCPC 3W2DA 3J81j 4XDXA 4IJLA 4DK1A 2HHHL 1LABA 4GLAC 4JG2A 1SROA 1S5DD 1VQCA 4KD3A 4AH6A 4K0KL 4PMCA 3FMCA 4IFDI 2SOBA 4QCLA 2WIIB 3K5LA 1X6OA 4A3EG 4RFBA 5M5WB 4KK7A 1CFMA 5I9PA 3BZDB 1PTOB 5JAVA 1Q86C 4MIUA 1VDZA 1TWCB 5M3FH 1SEBD 3S17B 4P71A 2AKWB 4M8AA 4X65L 1XXGA 4KJOA 1KABA 4KKTA 4BWGB 2OTLA 1EY4A 4JCVE 1SSOA 3JAMc 4DAMA 4IPCA 1A8VA 1X65A 3CCJA 4ZUIA 3RNUA 3KLSA 3AB9A 1N34L 2B8FA 2JA8B 2KCMA 1RHPA 1UEBA 4CDFC 3MFGA 4CJ1B 4HAEA 1FR3A 5A2QE 5FKAC 1HZAA 2AHOB 4A3IB 4P2CB 1EIHA 1YIJA 4LW1A 1C48A 1BUVT 4YCVA 3GDEA 2C5CA 1KLGD 2FMCA 1ET6A 2I07B 4K2LA 4L5SA 2PZWA 2Z6KC 1N36L 2R61A 4B3RQ 1IZ6A 1HRJA 3FP9A 1HUNA 2NVTH 3TP7A 2GVBA 4K14A 5FO9B 2B63H 2E76C 1NNXA 3BYYB 3I4MH 1SYDA 1SYCA 3PO2G 1Q12A 2VUMB 3L0OA 3VYRA 2RHSB 3CQZB 1QWYA 2DNCA 1D5ZC 3FRPB 4LFCQ 1EY5A 4JI8Q 1EYCA 1GD7A 3CCVA 2A74C 3OSOA 1BR9A 1BF4A 5ELBA 2BH2A 1B3AA 2Z1CA 3GTPH 1SYGA 5IYDH 4JI3L 1EQTA 4DR1L 1CHPD 3SGIA 1KDAA 4J1MA 2ID0A 3P7JA 5C4HA 4F7XA 3CPWA 1G2SA 2QILA 2BA1A 1GKHA 1EOTA 2R92B 2MUYA 2B29A 1NAPA 3PO3G 1A63A 1D8LA 4A3DB 1SJHD 4OHJA 5TSSA 3OWFA 2EYMA 3K8AA 4QB4A 4PZ7A 3I55A 1IW7C 2L5TA 3OPOA 2PW5A 2PO4A 1V8QA 2Z6KA 1Y1WB 2K5WA 4DV0Q 1JORA 1QVGA 1HA6A 3PMFA 5A35A 2VB2X 4QF4A 1BCPD 4GOPA 5C44G 1BVSA 1VMCA 1XYIA 4XIGS 3MXNA 4RH6A 1AW7A 2VQEL 3I4NB 4DV6L 1E7ZA 1KAWA 2B2TA 3HOVH 2KQ3A 1H9SA 2K1BA 2K32A 2KVMA 4JK1C 2MQHA 2F0TA 4OWXB 3KF8A 4C3JG 1GJXA 1KRSA 4RHSA 3OMGA 2N8NA 1J8IA 3QOJA 4DR3L 4RKLA 5M5YB 3DM3A 1K28A 1JJ2A 1H9KA 2Q2TA 4K5VA 2D9UA 1XMQL 4KMUC 1XX8A 5EKIA 5EPLA 2PMZE 1R4PB 1PFMA 4ZKBB 1GO3E 2I5MX 1CM9A 1QE6A 3N52A 2XNAC 3TSSA 4A3GG 3G48A 3E5SA 3S14H 2A68C 3E0EA 1LYLA 4RGTA 3M7NA 1I3QH 1XPOA 2E2IH 1Q8IA 3MXUA 3DWPA 3U4VA 3A7LA 4POFA 1D2BA 1E3PA 4A3EH 4JI0Q 3R93A 1SE4A 3I73A 1HZBA 5T1GA 1Z9FA 4WJ3M 2EXDA 3G4SA 3MXNB 3KLWA 1KL9A 3NTHA 1TWFH 4K5WA 2UXDQ 4LF5Q 1I6HH 3U9OA 5LMNL 2F0WA 4A3JH 5C4JH 2XIWA 3TS2A 3E6ZX 5JPNC 1H9SB 3T1YQ 1T9HA 2O2LD 3KF8B 1ONLA 3IAYA 4BA1I 4OWTB 1A3VA 4YCUA 3HOXB 1JICA 3H15A 1VMPA 2K7VA 5C4XG 2E5LL 2SNMA 1SNCA 3L7ZC 2E8GA 4UHVA 2EYFA 1TU2B 2H1EA 4BY1G 3ULPA 2QDBA 4JI4L 4TVAB 5E7NA 3K0YA 3ERSX 3HKZE 1ENCA 1VQBA 3HOWB 1XPRA 1EU4A 2EY5A 1HR0Q 4CJ0B 1ASYA 4A76A 1IXRA 2OCEA 3A0JA 3S15H 4NXMQ 3NE5B 1TT2A 3GQBA 1PH1A 3H3VH 3J80i 3KOJA 3NBHB 2NBFA 4G57A 2IX1A 1X32A 1PFNA 1PH2A 1WTQA 3S2HB 1QZHA 3PO2H 1KXLA 3U9SA 4AQYQ 1X3PA 1IW7D 2UUCQ 1LV9A 1T5XD 5KNDA 4Y7NB 2JA5B 4KV6A 1NCVA 4L5QA 3TP8A 4DNRB 2G9DA 4L8JA 3AEVA 2B2UC 3Q22A 2F4VL 3H0GB 5E3FA 2XWJB 1CKNA 1J6QA 1N8RC 3SK5A 3J7A5 3S24A 3QIAA 1HNXQ 5M3MG 1EY7A 3KF6B 4XTCS 2ZJRA 4DR2L 3PO3H 2E2JB 5M5XH 2FHTA 1LUZA 3M3YH 1V1OA 3CCQA 1OXXK 3AMUA 2F3IA 4UDUC 3LX0A 3I2ZA 4R8NA 1U9RA 4JOIA 3RMHA 1KQSA 4FF2A 4HTHA 1P16A 1HZCA 2X6LA 2ICIA 1R4QB 4RCNA 1HH2P 2K50A 2QF7A 3K57A 3S1QH 4IFDG 5KEEA 4MZ9A 1E2VA 4WRDA 1JWUD 5C3EG 1D5XC 2EYHA 4XXEA 3AFQA 5C44H 2AWNA 4NXNL 3T51B 3OYYA 2HUGA 1EU3A 1LTLA 2JA6B 3M4OB 5J3BA 2ZTCA 3TBIB 4JBMA 1YZ6A 2A68D 2RA4A 4ME3A 1S5BD 2IJ0A 3CCUA 3NPPA 4IALA 1O7YA 3QWNA 3RUZA 1IYVA 1NBWA 1C4QA 1PDQA 2B2WC 1YJNA 3LWEA 5IT9c 2EIFA 1B9MA 1A2TA 1MSHA 2B2UA 4UP9A 1WD1A 4POGA 3GTKH 3KLSX 1TS2A 1BCPF 4DAYA 1Q1BA 3VYTA 3L3OC 4ZQ3A 1CZWA 1Z7TA 5KNCA 5IYCG 3X3MA 4DUYQ 5CV6A 2BDOA 3C3LA 2F0IA 2A5HA 3PIP3 3HKZG 1FJGL 1YNXA 4A3GH 3QG1A 4JI7L 4JI1Q 2F0DA 3UDXA 3RZDH 3S9WA 1BO0A 1NR2A 2F0GA 4KKSA 5EAYA 2CKZB 1ILQA 5ELEA 1O78A 4L5RC 1STYA 2WAQB 3URYA 3U58A 4JI6L 4IUVA 5CMDA 1PH7A 5GAGC 5DLQE 4JV5Q 2B3GA 1O80A 1Y69U 2F0EA 1C8CA 1WD0A 2ATWA 5M9OA 3P1HA 3MXGA 5IE8A 1LT4D 1JCKB 3Q24A 1E0BA 1EWHA 1K83H 3GTJH 4P75A 4B3RL 4ZKCB 1IBMQ 5JJIA 1SYEA 2ZXOA 2EY2A 3SR1A 2RCFA 1TWGH 5IWAQ 3S16B 2RCNA 4LUZA 3RZOB 2L0CA 3CCLA 1EQVA 2EY6A 4B3TQ 2OTJA 4LFCL 4JI8L 3A5ZB 1S4ZA 4DAYB 5IIFA 4BY1H 2A69C 4LFAL 2Z4HA 2F52A 1A15A 1VQ8A 1JQYD 4QY7A 2CWPA 1RTNA 1B4OA 1W6KA 2K52A 1B8AA 2EY1A 2VB3X 3CRKC 3F1ZA 3NWSA 4X3KA 1YI2A 4FXDA 1BXTA 1H9MA 2FMMA 2LXJA 1NSNS 3K5MA 4I7AA 1I94Q 4UPAA 2JN4A 1B3QA 1HFNA 2CCZA 1QVCA 3J81L 3K59A 3M85A 3R3OA 5DNFA 1KNEA 4A3BG 5L37A 1E1OA 2FJ2A 4NPSA 4PV1C 2XN9C 2K14A 1B2TA 5FOBB 1X3QA 1ZYRC 3EBEA 2ZM6L 1NE3A 3SK6A 4JYAQ 4DV0L 3CP0A 4IPHA 1X56A 4IUTA 2F0KA 1HNWQ 4X6AH 1TKWB 2UU9Q 2UXCL 1Q7YC 3OIPA 3EQLC 3K58A 2OWOA 3GO5A 1K8AC 2NVQB 3UDIA 2CQOA 1STAA 2HDMA 5GAEC 2I5LX 3HOZG 3GTOH 1VQIA 1STNA 4K8IA 3PIOA 1QB5D 1EY8A 5M3MH 3L2PA 3IRBA 5CBEE 2J7ZA 1DOKA 3M4PA 3PUVA 3MEFA 4AYBE 4GLXA 4DV2L 5IGEA 3S1RH 2AUJD 1QVFA 4DR4Q 2MP1A 1PFSA 2HD3A 4WORA 1YITA 1LT6D 3QOLA 2CHBD 2B2YC 2H5XA 5AJ3Q 3C1EA 3D3RA 3J81c 1N9WA 5DM63 2R7ZG 1NTGA 2AQ2B 4DR5Q 2WB1B 3GTQH 1I5FA 2MGSA 1QILA 1NMFA 2O5JC 1RDPD 1CUKA 1ESFA 3S1MH 1DJRD 3AU7A 3G71A 3K81C 2PW7A 2NWGA 4JBJA 2EXZA
chains in the Genus database with same CATH topology
3CRLC 1ZKOA 5AFWA 5C5LA 2VNUD 2DNEA 1RTOA 5I2YA 5ELDA 1F2MA 2L4NA 5D3IB 3EROA 3TZDA 2K03A 4TRDA 2CW0C 3EA6A 1F9PA 4HSVA 1DONA 2DY8A 1F9RA 2D62A 1JOQA 5DM73 3IFTA 2ICEC 3F2UA 1RODA 2M2LA 1Y8PB 4FYDA 2QEJC 2V4DA 2B2YA 2I46A 5CC4A 1BNZA 2M00A 4CBVA 2CVRA 2A69D 1I4HA 1TVXA 3PUXA 1GHKA 4IURA 2R93B 3CHBD 4RKBA 3GV3A 1GHJA 1MI2A 3VR5A 1HCZA 5EGTA 1Q3LA 1EYAA 4CHTB 4U673 2BA0A 4PMBA 1RF2D 4F8MA 5ISRA 1OXSC 1FYCA 3OIQA 1PZKD 1U4LA 3GTLB 2K04A 3TP5A 1JE4A 1O7ZA 1ZYRD 2XRSD 1IHZA 2C9OA 5I9OA 1JC7A 3BVGA 5CR3A 3I4LA 1NUCA 1JOOA 4ILWA 5IGFA 5CORA 1WTWA 3R8BA 1SJED 2DN8A 4RGNA 1SE3A 3MWYW 1PTOD 2NTTA 5CBAE 3NWTA 4KN4C 4O42A 2MJ8A 2F0JA 3IL8A 1BBXC 1MD2D 3MVVA 1Y8NB 4LAAA 1F77A 1EY9A 2F0VA 2JP1A 1HFGA 1WTOA 1U4PA 1STEA 5LHY1 4BA2I 4NW2A 3A56A 2N55A 3I8ZA 3ERQA 2CW0D 3IKJA 3UI2A 3EJIA 4PMWA 2B2TC 4DXFA 2X69A 1JWSD 3WOFA 1LTID 1KDCA 3MHBA 5KIXA 2NVTB 5C3XA 5D3DA 3T16A 3I4MB 1RJTA 3HG9A 2F0OA 3IFDA 3DWQA 1CZGA 4ZYSA 2NUCA 2AQ3B 5IODA 1S5CD 2FFKB 3DEPA 2K05A 5FO8B 2F03A 2TMPA 3DM1A 3OMCA 3GTPB 3LWUA 2KCNA 4DFAA 1D1IA 3H91A 5IGDA 2XVSA 2RKSA 5J1ZA 3D6WA 4J6HA 3TMEA 4K2KA 3HGBA 2NZ1D 1PRTC 2K33A 1TWHB 3DXJC 1EY0A 1HPCA 3H3VC 3ND9A 4N9TA 1Y8OB 1OXVA 3A7AB 3I3CA 1LTAD 1CA6A 5D14A 4PQXA 1CA5A 1UUPA 2HCCA 5G3LF 3FPUB 4DAPA 5I2XA 3HOYB 2Y0SB 3GP7A 2JXMB 1Q90A 4WFN3 1QNKA 3NXWA 1STHA 3HOVB 5E4XA 2RVLA 4H7BA 4DNTB 3QO2A 1SNDA 2QCPX 1STBA 5ELFA 4BBRB 5KYLA 1YNJC 4DN4M 2F0PA 3DUZA 2KHSA 5EBDA 1I4RA 2KOLA 4TSSA 4CGYB 5C3WA 3V96A 2E2IB 3JAME 5BN3A 2KUMA 4OL7A 3J7YW 4RGOS 4A3EB 4CJ2C 2F0FA 1WVLA 2RQXA 2OF1A 1SNQA 1TWFB 1F9QA 1I6HB 4HCSA 4G4KA 4A3JB 5C4JB 3K7AB 4CKBA 4RCOA 1PTOF 1TR5A 5JEAJ 5JPMC 3J80L 2N88A 1DXMA 1TY0A 3NTIA 3NQTA 4C2MB 3D4WA 5BN4A 1EFID 1PRTB 3VR3A 3WOEA 2Q8IB 5HGTA 1B9NA 4OO1I 4LJZC 1GUSA 5I4DA 4KKUA 5E1FA 5K36G 1JWMD 1VCIA 1T5EA 1PRTD 5IT9L 2O5IC 5IGGA 2EYPA 3BYTB 5T1IA 2NB0A 1CI3M 3OOCA 2NN6I 1WTPA 2NTSA 3A8JE 4ABNA 2PNRC 1HQRD 4CKEA 4EQPA 4EQOA 2QKIC 4KTAA 1I6VC 3A54A 3PV0A 1PFBA 1EWCA 1B44D 5COYA 4HSPA 1KNAA 3TN2A 2XRQD 