1F2ZA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVAAPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
molecule keywords STAPHYLOCOCCAL NUCLEASE
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2zA00
4EVOA 3MHBA 5KYLA 3QOLA 3T13A 4F8MA 2F0QA 1EY8A 5C6AA 4DU9A 2F0VA 1A2TA 1STAA 1SNOA 2F0KA 1NSNS 3D4WA 1SYCA 1SYBA 1II3A 1ENCA 4K14A 4ME5A 4PMBA 1A3VA 2EYLA 5EGTA 3MZ5A 2KHSA 4I65A 1JOKA 3V2TA 2EYJA 3U9OA 5C5LA 3T16A 2PW7A 3QB3A 4K2LA 5C3WA 3D4DA 5J1ZA 1F2YA 3OMCA 1A3TA 4ZQ3A 5KIXA 3H6MA 4K5WA 4ZUIA 1KDAA 2EYOA 2EY5A 5F2DA 5C4ZA 2EY6A 2F0TA 1KDBA 2HQEA 2OF1A 2SOBA 3R3OA 3NXWA 4IALA 4R8NA 5JAVA 1JOOA 1STYA 4TRDA 5E3FA 5I6WA 4RKBA 3QOJA 1STHA 1EYDA 3BDCA 4NMZA 3VA5A 1F2MA 3TMEA 1SNCA 2PW5A 5KGUA 4KTAA 1SNPA 5NUCA 5HURA 1NUCA 4B9XA 1SNMA 3NP8A 4HMIA 3HEJA 1IHZA 2EY1A 4H7BA 5IGCA 1EY5A 4J1MA 4G57A 4KY6A 5KYIA 4QB4A 5IGBA 4EQPA 2RBMA 2RKSA 3MVVA 5CV7A 2F0EA 5EKLA 4PMCA 5CGKA 5IGGA 2F0LA 3NUCA 3C1FA 1AEXA 3SK5A 2ENBA 2PZUA 5KRUA 5M9OA 5HGTA 1SNQA 2F0WA 4KJNA 3TP7A 1A3UA 1KDCA 4K6DA 5I9OA 3OWFA 3TP8A 2F0GA 3BDLA 3D8GA 3E5SA 3NHHA 4HMJA 4ID6A 4DF7A 5E1FA 5JOBA 1TT2A 3EJIA 3OMGA 3PMFA 5CV6A 3HZXA 1STNA 4NDXA 4YIJA 2F3VA 3D6CA 5I9PA 2EYPA 1STGA 3SHLA 5J39A 5CV9A 2F0UA 1F2ZA 2F0IA 4QMGA 1EYAA 1SNDA 2M00A 5CV4A 5I6YA 3SXHA 4F7XA 2EXZA 4NP5A 4WORA 5C5MA 4K2KA 2OXPA 1EY7A 2KQ3A 2OEOA 4WRDA 1EY0A 2EYMA 5DAUA 4J6HA 3NQTA 1KAAA 2LKVA 4ZUJA 1TQOA 2EY2A 3ERQA 4KV6A 1SYDA 3OSOA 1EQVA 1U9RA 1A2UA 2PQEA 5IGEA 5K5PA 5ISRA 1RKNA 1TR5A 2SNSA 4IUNA 3ITPA 2SNMA 3EVQA 4QF4A 5C4HA 5C3XA 3MEHA 2EYHA 5EKKA 1EY4A 3LX0A 5KEEA 3P1HA 1EY9A 4IZ8A 5IGDA 2F0HA 1SYEA 4NKLA 1STBA 2F0JA 2F0PA 4E6IA 1EZ8A 4K5XA 2F0SA 3DMUA 1ENAA 2F0MA 4K8JA 5CV5A 4KJOA 4N9TA 3RUZA 4KD4A 4DGZA 5IIFA 4KHVA 3SK8A 3TP6A 1EY6A 5DEHA 2QDBA 4KD3A 4RKLA 4DFAA 3SK6A 3C1EA 1EYCA 4S3SA 2F0DA 2F3WA 2WACA 4K5VA 4PNYA 2O4XA 4LAAA 4MIUA 4B9WA 2EYFA 4K8IA 1JOQA 5J22A 2NUCA 5IODA 2F0NA 3S9WA 2F0FA 5CR3A 5IOCA 2PZTA 2PZWA 1SYGA 3DHQA 2F0OA 3SR1A 5IGFA 1KABA 4KY7A 4OL7A 3P75A 2RDFA 3EROA 3NK9A 2PYKA 5CV8A 4EQNA 4EQOA 1JORA 4ODGA 1EZ6A 3SK4A 1SYFA 4KY5A 3MXPA 4N9PA 3TP5A 5CC4A 4HTHA
chains in the Genus database with same CATH superfamily
1BOSA 4BWGB 3CMEA 4X3SA 4DR6L 4NXML 2ATWA 4JI4Q 4LF5Q 2ZXRA 1K0SA 1KAWA 4K14A 1HNZL 3GTKH 1HJPA 4A3MG 2K32A 2ASBA 3F2BA 4LFBQ 4GOPA 2K5NA 3QB3A 3KYHC 2R92H 3PCOB 4DV0L 1C7YA 2NVXH 4CKCA 2UUAL 2A5HA 1BF4A 2Q2UA 3HP3A 1PH7A 3BDCA 1MI2A 4V190 1PV4A 4QGUA 1YNJC 5IYDG 5KGUA 4DUYQ 1NUCA 1PRTC 1I4PA 4RGOS 4A3LG 1TS2A 2NVTB 4OO1H 1BDOA 4H0LC 3I8ZA 4DNIA 4NW2A 5CV7A 5IGGA 3R2IA 1LTLA 2R7ZB 5HGTA 1XPOA 2XTIA 3C46A 1QUQB 1BCPD 1UE5A 5KNDA 1DD2A 1JJ2A 3FP9A 5JOBA 1N8RC 3JAML 1N36L 4PZ6A 2F0IA 2EE1A 4QMGA 1PH5A 2EXZA 5I2YA 2E75C 4P71A 1A8VA 4YHHQ 4NXNL 1SR3A 4A3FG 2RCNA 2E2JH 1KD1C 3HOUG 3UDIA 5AJ3L 2PQEA 5K5PA 1JMCA 1I6HB 3T4AC 1YHAA 3IRBA 1X32A 4X64L 1R4PB 2JA5B 1PFMA 2E5LQ 5G3LD 2PI2A 3D0FA 3I4MG 1OTCA 3HOZH 2NVYB 1EFWA 1UEAB 4C2MB 1IKLA 3IL8A 4IUVA 3GV6A 4LFAQ 1C48A 4DUZQ 3SK6A 1S5FD 2WV6D 5FLXL 5M5YH 2WACA 1KC8C 1WFQA 2L0CA 2LS01 5EBCA 5FO9B 4FO2A 1KABA 1CSPA 2XWBB 4HIOA 2RDFA 2DNEA 5E4WC 3S1NH 4XT1B 1JORA 1VF5C 1EIYB 4KY5A 5ELNA 5E1FA 1D8LA 4IURA 5KYLA 3CCEA 3NEMA 1Q12A 4Y52H 3DEOA 1VQNA 1HPCA 4MN3A 4XYQA 1A3VA 3MZ5A 1EWHA 3GTLB 1BBXC 1VQ9A 5IYBH 1VQMA 3WWVA 1EU3A 1Y1WB 1KLUD 5CMDA 4M1UB 3PUWA 4PG3A 1YJWA 4DR2L 4A3IB 3T1YQ 4H44C 1SSOA 1SE8A 1B3AA 1VMPA 2J7ZA 3VR3A 5C44G 2O5IC 2UXBL 3VA5A 3TMEA 5KNCA 2KCTA 3JC66 3D3RA 1AP0A 3GTGH 3CCVA 3HOWG 4X62L 5CORA 4J1MA 2HIVA 1JWUD 3RLNA 5H1SE 4HCEA 4GN4B 1PXUA 1SROA 1QB5D 3HOVB 2QEXA 1MBYA 2PZUA 1N33Q 1WTPA 1QNKA 1A3UA 1E2VA 3D8GA 3BDLA 2MJ8A 4A76A 3F8TA 4A3EG 3QR8A 3M3YB 1B1ZA 2CKZB 4BBSG 1QG7A 1YBYA 3DUZA 3SHLA 2QDLA 2QKIC 3J81L 3S1MB 2RCFA 1EYAA 1F77A 1SNDA 1PMRA 2IX3A 3F2CA 2K75A 3I91A 4MTKA 4YY3Q 4HR7B 3HOXG 3L2PA 1B7YB 1A0IA 2JA8H 4K0KQ 1DZ1A 1T5EA 1AH9A 5J3BA 2PNRC 3OWEB 3EQLC 5IP7H 1Q7YC 5T1IA 2Y0SE 3KOJA 4IZ8A 1SYEA 2WB1B 4CHTB 2F0JA 2GVBA 4CDCC 1TY0A 2A6EC 4OGQC 1ENAA 3M4YA 4QL5A 4O42A 2K14A 4IFDG 2I5MX 1CQFA 2K50A 2QDBA 4RGTA 1G2TA 4A3KB 3S15H 1KTKA 2O4XA 4LAAA 4B9WA 4BBRG 1HNXL 5M3FH 4DK1A 3E3XA 3T1HQ 1Q81C 1AW7A 3J7A5 4JI1L 2A6HC 2D0PA 4L5QA 4YHHL 4ODGA 1CSQA 3U58A 3HKZB 3MXPA 1W6KA 3PUVA 2B2YA 4A3GB 3CQZB 2JEBI 1LM0A 5GROA 4ABNA 2R6GA 3CC4A 3CP0A 1ENCA 1KRSA 3E9IA 3CW2C 3BYYB 3I90A 3H6MA 1FJGQ 2KCNA 2RHSB 4I7ZC 2E74C 4LFAL 4DUZL 3S1QB 3J7AV 4IALA 1V8QA 1CUKA 1DOMA 5COYA 4B3MQ 1K9MC 4RKBA 2I5HA 4Y7NH 1STHA 1LTRD 3H91A 2CQAA 2PW5A 3BZDB 2A8VA 3K80C 1IHZA 1EOVA 1YHBA 1Y8PB 2J0TD 2L9HA 1JJCB 1J5EQ 4BY7G 3HOYH 1SNQA 4JPBW 3VR6A 4NB3A 4XYOA 2YTYA 4C3JG 1K8MA 1PFNA 2EXDA 1PTOF 4JW0A 2RVLA 5FJ8H 5C4JH 5IY0A 4LF4Q 5J39A 1RDPD 1CHPD 2E2HB 1MJCA 2M00A 4A3MB 1BO0A 1YNXA 5T1GA 4K2KA 3PO3H 1KLGD 3TS0A 3BZKA 1ET9A 1D2BA 1N32L 4MTNA 4DR3L 1EQVA 1A2UA 2EDGA 3SDZA 4OXPA 3KLSX 