3T4AC 4MHEA 2VXWA 1B50A 3PO3B 5M5XB 2R3ZA 3M3YB 2BE5C 1EZ6A 4J8QA 4N9PA 2WACA 2F3VA 3SDZA 1YNJD 4K5XA 4NP5A 1SYBA 4A3FB 1AZQA 4K6LA 1KDBA 3NQIA 4HN7A 4DK0A 5CYUA 4C56C 1PLFA 3I90A 2O4XA 1LTGD 1AEXA 4X3UA 1ZEQX 4NMZA 3FEWX 3NK9A 3VA7A 1HQMC 4A93B 3G7LA 3SEBA 4C3HG 3GTKB 2B8GA 4ZLTF 4HEDA 2E74C 2F3WA 2PPBC 3MTSA 4F88A 3KUPA 1AFPA 1LACA 1S5FD 3RZDB 1S5ED 5JVH3 3T56B 1IYUA 1G91A 1XTCD 3P20A 1SDFA 1EIGA 1RD9D 3MFYA 3CU7A 1RCVD 4ZAIA 3RLFA 1K83B 3GTJB 4Q5VA 1F2LA 2F1MA 3PIO3 4TQUS 1TWGB 1G291 2EZVA 2JA7B 2PCFB 1SNMA 3ITPA 3KK7A 3DWAA 4HR7B 3GTGB 3ZYYX 1STGA 4FF3A 1CHQD 1EYDA 3SK8A 1RKNA 5IGBA 1JB3A 1HTLD 2AUKA 3EVQA 4TKOB 1TS5A 2RDHA 4BS9A 2FINB 4IQZA 3HZXA 1CT1D 4HMIA 1YNNC 2OT2A 2LKVA 4ZUJA 1JOKA 4FO2A 2EYOA 5NUCA 1MSGA 2B2VC 1PXUA 4R9WA 4IFDH 4O1NA 4Z9CB 5C0XJ 3SHLA 5EPJA 3PUZA 4WJWA 3Q23A 5CV5A 1GUOA 3GTMB 4JBWA 1PRTF 4CKCA 2KCCA 2PMZB 1CQVA 3D4RA 4RGMA 2Z4IA 1OXUA 3G6JB 2J0TD 1OO9B 1UNSA 2Q8RE 3I72A 2BCOA 1SMYC 1TY2A 4IZ8A 5C0XI 1D1KA 5CV7A 1Z47A 3BVMA 1V1PA 3R2IA 3S1MB 5IT9E 2B39A 1GUWA 1GXDC 2WINB 2HDLA 3E0JA 3T53B 1BOSA 2M9VA 3HOUB 1D5MC 1CQFA 3SE0A 1QNUA 2B2VA 4C3IB 1TQOA 2MPMA 3S2DB 2OXPA 3FVQA 3MA2B 1IL8A 3BDCA 4DF7A 1LT3D 4XT3B 5CGKA 5KGUA 2JEAI 3HKZB 2LMCB 4RHRA 4EVOA 2IPKD 2X6GA 4KY5A 2EE1A 5JEAG 1H9JA 5BN5A 3D8GA 1V1PB 1PTOH 2TSSA 4IN3A 3TDQA 4OO1G 5LL6X 4KJNA 4FF4A 1GUGA 3N6RA 1WTRA 1CTMA 3EFXD 2NN6G 2K6AA 4XYOA 4C1NK 1U4RA 1PYWD 4G7HC 1YNND 1K8OA 4BBSB 1FNUA 2YU9B 3J7AV 2F0LA 3VA5A 1I50B 2ZXPA 2EJFC 5M3FB 2KA7A 5KRUA 2KEEA 3MZ5A 1HTPA 1TWAB 3BDLA 4ME5A 1DCZA 1HXYD 3NHHA 1MGSA 4A3BB 2L1BA 4FP5D 1TS4A 2RSNA 2NVYB 2HQEA 3GV6A 1SMYD 1BQQT 2IWHA 2CQAA 2WKCA 2EOTA 4B9XA 4QUCA 3RD4A 1HA5A 3J81E 4KY6A 4FVMA 5C4ZA 1O7LA 3K5OA 2A6EC 2L55A 3HOZB 2HCIA 3OW7A 1PZJD 3WDNA 2RDFA 2B63B 1L0YB 3T13A 2LFNA 5FO7B 2YYZA 3LNNA 3HEJA 4FXGC 2AWOA 4XYQA 2R7ZB 2WV6D 5EPKA 4GZYC 2RDGA 5F2DA 1SNOA 1NR4A 2GA4B 4V190 3MXPA 3A8IE 3SK4A 1BCPB 1GUTA 2BDNA 2J4XA 1M8AA 4PNYA 3Q0AA 2PZUA 2SNSA 5I6WA 2E2DC 4B9WA 3V2TA 3SVMA 2XWBB 1ET9A 4I65A 4ODGA 3D6CA 1ENFA 4H0LC 3NSWA 2LS01 1ESRA 1SNPA 4Q0FA 4FF1A 1H9RA 4YIJA 2KEDA 3QJYA 5IGCA 5HURA 4IUQA 1G8ZD 5EBCA 4ID6A 4DXGA 4OIKA 1E2ZA 5JEAH 2F0UA 3BG3A 2IT1A 3GD7A 4OIJA 2D5DA 5J22A 3BDOA 2KJXA 4OO1H 4RA8A 1FNVA 3NP8A 5JJZA 2NYZD 1W6JA 1UAPA 3OWEB 3R2TA 1MBYA 1LLRD 4EQNA 3L9AX 2NN6H 1F9SA 2F0NA 3NBHA 2H4OA 1SE2A 3S14B 1ML0D 4L63B 2ENBA 3M7GA 4IUPA 2PQEA 4KD4A 1I3QB 1CK1A 1M4VA 3FPPA 4UAIA 3VR4A 3H09A 1SFOB 3Q6SA 2SDFA 3C2PA 1QOHA 4AYBB 1EEID 3VR2A 1B53A 1A3UA 1QCBD 1SXTA 3BS1A 2A6ED 2RSOA 1ENAA 1Y1VB 5C0XG 1AZPA 5IOCA 4DAVA 1FD7D 1IKLA 2Q8TA 2RBMA 3SXHA 2A6HC 5CV9A 1IKMA 1E2WA 1HUMA 4ULLA 4R8IA 4DU9A 2K28A 1LT5D 4L6TB 2K01A 5DEHA 3OHXC 3DHQA 1PZID 2EPBA 2IL8A 5J39A 1G6ZA 1DM0B 3S15B 2OEOA 1LTRD 1A2UA 3J7AF 2L9HA 4KN7C 2L12A 3PO2B 4HCEA 3QB3A 2AQ1B 3VYUA 4G7OC 1KAAA 4LK1C 3S1NB 5FLXL 1HHVA 4BY7B 5I6YA 3ND8A 1VF5C 2JE6I 2F0QA 3MEHA 3K5NA 5KNBA 1XWEA 1KLUD 3DMUA 3O13A 1F2YA 5K5PA 3ONAB 1TS3A 2JYOA 5JOBA 2KECA 2EJMA 4QMGA 2XSCA 5E4WC 4X3SA 4F87A 3S1QB 1PMRA 1UEAB 3DEOA 5DAUA 1A6XA 4FNFA 2EYJA 5LL6S 5C44B 4KI0A 1FGBD 3NBIA 2WKDA 3PUWA 2DY7A 5CV8A 4C3IG 4KHVA 1EEFD 4OGQC 5C6AA 4K8JA 4C3JB 4KY7A 3HRZC 5EKKA 1FNWA 4DGZA 1F2ZA 1OXTA 1Z6HA 1I4PA 3FDTA 4G7ZC 3NUCA 2JEBI 3X3NA 1I4QA 2A73B 3A55A 1DD2A 3BVZA 2K5QA 4A3GB 3D4DA 2A6HD 1ICWA 4XQNA 3KLRA 3H94A 4ZK9B 5EQ0A 1WTVA 2ZXRA 4LMQD 3I70A 1QG7A 4EGVA 3PUYA 2E2HB 2IX3A 1ILPA 3P75A 3TP6A 1G2TA 2MHVA 4QUFA 2G9HD 1WCMB 3C1FA 4E6IA 1SAPA 2L11A 5A2QL 4I7ZC 2B2WA 3D31A 1D6EC 2Z8LA 3VYSA 4DA2A 5JVG3 5EJWA 2R6GA 4RAUC 3H6MA 1EL0A 5C0XH 4H13C 1ZXTA 4S3SA 5C4XB 2EDGA 1U4MA 5FK9C 4BY1B 4X3TA 1GUNA 4NKLA 1QJOA 2PZTA 2BOSA 1SYFA 1I4XA 1AN8A 3W3AA 4H44C 2F0SA 5KYIA 1DOLA 3MAQA 3M4YA 2BE5D 5K36H 2D2CC 5EKLA 2IW3A 4C1NI 4K6DA 1LTTD 3J80E 4QIWB 1Q1EA 2JSOA 3NTKA 1PTOC 2EYLA 1SBBB 5ELCA 3A8KE 3I91A 3GTOB 4HMJA 5M3MB 2K5DA 3MC0B 4KHZA 3S1RB 3KBXA 4ZRZA 1JR0D 1EZ8A 1I4GA 5C5MA 3GTQB 4IUNA 1LO5D 2EJGC 3C46A 1J9OA 2ZT9C 4FXKC 5C3EB 2IX0A 1TIID 4XT1B 2WP8J 4M1UB 5D65A 2EVBA 1B1ZA 2F4IA 3CKIB 4U68A 2F0MA 5FLXE 4NDXA 2PYKA 3V05A 4RWSC 1KTKA 1LTSD 4XQJA 4A3MB 1BDOA 2E75C 1R9TB 1EY6A 3FKIB 1A3TA 3HS0C 3TZUA 5G3LD 1V43A 4IUUA 4MN3A 1DZ1A 1LTBD 3K6OA 2LY7A 2F0HA 1II3A 1GOZA 2NVXB 1DOMA 1VF7A 1DYQA 1K8MA 1WTXA 4B08A 3HP3A 1L0XB 4IFDJ 5CV4A 1AP0A 3KBGA 3JAML 2SEBD 4A3KB 4V0BA 4C3HB 3VR6A 4XQQA 1BCPC 3W2DA 4XDXA 4DK1A 1LABA 1S5DD 4KD3A 4PMCA 3FMCA 4IFDI 2SOBA 4QCLA 2WIIB 3K5LA 4RFBA 5M5WB 4KK7A 1CFMA 5I9PA 3BZDB 1PTOB 5JAVA 4MIUA 1VDZA 1TWCB 1SEBD 3S17B 4M8AA 1XXGA 4KJOA 1KABA 4KKTA 4BWGB 1EY4A 1SSOA 4ZUIA 3KLSA 3AB9A 2B8FA 2JA8B 1RHPA 3MFGA 4CJ1B 4HAEA 1FR3A 5A2QE 5FKAC 4A3IB 4P2CB 1EIHA 1C48A 1BUVT 2C5CA 1KLGD 2FMCA 1ET6A 4K2LA 2I07B 2PZWA 2R61A 1HRJA 1HUNA 3TP7A 5FO9B 4K14A 2E76C 3BYYB 1SYDA 1SYCA 1Q12A 2VUMB 3VYRA 3CQZB 1QWYA 2DNCA 1D5ZC 3FRPB 1EY5A 1EYCA 2A74C 3OSOA 1BR9A 1BF4A 5ELBA 1B3AA 2Z1CA 1SYGA 1EQTA 1CHPD 1KDAA 4J1MA 2ID0A 3P7JA 5C4HA 4F7XA 1G2SA 2QILA 2BA1A 1EOTA 2R92B 2MUYA 1NAPA 4A3DB 1SJHD 4OHJA 5TSSA 3OWFA 2EYMA 4QB4A 1IW7C 2L5TA 3OPOA 2PW5A 2PO4A 1V8QA 1Y1WB 2K5WA 1JORA 1HA6A 3PMFA 5A35A 2VB2X 4QF4A 1BCPD 1VMCA 1XYIA 4XIGS 3MXNA 4RH6A 1AW7A 3I4NB 2B2TA 2KQ3A 1H9SA 2K1BA 2K32A 2KVMA 4JK1C 2F0TA 1GJXA 3KF8A 4C3JG 4RHSA 3OMGA 1J8IA 3QOJA 4RKLA 5M5YB 1H9KA 4K5VA 2D9UA 4KMUC 1XX8A 5EKIA 5EPLA 1R4PB 1PFMA 4ZKBB 1CM9A 1QE6A 3N52A 2XNAC 3TSSA 3E5SA 2A68C 4RGTA 3M7NA 1Q8IA 3MXUA 3DWPA 3A7LA 1D2BA 3R93A 1SE4A 3I73A 5T1GA 3NTHA 4K5WA 3U9OA 2F0WA 2XIWA 3E6ZX 5JPNC 1H9SB 2O2LD 1ONLA 3IAYA 4BA1I 1A3VA 3HOXB 1JICA 1VMPA 2K7VA 2SNMA 1SNCA 3L7ZC 2EYFA 1TU2B 2H1EA 2QDBA 3K0YA 1ENCA 3HOWB 1EU4A 2EY5A 4CJ0B 3NE5B 1TT2A 3GQBA 2NBFA 4G57A 2IX1A 1X32A 1PFNA 1WTQA 3S2HB 3U9SA 1X3PA 1IW7D 1LV9A 1T5XD 5KNDA 4Y7NB 2JA5B 4KV6A 1NCVA 3TP8A 4DNRB 2G9DA 4L8JA 2B2UC 3Q22A 3H0GB 5E3FA 2XWJB 3SK5A 3QIAA 1EY7A 4XTCS 2E2JB 2FHTA 1V1OA 1OXXK 3AMUA 4UDUC 3LX0A 4R8NA 1U9RA 3RMHA 4FF2A 4HTHA 2X6LA 2ICIA 1R4QB 4RCNA 2QF7A 3K57A 4IFDG 5KEEA 1E2VA 4WRDA 1JWUD 1D5XC 2EYHA 4XXEA 2AWNA 3T51B 2HUGA 1EU3A 2JA6B 3M4OB 3TBIB 2A68D 2RA4A 1S5BD 2IJ0A 3NPPA 4IALA 1O7YA 3QWNA 3RUZA 1IYVA 1C4QA 1PDQA 2B2WC 3LWEA 1B9MA 1A2TA 1MSHA 2B2UA 1WD1A 3KLSX 1TS2A 1BCPF 4DAYA 1Q1BA 3VYTA 3L3OC 4ZQ3A 1CZWA 1Z7TA 5KNCA 3X3MA 5CV6A 2BDOA 3C3LA 2F0IA 2A5HA 3PIP3 3QG1A 2F0DA 3S9WA 1BO0A 1NR2A 2F0GA 4KKSA 1ILQA 5ELEA 1O78A 1STYA 2WAQB 3URYA 4IUVA 5CMDA 1O80A 1Y69U 2F0EA 1C8CA 1WD0A 5M9OA 3P1HA 3MXGA 1LT4D 1JCKB 3Q24A 1E0BA 1EWHA 4ZKCB 1SYEA 2ZXOA 2EY2A 3SR1A 3S16B 3RZOB 2L0CA 1EQVA 2EY6A 1S4ZA 5IIFA 2A69C 2Z4HA 1A15A 1JQYD 1RTNA 1B4OA 1W6KA 2EY1A 2VB3X 3CRKC 3NWSA 4X3KA 4FXDA 1BXTA 1H9MA 2FMMA 1NSNS 3K5MA 1HFNA 3J81L 3K59A 3M85A 3R3OA 5DNFA 1KNEA 2FJ2A 4PV1C 2XN9C 1B2TA 5FOBB 1X3QA 1ZYRC 3SK6A 4IUTA 2F0KA 1TKWB 3OIPA 3EQLC 3K58A 3GO5A 2NVQB 1STAA 2HDMA 1STNA 4K8IA 1QB5D 1EY8A 5CBEE 2J7ZA 1DOKA 3PUVA 5IGEA 2AUJD 2MP1A 4WORA 1LT6D 3QOLA 2CHBD 2B2YC 3C1EA 3D3RA 5DM63 2AQ2B 2WB1B 2MGSA 1QILA 2O5JC 1RDPD 1ESFA 1DJRD 3AU7A 2PW7A 2NWGA 2EXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYE A;  3D8G A;  5JOB A;  2PZW A;  4HMI A;  4K2K A;  2EY2 A;  1EY6 A;  3SK5 A;  2PZT A;  3SR1 A;  5C5L A;  3HEJ A;  1A3T A;  2LKV A;  4QMG A;  4ZUJ A;  1EY7 A;  3E5S A;  1JOK A;  4KJN A;  3TP7 A;  1F2M A;  1SYF A;  4K14 A;  3ERO A;  1EQV A;  2EY6 A;  4TRD A;  1A3U A;  5DAU A;  3NQT A;  2EYJ A;  1SYD A;  1EY0 A;  1SYC A;  1SNO A;  5F2D A;  5IIF A;  3LX0 A;  2EYO A;  2F0J A;  1ENA A;  2F0H A;  4N9T A;  4R8N A;  1II3 A;  1U9R A;  5NUC A;  3D4W A;  2F0S A;  3MXP A;  2F3W A;  5KYI A;  4HTH A;  3MVV A;  4LAA A;  5CV8 A;  1EY5 A;  3SK4 A;  5IOC A;  1EYC A;  1JOQ A;  1EY9 A;  2F0V A;  3OSO A;  4PNY A;  3SHL A;  2PZU A;  2SNS A;  2RBM A;  2EY1 A;  3SXH A;  5I6W A;  4KHV A;  5CV5 A;  5CV9 A;  5HGT A;  5KEE A;  5C6A A;  4B9W A;  5CV4 A;  4K5W A;  5EKL A;  4K8J A;  4WRD A;  1NSN S;  1SYG A;  3V2T A;  2EYH A;  3U9O A;  5E1F A;  2F0W A;  3NXW A;  1STH A;  4KY7 A;  1KDA A;  5EKK A;  4J1M A;  4DU9 A;  4I65 A;  5C4H A;  4ODG A;  4F7X A;  4H7B A;  5IGG A;  2EYP A;  4K6D A;  3D6C A;  5CC4 A;  1SND A;  4DGZ A;  1F2Z A;  2F0L A;  2M00 A;  3ERQ A;  3VA5 A;  3R3O A;  1A3V A;  5DEH A;  4IZ8 A;  1STB A;  4IAL A;  3DHQ A;  5CV7 A;  3RUZ A;  2SNM A;  1SNC A;  3EJI A;  3NUC A;  4KD3 A;  4EQO A;  4EQP A;  5KRU A;  2EYF A;  5KYL A;  2EYL A;  4PMC A;  5J39 A;  3MZ5 A;  3OWF A;  2SOB A;  2EYM A;  1SNP A;  2QDB A;  4HMJ A;  2OEO A;  1A2T A;  4QB4 A;  2F0P A;  4RKB A;  4YIJ A;  3SK6 A;  3D4D A;  2KHS A;  3BDL A;  4KTA A;  1A2U A;  2F0K A;  4ME5 A;  5IGC A;  2PW5 A;  3NHH A;  5HUR A;  4ID6 A;  1KDC A;  1ENC A;  4ZQ3 A;  5I9P A;  5EGT A;  5JAV A;  3MHB A;  4MIU A;  1JOR A;  2F0U A;  2EY5 A;  5KIX A;  1EYA A;  1EZ8 A;  3PMF A;  3QB3 A;  1STA A;  4QF4 A;  5C3W A;  5CV6 A;  5C3X A;  5C5M A;  1SNM A;  5J22 A;  4KJO A;  4PMB A;  1KAB A;  3T16 A;  3ITP A;  2F0I A;  2HQE A;  4F8M A;  1EZ6 A;  1TT2 A;  1STN A;  2F0O A;  4K8I A;  5ISR A;  4IUN A;  1EY4 A;  1EY8 A;  1KAA A;  1TQO A;  2WAC A;  3P75 A;  4N9P A;  2F3V A;  3NP8 A;  4G57 A;  4B9X A;  2OXP A;  2NUC A;  3C1F A;  4OL7 A;  5IOD A;  4E6I A;  5IGE A;  2F0D A;  3TP5 A;  4K5X A;  5I6Y A;  4NP5 A;  3BDC A;  4WOR A;  4ZUI A;  1SYB A;  2KQ3 A;  4DF7 A;  2F0G A;  1STG A;  3QOL A;  4KY6 A;  2F0F A;  2F0Q A;  1EYD A;  2F0T A;  1IHZ A;  3C1E A;  3MEH A;  3SK8 A;  4EQN A;  2OF1 A;  1SNQ A;  1KDB A;  1STY A;  5C4Z A;  5I9O A;  3S9W A;  1RKN A;  3TP6 A;  3H6M A;  3OMC A;  3OMG A;  5CR3 A;  5CGK A;  2O4X A;  2F0N A;  3QOJ A;  4DFA A;  2F0M A;  1NUC A;  4S3S A;  2F0E A;  4RKL A;  5IGB A;  1JOO A;  5KGU A;  1AEX A;  4NDX A;  5IGD A;  2PYK A;  5M9O A;  5IGF A;  2RKS A;  4K5V A;  2RDF A;  3P1H A;  2ENB A;  3DMU A;  4KV6 A;  3EVQ A;  2PQE A;  4NMZ A;  4EVO A;  4KD4 A;  2PW7 A;  3TP8 A;  1F2Y A;  5J1Z A;  4KY5 A;  3T13 A;  1TR5 A;  5K5P A;  3NK9 A;  4J6H A;  5E3F A;  2EXZ A;  3HZX A;  3TME A;  4NKL A;  4K2L A; 
#chains in the Genus database with same CATH topology
 4DPG A;  2IY5 B;  3CRL C;  1ZKO A;  5AFW A;  5C5L A;  4DV4 Q;  2DNE A;  2VNU D;  4HIM A;  1RTO A;  3JC6 6;  5I2Y A;  5ELD A;  1F2M A;  2L4N A;  5D3I B;  3ERO A;  3TZD A;  2K03 A;  4TRD A;  1VQ5 A;  2CW0 C;  3EA6 A;  1F9P A;  5GRO A;  3S2D H;  3TRZ A;  4HSV A;  3UDF A;  2UXD L;  1X3G A;  2DY8 A;  1DON A;  1F9R A;  2D62 A;  1JOQ A;  5DM7 3;  3IFT A;  2ICE C;  3F2U A;  5IYC H;  1HNZ Q;  1ROD A;  2M2L A;  1Y8P B;  2Q2U A;  4GKK L;  4FYD A;  2QEJ C;  4YHH Q;  4GLV B;  4WJ4 A;  2MFI A;  1Y14 B;  1KIX A;  3BZK A;  4YY3 Q;  2V4D A;  2B2Y A;  2I46 A;  1WTH A;  5CC4 A;  1BNZ A;  2M00 A;  4CBV A;  2CVR A;  1L1O C;  1P8L A;  4DV5 Q;  2A69 D;  1I4H A;  1TVX A;  1NMG A;  3PUX A;  1GHK A;  1V1Q A;  4GS3 A;  4IUR A;  4O0A A;  2R93 B;  5HY6 A;  3CHB D;  4RKB A;  3GV3 A;  4A3C G;  1GHJ A;  1HR0 L;  1MI2 A;  3VR5 A;  1HCZ A;  3UE0 A;  1W3S A;  1K8G A;  5EGT A;  4NXM L;  1Q3L A;  2Q2I A;  1EYA A;  4CHT B;  4U67 3;  4OEM B;  2BA0 A;  4PMB A;  1RF2 D;  4F8M A;  5ISR A;  1OXS C;  1FYC A;  3AYH B;  3OIQ A;  1PZK D;  1MHW C;  5M5W H;  1XTD A;  1EIY B;  1U4L A;  3GTL B;  1XNR Q;  2K04 A;  1RL2 A;  3TP5 A;  2UUC L;  1BBW A;  1JE4 A;  1O7Z A;  3T1H Q;  4BBS H;  1ZYR D;  2QA4 A;  2YU9 H;  2XRS D;  1IHZ A;  2C9O A;  5I9O A;  1JC7 A;  3BVG A;  1I50 H;  4AYB G;  2NZO A;  2GVA A;  5CR3 A;  3I4L A;  1NUC A;  1JOO A;  4ILW A;  5IGF A;  4CDC C;  5IP9 G;  4B3S Q;  5COR A;  3HOX G;  3Q8D A;  1WTW A;  1N32 L;  3R8B A;  1TWA H;  1Y1V G;  1JMC A;  1SJE D;  3CCS A;  1L1O A;  2DN8 A;  4RGN A;  1SE3 A;  1EWI A;  3MWY W;  1PTO D;  4RMF A;  2NTT A;  2PI2 A;  5CBA E;  4GN5 A;  3NWT A;  4A3B H;  3DLL A;  4KN4 C;  3AQQ A;  4O42 A;  2NVY H;  1JT8 A;  2MJ8 A;  2F0J A;  3IL8 A;  2KHJ A;  1BBX C;  3CME A;  1MD2 D;  1WI5 A;  1Y8N B;  3MVV A;  4LAA A;  4X66 Q;  1F77 A;  1EY9 A;  2F0V A;  2JP1 A;  1HFG A;  1YEZ A;  1A0I A;  1WTO A;  1U4P A;  3UDG A;  4J15 A;  3HFZ B;  3TQY A;  3HOZ H;  1STE A;  5LHY 1;  1LM0 A;  4BA2 I;  1RIP A;  1MJE A;  1YJ9 A;  4GOP C;  4NW2 A;  3A56 A;  2N55 A;  3ULL A;  3I8Z A;  3ERQ A;  2CW0 D;  3IKJ A;  2JA5 G;  3UI2 A;  3EJI A;  3CAM A;  4LF7 L;  4PMW A;  2B2T C;  4DXF A;  2X69 A;  3H0G G;  2R7Z H;  4LF4 Q;  4BY7 G;  1L1O B;  1JWS D;  3WOF A;  4DUY L;  1LTI D;  1CKM A;  4DK3 C;  2UUA Q;  3ZJY C;  1KDC A;  3STB C;  2Z0S A;  3MHB A;  1XMO Q;  5KIX A;  2NVT B;  5C3X A;  5D3D A;  1C9O A;  2WFW A;  4DKA C;  3T16 A;  3I4M B;  1RJT A;  3HG9 A;  2UUB L;  3BU2 A;  2F0O A;  3IFD A;  3DWQ A;  1CZG A;  4ZYS A;  1VQ4 A;  2NUC A;  2AQ3 B;  5IOD A;  1S5C D;  2FFK B;  4JV5 L;  2KHI A;  3DEP A;  2K05 A;  5FO8 B;  2F03 A;  4X64 Q;  2TMP A;  3DM1 A;  4KLK A;  2VY3 A;  3OMC A;  3GTP B;  3LWU A;  2KCN A;  2JA6 G;  4DFA A;  3CD6 A;  4AIM A;  1D1I A;  3H91 A;  5IGD A;  1IBM L;  2XVS A;  2RKS A;  2ES2 A;  3PGZ A;  4JI5 Q;  5J1Z A;  1VQ6 A;  3D6W A;  4J6H A;  2KBN A;  3TME A;  1PYB A;  4K2K A;  2C35 B;  3HGB A;  2NZ1 D;  1PRT C;  5M5Y H;  2K33 A;  1TWH B;  4QIW E;  1CKO A;  3DXJ C;  1EY0 A;  1HPC A;  5IP7 G;  3H3V C;  3ND9 A;  4N9T A;  1Y8O B;  4BXX H;  1OXV A;  3A7A B;  3I3C A;  1LTA D;  2CH4 W;  1CA6 A;  5D14 A;  4A3C H;  4PQX A;  1CA5 A;  1UUP A;  3CXC A;  4CDD C;  1I94 L;  2HCC A;  4DR7 Q;  5G3L F;  3FPU B;  4DAP A;  5I2X A;  3CC7 A;  3HOY B;  2Y0S B;  3GP7 A;  2JXM B;  1Q90 A;  4WFN 3;  1QNK A;  3NXW A;  1STH A;  3HOV B;  5E4X A;  1PH5 A;  4YCW A;  2RVL A;  4H7B A;  4DNT B;  3QO2 A;  1SND A;  1BKB A;  2QCP X;  1STB A;  