3S2DB 2N78A 3PF5A 1EY9A 4B3TQ 1PRTB 2F0HA 1JQYD 1STBA 4C1NI 2DJFC 1HQMC 3VA7A 1C9OA 2R93G 1PZJD 2K04A 3DWPA 4GNXA 3L0OA 3GTMH 3JAMi 1L1OC 5EPKA 5M5WB 1M90C 2UUCQ 2A68C 1A6XA 1BCPF 2F3WA 1FGUA 1LTSD 5IODA 1O7LA 3S1RB 1W6JA 1XJVA 4LF7L 4N8X1 2PYKA 2JQOA 4YY3L 3E6ZX 1X3FA 4CGYB 4HSVA 1S5ED 1HTPA 4GOPC 2AUKA 4K0KL 1K8AC 2DUDA 3S16B 4BS9A 3F2UA 1F9QA 1KXLA 4GLAC 3LWUA 4A3FB 4CKBA 2E76C 3A74A 2KHIA 1GM5A 4OX9Q 3HOUB 4R1JA 2XWJB 5LMUL 4X6AH 4ME3A 1CA6A 1PH9A 4K2LA 3GTPH 2Q8TA 1ENFA 1NTGA 2KEEA 4IPDA 2HDMA 1Q46A 5C0XG 1L0XB 1SFOB 4ZUIA 2NN6G 1BBUA 5C4ZA 2EY6A 2OF1A 4KMUC 2R7ZG 3I4MB 2TSSA 1STYA 4DV3Q 3G6EA 1PTOC 5I6WA 3QOJA 4DV2L 4NMZA 3QJYA 2EPBA 1YIJA 1TS5A 1KHIA 3T1HL 2AMCB 4H7BA 4DR1Q 4TQUS 3VR4A 1EU4A 3M85A 3S2HB 3OYYA 2I0QA 2NZHA 3QWNA 5BN4A 4DAVA 1PFBA 4A93H 2Z1CA 1NAPA 3MFGA 2HDLA 4HMJA 3KBXA 1KNAA 4JVZA 2MQHA 1STNA 4JBJA 4ILWA 4YWMA 1B9NA 1U4LA 1KIXA 1O7YA 2IWHA 2OQ0A 4QIWB 2JP1A 1V1QA 4GKJQ 1HTLD 2C5CA 2KA7A 1DONA 1GUSA 2K5WA 1TS4A 3L9AX 4UY8C 1CKNA 1EEFD 2BE5C 3J80c 3KDFA 1HUNA 1D1KA 5ISRA 2E2IB 1K8OA 2CQOA 5AFWA 2SNMA 2KCMA 2HD3A 2NB0A 5C44B 1Y1VG 3EFXD 1UE7A 1TWCB 2JA7H 3HOWB 4XIGS 1Q8IA 2F0MA 2VY3A 1IYUA 4KD4A 2XRQD 2IW3A 1XWEA 3EN2A 4DFAA 4ZLTF 1NR2A 3CCSA 4L8JA 4DV5Q 3AFQA 3J81i 1EL0A 1TWGB 3BJUA 3P7JA 4A3EB 1J6QA 2D62A 4GLVB 5LL6X 4BBSB 3ZYYX 3OIQA 3PIP3 4P72A 4EQNA 3U4ZA 1EZ6A 1N34Q 1TWFB 1Z7TA 3QOLA 1XNRL 3T13A 3HOXB 1EY8A 4C3HH 3MXNB 2ZJQA 5M5XB 4FXDA 2NTSA 5EPLA 1CM9A 1WYDA 3Q22A 4UDUC 4NPSA 5M3MG 4A3JG 3OMCA 2X69A 4DV6Q 3GTQH 1IL2A 2KJXA 3HOVG 1ONLA 4M8AA 1LT5D 3NXWA 4TRDA 3PSIA 4YWKA 2RSNA 2K5QA 2OQKA 2B2TA 2WB1E 1SLJA 2Z8LA 3X3MA 4HIKA 1YEZA 3FDTA 3I72A 4G7OC 4G57A 4KY6A 4BBRB 3CRKC 3K5OA 3WOEA 4EQPA 1PH2A 4DR7Q 4ZYSA 2F0LA 4DNTB 1Q90A 4F88A 1SDFA 4HJ7A 4X3UA 3OWFA 4L5SA 5FLXE 1RHPA 4C3IB 4XTCS 4OX9L 4NDXA 3LWEA 2F3VA 4APVA 3HKZE 3I4NG 3FMCA 2EVBA 2UUBL 1I4QA 1VQ8A 1E2ZA 2FXQA 1PFSA 2NYZD 2KCCA 2JA6H 1G6PA 1CA5A 3Q8DA 1LTID 2HHHL 4PQXA 5DAUA 4HIDA 5BN3A 1SYDA 4Q0FA 4JBMA 5IP9H 1YZ6A 1ET6A 4WJ4A 1HHVA 3BZCA 2B2UA 4DR1L 3J7ZC 1YNNC 1NR4A 4TVAB 4JBKA 1H9SA 1LACA 5C4XG 1D5ZC 4E6IA 3Q23A 2PQAA 4DGZA 2JXMB 1GD7A 2EIFA 3PO2H 4HIMA 4OIJA 1IBKL 1H9KA 2IHEA 3K81C 4BY7B 4OHJA 4R4QA 1XYIA 1BKBA 4OWXB 3EBEA 4MIUA 2B2YC 4C3JB 3HS0C 1MSHA 3SR1A 4DK0A 2OWOA 4GKJL 4KY7A 2MUYA 4LFCQ 1K3RA 1YI2A 2IL8A 1VQFA 2CHBD 3NWSA 1F9SA 1G8ZD 2YV5A 3I73A 1NMGA 2HT1A 3UDXA 5IT9L 1SNOA 1II3A 4RHSA 1YITA 4B3RL 2ALYB 3T16A 4MNOA 4ZQ3A 1LLRD 2OTJA 1U4RA 4K5WA 1NE3A 4WJ3M 2EY5A 3IKJA 1VQJA 2DN8A 2C35B 1EQQA 2NVTH 3CPFA 1JOOA 2R93B 2N3SA 1WCMH 1F2MA 1IYVA 1SNPA 1L1OB 2M2LA 3PIOA 1FNWA 3MXUA 4U673 2NWGA 3PUYA 4KJNA 4FF3A 4HJ8A 3NHHA 4GOPB 2Q8IB 3CC2A 4J15A 1OO9B 3HFZB 1MGSA 2PO4A 3N6RA 1F2ZA 1I6HH 2F4VL 5I6YA 2HIXA 4P2CB 4DV6L 1S5CD 2DJGC 3GQBA 5IWAQ 1GHJA 2JA5H 3AFPA 2NZOA 2KQ3A 4DV1L 2R3ZA 1ML0D 2AUJD 1LT3D 2NVYH 2SEBD 3X3NA 1PYBA 4KHPL 4L6TB 4UP8A 1XMQQ 1B53A 4C2MH 1PZID 4GNXC 2FMCA 1PTOB 3EVQA 2RF4A 3NTIA 1EY4A 1CZGA 1DJRD 5EPJA 3KF6A 5BN5A 4DR7L 4DV4L 3LNNA 4K5XA 2JYOA 3MA2B 2EZVA 4RKLA 2XRSD 3TEHB 3C2PA 3H3VC 3GV3A 4PNYA 2EYFA 4BY1G 1WVLA 4F87A 2BA0A 5HY6A 4FF2A 3J7YW 1RODA 1GO3E 3EROA 3NK9A 1Q1BA 1E0BA 1K83B 2A73B 2B3GA 1Y1WH 3RLFA 2QILA 1VQLA 4R4OA 1WD0A 2NBFA 4QIWE 1I94L 1BR9A 4A3IH 4FDBA 5LL6S 3TZDA 2YU9H 1L0WA 1E2WA 2KHSA 2KUMA 5C3EH 2YTXA 2N88A 2LFNA 1IBML 2WP8J 1EQRA 2JSOA 3FPUB 1U0LA 5KIXA 1YJNA 4KN4C 1Y1VB 1HQRD 2XSCA 4K6LA 2Z4HA 1E22A 1QVCA 2Q2IA 2I07B 2VB2X 1VMCA 2R7FA 4DA2A 1VQ6A 5ELFA 3NELA 1EYDA 2PCFB 3GP7A 5NUCA 1HZ9A 3MTSA 3M3YH 1TKWB 3TBIB 5IYCH 4EGVA 1SMYD 4LFCL 3T53B 1ASZA 4KKUA 1VQ7A 4A3DG 2K03A 2PNHA 3G6JB 3S1MH 4KKTA 3PMFA 1ZYRD 2FMMA 4LUOA 2WAQG 2EYPA 4CDDC 2MHVA 1ZEQX 4AQYL 4JCVE 3SXHA 4L5TA 4DR5L 2B63G 2IT1A 5M3MB 5FLMG 4IPHA 4A3JB 4POGA 3BVMA 3HOZB 4LJZC 2CW0D 1PDQA 4IN3A 1STEA 5FOBB 5BR8Q 4QCLA 1GXDC 1HUMA 3S17H 3BG3A 4JI4L 1NBWA 3J80L 4LF5L 3KLRA 3K5LA 4A3KH 4BXXG 4A3CG 5JEAG 4ZKBB 1QZGA 3VYSA 4LFBL 3CC7A 4QUFA 4DV7Q 3K58A 2A19A 2OTLA 1X54A 4S3SA 1QCBD 2BDNA 2ZTEA 2LXKA 5FK9C 4A3GH 3CQZH 1WTQA 4DUYL 3RZDB 3M9BA 4B3SQ 1FYCA 2NTTA 2KBNA 4Q5VA 2L11A 1ZXTA 2I5LX 3I4NB 4KK7A 4IOAA 1H9MA 1VQDA 3L3OC 3M4PA 3OW7A 3FVQA 1RD9D 5D3DA 4JOIA 4B08A 4IOCA 4UAIA 1C8CA 3TS2A 3STBC 2VQEQ 4AYBG 1NSNS 3NBIA 2CH4A 3KK7A 4O0AA 1UE6A 5CYUA 1AE3A 5DM63 1B4OA 5I2XA 4I65A 1HNWQ 2L55A 2B2TC 3K7AH 3CCUA 1I4HA 1RIPA 4IUPA 2BOSA 2X6GA 5F2DA 1UWVA 2HQEA 5C4XB 5EKIA 4Z9CB 3MAQA 5JVH3 2ZXPA 1D1IA 3U9SA 4C3IG 3BYTB 4JI7Q 1SNMA 4HMIA 5EQ0A 1I50B 2EJGC 2EY1A 1IL8A 3H09A 2BH2A 2VUMG 5EAYA 1QVGA 2E5LL 4H13C 3PUXA 1AEXA 2E2HH 1N9WA 1VQIA 3B6YA 2VL6A 4G4KA 4A3MH 5I9OA 3TSSA 3E5SA 4ID6A 1CTMA 2DNCA 3KLWA 1UNSA 3CPWA 1A63A 5L37A 2UXDQ 1G291 2QCPX 2B2UC 1I3QH 5LMNQ 2Z6BA 3MWYW 5IYDH 4YCUA 2OEOA 1GUNA 4LF8Q 4HJ9A 5K36G 1TQOA 1HZCA 4A3LH 2A69C 1FL0A 5GAHC 2R7DA 4ULLA 1XMOQ 2F03A 3ITPA 5DLQE 1Y8NB 4A3BG 5C3XA 