5ELF A;  4BBR B;  1ASZ A;  5KYL A;  1YNJ C;  4DN4 M;  1SFO H;  2ZTD A;  4GOP B;  2UU9 L;  4NB3 A;  2F0P A;  4GN3 B;  1WCM G;  3DUZ A;  3RLN A;  1B70 B;  2KHS A;  2Q2H A;  5EBD A;  5IP9 H;  3HOX H;  1IBK Q;  1CSQ A;  1I4R A;  2KOL A;  1U0L A;  1Y1V H;  4LF8 Q;  1K3R A;  4TSS A;  4CGY B;  5C3W A;  3V96 A;  4DR4 L;  2E2I B;  2HIX A;  3JAM E;  5BN3 A;  4DV3 L;  2KUM A;  2EQS A;  4LNQ A;  4OL7 A;  3J7Y W;  4RGO S;  4A3E B;  1L0W A;  4DR5 L;  4CJ2 C;  2F0F A;  1WVL A;  2RQX A;  2OF1 A;  1SNQ A;  1TWF B;  1F9Q A;  4JOI C;  4JVZ A;  3CF5 A;  1I6H B;  3LGJ A;  4HCS A;  4G4K A;  4P72 A;  4A3J B;  5C4J B;  3K7A B;  1W2B A;  1VQD A;  4CKB A;  4RCO A;  3S2H H;  1PTO F;  4DV4 L;  1TR5 A;  1YHA A;  1AE2 A;  1S40 A;  5JEA J;  1YBY A;  5JPM C;  3J80 L;  3E9I A;  2UXB Q;  2MO0 A;  3ULJ A;  2N88 A;  1DXM A;  4R4O A;  1M90 C;  1TY0 A;  2K4K A;  3FHW A;  3NTI A;  3NQT A;  4LF6 Q;  4R1J A;  1TXY A;  4C2M B;  3H0G H;  3D4W A;  1VQF A;  5BN4 A;  1EFI D;  1PRT B;  3S1N H;  4QL5 A;  3VR3 A;  1XPU A;  4BY7 H;  3WOE A;  2YTY A;  2Q8I B;  2HHH Q;  2QDL A;  5HGT A;  4YY3 L;  1B9N A;  4OO1 I;  4K0K Q;  4LJZ C;  1GUS A;  5I4D A;  2R7D A;  4KKU A;  5E1F A;  1JJG A;  5K36 G;  1JWM D;  4ALP A;  5LMU Q;  1VCI A;  1T5E A;  1PRT D;  2XGT A;  3EN2 A;  5IT9 L;  2O5I C;  5IGG A;  1WOC A;  2EYP A;  3BYT B;  2XTI A;  2WB1 G;  5T1I A;  2NB0 A;  1CI3 M;  3OOC A;  1FGU A;  1E1T A;  1L2F A;  2NN6 I;  3J80 c;  1WTP A;  2NTS A;  3A8J E;  4ABN A;  2PNR C;  1HQR D;  4LWC A;  4CKE A;  4EQP A;  4EQO A;  4X65 Q;  5IYB G;  4LF9 Q;  1GM5 A;  2QKI C;  4Y52 H;  2JA6 H;  1PV4 A;  3M4O H;  1EQR A;  4KTA A;  1I6V C;  3A54 A;  3PV0 A;  1PFB A;  1EWC A;  1B44 D;  1UE7 A;  5COY A;  2A1A A;  4HSP A;  1KNA A;  2DJG C;  3TN2 A;  1N34 Q;  2XRQ D;  3T4A C;  4MHE A;  1H95 A;  4YWK A;  2VXW A;  1B50 A;  5LMN W;  3PO3 B;  5M5X B;  4N8X 1;  2R3Z A;  3M3Y B;  2BE5 C;  2VL6 A;  1EZ6 A;  4J8Q A;  1SRU A;  4N9P A;  2WAC A;  2QEX A;  2F3V A;  3CCR A;  3SDZ A;  1J5E Q;  4C3J H;  1YNJ D;  4A3M G;  4DNI A;  4K5X A;  4NP5 A;  1SYB A;  5IP7 H;  4O2D A;  1MIU A;  4A3F B;  1CKN B;  3FKI G;  2GN5 A;  1AZQ A;  4K6L A;  1KDB A;  4B3S L;  3NQI A;  3K80 C;  4HN7 A;  4DK0 A;  5CYU A;  4C56 C;  1PLF A;  4UP8 A;  3I90 A;  2D0P A;  2O4X A;  1VQM A;  1LTG D;  1AEX A;  2CFM A;  2HIV A;  4X3U A;  5FLX c;  1ZEQ X;  1EOV A;  3W5O A;  4NMZ A;  3FEW X;  3NK9 A;  3VA7 A;  2MNA A;  1JB7 A;  1HQM C;  4A93 B;  2R93 G;  3G7L A;  2DGY A;  4LUO A;  2E2H H;  3F2B A;  4A3K G;  3SEB A;  4C3H G;  3GTK B;  2LSS A;  2B8G A;  1G6P A;  4ZLT F;  4HED A;  2E74 C;  2P5Z X;  2F3W A;  1K73 C;  3UE1 A;  1WCM H;  2PPB C;  3MTS A;  4F88 A;  1EQQ A;  1XJV A;  3S16 H;  3KUP A;  1AFP A;  1Q81 C;  3CCM A;  1LAC A;  2R7F A;  1S5F D;  3U4Z A;  3RZD B;  2FXQ A;  1S5E D;  5C4X H;  5JVH 3;  1K0R A;  2IHF A;  3T56 B;  1IYU A;  4LFB Q;  1G91 A;  1XTC D;  3P20 A;  1SDF A;  1EIG A;  4OEL B;  1RD9 D;  3MFY A;  2JK8 A;  3CU7 A;  2UUA L;  1RCV D;  4ZAI A;  3CCE A;  3RLF A;  3G6E A;  1K83 B;  1XMO L;  3GTJ B;  4Q5V A;  1F2L A;  4DV6 Q;  2F1M A;  3PIO 3;  3PIP A;  2JA8 G;  4TQU S;  4JI2 Q;  1TWG B;  1G29 1;  3B6Y A;  2EZV A;  2JA7 B;  2PCF B;  1SNM A;  4HJ9 A;  3RN5 A;  2ALY B;  3ITP A;  3KK7 A;  4A3I G;  2MO1 A;  3DWA A;  4HR7 B;  1XMQ Q;  1XNQ Q;  3GTG B;  3ZYY X;  2Z6B A;  2VW9 A;  1STG A;  4FF3 A;  1CHQ D;  1EYD A;  3SK8 A;  5BR8 Q;  3ER0 A;  1RKN A;  3I56 A;  2A8V A;  2LXK A;  5IGB A;  1JB3 A;  1HTL D;  4DR6 Q;  2IHE A;  2AUK A;  2VUM G;  5FLM G;  3EVQ A;  5H1S E;  4TKO B;  1TS5 A;  2RDH A;  4BS9 A;  3I7F A;  2FIN B;  4IQZ A;  3HZX A;  1CT1 D;  4HMI A;  1YNN C;  2OT2 A;  2LKV A;  4ZUJ A;  4DV1 Q;  1YJW A;  5GQO A;  1JOK A;  3CMA A;  3VDY A;  4FO2 A;  5LMN Q;  1M1K C;  2EYO A;  5NUC A;  1MSG A;  2K5V A;  2B2V C;  5IYB H;  2HT1 A;  1PXU A;  4DR7 L;  4R9W A;  4IFD H;  4O1N A;  2R92 G;  2YV5 A;  4Z9C B;  5C0X J;  2A19 A;  4DK6 C;  5C3E H;  3SHL A;  5EPJ A;  4A3D G;  3PUZ A;  4WJW A;  3Q23 A;  5CV5 A;  1GUO A;  3GTM B;  2E5L Q;  4JBW A;  1PRT F;  1PH9 A;  3U50 C;  1CSP A;  1WYD A;  2QGQ A;  4CKC A;  3KJO A;  2KCC A;  2PMZ B;  1CQV A;  3D4R A;  4RGM A;  2Z4I A;  1OXU A;  3G6J B;  2J0T D;  4JI4 Q;  1OO9 B;  1UNS A;  4YWM A;  2Q8R E;  4JI0 L;  3M9B A;  3I72 A;  1Y1W G;  2BCO A;  1SMY C;  1TY2 A;  4A3M H;  2Z9H A;  4IZ8 A;  5C0X I;  1D1K A;  5CV7 A;  1Z47 A;  3BVM A;  1R9T H;  1V1P A;  1IYJ B;  4IJH A;  3R2I A;  3FKI H;  4LF5 L;  3S1M B;  5IT9 E;  2B39 A;  3I4N G;  1IBK L;  3EIV A;  5ELO A;  1GUW A;  1EUJ A;  1GXD C;  4LF8 L;  2WIN B;  3T1Y L;  2HDL A;  3E0J A;  2NVX H;  3T53 B;  1BOS A;  2M9V A;  3HOU B;  1D5M C;  1SE8 A;  1VQL A;  3K7U C;  2JQO A;  2N3S A;  1CQF A;  3SE0 A;  1VQJ A;  1QNU A;  2B2V A;  4C3I B;  1TQO A;  2MPM A;  4GKJ Q;  3S2D B;  2CH4 A;  2OXP A;  3FVQ A;  4A3K H;  1VQO A;  4C3H H;  3MA2 B;  1IL8 A;  3BDC A;  4DF7 A;  4OWW B;  2F4V Q;  4DV7 Q;  3HOY G;  1LT3 D;  1YHB A;  1AE3 A;  4XT3 B;  5CGK A;  1N33 Q;  5KGU A;  1UE5 A;  3J7Z C;  4HIO A;  1NJI C;  1UE1 A;  4DR2 Q;  2JEA I;  3HKZ B;  2NZH A;  4HJ8 A;  2LMC B;  4RHR A;  4EVO A;  4R4I A;  4BBR G;  2IPK D;  2X6G A;  4KY5 A;  2EE1 A;  5JEA G;  1H9J A;  4MTN A;  1FVI A;  4AQY L;  5BN5 A;  3D8G A;  1V1P B;  4A75 A;  3JAM i;  4LF6 L;  1PTO H;  3PF4 A;  2TSS A;  4IN3 A;  3TDQ A;  4OO1 G;  5LL6 X;  1TWC H;  4H02 A;  1FL0 A;  4QJF A;  4KJN A;  3S17 H;  2VQF Q;  4FF4 A;  1GUG A;  3N6R A;  4NXN Q;  1WTR A;  1CTM A;  3EFX D;  4HJ5 A;  2NN6 G;  4IOA A;  1KD1 C;  2K6A A;  3HKS A;  1HNX L;  4XYO A;  4C1N K;  2JA8 H;  5LMU L;  1U4R A;  2DUD A;  1PYW D;  4EX5 A;  4G7H C;  2I0Q A;  1YNN D;  1JJC B;  1K8O A;  4BBS B;  1SMX A;  4A3I H;  1FNU A;  2YU9 B;  3J7A V;  3HOW G;  2F0L A;  3VA5 A;  4A3J G;  1I50 B;  2ZXP A;  3E9H A;  4LF9 L;  1U5K A;  2EJF C;  2BH8 A;  5M3F B;  2KA7 A;  5KRU A;  1PVO A;  2G5D A;  1E24 A;  2KEE A;  3MZ5 A;  1HTP A;  2WAQ E;  1FJG Q;  1TWA B;  3BDL A;  4ME5 A;  4JI7 Q;  1DCZ A;  1HXY D;  3NHH A;  2VUM H;  1MGS A;  5FLM H;  4OX9 Q;  4IPG A;  3CQZ H;  3W1B A;  4DUZ Q;  1EYG A;  4KHP Q;  1IBL Q;  4A3B B;  2L1B A;  4FP5 D;  5HGQ A;  1TS4 A;  2RSN A;  1J5E L;  4JI6 Q;  1UE6 A;  1UWV A;  2NVY B;  2HQE A;  3GV6 A;  1SMY D;  1BQQ T;  2IWH A;  2CQA A;  2WKC A;  3ICE A;  2EOT A;  4B9X A;  4QUC A;  2L15 A;  1YVC A;  3RD4 A;  1HA5 A;  1O7I A;  4QQB X;  3J81 E;  4KY6 A;  4FVM A;  4IPD A;  1Q82 C;  5C4Z A;  1O7L A;  3K5O A;  2R92 H;  2A6E C;  2L55 A;  1NY4 A;  3HOZ B;  2HCI A;  1HR0 W;  3OW7 A;  4A3D H;  4B3M Q;  1PZJ D;  3WDN A;  2RDF A;  1WFQ A;  4R4Q A;  4JI1 L;  2B63 B;  4RG1 A;  1L0Y B;  3T13 A;  2LFN A;  4LFA Q;  5FO7 B;  2YYZ A;  4GNX C;  3LNN A;  1Y1W H;  3HEJ A;  4FXG C;  2AWO A;  4XYQ A;  2R7Z B;  3AFP A;  2WV6 D;  5EPK A;  4GZY C;  4A3L G;  2RDG A;  5F2D A;  1SNO A;  1NR4 A;  2GA4 B;  4V19 0;  3I4N H;  3MXP A;  1PYS B;  3RN2 A;  1VQE A;  3A8I E;  3SK4 A;  1BCP B;  1GUT A;  2BDN A;  2J4X A;  1M8A A;  4PNY A;  5IWA L;  2PZU A;  2SNS A;  3Q0A A;  3CC2 A;  1TWH H;  5I6W A;  2E2D C;  4B9W A;  4B3T L;  4MTK A;  3V2T A;  2ZJP A;  4A3F G;  4LFB L;  3SVM A;  2XWB B;  2ZM6 Q;  1ET9 A;  4I65 A;  4ODG A;  2PNH A;  1ICF B;  3D6C A;  5IY0 A;  1ENF A;  4H0L C;  3NSW A;  2UXC Q;  2LS0 1;  2KEN A;  1ESR A;  3HOY H;  4OXP A;  4YWL A;  1SNP A;  4JI2 L;  4Q0F A;  4FF1 A;  1H9R A;  4A4I A;  4A93 G;  4YIJ A;  2WB1 E;  2KED A;  3QJY A;  5IGC A;  4GNX A;  3BZC A;  4JC0 A;  4DV2 Q;  4IUQ A;  1G8Z D;  5EBC A;  4ID6 A;  5HUR A;  4DXG A;  4OIK A;  4BBR H;  1E2Z A;  2WAQ G;  5JEA H;  2F0U A;  3BG3 A;  2KCT A;  4EQ5 A;  1PH8 A;  2IT1 A;  3GD7 A;  4X62 Q;  4OIJ A;  2D5D A;  5J22 A;  1XNQ L;  3BDO A;  2KJX A;  4FDB A;  4OO1 H;  4JYA L;  4RA8 A;  1FNV A;  3NP8 A;  1HNW L;  5JJZ A;  2NYZ D;  5BR8 L;  1W6J A;  3CPF A;  1UAP A;  1JE5 A;  3R2T A;  3OWE B;  1C0A A;  1MBY A;  1EIF A;  4JPB W;  4DR6 L;  1Q46 A;  1LLR D;  4EQN A;  4P73 A;  3L9A X;  2NN6 H;  4HJA A;  3M4Q A;  1F9S A;  2F0N A;  2HQL A;  1X55 A;  1X3F A;  3NBH A;  2H4O A;  3F8T A;  2PQA A;  1SE2 A;  3S14 B;  1ML0 D;  4L63 B;  2ENB A;  3M7G A;  4IUP A;  2PQE A;  4KD4 A;  1I3Q B;  1CK1 A;  4DV1 L;  1M4V A;  5AJ3 L;  1MJC A;  3FPP A;  4UAI A;  2JA9 A;  3VR4 A;  1VQG A;  3H09 A;  1MKH A;  1SFO B;  3A5U A;  3Q6S A;  3HOW H;  2SDF A;  3C2P A;  1QOH A;  1K3B C;  1YHQ A;  2K5H A;  4AYB B;  3K7A H;  1IL2 A;  1EEI D;  3VR2 A;  1B53 A;  1A3U A;  1A62 A;  4GKK Q;  1QCB D;  1SXT A;  4GNX B;  3BS1 A;  2A6E D;  2RSO A;  1ENA A;  1D7Q A;  5GAD C;  3STB D;  3OTO Q;  2JA7 G;  3KYH C;  1Y1V B;  5C0X G;  1AZP A;  5IOC A;  4DAV A;  1VQP A;  1FD7 D;  1IKL A;  2Q8T A;  3KF6 A;  2RBM A;  3SXH A;  2A6H C;  5CV9 A;  1IKM A;  2RF4 A;  1E2W A;  1HUM A;  2ZTE A;  2N49 A;  4ULL A;  3KJP A;  3QR8 A;  4R8I A;  4C2M H;  1GVP A;  1VQH A;  1VS0 A;  4DU9 A;  4Y7N H;  2JA5 H;  2K28 A;  3PCO B;  1LT5 D;  4L6T B;  2K01 A;  5DEH A;  3OHX C;  1QUQ A;  3DHQ A;  1PZI D;  1HNZ L;  2JJQ A;  2EPB A;  1DGS A;  2PQA B;  2IL8 A;  5J39 A;  4YHH L;  1G6Z A;  1K9M C;  4PZ8 A;  1DM0 B;  3S15 B;  2OEO A;  3E3X A;  2E2J H;  1LTR D;  1A2U A;  2ASB A;  3J7A F;  1PA6 A;  2L9H A;  3D0F A;  4KN7 C;  4DV5 L;  2L12 A;  3PO2 B;  4HCE A;  2AMC B;  4GKJ L;  3QB3 A;  2AQ1 B;  1X3E A;  1VQK A;  3VYU A;  4G7O C;  4DV7 L;  1KAA A;  4LK1 C;  1KHI A;  3S1N B;  5FLX L;  1HHV A;  4BY7 B;  1N32 Q;  5I6Y A;  1N33 L;  4A3L H;  3ND8 A;  1VF5 C;  2JE6 I;  2F0Q A;  3MEH A;  3K5N A;  2RHQ B;  2YTX A;  5KNB A;  5FJ8 G;  1VQN A;  1E22 A;  1S3O A;  1XWE A;  1KLU D;  1QZG A;  3DMU A;  1XNR L;  3O13 A;  1F2Y A;  3T1H L;  1BBU A;  5K5P A;  4A3F H;  3RLO A;  1QUQ B;  3ONA B;  1G51 A;  2VZA A;  1TS3 A;  2JYO A;  5JJK A;  2VQF L;  5JOB A;  1PH3 A;  2KEC A;  2EJM A;  1S72 A;  4QMG A;  2ZJQ A;  1AH9 A;  2XSC A;  5E4W C;  4X3S A;  4F87 A;  3S1Q B;  3W1G A;  1PMR A;  1UEA B;  4LUV A;  3DEO A;  5DAU A;  1A6X A;  4FNF A;  2EYJ A;  1N36 Q;  5LL6 S;  1VQA A;  5C44 B;  3HOU G;  4KI0 A;  1FGB D;  3NBI A;  2WKD A;  3PUW A;  2K5N A;  3OW2 A;  3BJU A;  4A93 H;  4P74 A;  2DY7 A;  5CV8 A;  1KRT A;  4C3I G;  4KHV A;  1EEF D;  4OGQ C;  5C6A A;  4LF7 Q;  2PI2 E;  3H3V I;  4K8J A;  1KC8 C;  4C3J B;  2VS1 A;  4KY7 A;  3HRZ C;  5EKK A;  1FNW A;  4N8F A;  4X66 L;  3CC4 A;  4DGZ A;  1F2Z A;  1OXT A;  4JI3 Q;  1Z6H A;  3KFU A;  1I4P A;  1SR3 A;  4DR1 Q;  3FDT A;  4G7Z C;  4ZCK A;  3NUC A;  2JEB I;  3X3N A;  1I4Q A;  2A73 B;  3CW2 C;  3A55 A;  1DD2 A;  3KDF A;  3BVZ A;  2K5Q A;  4UP7 A;  2OQK A;  1SLJ A;  2UUB Q;  4OX9 L;  3RZO H;  4DUZ L;  4A3G B;  4KHP L;  3D4D A;  1IBL L;  2A6H D;  1ICW A;  4HID A;  4XQN A;  3A74 A;  3KLR A;  3H94 A;  4ZK9 B;  5EQ0 A;  4R4T A;  1WTV A;  2ZXR A;  4LMQ D;  3I70 A;  1QG7 A;  4L5T A;  4EGV A;  3PUY A;  2E2H B;  2IX3 A;  3K0X A;  3NEN A;  4LF4 L;  1ILP A;  3P75 A;  3TP6 A;  1C7Y A;  1G2T A;  2MHV A;  4QUF A;  2G9H D;  1WCM B;  3C1F A;  4E6I A;  4GN4 B;  1SAP A;  2L11 A;  5A2Q L;  4I7Z C;  2B2W A;  2VQE Q;  3D31 A;  4B3M L;  3TEH B;  1D6E C;  2Z8L A;  3VYS A;  4DA2 A;  5JVG 3;  2JA7 H;  5EJW A;  2R6G A;  4RAU C;  3H6M A;  3I4O A;  1X9N A;  5C0X H;  1EL0 A;  4H13 C;  1OTC A;  4BBS G;  1ZXT A;  4S3S A;  2I5H A;  5C4X B;  2EDG A;  2YTV A;  1U4M A;  3GTG H;  5FK9 C;  4BY1 B;  1Q8K A;  2Y0S E;  4X3T A;  4DR3 Q;  5M3F G;  1GUN A;  1HZ9 A;  4X64 L;  2CWA A;  4NKL A;  1QJO A;  4QGU A;  2PZT A;  3KDF B;  4CDE C;  1WJJ A;  3TS0 A;  2NVQ H;  3PQI A;  2BOS A;  1SYF A;  3J81 i;  2K75 A;  4APV A;  1I4X A;  1AN8 A;  3W3A A;  4JI5 L;  4H44 C;  2F0S A;  5KYI A;  4PZ6 A;  1DOL A;  4IO9 A;  3MAQ A;  5GAH C;  3M4Y A;  2BE5 D;  5K36 H;  2D2C C;  3WWV A;  5EKL A;  2IW3 A;  4PG3 A;  4C1N I;  4K6D A;  1LTT D;  3J80 E;  1PH4 A;  4QIW B;  1Q1E A;  3GTM H;  2JSO A;  2B63 G;  3NTK A;  3I4M G;  1PTO C;  2EYL A;  1VQ7 A;  1K0S A;  1SBB B;  5ELC A;  1HJP A;  3A8K E;  3I91 A;  3GTO B;  4HMJ A;  5FJ8 H;  5M3M B;  2K5D A;  3NEM A;  4JBK A;  3MC0 B;  4DV3 Q;  4X62 L;  4KHZ A;  3S1R B;  3KBX A;  4ZRZ A;  1JR0 D;  3F2C A;  1EZ8 A;  5IYD G;  1PH6 A;  3NEL A;  4JW0 A;  1I4G A;  5C5M A;  4IOC A;  3GTQ B;  4IUN A;  1LO5 D;  2EJG C;  3C46 A;  1J9O A;  2ZT9 C;  4FXK C;  5C3E B;  2IX0 A;  1TII D;  1X54 A;  4XT1 B;  2WP8 J;  4M1U B;  3HOU H;  3PF5 A;  5D65 A;  2EVB A;  2OQ0 A;  1B1Z A;  2F4I A;  3CKI B;  4OON A;  4U68 A;  2F0M A;  5FLX E;  4C3I H;  4NDX A;  1V9P A;  2PYK A;  3V05 A;  4RWS C;  1KTK A;  2N78 A;  1LTS D;  2R93 H;  1SN8 A;  4XQJ A;  1EFW A;  4R4C A;  4A3M B;  1PHJ A;  1B7Y B;  2D0O A;  4HIK A;  1BDO A;  2E75 C;  1R9T B;  1EY6 A;  3FKI B;  1A3T A;  3HS0 C;  3TZU A;  5JJL A;  2V1C C;  2Y0S G;  5G3L D;  3OTO L;  1V43 A;  4IUU A;  3PSI A;  4MN3 A;  3HOV G;  1DZ1 A;  4UY8 C;  1LTB D;  3K6O A;  2LY7 A;  2F0H A;  1II3 A;  2DJF C;  1GOZ A;  2NVX B;  1DOM A;  1VQ9 A;  1VF7 A;  3GTL H;  1DYQ A;  1K8M A;  3RR5 A;  2UXB L;  1WTX A;  3F2D A;  4B08 A;  3HP3 A;  4BXX G;  1L0X B;  4IFD J;  5ELN A;  2QW7 A;  5CV4 A;  3TRE A;  1AP0 A;  3KBG A;  3JAM L;  2SEB D;  4MNO A;  4A3K B;  4V0B A;  4C3H B;  4HJ7 A;  3VR6 A;  4XQQ A;  1BCP C;  3W2D A;  3J81 j;  4XDX A;  4IJL A;  4DK1 A;  2HHH L;  1LAB A;  4GLA C;  4JG2 A;  1SRO A;  1S5D D;  1VQC A;  4KD3 A;  4AH6 A;  4K0K L;  4PMC A;  3FMC A;  4IFD I;  2SOB A;  4QCL A;  2WII B;  3K5L A;  1X6O A;  4A3E G;  4RFB A;  5M5W B;  4KK7 A;  1CFM A;  5I9P A;  3BZD B;  1PTO B;  5JAV A;  1Q86 C;  4MIU A;  1VDZ A;  1TWC B;  5M3F H;  1SEB D;  3S17 B;  4P71 A;  2AKW B;  4M8A A;  4X65 L;  1XXG A;  4KJO A;  1KAB A;  4KKT A;  4BWG