5M5WH 3PQIA 2YTVA 2B8FA 1XNQQ 3CAMA 1V1OA 2H5XA 2ICIA 1IW7C 5A2QE 2QF7A 3S1RH 1YNJD 1SE2A 1V1PA 1X65A 1PRTD 3A8JE 4GN3B 2OCEA 4RGNA 3H0GG 3K59A 3T1YL 1VCIA 4GKKQ 3S16H 4C1NK 3NBHA 4A4IA 2PZTA 2ZT9C 4A3FH 4OIKA 4C56C 2EQSA 3IFTA 1LUZA 1TIID 3HOUH 3G7LA 2K7VA 4DK6C 1I4XA 3RZOB 4JI8Q 1N33L 1E3PA 4MZ9A 3KBGA 5LHY1 3K57A 3D4WA 2WKDA 1SYCA 3FHWA 2MNAA 3I4MH 2VS1A 1GUOA 3GTOB 4AH6A 5FO8B 4Y7NB 4XXEA 1I4RA 3NWTA 4DAYA 5GADC 4JI2Q 4GNXB 2V1CC 1A3TA 2HUGA 4DV7L 4EQ5A 4DAYB 1KDAA 1TWHB 1KDBA 3K0YA 1X9NA 2MO0A 3S2HH 2JEAI 1CHQD 3PUZA 1GUGA 1TXYA 2VW9A 3IAYA 1I5FA 4O1NA 4N8FA 1LT4D 2G9HD 2QEJC 4B3SL 1HFGA 2DY8A 2D5DA 2F3IA 5C4JB 4BY1B 2CCZA 2JJQA 2JA9A 4PMCA 3FKIB 3C1FA 3NUCA 3U4VA 1K73C 1JWMD 4K6DA 1G2SA 3O13A 2F0GA 3ND8A 5G3LF 2VQEL 1VQEA 3CD6A 3PO3B 2M9VA 4X66Q 1SE4A 4YIJA 3VYRA 2ICEC 1ESFA 1HR0Q 5FLXc 2E2IH 1VS0A 3C3LA 3MC0B 3QO2A 5C44H 2YYZA 2PI2E 4IFDI 1TWCH 4POFA 2VZAA 2ZTCA 4J6HA 2LKVA 3EIVA 3HOWH 1S5DD 5IT9E 2NVQB 1Z47A 1LYLA 4JI7L 3KJPA 2SDFA 1RKNA 4IUNA 3K0XA 3TQYA 3NQIA 2AKWB 2ZTDA 3ERSX 4O2DA 1TWGH 3OHXC 1EZ8A 4A3EH 1IXRA 1TS3A 4IFDJ 1HH2P 1HXYD 3KFUA 4BBSH 3RLOA 2VB3X 3TN2A 1FJGL 1IBLQ 2R92G 4A3DB 1DM0B 2AQ3B 1TWAB 4B3ML 1HZAA 1BCPC 1K0RA 2NZ1D 4FXGC 2F0NA 5FKAC 4LF9Q 3HOXH 3I2ZA 1VQKA 5M5XH 5ELCA 1CKNB 2WAQB 5LMNL 3KDFB 4EQOA 1PH6A 1VQAA 1H95A 5EKKA 1O7ZA 4JV5Q 4OO1G 1AE2A 1PA6A 2B63B 4JI3Q 2RHQB 1QWYA 1J5EL 3CU7A 3J80i 2IY5B 4JG2A 1XMOL 1QE6A 1DOKA 5E7NA 2EYLA 3NENA 5ELDA 4IFDH 5HGQA 5C5LA 3E0JA 1X3EA 1XNQL 4LF4L 1F2YA 3UDFA 1X55A 1RL2A 1DXMA 4RGMA 2WKCA 2SOBA 4KLKA 4BBRH 1EUJA 4IPCA 5GQOA 3N52A 1SNCA 5HURA 3PV0A 3TRZA 1PYWD 2A6ED 2K33A 3HEJA 3KF8A 2HQLA 1MKHA 4R9WA 3FPPA 4DXFA 3JAME 2K05A 1X3PA 4B3TL 2AHOB 5JPNC 3ONAB 1JICA 4DR6Q 2F0WA 2PPBC 4WFN3 3TP8A 1R9TB 3VYUA 3ULJA 3HOZG 4JI5Q 3M7GA 1VQPA 3EJIA 2LMCB 1SXTA 3H15A 2A6HD 1CI3M 2UUCL 1SMXA 1XPUA 3IFDA 2GN5A 1PYSB 4PV1C 2L12A 2E2DC 4DV0Q 4AYBB 2CH4W 4RMFA 2UUAQ 2F52A 1FGBD 2Z6KA 5C5MA 1HZBA 2VQFQ 4WRDA 1H9JA 2LSSA 1ICWA 1T9HA 1MHWC 4ZCKA 1JB7A 4IJHA 3ERQA 4R4TA 2KHJA 2VXWA 3P20A 1OXTA 1TR5A 1AZPA 1Q82C 2P5ZX 4JK1C 3A7AB 1F9PA 4BY7H 5KEEA 3K8AA 1D5MC 1CFMA 1HA6A 2D0OA 5D3IB 3GDEA 2KVMA 4KJOA 4N9TA 4C3JH 4DN4M 3Q0AA 2VUMB 2X6LA 5IYBG 5GAGC 1UUPA 1S4ZA 4JI0Q 2F0DA 1N36Q 2K6AA 1CKMA 2JE6I 4K5VA 4DV3L 2B29A 4ZAIA 1KRTA 3CKIB 4K8IA 4UP7A 1CQVA 4JOIC 4C3HB 1SYGA 5IGFA 3P75A 5EJWA 5C0XI 1OXUA 2NN6I 3A55A 4IUUA 2J4XA 3DWQA 1VQBA 3MXGA 4HAEA 3Q6SA 4G7HC 2KEDA 2F0QA 1AZQA 4DU9A 1H9SB 1SJHD 3VDYA 2QGQA 1BUVT 1B2TA 1SYBA 5KNBA 3M4OB 2PQAB 3I4OA 2R93H 2PW7A 5CBEE 4A3BB 1IYJB 5C0XJ 2EYOA 3KJOA 2K01A 4UHVA 2F0TA 3R3OA 4RHRA 4X3TA 2B2WA 1WTXA 2D9UA 4LK1C 1PRTF 3SVMA 4GS3A 4KTAA 4QQBX 3BS1A 3DWAA 3H0GB 4DPGA 2JA8G 3GTJB 1E24A 1Z6HA 2DGYA 1EIGA 2Z0SA 3UE0A 4CJ0B 5IP7G 3J81E 2A68D 4JV5L 2ENBA 4A75A 3S14B 4JI3L 1SEBD 1NJIC 3VR2A 1TT2A 3OMGA 4FYDA 4ALPA 1W3SA 3SGIA 5C0XH 4U68A 1TU2B 4DV5L 2ZM6Q 2NN6H 1STGA 1NCVA 3ULPA 2R7ZH 3PGZA 4DR2Q 1PTOH 4NP5A 1MJEA 5M3FG 1J8IA 2N49A 1GVPA 1EY7A 2BA1A 2FJ2A 3NQTA 1Q1EA 4XQNA 4HEDA 1N34L 4IQZA 2ZXOA 4X62Q 3NTHA 3BVZA 2FINB 1U4MA 2SNSA 1SAPA 3CCQA 1P16A 4QF4A 1YVCA 3RN5A 2UXCQ 1UAPA 4J8QA 2RSOA 3R8BA 3AQQA 3S24A 1PTOD 1JT8A 2LY7A 1VQHA 4FP5D 4KHVA 3SK8A 3GO5A 3FEWX 1EY6A 5DEHA 4JI5L 3SEBA 1IZ6A 1PVOA 3HG9A 4LWCA 1M1KC 1K83H 1JOQA 1E7ZA 3W1BA 1EWCA 5IOCA 1M4VA 4TSSA 2VQFL 3UE1A 3SK4A 1Q8KA 2F4IA 3DEPA 3TDQA 1NY4A 1QVFA 1Y1VH 3KF6B 3UI2A 5C6AA 2MFIA 3E0EA 1A2TA 1M8AA 1G51A 3HOYG 1HRJA 1QUQA 1WCMB 2GVAA 1SE3A 5J1ZA 5FJ8G 4H02A 4HJ5A 1UEBA 2BE5D 2KENA 4V0BA 4LUZA 3FKIG 3GTKB 1PH3A 3I4LA 3KUPA 4JI0L 2QW7A 1HNXQ 1X6OA 4GN5A 3GTLH 3J7AF 3PO3G 4GLXA 2R92B 3TZUA 1VQ4A 1WTHA 4JI1Q 3DLLA 2NVXB 2TMPA 3Q24A 1JJGA 4GZYC 4DNRB 1BCPB 4QB4A 5D14A 2F0EA 3SK5A 2BH8A 3ER0A 3TP7A 2K28A 1D5XC 4DF7A 5M3MH 4A3JH 1S40A 2WAQE 1SJED 5DM73 3NPPA 1KQSA 3D6CA 3A8KE 1E1OA 3HOVH 5CV9A 4DXGA 1GHKA 1XPRA 5CBAE 2D2CC 4WJWA 1U5KA 2OXPA 4XT3B 2EYMA 1D6EC 1CT1D 3RR5A 4ZUJA 1HCZA 3EA6A 2CWPA 2BDOA 2B2VA 1S5BD 1XXGA 3I7FA 1Y69U 1BVSA 5C4HA 1DGSA 3BDOA 3I70A 3F2DA 3OOCA 2E2JB 1BQQT 4LUVA 1P8LA 3RZDH 1VQGA 3A8IE 4KD3A 3WDNA 3A0JA 3I4NH 4KN7C 1AN8A 1A15A 3AMUA 1BXTA 2ZM6L 2NUCA 3S9WA 1JCKB 4IPGA 2F0FA 2XNAC 4UPAA 5CR3A 1ILQA 4OL7A 5GAEC 4L63B 4RWSC 2YU9B 3G71A 4YCVA 3ICEA 5C3EB 2EJFC 3TP5A 2B8GA 4XDXA 5CC4A 4DR3Q 1N32Q 5M5YB 1QOHA 4I7AA 5JJKA 5JJLA 4AYBE 1MSGA 5C4XH 4A93G 1X56A 3S1NB 1CKOA 3PF4A 2UXCL 3D31A 1WTWA 3V2TA 2FHTA 5DNFA 1YJ9A 1AFPA 1DCZA 1I50H 2E8GA 1ILPA 4JC0A 4ZKCB 5IWAL 4OWWB 3R93A 3DXJC 3E9HA 2RA4A 4HCSA 1YNND 2IX0A 3OTOQ 3HGBA 1EIFA 4LW1A 1PHJA 2UU9Q 4DR4Q 4LF7Q 4IUTA 3RMHA 2HCCA 1XMQL 4RAUC 1EY5A 1JWSD 1V43A 4QJFA 3S1QH 1JE5A 4OEMB 4X3KA 3MVVA 1DYQA 5EKLA 5M9OA 1WTVA 1RF2D 5LMNW 3GTGB 4DAPA 2JA7G 3QIAA 2Z6KC 4KKSA 4G7ZC 4DK3C 5LMUQ 3A7LA 1OXVA 1MIUA 2CFMA 5ELBA 2G9DA 3S17B 2RDGA 1GKHA 3CMAA 3DM1A 1QNUA 3D4RA 3VR5A 4WORA 1B50A 1CZWA 