B;  2OTL A;  1EY4 A;  4JCV E;  1SSO A;  3JAM c;  4DAM A;  4IPC A;  1A8V A;  1X65 A;  3CCJ A;  4ZUI A;  3RNU A;  3KLS A;  3AB9 A;  1N34 L;  2B8F A;  2JA8 B;  2KCM A;  1RHP A;  1UEB A;  4CDF C;  3MFG A;  4CJ1 B;  4HAE A;  1FR3 A;  5A2Q E;  5FKA C;  1HZA A;  2AHO B;  4A3I B;  4P2C B;  1EIH A;  1YIJ A;  4LW1 A;  1C48 A;  1BUV T;  4YCV A;  3GDE A;  2C5C A;  1KLG D;  2FMC A;  1ET6 A;  2I07 B;  4K2L A;  4L5S A;  2PZW A;  2Z6K C;  1N36 L;  2R61 A;  4B3R Q;  1IZ6 A;  1HRJ A;  3FP9 A;  1HUN A;  2NVT H;  3TP7 A;  2GVB A;  4K14 A;  5FO9 B;  2B63 H;  2E76 C;  1NNX A;  3BYY B;  3I4M H;  1SYD A;  1SYC A;  3PO2 G;  1Q12 A;  2VUM B;  3L0O A;  3VYR A;  2RHS B;  3CQZ B;  1QWY A;  2DNC A;  1D5Z C;  3FRP B;  4LFC Q;  1EY5 A;  4JI8 Q;  1EYC A;  1GD7 A;  3CCV A;  2A74 C;  3OSO A;  1BR9 A;  1BF4 A;  5ELB A;  2BH2 A;  1B3A A;  2Z1C A;  3GTP H;  1SYG A;  5IYD H;  4JI3 L;  1EQT A;  4DR1 L;  1CHP D;  3SGI A;  1KDA A;  4J1M A;  2ID0 A;  3P7J A;  5C4H A;  4F7X A;  3CPW A;  1G2S A;  2QIL A;  2BA1 A;  1GKH A;  1EOT A;  2R92 B;  2MUY A;  2B29 A;  1NAP A;  3PO3 G;  1A63 A;  1D8L A;  4A3D B;  1SJH D;  4OHJ A;  5TSS A;  3OWF A;  2EYM A;  3K8A A;  4QB4 A;  4PZ7 A;  3I55 A;  1IW7 C;  2L5T A;  3OPO A;  2PW5 A;  2PO4 A;  1V8Q A;  2Z6K A;  1Y1W B;  2K5W A;  4DV0 Q;  1JOR A;  1QVG A;  1HA6 A;  3PMF A;  5A35 A;  2VB2 X;  4QF4 A;  1BCP D;  4GOP A;  5C44 G;  1BVS A;  1VMC A;  1XYI A;  4XIG S;  3MXN A;  4RH6 A;  1AW7 A;  2VQE L;  3I4N B;  4DV6 L;  1E7Z A;  1KAW A;  2B2T A;  3HOV H;  2KQ3 A;  1H9S A;  2K1B A;  2K32 A;  2KVM A;  4JK1 C;  2MQH A;  2F0T A;  4OWX B;  3KF8 A;  4C3J G;  1GJX A;  1KRS A;  4RHS A;  3OMG A;  2N8N A;  1J8I A;  3QOJ A;  4DR3 L;  4RKL A;  5M5Y B;  3DM3 A;  1K28 A;  1JJ2 A;  1H9K A;  2Q2T A;  4K5V A;  2D9U A;  1XMQ L;  4KMU C;  1XX8 A;  5EKI A;  5EPL A;  2PMZ E;  1R4P B;  1PFM A;  4ZKB B;  1GO3 E;  2I5M X;  1CM9 A;  1QE6 A;  3N52 A;  2XNA C;  3TSS A;  4A3G G;  3G48 A;  3E5S A;  3S14 H;  2A68 C;  3E0E A;  1LYL A;  4RGT A;  3M7N A;  1I3Q H;  1XPO A;  2E2I H;  1Q8I A;  3MXU A;  3DWP A;  3U4V A;  3A7L A;  4POF A;  1D2B A;  1E3P A;  4A3E H;  4JI0 Q;  3R93 A;  1SE4 A;  3I73 A;  1HZB A;  5T1G A;  1Z9F A;  4WJ3 M;  2EXD A;  3G4S A;  3MXN B;  3KLW A;  1KL9 A;  3NTH A;  1TWF H;  4K5W A;  2UXD Q;  4LF5 Q;  1I6H H;  3U9O A;  5LMN L;  2F0W A;  4A3J H;  5C4J H;  2XIW A;  3TS2 A;  3E6Z X;  5JPN C;  1H9S B;  3T1Y Q;  1T9H A;  2O2L D;  3KF8 B;  1ONL A;  3IAY A;  4BA1 I;  4OWT B;  1A3V A;  4YCU A;  3HOX B;  1JIC A;  3H15 A;  1VMP A;  2K7V A;  5C4X G;  2E5L L;  2SNM A;  1SNC A;  3L7Z C;  2E8G A;  4UHV A;  2EYF A;  1TU2 B;  2H1E A;  4BY1 G;  3ULP A;  2QDB A;  4JI4 L;  4TVA B;  5E7N A;  3K0Y A;  3ERS X;  3HKZ E;  1ENC A;  1VQB A;  3HOW B;  1XPR A;  1EU4 A;  2EY5 A;  1HR0 Q;  4CJ0 B;  1ASY A;  4A76 A;  1IXR A;  2OCE A;  3A0J A;  3S15 H;  4NXM Q;  3NE5 B;  1TT2 A;  3GQB A;  1PH1 A;  3H3V H;  3J80 i;  3KOJ A;  3NBH B;  2NBF A;  4G57 A;  2IX1 A;  1X32 A;  1PFN A;  1PH2 A;  1WTQ A;  3S2H B;  1QZH A;  3PO2 H;  1KXL A;  3U9S A;  4AQY Q;  1X3P A;  1IW7 D;  2UUC Q;  1LV9 A;  1T5X D;  5KND A;  4Y7N B;  2JA5 B;  4KV6 A;  1NCV A;  4L5Q A;  3TP8 A;  4DNR B;  2G9D A;  4L8J A;  3AEV A;  2B2U C;  3Q22 A;  2F4V L;  3H0G B;  5E3F A;  2XWJ B;  1CKN A;  1J6Q A;  1N8R C;  3SK5 A;  3J7A 5;  3S24 A;  3QIA A;  1HNX Q;  5M3M G;  1EY7 A;  3KF6 B;  4XTC S;  2ZJR A;  4DR2 L;  3PO3 H;  2E2J B;  5M5X H;  2FHT A;  1LUZ A;  3M3Y H;  1V1O A;  3CCQ A;  1OXX K;  3AMU A;  2F3I A;  4UDU C;  3LX0 A;  3I2Z A;  4R8N A;  1U9R A;  4JOI A;  3RMH A;  1KQS A;  4FF2 A;  4HTH A;  1P16 A;  1HZC A;  2X6L A;  2ICI A;  1R4Q B;  4RCN A;  1HH2 P;  2K50 A;  2QF7 A;  3K57 A;  3S1Q H;  4IFD G;  5KEE A;  4MZ9 A;  1E2V A;  4WRD A;  1JWU D;  5C3E G;  1D5X C;  2EYH A;  4XXE A;  3AFQ A;  5C44 H;  2AWN A;  4NXN L;  3T51 B;  3OYY A;  2HUG A;  1EU3 A;  1LTL A;  2JA6 B;  3M4O B;  5J3B A;  2ZTC A;  3TBI B;  4JBM A;  1YZ6 A;  2A68 D;  2RA4 A;  4ME3 A;  1S5B D;  2IJ0 A;  3CCU A;  3NPP A;  4IAL A;  1O7Y A;  3QWN A;  3RUZ A;  1IYV A;  1NBW A;  1C4Q A;  1PDQ A;  2B2W C;  1YJN A;  3LWE A;  5IT9 c;  2EIF A;  1B9M A;  1A2T A;  1MSH A;  2B2U A;  4UP9 A;  1WD1 A;  4POG A;  3GTK H;  3KLS X;  1TS2 A;  1BCP F;  4DAY A;  1Q1B A;  3VYT A;  3L3O C;  4ZQ3 A;  1CZW A;  1Z7T A;  5KNC A;  5IYC G;  3X3M A;  4DUY Q;  5CV6 A;  2BDO A;  3C3L A;  2F0I A;  2A5H A;  3PIP 3;  3HKZ G;  1FJG L;  1YNX A;  4A3G H;  3QG1 A;  4JI7 L;  4JI1 Q;  2F0D A;  3UDX A;  3RZD H;  3S9W A;  1BO0 A;  1NR2 A;  2F0G A;  4KKS A;  5EAY A;  2CKZ B;  1ILQ A;  5ELE A;  1O78 A;  4L5R C;  1STY A;  2WAQ B;  3URY A;  3U58 A;  4JI6 L;  4IUV A;  5CMD A;  1PH7 A;  5GAG C;  5DLQ E;  4JV5 Q;  2B3G A;  1O80 A;  1Y69 U;  2F0E A;  1C8C A;  1WD0 A;  2ATW A;  5M9O A;  3P1H A;  3MXG A;  5IE8 A;  1LT4 D;  1JCK B;  3Q24 A;  1E0B A;  1EWH A;  1K83 H;  3GTJ H;  4P75 A;  4B3R L;  4ZKC B;  1IBM Q;  5JJI A;  1SYE A;  2ZXO A;  2EY2 A;  3SR1 A;  2RCF A;  1TWG H;  5IWA Q;  3S16 B;  2RCN A;  4LUZ A;  3RZO B;  2L0C A;  3CCL A;  1EQV A;  2EY6 A;  4B3T Q;  2OTJ A;  4LFC L;  4JI8 L;  3A5Z B;  1S4Z A;  4DAY B;  5IIF A;  4BY1 H;  2A69 C;  4LFA L;  2Z4H A;  2F52 A;  1A15 A;  1VQ8 A;  1JQY D;  4QY7 A;  2CWP A;  1RTN A;  1B4O A;  1W6K A;  2K52 A;  1B8A A;  2EY1 A;  2VB3 X;  3CRK C;  3F1Z A;  3NWS A;  4X3K A;  1YI2 A;  4FXD A;  1BXT A;  1H9M A;  2FMM A;  2LXJ A;  1NSN S;  3K5M A;  4I7A A;  1I94 Q;  4UPA A;  2JN4 A;  1B3Q A;  1HFN A;  2CCZ A;  1QVC A;  3J81 L;  3K59 A;  3M85 A;  3R3O A;  5DNF A;  1KNE A;  4A3B G;  5L37 A;  1E1O A;  2FJ2 A;  4NPS A;  4PV1 C;  2XN9 C;  2K14 A;  1B2T A;  5FOB B;  1X3Q A;  1ZYR C;  3EBE A;  2ZM6 L;  1NE3 A;  3SK6 A;  4JYA Q;  4DV0 L;  3CP0 A;  4IPH A;  1X56 A;  4IUT A;  2F0K A;  1HNW Q;  4X6A H;  1TKW B;  2UU9 Q;  2UXC L;  1Q7Y C;  3OIP A;  3EQL C;  3K58 A;  2OWO A;  3GO5 A;  1K8A C;  2NVQ B;  3UDI A;  2CQO A;  1STA A;  2HDM A;  5GAE C;  2I5L X;  3HOZ G;  3GTO H;  1VQI A;  1STN A;  4K8I A;  3PIO A;  1QB5 D;  1EY8 A;  5M3M H;  3L2P A;  3IRB A;  5CBE E;  2J7Z A;  1DOK A;  3M4P A;  3PUV A;  3MEF A;  4AYB E;  4GLX A;  4DV2 L;  5IGE A;  3S1R H;  2AUJ D;  1QVF A;  4DR4 Q;  2MP1 A;  1PFS A;  2HD3 A;  4WOR A;  1YIT A;  1LT6 D;  3QOL A;  2CHB D;  2B2Y C;  2H5X A;  5AJ3 Q;  3C1E A;  3D3R A;  3J81 c;  1N9W A;  5DM6 3;  2R7Z G;  1NTG A;  2AQ2 B;  4DR5 Q;  2WB1 B;  3GTQ H;  1I5F A;  2MGS A;  1QIL A;  1NMF A;  2O5J C;  1RDP D;  1CUK A;  1ESF A;  3S1M H;  1DJR D;  3AU7 A;  3G71 A;  3K81 C;  2PW7 A;  2NWG A;  4JBJ A;  2EXZ A; 
#chains in the Genus database with same CATH homology