3PIPA 5JJZA 4DV2Q 5ELOA 4BA2I 3LGJA 4DAMA 2EY2A 3H3VI 2IX1A 1EWIA 1NMFA 2XGTA 5IGEA 2MO1A 4PZ8A 2L4NA 3PIO3 2IJ0A 2Z9HA 2OT2A 4KHZA 1EEID 1F2LA 1BNZA 2PMZB 2Y0SG 3MEFA 4RH6A 1K3BC 4C3HG 5IT9c 1OXXK 4NKLA 2JA8B 2F0PA 2LXJA 3DM3A 4K8JA 3NTKA 3S2DH 2R61A 3SE0A 1VQCA 4AIMA 2I46A 3C1EA 1U4PA 4QUCA 1C4QA 3RZOH 1WJJA 2K4KA 4P75A 1QJOA 2PZWA 2N8NA 5A35A 3DHQA 1Y14B 1G91A 3GTOH 5CV8A 2AWNA 4DKAC 1UE1A 3J81j 2VNUD 3S15B 2MP1A 3K7AB 2XVSA 3T51B 2RQXA 5M3FB 1B44D 3W5OA 3CF5A 1TWHH 3A54A 1O78A 4RG1A 4PMBA 2WIIB 2B2WC 3HRZC 1XTCD 2Z4IA 2MPMA 1JOKA 1V1PB 3BVGA 3MFYA 3GD7A 2JN4A 3H3VH 1ESRA 4CKEA 1FR3A 4ZK9B 3CCMA 4BY1H 3CXCA 4MHEA 4PZ7A 3NBHB 1IKMA 5EBDA 2B39A 3FKIH 1W2BA 2JA6G 3F1ZA 1RTOA 1LTBD 4B9XA 2Q2HA 3W3AA 5BR8L 2WINB 1SFOH 5IP9G 5KYIA 1HR0W 4LMQD 3ULLA 1XNRQ 3CCLA 4OELB 3ND9A 2ZJPA 3H94A 3NSWA 1LABA 2O5JC 3JAMc 1I3QB 3PO2G 1ASYA 2K5DA 1O7IA 4HN7A 1K28A 3OIPA 2NVQH 3HOYB 1JB3A 3D6WA 2KOLA 3W1GA 4HJAA 2QA4A 1KAAA 2KECA 5D65A 4XQQA 3OTOL 1FD7D 2UU9L 2A74C 1KNEA 4DR4L 4JBWA 2EOTA 2H1EA 4FF4A 1H9RA 4A3DH 1G6ZA 5IGDA 1TWAH 3RD4A 5JEAJ 1E1TA 4FNFA 4CDEC 1JE4A 2ES2A 1HNWL 2F0SA 5CV5A 2K5VA 2N55A 3RUZA 4CDFC 3AU7A 1O80A 1Q86C 3A56A 3K5NA 4JYAQ 3K7UC 1EYCA 1WD1A 3K5MA 1SN8A 1LTAD 3AYHB 4CBVA 3M4QA 4X65Q 2B63H 1B9MA 5FLMH 2UUBQ 1FNUA 1X3GA 1WCMG 1GUWA 3GTMB 3V05A 2HHHQ 1X3QA 4ZRZA 4N9PA 4HTHA 3MHBA 4RCNA 2F1MA 4PMWA 4F8MA 1C0AA 1VF7A 2F0VA 4BXXH 4A3CH 1STAA 2F0KA 5JEAH 3AEVA 1KL9A 2EYJA 3U9OA 5JJIA 3D4DA 1TWFH 3OW2A 2EJMA 1IBKQ 1LO5D 2C9OA 2WFWA 2UXDL 1PH4A 5JAVA 2K52A 1BBWA 1I4GA 1V9PA 3V96A 1LTTD 4LF6Q 2K1BA 3ZJYC 3GTPB 4LF8L 1Q3LA 2JA5G 1VQ5A 3NP8A 3UDGA 1R9TH 3A5UA 3NE5B 2K5HA 1A62A 1S3OA 1WTOA 4KI0A 4UP9A 5IE8A 2IHFA 1GJXA 2RBMA 2RKSA 4R4CA 2HCIA 2CVRA 3A5ZB 1HA5A 1K8GA 1LT6D 1T5XD 4R4IA 1XX8A 4B3RQ 3HZXA 3J81c 1TVXA 1DOLA 3KLSA 4GKKL 1XTDA 1VDZA 2Q2TA 4A93B 1EOTA 4JI6Q 1FNVA 2B2VC 5CV4A 2ZJRA 2CWAA 4C3IH 1EFID 3CHBD 3STBD 3R2TA 1WOCA 3KF8B 2IPKD 1LTGD 4KV6A 1U9RA 4JI8L 2VUMH 4NXMQ 4HSPA 1QZHA 1VQOA 1Y1WG 4P73A 4CJ1B 1B70B 1HNZQ 4OWTB 3FRPB 1ZKOA 3HKSA 3MXNA 5TSSA 4A3IG 4JI2L 5IIFA 5C3EG 1SMYC 1EIHA 3I3CA 4YWLA 1RTNA 3I55A 1J9OA 1L0YB 2JA7B 1L2FA 1GOZA 5J22A 2F4VQ 1WI5A 3M7NA 1TY2A 2F0OA 5A2QL 1ZYRC 2RDHA 2O2LD 1Z9FA 5K36H 4L5RC 3CCJA 3M4OH 4IJLA 1PH1A 4R8IA 4DV1Q 5IYCG 4IO9A 3K6OA 3QG1A 4IUQA 4KHPQ 4EVOA 3CCRA 2GA4B 4LNQA 2AQ2B 4A3BH 4FVMA 2MGSA 3AB9A 1D7QA 4ME5A 4YCWA 3BU2A 4FXKC 5EGTA 4DV4Q 2CW0C 5I9PA 4RA8A 5C3WA 4X66L 2JK8A 4EX5A 3WOFA 1NNXA 1MD2D 1HR0L 1HFNA 3H0GH 4CJ2C 2A69D 5FO7B 4QY7A 2Y0SB 3GTJH 4R8NA 4NXNQ 4JYAL 3G48A 5E3FA 1QILA 2PMZE 1WTRA 3S14H 5AJ3Q 4X65L 5JVG3 4RFBA 3OPOA 2L15A 2WB1G 1IW7D 1GUTA 3GTQB 5IGCA 4X64Q 1B8AA 2L5TA 4BA1I 2ID0A 5I4DA 5IGBA 4OONA 5CGKA 5KRUA 2BCOA 4A3KG 2Q8RE 5ELEA 2A1AA 1JR0D 5E4XA 1KDCA 1I94Q 1B3QA 1RCVD 5CV6A 3W2DA 1IBLL 1JC7A 3RN2A 1IBMQ 2XIWA 1S72A 2XN9C 3HKZG 2F0UA 1FVIA 3J80E 2G5DA 4LF9L 3TREA 4F7XA 4A3GG 4XQJA 2V4DA 2FFKB 1SRUA 1EY0A 2DY7A 4LF6L 3CRLC 3L7ZC 1SBBB 3OSOA 3VYTA 1YHQA 1EYGA 4FF1A 3MEHA 2EYHA 3LX0A 2JA6B 3P1HA 1OXSC 4TKOB 3DMUA 4RCOA 3URYA 3TP6A 2L1BA 4OO1I 1RJTA 5JPMC 1PLFA 2AWOA 1ICFB 1I6VC 3RNUA 1R4QB 3U50C 2UXBQ 1CK1A 3T56B 1Y8OB 4AQYQ 2AQ1B 1F9RA 4DR5Q 1PZKD 4JI6L 3G4SA 3PO2B 2H4OA 1LV9A 4P74A 1L1OA 1EQTA 1SYFA 1PH8A 3I56A
chains in the Genus database with same CATH topology
1BOSA 4BWGB 4X3SA 2ZXRA 4K14A 2K32A 3QB3A 4CKCA 2A5HA 1BF4A 3HP3A 3BDCA 1MI2A 4V190 1YNJC 5KGUA 1NUCA 1PRTC 1I4PA 4RGOS 1TS2A 2NVTB 4OO1H 1BDOA 4H0LC 3I8ZA 4NW2A 5CV7A 5IGGA 3R2IA 2R7ZB 5HGTA 3C46A 1BCPD 5KNDA 1DD2A 5JOBA 3JAML 2F0IA 2EE1A 4QMGA 2EXZA 5I2YA 2E75C 2PQEA 5K5PA 1I6HB 3T4AC 1X32A 1R4PB 2JA5B 1PFMA 5G3LD 2NVYB 1UEAB 4C2MB 1IKLA 3IL8A 4IUVA 3GV6A 1C48A 3SK6A 1S5FD 2WV6D 5FLXL 2WACA 2L0CA 2LS01 5EBCA 5FO9B 4FO2A 1KABA 2XWBB 2RDFA 2DNEA 5E4WC 4XT1B 1JORA 1VF5C 4KY5A 5E1FA 4IURA 5KYLA 1Q12A 3DEOA 1HPCA 4MN3A 4XYQA 1A3VA 3MZ5A 1EWHA 3GTLB 1BBXC 1EU3A 1Y1WB 1KLUD 5CMDA 4M1UB 3PUWA 4A3IB 4H44C 1SSOA 1B3AA 1VMPA 2J7ZA 3VR3A 2O5IC 3VA5A 3TMEA 5KNCA 3D3RA 1AP0A 5CORA 4J1MA 1JWUD 4HCEA 1PXUA 1QB5D 3HOVB 1MBYA 2PZUA 1WTPA 1QNKA 1A3UA 1E2VA 3D8GA 3BDLA 2MJ8A 3M3YB 1B1ZA 1QG7A 3DUZA 3SHLA 2QKIC 3J81L 3S1MB 1EYAA 1F77A 1SNDA 1PMRA 2IX3A 3I91A 4HR7B 1DZ1A 1T5EA 2PNRC 3OWEB 3EQLC 5T1IA 4IZ8A 1SYEA 2WB1B 4CHTB 2F0JA 1TY0A 4OGQC 2A6EC 1ENAA 3M4YA 4O42A 4IFDG 1CQFA 2QDBA 4RGTA 1G2TA 4A3KB 1KTKA 2O4XA 4LAAA 4B9WA 4DK1A 1AW7A 2A6HC 4ODGA 3HKZB 3MXPA 1W6KA 3PUVA 2B2YA 4A3GB 3CQZB 2JEBI 4ABNA 2R6GA 1ENCA 3BYYB 3I90A 3H6MA 2KCNA 4I7ZC 2E74C 3S1QB 3J7AV 4IALA 1V8QA 1DOMA 5COYA 4RKBA 1STHA 1LTRD 3H91A 2CQAA 2PW5A 3BZDB 1IHZA 1Y8PB 2J0TD 2L9HA 1SNQA 3VR6A 4XYOA 4C3JG 1K8MA 1PFNA 1PTOF 2RVLA 5J39A 1RDPD 1CHPD 2E2HB 2M00A 4A3MB 1BO0A 5T1GA 4K2KA 1KLGD 1ET9A 1D2BA 1EQVA 1A2UA 2EDGA 3SDZA 3KLSX 3S2DB 1EY9A 1PRTB 2F0HA 1JQYD 1STBA 4C1NI 1HQMC 3VA7A 1PZJD 2K04A 3DWPA 5EPKA 