 3CRL C;  1ZKO A;  5AFW A;  5C5L A;  2VNU D;  2DNE A;  1RTO A;  5I2Y A;  5ELD A;  1F2M A;  2L4N A;  5D3I B;  3ERO A;  3TZD A;  2K03 A;  4TRD A;  2CW0 C;  3EA6 A;  1F9P A;  4HSV A;  1DON A;  2DY8 A;  1F9R A;  2D62 A;  1JOQ A;  5DM7 3;  3IFT A;  2ICE C;  3F2U A;  1ROD A;  2M2L A;  1Y8P B;  4FYD A;  2QEJ C;  2V4D A;  2B2Y A;  2I46 A;  5CC4 A;  1BNZ A;  2M00 A;  4CBV A;  2CVR A;  2A69 D;  1I4H A;  1TVX A;  3PUX A;  1GHK A;  4IUR A;  2R93 B;  3CHB D;  4RKB A;  3GV3 A;  1GHJ A;  1MI2 A;  3VR5 A;  1HCZ A;  5EGT A;  1Q3L A;  1EYA A;  4CHT B;  4U67 3;  2BA0 A;  4PMB A;  1RF2 D;  4F8M A;  5ISR A;  1OXS C;  1FYC A;  3OIQ A;  1PZK D;  1U4L A;  3GTL B;  2K04 A;  3TP5 A;  1JE4 A;  1O7Z A;  1ZYR D;  2XRS D;  1IHZ A;  2C9O A;  5I9O A;  1JC7 A;  3BVG A;  5CR3 A;  3I4L A;  1NUC A;  1JOO A;  4ILW A;  5IGF A;  5COR A;  1WTW A;  3R8B A;  1SJE D;  2DN8 A;  4RGN A;  1SE3 A;  3MWY W;  1PTO D;  2NTT A;  5CBA E;  3NWT A;  4KN4 C;  4O42 A;  2MJ8 A;  2F0J A;  3IL8 A;  1BBX C;  1MD2 D;  3MVV A;  1Y8N B;  4LAA A;  1F77 A;  1EY9 A;  2F0V A;  2JP1 A;  1HFG A;  1WTO A;  1U4P A;  1STE A;  5LHY 1;  4BA2 I;  4NW2 A;  3A56 A;  2N55 A;  3I8Z A;  3ERQ A;  2CW0 D;  3IKJ A;  3UI2 A;  3EJI A;  4PMW A;  2B2T C;  4DXF A;  2X69 A;  1JWS D;  3WOF A;  1LTI D;  1KDC A;  3MHB A;  5KIX A;  2NVT B;  5C3X A;  5D3D A;  3T16 A;  3I4M B;  1RJT A;  3HG9 A;  2F0O A;  3IFD A;  3DWQ A;  1CZG A;  4ZYS A;  2NUC A;  2AQ3 B;  5IOD A;  1S5C D;  2FFK B;  3DEP A;  2K05 A;  5FO8 B;  2F03 A;  2TMP A;  3DM1 A;  3OMC A;  3GTP B;  3LWU A;  2KCN A;  4DFA A;  1D1I A;  3H91 A;  5IGD A;  2XVS A;  2RKS A;  5J1Z A;  3D6W A;  4J6H A;  3TME A;  4K2K A;  3HGB A;  2NZ1 D;  1PRT C;  2K33 A;  1TWH B;  3DXJ C;  1EY0 A;  1HPC A;  3H3V C;  3ND9 A;  4N9T A;  1Y8O B;  1OXV A;  3A7A B;  3I3C A;  1LTA D;  1CA6 A;  5D14 A;  4PQX A;  1CA5 A;  1UUP A;  2HCC A;  5G3L F;  3FPU B;  4DAP A;  5I2X A;  3HOY B;  2Y0S B;  3GP7 A;  2JXM B;  1Q90 A;  4WFN 3;  1QNK A;  3NXW A;  1STH A;  3HOV B;  5E4X A;  2RVL A;  4H7B A;  4DNT B;  3QO2 A;  1SND A;  2QCP X;  1STB A;  5ELF A;  4BBR B;  5KYL A;  1YNJ C;  4DN4 M;  2F0P A;  3DUZ A;  2KHS A;  5EBD A;  1I4R A;  2KOL A;  4TSS A;  4CGY B;  5C3W A;  3V96 A;  2E2I B;  3JAM E;  5BN3 A;  2KUM A;  4OL7 A;  3J7Y W;  4RGO S;  4A3E B;  4CJ2 C;  2F0F A;  1WVL A;  2RQX A;  2OF1 A;  1SNQ A;  1TWF B;  1F9Q A;  1I6H B;  4HCS A;  4G4K A;  4A3J B;  5C4J B;  3K7A B;  4CKB A;  4RCO A;  1PTO F;  1TR5 A;  5JEA J;  5JPM C;  3J80 L;  2N88 A;  1DXM A;  1TY0 A;  3NTI A;  3NQT A;  4C2M B;  3D4W A;  5BN4 A;  1EFI D;  1PRT B;  3VR3 A;  3WOE A;  2Q8I B;  5HGT A;  1B9N A;  4OO1 I;  4LJZ C;  1GUS A;  5I4D A;  4KKU A;  5E1F A;  5K36 G;  1JWM D;  1VCI A;  1T5E A;  1PRT D;  5IT9 L;  2O5I C;  5IGG A;  2EYP A;  3BYT B;  5T1I A;  2NB0 A;  1CI3 M;  3OOC A;  2NN6 I;  1WTP A;  2NTS A;  3A8J E;  4ABN A;  2PNR C;  1HQR D;  4CKE A;  4EQP A;  4EQO A;  2QKI C;  4KTA A;  1I6V C;  3A54 A;  3PV0 A;  1PFB A;  1EWC A;  1B44 D;  5COY A;  4HSP A;  1KNA A;  3TN2 A;  2XRQ D;  3T4A C;  4MHE A;  2VXW A;  1B50 A;  3PO3 B;  5M5X B;  2R3Z A;  3M3Y B;  2BE5 C;  1EZ6 A;  4J8Q A;  4N9P A;  2WAC A;  2F3V A;  3SDZ A;  1YNJ D;  4K5X A;  4NP5 A;  1SYB A;  4A3F B;  1AZQ A;  4K6L A;  1KDB A;  3NQI A;  4HN7 A;  4DK0 A;  5CYU A;  4C56 C;  1PLF A;  3I90 A;  2O4X A;  1LTG D;  1AEX A;  4X3U A;  1ZEQ X;  4NMZ A;  3FEW X;  3NK9 A;  3VA7 A;  1HQM C;  4A93 B;  3G7L A;  3SEB A;  4C3H G;  3GTK B;  2B8G A;  4ZLT F;  4HED A;  2E74 C;  2F3W A;  2PPB C;  3MTS A;  4F88 A;  3KUP A;  1AFP A;  1LAC A;  1S5F D;  3RZD B;  1S5E D;  5JVH 3;  3T56 B;  1IYU A;  1G91 A;  1XTC D;  3P20 A;  1SDF A;  1EIG A;  1RD9 D;  3MFY A;  3CU7 A;  1RCV D;  4ZAI A;  3RLF A;  1K83 B;  3GTJ B;  4Q5V A;  1F2L A;  2F1M A;  3PIO 3;  4TQU S;  1TWG B;  1G29 1;  2EZV A;  2JA7 B;  2PCF B;  1SNM A;  3ITP A;  3KK7 A;  3DWA A;  4HR7 B;  3GTG B;  3ZYY X;  1STG A;  4FF3 A;  1CHQ D;  1EYD A;  3SK8 A;  1RKN A;  5IGB A;  1JB3 A;  1HTL D;  2AUK A;  3EVQ A;  4TKO B;  1TS5 A;  2RDH A;  4BS9 A;  2FIN B;  4IQZ A;  3HZX A;  1CT1 D;  4HMI A;  1YNN C;  2OT2 A;  2LKV A;  4ZUJ A;  1JOK A;  4FO2 A;  2EYO A;  5NUC A;  1MSG A;  2B2V C;  1PXU A;  4R9W A;  4IFD H;  4O1N A;  4Z9C B;  5C0X J;  3SHL A;  5EPJ A;  3PUZ A;  4WJW A;  3Q23 A;  5CV5 A;  1GUO A;  3GTM B;  4JBW A;  1PRT F;  4CKC A;  2KCC A;  2PMZ B;  1CQV A;  3D4R A;  4RGM A;  2Z4I A;  1OXU A;  3G6J B;  2J0T D;  1OO9 B;  1UNS A;  2Q8R E;  3I72 A;  2BCO A;  1SMY C;  1TY2 A;  4IZ8 A;  5C0X I;  1D1K A;  5CV7 A;  1Z47 A;  3BVM A;  1V1P A;  3R2I A;  3S1M B;  5IT9 E;  2B39 A;  1GUW A;  1GXD C;  2WIN B;  2HDL A;  3E0J A;  3T53 B;  1BOS A;  2M9V A;  3HOU B;  1D5M C;  1CQF A;  3SE0 A;  1QNU A;  2B2V A;  4C3I B;  1TQO A;  2MPM A;  3S2D B;  2OXP A;  3FVQ A;  3MA2 B;  1IL8 A;  3BDC A;  4DF7 A;  1LT3 D;  4XT3 B;  5CGK A;  5KGU A;  2JEA I;  3HKZ B;  2LMC B;  4RHR A;  4EVO A;  2IPK D;  2X6G A;  4KY5 A;  2EE1 A;  5JEA G;  1H9J A;  5BN5 A;  3D8G A;  1V1P B;  1PTO H;  2TSS A;  4IN3 A;  3TDQ A;  4OO1 G;  5LL6 X;  4KJN A;  4FF4 A;  1GUG A;  3N6R A;  1WTR A;  1CTM A;  3EFX D;  2NN6 G;  2K6A A;  4XYO A;  4C1N K;  1U4R A;  1PYW D;  4G7H C;  1YNN D;  1K8O A;  4BBS B;  1FNU A;  2YU9 B;  3J7A V;  2F0L A;  3VA5 A;  1I50 B;  2ZXP A;  2EJF C;  5M3F B;  2KA7 A;  5KRU A;  2KEE A;  3MZ5 A;  1HTP A;  1TWA B;  3BDL A;  4ME5 A;  1DCZ A;  1HXY D;  3NHH A;  1MGS A;  4A3B B;  2L1B A;  4FP5 D;  1TS4 A;  2RSN A;  2NVY B;  2HQE A;  3GV6 A;  1SMY D;  1BQQ T;  2IWH A;  2CQA A;  2WKC A;  2EOT A;  4B9X A;  4QUC A;  3RD4 A;  1HA5 A;  3J81 E;  4KY6 A;  4FVM A;  5C4Z A;  1O7L A;  3K5O A;  2A6E C;  2L55 A;  3HOZ B;  2HCI A;  3OW7 A;  1PZJ D;  3WDN A;  2RDF A;  2B63 B;  1L0Y B;  3T13 A;  2LFN A;  5FO7 B;  2YYZ A;  3LNN A;  3HEJ A;  4FXG C;  2AWO A;  4XYQ A;  2R7Z B;  2WV6 D;  5EPK A;  4GZY C;  2RDG A;  5F2D A;  1SNO A;  1NR4 A;  2GA4 B;  4V19 0;  3MXP A;  3A8I E;  3SK4 A;  1BCP B;  1GUT A;  2BDN A;  2J4X A;  1M8A A;  4PNY A;  3Q0A A;  2PZU A;  2SNS A;  5I6W A;  2E2D C;  4B9W A;  3V2T A;  3SVM A;  2XWB B;  1ET9 A;  4I65 A;  4ODG A;  3D6C A;  1ENF A;  4H0L C;  3NSW A;  2LS0 1;  1ESR A;  1SNP A;  4Q0F A;  4FF1 A;  1H9R A;  4YIJ A;  2KED A;  3QJY A;  5IGC A;  5HUR A;  4IUQ A;  1G8Z D;  5EBC A;  4ID6 A;  4DXG A;  4OIK A;  1E2Z A;  5JEA H;  2F0U A;  3BG3 A;  2IT1 A;  3GD7 A;  4OIJ A;  2D5D A;  5J22 A;  3BDO A;  2KJX A;  4OO1 H;  4RA8 A;  1FNV A;  3NP8 A;  5JJZ A;  2NYZ D;  1W6J A;  1UAP A;  3OWE B;  3R2T A;  1MBY A;  1LLR D;  4EQN A;  3L9A X;  2NN6 H;  1F9S A;  2F0N A;  3NBH A;  2H4O A;  1SE2 A;  3S14 B;  1ML0 D;  4L63 B;  2ENB A;  3M7G A;  4IUP A;  2PQE A;  4KD4 A;  1I3Q B;  1CK1 A;  1M4V A;  3FPP A;  4UAI A;  3VR4 A;  3H09 A;  1SFO B;  3Q6S A;  2SDF A;  3C2P A;  1QOH A;  4AYB B;  1EEI D;  3VR2 A;  1B53 A;  1A3U A;  1QCB D;  1SXT A;  3BS1 A;  2A6E D;  2RSO A;  1ENA A;  1Y1V B;  5C0X G;  1AZP A;  5IOC A;  4DAV A;  1FD7 D;  1IKL A;  2Q8T A;  2RBM A;  3SXH A;  2A6H C;  5CV9 A;  1IKM A;  1E2W A;  1HUM A;  4ULL A;  4R8I A;  4DU9 A;  2K28 A;  1LT5 D;  4L6T B;  2K01 A;  5DEH A;  3OHX C;  3DHQ A;  1PZI D;  2EPB A;  2IL8 A;  5J39 A;  1G6Z A;  1DM0 B;  3S15 B;  2OEO A;  1LTR D;  1A2U A;  3J7A F;  2L9H A;  4KN7 C;  2L12 A;  3PO2 B;  4HCE A;  3QB3 A;  2AQ1 B;  3VYU A;  4G7O C;  1KAA A;  4LK1 C;  3S1N B;  5FLX L;  1HHV A;  4BY7 B;  5I6Y A;  3ND8 A;  1VF5 C;  2JE6 I;  2F0Q A;  3MEH A;  3K5N A;  5KNB A;  1XWE A;  1KLU D;  3DMU A;  3O13 A;  1F2Y A;  5K5P A;  3ONA B;  1TS3 A;  2JYO A;  5JOB A;  2KEC A;  2EJM A;  4QMG A;  2XSC A;  5E4W C;  4X3S A;  4F87 A;  3S1Q B;  1PMR A;  1UEA B;  3DEO A;  5DAU A;  1A6X A;  4FNF A;  2EYJ A;  5LL6 S;  5C44 B;  4KI0 A;  1FGB D;  3NBI A;  2WKD A;  3PUW A;  2DY7 A;  5CV8 A;  4C3I G;  4KHV A;  1EEF D;  4OGQ C;  5C6A A;  4K8J A;  4C3J B;  4KY7 A;  3HRZ C;  5EKK A;  1FNW A;  4DGZ A;  1F2Z A;  1OXT A;  1Z6H A;  1I4P A;  3FDT A;  4G7Z C;  3NUC A;  2JEB I;  3X3N A;  1I4Q A;  2A73 B;  3A55 A;  1DD2 A;  3BVZ A;  2K5Q A;  4A3G B;  3D4D A;  2A6H D;  1ICW A;  4XQN A;  3KLR A;  3H94 A;  4ZK9 B;  5EQ0 A;  1WTV A;  2ZXR A;  4LMQ D;  3I70 A;  1QG7 A;  4EGV A;  3PUY A;  2E2H B;  2IX3 A;  1ILP A;  3P75 A;  3TP6 A;  1G2T A;  2MHV A;  4QUF A;  2G9H D;  1WCM B;  3C1F A;  4E6I A;  1SAP A;  2L11 A;  5A2Q L;  4I7Z C;  2B2W A;  3D31 A;  1D6E C;  2Z8L A;  3VYS A;  4DA2 A;  5JVG 3;  5EJW A;  2R6G A;  4RAU C;  3H6M A;  1EL0 A;  5C0X H;  4H13 C;  1ZXT A;  4S3S A;  5C4X B;  2EDG A;  1U4M A;  5FK9 C;  4BY1 B;  4X3T A;  1GUN A;  4NKL A;  1QJO A;  2PZT A;  2BOS A;  1SYF A;  1I4X A;  1AN8 A;  3W3A A;  4H44 C;  2F0S A;  5KYI A;  1DOL A;  3MAQ A;  3M4Y A;  2BE5 D;  5K36 H;  2D2C C;  5EKL A;  2IW3 A;  4C1N I;  4K6D A;  1LTT D;  3J80 E;  4QIW B;  1Q1E A;  2JSO A;  3NTK A;  1PTO C;  2EYL A;  1SBB B;  5ELC A;  3A8K E;  3I91 A;  3GTO B;  4HMJ A;  5M3M B;  2K5D A;  3MC0 B;  4KHZ A;  3S1R B;  3KBX A;  4ZRZ A;  1JR0 D;  1EZ8 A;  1I4G A;  5C5M A;  3GTQ B;  4IUN A;  1LO5 D;  2EJG C;  3C46 A;  1J9O A;  2ZT9 C;  4FXK C;  5C3E B;  2IX0 A;  1TII D;  4XT1 B;  2WP8 J;  4M1U B;  5D65 A;  2EVB A;  1B1Z A;  2F4I A;  3CKI B;  4U68 A;  2F0M A;  5FLX E;  4NDX A;  2PYK A;  3V05 A;  4RWS C;  1KTK A;  1LTS D;  4XQJ A;  4A3M B;  1BDO A;  2E75 C;  1R9T B;  1EY6 A;  3FKI B;  1A3T A;  3HS0 C;  3TZU A;  5G3L D;  1V43 A;  4IUU A;  4MN3 A;  1DZ1 A;  1LTB D;  3K6O A;  2LY7 A;  2F0H A;  1II3 A;  1GOZ A;  2NVX B;  1DOM A;  1VF7 A;  1DYQ A;  1K8M A;  1WTX A;  4B08 A;  3HP3 A;  1L0X B;  4IFD J;  5CV4 A;  1AP0 A;  3KBG A;  3JAM L;  2SEB D;  4A3K B;  4V0B A;  4C3H B;  3VR6 A;  4XQQ A;  1BCP C;  3W2D A;  4XDX A;  4DK1 A;  1LAB A;  1S5D D;  4KD3 A;  4PMC A;  3FMC A;  4IFD I;  2SOB A;  4QCL A;  2WII B;  3K5L A;  4RFB A;  5M5W B;  4KK7 A;  1CFM A;  5I9P A;  3BZD B;  1PTO B;  5JAV A;  4MIU A;  1VDZ A;  1TWC B;  1SEB D;  3S17 B;  4M8A A;  1XXG A;  4KJO A;  1KAB A;  4KKT A;  4BWG B;  1EY4 A;  1SSO A;  4ZUI A;  3KLS A;  3AB9 A;  2B8F A;  2JA8 B;  1RHP A;  3MFG A;  4CJ1 B;  4HAE A;  1FR3 A;  5A2Q E;  5FKA C;  4A3I B;  4P2C B;  1EIH A;  1C48 A;  1BUV T;  2C5C A;  1KLG D;  2FMC A;  1ET6 A;  4K2L A;  2I07 B;  2PZW A;  2R61 A;  1HRJ A;  1HUN A;  3TP7 A;  5FO9 B;  4K14 A;  2E76 C;  3BYY B;  1SYD A;  1SYC A;  1Q12 A;  2VUM B;  3VYR A;  3CQZ B;  1QWY A;  2DNC A;  1D5Z C;  3FRP B;  1EY5 A;  1EYC A;  2A74 C;  3OSO A;  1BR9 A;  1BF4 A;  5ELB A;  1B3A A;  2Z1C A;  1SYG A;  1EQT A;  1CHP D;  1KDA A;  4J1M A;  2ID0 A;  3P7J A;  5C4H A;  4F7X A;  1G2S A;  2QIL A;  2BA1 A;  1EOT A;  2R92 B;  2MUY A;  1NAP A;  4A3D B;  1SJH D;  4OHJ A;  5TSS A;  3OWF A;  2EYM A;  4QB4 A;  1IW7 C;  2L5T A;  3OPO A;  2PW5 A;  2PO4 A;  1V8Q A;  1Y1W B;  2K5W A;  1JOR A;  1HA6 A;  3PMF A;  5A35 A;  2VB2 X;  4QF4 A;  1BCP D;  1VMC A;  1XYI A;  4XIG S;  3MXN A;  4RH6 A;  1AW7 A;  3I4N B;  2B2T A;  2KQ3 A;  1H9S A;  2K1B A;  2K32 A;  2KVM A;  4JK1 C;  2F0T A;  1GJX A;  3KF8 A;  4C3J G;  4RHS A;  3OMG A;  1J8I A;  3QOJ A;  4RKL A;  5M5Y B;  1H9K A;  4K5V A;  2D9U A;  4KMU C;  1XX8 A;  5EKI A;  5EPL A;  1R4P B;  1PFM A;  4ZKB B;  1CM9 A;  1QE6 A;  3N52 A;  2XNA C;  3TSS A;  3E5S A;  2A68 C;  4RGT A;  3M7N A;  1Q8I A;  3MXU A;  3DWP A;  3A7L A;  1D2B A;  3R93 A;  1SE4 A;  3I73 A;  5T1G A;  3NTH A;  4K5W A;  3U9O A;  2F0W A;  2XIW A;  3E6Z X;  5JPN C;  1H9S B;  2O2L D;  1ONL A;  3IAY A;  4BA1 I;  1A3V A;  3HOX B;  1JIC A;  1VMP A;  2K7V A;  2SNM A;  1SNC A;  3L7Z C;  2EYF A;  1TU2 B;  2H1E A;  2QDB A;  3K0Y A;  1ENC A;  3HOW B;  1EU4 A;  2EY5 A;  4CJ0 B;  3NE5 B;  1TT2 A;  3GQB A;  2NBF A;  4G57 A;  2IX1 A;  1X32 A;  1PFN A;  1WTQ A;  3S2H B;  3U9S A;  1X3P A;  1IW7 D;  1LV9 A;  1T5X D;  5KND A;  4Y7N B;  2JA5 B;  4KV6 A;  1NCV A;  3TP8 A;  4DNR B;  2G9D A;  4L8J A;  2B2U C;  3Q22 A;  3H0G B;  5E3F A;  2XWJ B;  3SK5 A;  3QIA A;  1EY7 A;  4XTC S;  2E2J B;  2FHT A;  1V1O A;  1OXX K;  3AMU A;  4UDU C;  3LX0 A;  4R8N A;  1U9R A;  3RMH A;  4FF2 A;  4HTH A;  2X6L A;  2ICI A;  1R4Q B;  4RCN A;  2QF7 A;  3K57 A;  4IFD G;  5KEE A;  1E2V A;  4WRD A;  1JWU D;  1D5X C;  2EYH A;  4XXE A;  2AWN A;  3T51 B;  2HUG A;  1EU3 A;  2JA6 B;  3M4O B;  3TBI B;  2A68 D;  2RA4 A;  1S5B D;  2IJ0 A;  3NPP A;  4IAL A;  1O7Y A;  3QWN A;  3RUZ A;  1IYV A;  1C4Q A;  1PDQ A;  2B2W C;  3LWE A;  1B9M A;  1A2T A;  1MSH A;  2B2U A;  1WD1 A;  3KLS X;  1TS2 A;  1BCP F;  4DAY A;  1Q1B A;  3VYT A;  3L3O C;  4ZQ3 A;  1CZW A;  1Z7T A;  5KNC A;  3X3M A;  5CV6 A;  2BDO A;  3C3L A;  2F0I A;  2A5H A;  3PIP 3;  3QG1 A;  2F0D A;  3S9W A;  1BO0 A;  1NR2 A;  2F0G A;  4KKS A;  1ILQ A;  5ELE A;  1O78 A;  1STY A;  2WAQ B;  3URY A;  4IUV A;  5CMD A;  1O80 A;  1Y69 U;  2F0E A;  1C8C A;  1WD0 A;  5M9O A;  3P1H A;  3MXG A;  1LT4 D;  1JCK B;  3Q24 A;  1E0B A;  1EWH A;  4ZKC B;  1SYE A;  2ZXO A;  2EY2 A;  3SR1 A;  3S16 B;  3RZO B;  2L0C A;  1EQV A;  2EY6 A;  1S4Z A;  5IIF A;  2A69 C;  2Z4H A;  1A15 A;  1JQY D;  1RTN A;  1B4O A;  1W6K A;  2EY1 A;  2VB3 X;  3CRK C;  3NWS A;  4X3K A;  4FXD A;  1BXT A;  1H9M A;  2FMM A;  1NSN S;  3K5M A;  1HFN A;  3J81 L;  3K59 A;  3M85 A;  3R3O A;  5DNF A;  1KNE A;  2FJ2 A;  4PV1 C;  2XN9 C;  1B2T A;  5FOB B;  1X3Q A;  1ZYR C;  3SK6 A;  4IUT A;  2F0K A;  1TKW B;  3OIP A;  3EQL C;  3K58 A;  3GO5 A;  2NVQ B;  1STA A;  2HDM A;  1STN A;  4K8I A;  1QB5 D;  1EY8 A;  5CBE E;  2J7Z A;  1DOK A;  3PUV A;  5IGE A;  2AUJ D;  2MP1 A;  4WOR A;  1LT6 D;  3QOL A;  2CHB D;  2B2Y C;  3C1E A;  3D3R A;  5DM6 3;  2AQ2 B;  2WB1 B;  2MGS A;  1QIL A;  2O5J C;  1RDP D;  1ESF A;  1DJR D;  3AU7 A;  2PW7 A;  2NWG A;  2EXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...