5M5WB 2A68C 1A6XA 1BCPF 2F3WA 1LTSD 5IODA 1O7LA 3S1RB 1W6JA 2PYKA 3E6ZX 4CGYB 4HSVA 1S5ED 1HTPA 2AUKA 3S16B 4BS9A 3F2UA 1F9QA 3LWUA 4A3FB 4CKBA 2E76C 3HOUB 2XWJB 1CA6A 4K2LA 2Q8TA 1ENFA 2KEEA 2HDMA 5C0XG 1L0XB 1SFOB 4ZUIA 2NN6G 5C4ZA 2EY6A 2OF1A 4KMUC 3I4MB 2TSSA 1STYA 1PTOC 5I6WA 3QOJA 4NMZA 3QJYA 2EPBA 1TS5A 4H7BA 4TQUS 3VR4A 1EU4A 3M85A 3S2HB 3QWNA 5BN4A 4DAVA 1PFBA 2Z1CA 1NAPA 3MFGA 2HDLA 4HMJA 3KBXA 1KNAA 1STNA 4ILWA 1B9NA 1U4LA 1O7YA 2IWHA 4QIWB 2JP1A 1HTLD 2C5CA 2KA7A 1DONA 1GUSA 2K5WA 1TS4A 3L9AX 1EEFD 2BE5C 1HUNA 1D1KA 5ISRA 2E2IB 1K8OA 5AFWA 2SNMA 2NB0A 5C44B 3EFXD 1TWCB 3HOWB 4XIGS 1Q8IA 2F0MA 1IYUA 4KD4A 2XRQD 2IW3A 1XWEA 4DFAA 4ZLTF 1NR2A 4L8JA 1EL0A 1TWGB 3P7JA 4A3EB 2D62A 5LL6X 4BBSB 3ZYYX 3OIQA 3PIP3 4EQNA 1EZ6A 1TWFB 1Z7TA 3QOLA 3T13A 3HOXB 1EY8A 5M5XB 4FXDA 2NTSA 5EPLA 1CM9A 3Q22A 4UDUC 3OMCA 2X69A 2KJXA 1ONLA 4M8AA 1LT5D 3NXWA 4TRDA 2RSNA 2K5QA 2B2TA 2Z8LA 3X3MA 3FDTA 3I72A 4G7OC 4G57A 4KY6A 4BBRB 3CRKC 3K5OA 3WOEA 4EQPA 4ZYSA 2F0LA 4DNTB 1Q90A 4F88A 1SDFA 4X3UA 3OWFA 5FLXE 1RHPA 4C3IB 4XTCS 4NDXA 3LWEA 2F3VA 3FMCA 2EVBA 1I4QA 1E2ZA 2NYZD 2KCCA 1CA5A 1LTID 4PQXA 5DAUA 5BN3A 1SYDA 4Q0FA 1ET6A 1HHVA 2B2UA 1YNNC 1NR4A 1H9SA 1LACA 1D5ZC 4E6IA 3Q23A 4DGZA 2JXMB 4OIJA 1H9KA 4BY7B 4OHJA 1XYIA 4MIUA 2B2YC 4C3JB 3HS0C 1MSHA 3SR1A 4DK0A 4KY7A 2MUYA 2IL8A 2CHBD 3NWSA 1F9SA 1G8ZD 3I73A 5IT9L 1SNOA 1II3A 4RHSA 3T16A 4ZQ3A 1LLRD 1U4RA 4K5WA 2EY5A 3IKJA 2DN8A 1JOOA 2R93B 1F2MA 1IYVA 1SNPA 2M2LA 1FNWA 3MXUA 4U673 2NWGA 3PUYA 4KJNA 4FF3A 3NHHA 2Q8IB 1OO9B 1MGSA 2PO4A 3N6RA 1F2ZA 5I6YA 4P2CB 1S5CD 3GQBA 1GHJA 2KQ3A 2R3ZA 1ML0D 2AUJD 1LT3D 2SEBD 3X3NA 4L6TB 1B53A 1PZID 2FMCA 1PTOB 3EVQA 3NTIA 1EY4A 1CZGA 1DJRD 5EPJA 5BN5A 3LNNA 4K5XA 2JYOA 3MA2B 2EZVA 4RKLA 2XRSD 3C2PA 3H3VC 3GV3A 4PNYA 2EYFA 1WVLA 4F87A 2BA0A 4FF2A 3J7YW 1RODA 3EROA 3NK9A 1Q1BA 1E0BA 1K83B 2A73B 3RLFA 2QILA 1WD0A 2NBFA 1BR9A 5LL6S 3TZDA 1E2WA 2KHSA 2KUMA 2N88A 2LFNA 2WP8J 2JSOA 3FPUB 5KIXA 4KN4C 1Y1VB 1HQRD 2XSCA 4K6LA 2Z4HA 2I07B 2VB2X 1VMCA 4DA2A 5ELFA 1EYDA 2PCFB 3GP7A 5NUCA 3MTSA 1TKWB 3TBIB 4EGVA 1SMYD 3T53B 4KKUA 2K03A 3G6JB 4KKTA 3PMFA 1ZYRD 2FMMA 2EYPA 2MHVA 1ZEQX 3SXHA 2IT1A 5M3MB 4A3JB 3BVMA 3HOZB 4LJZC 2CW0D 1PDQA 4IN3A 1STEA 5FOBB 4QCLA 1GXDC 1HUMA 3BG3A 3J80L 3KLRA 3K5LA 5JEAG 4ZKBB 3VYSA 4QUFA 3K58A 4S3SA 1QCBD 2BDNA 5FK9C 1WTQA 3RZDB 1FYCA 2NTTA 4Q5VA 2L11A 1ZXTA 3I4NB 4KK7A 1H9MA 3L3OC 3OW7A 3FVQA 1RD9D 5D3DA 4B08A 4UAIA 1C8CA 1NSNS 3NBIA 3KK7A 5CYUA 5DM63 1B4OA 5I2XA 4I65A 2L55A 2B2TC 1I4HA 4IUPA 2BOSA 2X6GA 5F2DA 2HQEA 5C4XB 5EKIA 4Z9CB 3MAQA 5JVH3 2ZXPA 1D1IA 3U9SA 4C3IG 3BYTB 1SNMA 4HMIA 5EQ0A 1I50B 2EJGC 2EY1A 1IL8A 3H09A 4H13C 3PUXA 1AEXA 4G4KA 5I9OA 3TSSA 3E5SA 4ID6A 1CTMA 2DNCA 1UNSA 1G291 2QCPX 2B2UC 3MWYW 2OEOA 1GUNA 5K36G 1TQOA 2A69C 4ULLA 2F03A 3ITPA 1Y8NB 5C3XA 2B8FA 1V1OA 2ICIA 1IW7C 5A2QE 2QF7A 1YNJD 1SE2A 1V1PA 1PRTD 3A8JE 4RGNA 3K59A 1VCIA 4C1NK 3NBHA 2PZTA 2ZT9C 4OIKA 4C56C 3IFTA 1TIID 3G7LA 2K7VA 1I4XA 3RZOB 3KBGA 5LHY1 3K57A 3D4WA 2WKDA 1SYCA 3GTOB 1GUOA 5FO8B 4Y7NB 4XXEA 1I4RA 3NWTA 4DAYA 1A3TA 2HUGA 1KDAA 1TWHB 1KDBA 3K0YA 2JEAI 1CHQD 3PUZA 1GUGA 3IAYA 4O1NA 1LT4D 2G9HD 2QEJC 1HFGA 2DY8A 2D5DA 5C4JB 4BY1B 4PMCA 3FKIB 3C1FA 3NUCA 1JWMD 4K6DA 1G2SA 3O13A 2F0GA 3ND8A 5G3LF 3PO3B 2M9VA 1SE4A 4YIJA 3VYRA 2ICEC 1ESFA 3C3LA 3MC0B 3QO2A 2YYZA 4IFDI 4J6HA 2LKVA 1S5DD 5IT9E 2NVQB 1Z47A 2SDFA 1RKNA 4IUNA 3NQIA 3OHXC 1EZ8A 1TS3A 4IFDJ 1HXYD 2VB3X 3TN2A 4A3DB 1DM0B 2AQ3B 1TWAB 1BCPC 2NZ1D 4FXGC 2F0NA 5FKAC 5ELCA 2WAQB 4EQOA 5EKKA 1O7ZA 4OO1G 2B63B 1QWYA 3CU7A 1QE6A 1DOKA 2EYLA 5ELDA 4IFDH 5C5LA 3E0JA 1F2YA 1DXMA 4RGMA 2WKCA 2SOBA 3N52A 1SNCA 5HURA 3PV0A 1PYWD 2A6ED 2K33A 3HEJA 3KF8A 4R9WA 3FPPA 4DXFA 3JAME 2K05A 1X3PA 5JPNC 3ONAB 1JICA 2F0WA 2PPBC 4WFN3 3TP8A 1R9TB 3VYUA 3M7GA 3EJIA 2LMCB 1SXTA 2A6HD 1CI3M 3IFDA 4PV1C 2L12A 2E2DC 4AYBB 1FGBD 5C5MA 4WRDA 1H9JA 1ICWA 3ERQA 2VXWA 3P20A 1OXTA 1TR5A 1AZPA 4JK1C 3A7AB 1F9PA 5KEEA 1D5MC 1CFMA 1HA6A 5D3IB 2KVMA 4KJOA 4N9TA 4DN4M 3Q0AA 2VUMB 2X6LA 1UUPA 1S4ZA 2F0DA 2K6AA 2JE6I 4K5VA 4ZAIA 3CKIB 4K8IA 1CQVA 4C3HB 1SYGA 5IGFA 3P75A 5EJWA 5C0XI 1OXUA 2NN6I 3A55A 4IUUA 2J4XA 3DWQA 3MXGA 4HAEA 3Q6SA 4G7HC 2KEDA 2F0QA 1AZQA 4DU9A 1H9SB 1SJHD 1BUVT 1B2TA 1SYBA 5KNBA 3M4OB 2PW7A 5CBEE 4A3BB 5C0XJ 2EYOA 2K01A 2F0TA 3R3OA 4RHRA 4X3TA 2B2WA 1WTXA 2D9UA 4LK1C 1PRTF 3SVMA 4KTAA 3BS1A 3DWAA 3H0GB 3GTJB 1Z6HA 1EIGA 4CJ0B 3J81E 2A68D 2ENBA 3S14B 1SEBD 3VR2A 1TT2A 3OMGA 4FYDA 5C0XH 4U68A 1TU2B 2NN6H 1STGA 1NCVA 1PTOH 4NP5A 1J8IA 1EY7A 2BA1A 2FJ2A 3NQTA 1Q1EA 4XQNA 4HEDA 4IQZA 2ZXOA 3NTHA 3BVZA 2FINB 1U4MA 2SNSA 1SAPA 4QF4A 1UAPA 4J8QA 2RSOA 3R8BA 1PTOD 2LY7A 4FP5D 4KHVA 3SK8A 3GO5A 3FEWX 1EY6A 5DEHA 3SEBA 3HG9A 1JOQA 1EWCA 5IOCA 1M4VA 4TSSA 3SK4A 2F4IA 3DEPA 3TDQA 3UI2A 5C6AA 1A2TA 1M8AA 1HRJA 1WCMB 1SE3A 5J1ZA 2BE5D 4V0BA 3GTKB 3I4LA 3KUPA 3J7AF 2R92B 3TZUA 2NVXB 2TMPA 3Q24A 4GZYC 4DNRB 1BCPB 4QB4A 5D14A 2F0EA 3SK5A 3TP7A 2K28A 1D5XC 4DF7A 1SJED 5DM73 3NPPA 3D6CA 3A8KE 5CV9A 4DXGA 1GHKA 5CBAE 2D2CC 4WJWA 2OXPA 4XT3B 2EYMA 1D6EC 1CT1D 4ZUJA 1HCZA 3EA6A 2BDOA 2B2VA 1S5BD 1XXGA 1Y69U 5C4HA 3BDOA 3I70A 3OOCA 2E2JB 1BQQT 3A8IE 4KD3A 3WDNA 4KN7C 1AN8A 1A15A 3AMUA 1BXTA 2NUCA 3S9WA 1JCKB 2F0FA 2XNAC 5CR3A 1ILQA 4OL7A 4L63B 4RWSC 2YU9B 5C3EB 2EJFC 3TP5A 2B8GA 4XDXA 5CC4A 5M5YB 1QOHA 1MSGA 3S1NB 3D31A 1WTWA 3V2TA 2FHTA 5DNFA 1AFPA 1DCZA 1ILPA 4ZKCB 3R93A 3DXJC 2RA4A 4HCSA 1YNND 2IX0A 3HGBA 4IUTA 3RMHA 2HCCA 4RAUC 1EY5A 1JWSD 1V43A 4X3KA 3MVVA 1DYQA 5EKLA 5M9OA 1WTVA 1RF2D 3GTGB 4DAPA 3QIAA 4KKSA 4G7ZC 3A7LA 1OXVA 5ELBA 2G9DA 3S17B 2RDGA 3DM1A 1QNUA 3D4RA 3VR5A 4WORA 1B50A 1CZWA 5JJZA 4BA2I 2EY2A 2IX1A 5IGEA 2L4NA 3PIO3 2IJ0A 2OT2A 4KHZA 1EEID 1F2LA 1BNZA 2PMZB 4RH6A 4C3HG 1OXXK 4NKLA 2JA8B 2F0PA 4K8JA 3NTKA 2R61A 3SE0A 2I46A 3C1EA 1U4PA 4QUCA 1C4QA 1QJOA 2PZWA 5A35A 3DHQA 1G91A 5CV8A 2AWNA 2VNUD 3S15B 2MP1A 3K7AB 2XVSA 3T51B 2RQXA 5M3FB 1B44D 3A54A 1O78A 4PMBA 2WIIB 2B2WC 3HRZC 1XTCD 2Z4IA 2MPMA 1JOKA 1V1PB 3BVGA 3MFYA 3GD7A 1ESRA 4CKEA 1FR3A 4ZK9B 1IKMA 4MHEA 5EBDA 2B39A 1RTOA 1LTBD 4B9XA 3W3AA 2WINB 5KYIA 4LMQD 3ND9A 3H94A 3NSWA 1LABA 2O5JC 1I3QB 2K5DA 4HN7A 3OIPA 3HOYB 1JB3A 3D6WA 2KOLA 1KAAA 2KECA 5D65A 4XQQA 1FD7D 2A74C 1KNEA 4JBWA 2EOTA 2H1EA 4FF4A 1H9RA 1G6ZA 5IGDA 3RD4A 5JEAJ 4FNFA 1JE4A 2F0SA 5CV5A 2N55A 3RUZA 3AU7A 1O80A 3A56A 3K5NA 1EYCA 1WD1A 3K5MA 1LTAD 4CBVA 1B9MA 1FNUA 1GUWA 3GTMB 3V05A 1X3QA 4ZRZA 4N9PA 4HTHA 3MHBA 4RCNA 2F1MA 4PMWA 4F8MA 1VF7A 2F0VA 1STAA 2F0KA 5JEAH 2EYJA 3U9OA 3D4DA 2EJMA 1LO5D 2C9OA 5JAVA 1I4GA 3V96A 1LTTD 2K1BA 3GTPB 1Q3LA 3NP8A 3NE5B 1WTOA 4KI0A 1GJXA 2RBMA 2RKSA 2HCIA 2CVRA 1HA5A 1LT6D 1T5XD 1XX8A 3HZXA 1TVXA 1DOLA 3KLSA 1VDZA 4A93B 1EOTA 1FNVA 2B2VC 5CV4A 1EFID 3CHBD 3R2TA 2IPKD 1LTGD 4KV6A 1U9RA 4HSPA 4CJ1B 3FRPB 1ZKOA 3MXNA 5TSSA 5IIFA 1SMYC 1EIHA 3I3CA 1RTNA 1J9OA 1L0YB 2JA7B 1GOZA 5J22A 3M7NA 1TY2A 2F0OA 5A2QL 1ZYRC 2RDHA 2O2LD 5K36H 4R8IA 3K6OA 3QG1A 4IUQA 4EVOA 2GA4B 2AQ2B 4FVMA 2MGSA 3AB9A 4ME5A 4FXKC 5EGTA 2CW0C 5I9PA 4RA8A 5C3WA 3WOFA 1MD2D 1HFNA 4CJ2C 2A69D 5FO7B 2Y0SB 4R8NA 5E3FA 1QILA 1WTRA 5JVG3 4RFBA 3OPOA 1IW7D 1GUTA 3GTQB 5IGCA 4BA1I 2L5TA 2ID0A 5I4DA 5IGBA 5CGKA 5KRUA 2BCOA 2Q8RE 5ELEA 1JR0D 5E4XA 1KDCA 1RCVD 5CV6A 3W2DA 1JC7A 2XIWA 2XN9C 2F0UA 3J80E 4F7XA 4XQJA 2V4DA 2FFKB 1EY0A 2DY7A 3CRLC 3L7ZC 1SBBB 3OSOA 3VYTA 4FF1A 3MEHA 2EYHA 3LX0A 2JA6B 3P1HA 1OXSC 4TKOB 3DMUA 4RCOA 3URYA 3TP6A 2L1BA 4OO1I 1RJTA 5JPMC 1PLFA 2AWOA 1I6VC 1R4QB 1CK1A 3T56B 1Y8OB 2AQ1B 1F9RA 1PZKD 3PO2B 2H4OA 1LV9A 1EQTA 1SYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EVO A;  3MHB A;  5KYL A;  3QOL A;  3T13 A;  4F8M A;  2F0Q A;  1EY8 A;  5C6A A;  4DU9 A;  2F0V A;  1A2T A;  1STA A;  1SNO A;  2F0K A;  1NSN S;  3D4W A;  1SYC A;  1SYB A;  1II3 A;  1ENC A;  4K14 A;  4ME5 A;  4PMB A;  1A3V A;  2EYL A;  5EGT A;  3MZ5 A;  2KHS A;  4I65 A;  1JOK A;  3V2T A;  2EYJ A;  3U9O A;  5C5L A;  3T16 A;  2PW7 A;  3QB3 A;  4K2L A;  5C3W A;  3D4D A;  5J1Z A;  1F2Y A;  3OMC A;  1A3T A;  4ZQ3 A;  5KIX A;  3H6M A;  4K5W A;  4ZUI A;  1KDA A;  2EYO A;  2EY5 A;  5F2D A;  5C4Z A;  2EY6 A;  2F0T A;  1KDB A;  2HQE A;  2OF1 A;  2SOB A;  3R3O A;  3NXW A;  4IAL A;  4R8N A;  5JAV A;  1JOO A;  1STY A;  4TRD A;  5E3F A;  5I6W A;  4RKB A;  3QOJ A;  1STH A;  1EYD A;  3BDC A;  4NMZ A;  3VA5 A;  1F2M A;  3TME A;  1SNC A;  2PW5 A;  5KGU A;  4KTA A;  1SNP A;  5NUC A;  5HUR A;  1NUC A;  4B9X A;  1SNM A;  3NP8 A;  4HMI A;  3HEJ A;  1IHZ A;  2EY1 A;  4H7B A;  5IGC A;  1EY5 A;  4J1M A;  4G57 A;  4KY6 A;  5KYI A;  4QB4 A;  5IGB A;  4EQP A;  2RBM A;  2RKS A;  3MVV A;  5CV7 A;  2F0E A;  5EKL A;  4PMC A;  5CGK A;  5IGG A;  2F0L A;  3NUC A;  3C1F A;  1AEX A;  3SK5 A;  2ENB A;  2PZU A;  5KRU A;  5M9O A;  5HGT A;  1SNQ A;  2F0W A;  4KJN A;  3TP7 A;  1A3U A;  1KDC A;  4K6D A;  5I9O A;  3OWF A;  3TP8 A;  2F0G A;  3BDL A;  3D8G A;  3E5S A;  3NHH A;  4HMJ A;  4ID6 A;  4DF7 A;  5E1F A;  5JOB A;  1TT2 A;  3EJI A;  3OMG A;  3PMF A;  5CV6 A;  3HZX A;  1STN A;  4NDX A;  4YIJ A;  2F3V A;  3D6C A;  5I9P A;  2EYP A;  1STG A;  3SHL A;  5J39 A;  5CV9 A;  2F0U A;  1F2Z A;  2F0I A;  4QMG A;  1EYA A;  1SND A;  2M00 A;  5CV4 A;  5I6Y A;  3SXH A;  4F7X A;  2EXZ A;  4NP5 A;  4WOR A;  5C5M A;  4K2K A;  2OXP A;  1EY7 A;  2KQ3 A;  2OEO A;  4WRD A;  1EY0 A;  2EYM A;  5DAU A;  4J6H A;  3NQT A;  1KAA A;  2LKV A;  4ZUJ A;  1TQO A;  2EY2 A;  3ERQ A;  4KV6 A;  1SYD A;  3OSO A;  1EQV A;  1U9R A;  1A2U A;  2PQE A;  5IGE A;  5K5P A;  5ISR A;  1RKN A;  1TR5 A;  2SNS A;  4IUN A;  3ITP A;  2SNM A;  3EVQ A;  4QF4 A;  5C4H A;  5C3X A;  3MEH A;  2EYH A;  5EKK A;  1EY4 A;  3LX0 A;  5KEE A;  3P1H A;  1EY9 A;  4IZ8 A;  5IGD A;  2F0H A;  1SYE A;  4NKL A;  1STB A;  2F0J A;  2F0P A;  4E6I A;  1EZ8 A;  4K5X A;  2F0S A;  3DMU A;  1ENA A;  2F0M A;  4K8J A;  5CV5 A;  4KJO A;  4N9T A;  3RUZ A;  4KD4 A;  4DGZ A;  5IIF A;  4KHV A;  3SK8 A;  3TP6 A;  1EY6 A;  5DEH A;  2QDB A;  4KD3 A;  4RKL A;  4DFA A;  3SK6 A;  3C1E A;  1EYC A;  4S3S A;  2F0D A;  2F3W A;  2WAC A;  4K5V A;  4PNY A;  2O4X A;  4LAA A;  4MIU A;  4B9W A;  2EYF A;  4K8I A;  1JOQ A;  5J22 A;  2NUC A;  5IOD A;  2F0N A;  3S9W A;  2F0F A;  5CR3 A;  5IOC A;  2PZT A;  2PZW A;  1SYG A;  3DHQ A;  2F0O A;  3SR1 A;  5IGF A;  1KAB A;  4KY7 A;  4OL7 A;  3P75 A;  2RDF A;  3ERO A;  3NK9 A;  2PYK A;  5CV8 A;  4EQN A;  4EQO A;  1JOR A;  4ODG A;  1EZ6 A;  3SK4 A;  1SYF A;  4KY5 A;  3MXP A;  4N9P A;  3TP5 A;  5CC4 A;  4HTH A; 
#chains in the Genus database with same CATH topology
 1BOS A;  4BWG B;  3CME A;  4X3S A;  4DR6 L;  4NXM L;  2ATW A;  4JI4 Q;  4LF5 Q;  2ZXR A;  1K0S A;  1KAW A;  4K14 A;  1HNZ L;  3GTK H;  1HJP A;  4A3M G;  2K32 A;  2ASB A;  3F2B A;  4LFB Q;  4GOP A;  2K5N A;  3QB3 A;  3KYH C;  2R92 H;  3PCO B;  4DV0 L;  1C7Y A;  2NVX H;  4CKC A;  2UUA L;  2A5H A;  1BF4 A;  2Q2U A;  3HP3 A;  1PH7 A;  3BDC A;  1MI2 A;  4V19 0;  1PV4 A;  4QGU A;  1YNJ C;  5IYD G;  5KGU A;  4DUY Q;  1NUC A;  1PRT C;  1I4P A;  4RGO S;  4A3L G;  1TS2 A;  2NVT B;  4OO1 H;  1BDO A;  4H0L C;  3I8Z A;  4DNI A;  4NW2 A;  5CV7 A;  5IGG A;  3R2I A;  1LTL A;  2R7Z B;  5HGT A;  1XPO A;  2XTI A;  3C46 A;  1QUQ B;  1BCP D;  1UE5 A;  5KND A;  1DD2 A;  1JJ2 A;  3FP9 A;  5JOB A;  1N8R C;  3JAM L;  1N36 L;  4PZ6 A;  2F0I A;  2EE1 A;  4QMG A;  1PH5 A;  2EXZ A;  5I2Y A;  2E75 C;  4P71 A;  1A8V A;  4YHH Q;  4NXN L;  1SR3 A;  4A3F G;  2RCN A;  2E2J H;  1KD1 C;  3HOU G;  3UDI A;  5AJ3 L;  2PQE A;  5K5P A;  1JMC A;  1I6H B;  3T4A C;  1YHA A;  3IRB A;  1X32 A;  4X64 L;  1R4P B;  2JA5 B;  1PFM A;  2E5L Q;  5G3L D;  2PI2 A;  3D0F A;  3I4M G;  1OTC A;  3HOZ H;  2NVY B;  1EFW A;  1UEA B;  4C2M B;  1IKL A;  3IL8 A;  4IUV A;  3GV6 A;  4LFA Q;  1C48 A;  4DUZ Q;  3SK6 A;  1S5F D;  2WV6 D;  5FLX L;  5M5Y H;  2WAC A;  1KC8 C;  1WFQ A;  2L0C A;  2LS0 1;  5EBC A;  5FO9 B;  4FO2 A;  1KAB A;  1CSP A;  2XWB B;  4HIO A;  2RDF A;  2DNE A;  5E4W C;  3S1N H;  4XT1 B;  1JOR A;  1VF5 C;  1EIY B;  4KY5 A;  5ELN A;  5E1F A;  1D8L A;  4IUR A;  5KYL A;  3CCE A;  3NEM A;  1Q12 A;  4Y52 H;  3DEO A;  1VQN A;  1HPC A;  4MN3 A;  4XYQ A;  1A3V A;  3MZ5 A;  1EWH A;  3GTL B;  1BBX C;  1VQ9 A;  5IYB H;  1VQM A;  3WWV A;  1EU3 A;  1Y1W B;  1KLU D;  5CMD A;  4M1U B;  3PUW A;  4PG3 A;  1YJW A;  4DR2 L;  4A3I B;  3T1Y Q;  4H44 C;  1SSO A;  1SE8 A;  1B3A A;  1VMP A;  2J7Z A;  3VR3 A;  5C44 G;  2O5I C;  2UXB L;  3VA5 A;  3TME A;  5KNC A;  2KCT A;  3JC6 6;  3D3R A;  1AP0 A;  3GTG H;  3CCV A;  3HOW G;  4X62 L;  5COR A;  4J1M A;  2HIV A;  1JWU D;  3RLN A;  5H1S E;  4HCE A;  4GN4 B;  1PXU A;  1SRO A;  1QB5 D;  3HOV B;  2QEX A;  1MBY A;  2PZU A;  1N33 Q;  1WTP A;  1QNK A;  1A3U A;  1E2V A;  3D8G A;  3BDL A;  2MJ8 A;  4A76 A;  3F8T A;  4A3E G;  3QR8 A;  3M3Y B;  1B1Z A;  2CKZ B;  4BBS G;  1QG7 A;  1YBY A;  3DUZ A;  3SHL A;  2QDL A;  2QKI C;  3J81 L;  3S1M B;  2RCF A;  1EYA A;  1F77 A;  1SND A;  1PMR A;  2IX3 A;  3F2C A;  2K75 A;  3I91 A;  4MTK A;  4YY3 Q;  4HR7 B;  3HOX G;  3L2P A;  1B7Y B;  1A0I A;  2JA8 H;  4K0K Q;  1DZ1 A;  1T5E A;  1AH9 A;  5J3B A;  2PNR C;  3OWE B;  3EQL C;  5IP7 H;  1Q7Y C;  5T1I A;  2Y0S E;  3KOJ A;  4IZ8 A;  1SYE A;  2WB1 B;  4CHT B;  2F0J A;  2GVB A;  4CDC C;  1TY0 A;  2A6E C;  4OGQ C;  1ENA A;  3M4Y A;  4QL5 A;  4O42 A;  2K14 A;  4IFD G;  2I5M X;  1CQF A;  2K50 A;  2QDB A;  4RGT A;  1G2T A;  4A3K B;  3S15 H;  1KTK A;  2O4X A;  4LAA A;  4B9W A;  4BBR G;  1HNX L;  5M3F H;  4DK1 A;  3E3X A;  3T1H Q;  1Q81 C;  1AW7 A;  3J7A 5;  4JI1 L;  2A6H C;  2D0P A;  4L5Q A;  4YHH L;  4ODG A;  1CSQ A;  3U58 A;  3HKZ B;  3MXP A;  1W6K A;  3PUV A;  2B2Y A;  4A3G B;  3CQZ B;  2JEB I;  1LM0 A;  5GRO A;  4ABN A;  2R6G A;  3CC4 A;  3CP0 A;  1ENC A;  1KRS A;  3E9I A;  3CW2 C;  3BYY B;  3I90 A;  3H6M A;  1FJG Q;  2KCN A;  2RHS B;  4I7Z C;  2E74 C;  4LFA L;  4DUZ L;  3S1Q B;  3J7A V;  4IAL A;  1V8Q A;  1CUK A;  1DOM A;  5COY A;  4B3M Q;  1K9M C;  4RKB A;  2I5H A;  4Y7N H;  1STH A;  1LTR D;  3H91 A;  2CQA A;  2PW5 A;  3BZD B;  2A8V A;  3K80 C;  1IHZ A;  1EOV A;  1YHB A;  1Y8P B;  2J0T D;  2L9H A;  1JJC B;  1J5E Q;  4BY7 G;  3HOY H;  1SNQ A;  4JPB W;  3VR6 A;  4NB3 A;  4XYO A;  2YTY A;  4C3J G;  1K8M A;  1PFN A;  2EXD A;  1PTO F;  4JW0 A;  2RVL A;  5FJ8 H;  5C4J H;  5IY0 A;  4LF4 Q;  5J39 A;  1RDP D;  1CHP D;  2E2H B;  1MJC A;  2M00 A;  4A3M B;  1BO0 A;  1YNX A;  5T1G A;  4K2K A;  3PO3 H;  1KLG D;  3TS0 A;  3BZK A;  1ET9 A;  1D2B A;  1N32 L;  4MTN A;  4DR3 L;  1EQV A;  1A2U A;  2EDG A;  3SDZ A;  4OXP A;  3KLS X;  3S2D B;  2N78 A;  3PF5 A;  1EY9 A;  4B3T Q;  1PRT B;  2F0H A;  1JQY D;  1STB A;  4C1N I;  2DJF C;  1HQM C;  3VA7 A;  1C9O A;  2R93 G;  1PZJ D;  2K04 A;  3DWP A;  4GNX A;  3L0O A;  3GTM H;  3JAM i;  1L1O C;  5EPK A;  5M5W B;  1M90 C;  2UUC Q;  2A68 C;  1A6X A;  1BCP F;  2F3W A;  1FGU A;  1LTS D;  5IOD A;  1O7L A;  3S1R B;  1W6J A;  1XJV A;  4LF7 L;  4N8X 1;  2PYK A;  2JQO A;  4YY3 L;  3E6Z X;  1X3F A;  4CGY B;  4HSV A;  1S5E D;  1HTP A;  4GOP C;  2AUK A;  4K0K L;  1K8A C;  2DUD A;  3S16 B;  4BS9 A;  3F2U A;  1F9Q A;  1KXL A;  4GLA C;  3LWU A;  4A3F B;  4CKB A;  2E76 C;  3A74 A;  2KHI A;  1GM5 A;  4OX9 Q;  3HOU B;  4R1J A;  2XWJ B;  5LMU L;  4X6A H;  4ME3 A;  1CA6 A;  1PH9 A;  4K2L A;  3GTP H;  2Q8T A;  1ENF A;  1NTG A;  2KEE A;  4IPD A;  2HDM A;  1Q46 A;  5C0X G;  1L0X B;  1SFO B;  4ZUI A;  2NN6 G;  1BBU A;  5C4Z A;  2EY6 A;  2OF1 A;  4KMU C;  2R7Z G;  3I4M B;  2TSS A;  1STY A;  4DV3 Q;  3G6E A;  1PTO C;  5I6W A;  3QOJ A;  4DV2 L;  4NMZ A;  3QJY A;  2EPB A;  1YIJ A;  1TS5 A;  1KHI A;  3T1H L;  2AMC B;  4H7B A;  4DR1 Q;  4TQU S;  3VR4 A;  1EU4 A;  3M85 A;  3S2H B;  3OYY A;  2I0Q A;  2NZH A;  3QWN A;  5BN4 A;  4DAV A;  1PFB A;  4A93 H;  2Z1C A;  1NAP A;  3MFG A;  2HDL A;  4HMJ A;  3KBX A;  1KNA A;  4JVZ A;  2MQH A;  1STN A;  4JBJ A;  4ILW A;  4YWM A;  1B9N A;  1U4L A;  1KIX A;  1O7Y A;  2IWH A;  2OQ0 A;  4QIW B;  2JP1 A;  1V1Q A;  4GKJ Q;  1HTL D;  2C5C A;  2KA7 A;  1DON A;  1GUS A;  2K5W A;  1TS4 A;  3L9A X;  4UY8 C;  1CKN A;  1EEF D;  2BE5 C;  3J80 c;  3KDF A;  1HUN A;  1D1K A;  5ISR A;  2E2I B;  1K8O A;  2CQO A;  5AFW A;  2SNM A;  2KCM A;  2HD3 A;  2NB0 A;  5C44 B;  1Y1V G;  3EFX D;  1UE7 A;  1TWC B;  2JA7 H;  3HOW B;  4XIG S;  1Q8I A;  2F0M A;  2VY3 A;  1IYU A;  4KD4 A;  2XRQ D;  2IW3 A;  1XWE A;  3EN2 A;  4DFA A;  4ZLT F;  1NR2 A;  3CCS A;  4L8J A;  4DV5 Q;  3AFQ A;  3J81 i;  1EL0 A;  1TWG B;  3BJU A;  3P7J A;  4A3E B;  1J6Q A;  2D62 A;  4GLV B;  5LL6 X;  4BBS B;  3ZYY X;  3OIQ A;  3PIP 3;  4P72 A;  4EQN A;  3U4Z A;  1EZ6 A;  1N34 Q;  1TWF B;  1Z7T A;  3QOL A;  1XNR L;  3T13 A;  3HOX B;  1EY8 A;  4C3H H;  3MXN B;  2ZJQ A;  5M5X B;  4FXD A;  2NTS A;  5EPL A;  1CM9 A;  1WYD A;  3Q22 A;  4UDU C;  4NPS A;  5M3M G;  4A3J G;  3OMC A;  2X69 A;  4DV6 Q;  3GTQ H;  1IL2 A;  2KJX A;  3HOV G;  1ONL A;  4M8A A;  1LT5 D;  3NXW A;  4TRD A;  3PSI A;  4YWK A;  2RSN A;  2K5Q A;  2OQK A;  2B2T A;  2WB1 E;  1SLJ A;  2Z8L A;  3X3M A;  4HIK A;  1YEZ A;  3FDT A;  3I72 A;  4G7O C;  4G57 A;  4KY6 A;  4BBR B;  3CRK C;  3K5O A;  3WOE A;  4EQP A;  1PH2 A;  4DR7 Q;  4ZYS A;  2F0L A;  4DNT B;  1Q90 A;  4F88 A;  1SDF A;  4HJ7 A;  4X3U A;  3OWF A;  4L5S A;  5FLX E;  1RHP A;  4C3I B;  4XTC S;  4OX9 L;  4NDX A;  3LWE A;  2F3V A;  4APV A;  3HKZ E;  3I4N G;  3FMC A;  2EVB A;  2UUB L;  1I4Q A;  1VQ8 A;  1E2Z A;  2FXQ A;  1PFS A;  2NYZ D;  2KCC A;  2JA6 H;  1G6P A;  1CA5 A;  3Q8D A;  1LTI D;  2HHH L;  4PQX A;  5DAU A;  4HID A;  5BN3 A;  1SYD A;  4Q0F A;  4JBM A;  5IP9 H;  1YZ6 A;  1ET6 A;  4WJ4 A;  1HHV A;  3BZC A;  2B2U A;  4DR1 L;  3J7Z C;  1YNN C;  1NR4 A;  4TVA B;  4JBK A;  1H9S A;  1LAC A;  5C4X G;  1D5Z C;  4E6I A;  3Q23 A;  2PQA A;  4DGZ A;  2JXM B;  1GD7 A;  2EIF A;  3PO2 H;  4HIM A;  4OIJ A;  1IBK L;  1H9K A;  2IHE A;  3K81 C;  4BY7 B;  4OHJ A;  4R4Q A;  1XYI A;  1BKB A;  4OWX B;  3EBE A;  4MIU A;  2B2Y C;  4C3J B;  3HS0 C;  1MSH A;  3SR1 A;  4DK0 A;  2OWO A;  4GKJ L;  4KY7 A;  2MUY A;  4LFC Q;  1K3R A;  1YI2 A;  2IL8 A;  1VQF A;  2CHB D;  3NWS A;  1F9S A;  1G8Z D;  2YV5 A;  3I73 A;  1NMG A;  2HT1 A;  3UDX A;  5IT9 L;  1SNO A;  1II3 A;  4RHS A;  1YIT A;  4B3R L;  2ALY B;  3T16 A;  4MNO A;  4ZQ3 A;  1LLR D;  2OTJ A;  1U4R A;  4K5W A;  1NE3 A;  4WJ3 M;  2EY5 A;  3IKJ A;  1VQJ A;  2DN8 A;  2C35 B;  1EQQ A;  2NVT H;  3CPF A;  1JOO A;  2R93 B;  2N3S A;  1WCM H;  1F2M A;  1IYV A;  1SNP A;  1L1O B;  2M2L A;  3PIO A;  1FNW A;  3MXU A;  4U67 3;  2NWG A;  3PUY A;  4KJN A;  4FF3 A;  4HJ8 A;  3NHH A;  4GOP B;  2Q8I B;  3CC2 A;  4J15 A;  1OO9 B;  3HFZ B;  1MGS A;  2PO4 A;  3N6R A;  1F2Z A;  1I6H H;  2F4V L;  5I6Y A;  2HIX A;  4P2C B;  4DV6 L;  1S5C D;  2DJG C;  3GQB A;  5IWA Q;  1GHJ A;  2JA5 H;  3AFP A;  2NZO A;  2KQ3 A;  4DV1 L;  2R3Z A;  1ML0 D;  2AUJ D;  1LT3 D;  2NVY H;  2SEB D;  3X3N A;  1PYB A;  4KHP L;  4L6T B;  4UP8 A;  1XMQ Q;  1B53 A;  4C2M H;  1PZI D;  4GNX C;  2FMC A;  1PTO B;  3EVQ A;  2RF4 A;  3NTI A;  1EY4 A;  1CZG A;  1DJR D;  5EPJ A;  3KF6 A;  5BN5 A;  4DR7 L;  4DV4 L;  3LNN A;  4K5X A;  2JYO A;  3MA2 B;  2EZV A;  4RKL A;  2XRS D;  3TEH B;  3C2P A;  3H3V C;  3GV3 A;  4PNY A;  2EYF A;  4BY1 G;  1WVL A;  4F87 A;  2BA0 A;  5HY6 A;  4FF2 A;  3J7Y W;  1ROD A;  1GO3 E;  3ERO A;  3NK9 A;  1Q1B A;  1E0B A;  1K83 B;  2A73 B;  2B3G A;  1Y1W H;  3RLF A;  2QIL A;  1VQL A;  4R4O A;  1WD0 A;  2NBF A;  4QIW E;  1I94 L;  1BR9 A;  4A3I H;  4FDB A;  5LL6 S;  3TZD A;  2YU9 H;  1L0W A;  1E2W A;  2KHS A;  2KUM A;  5C3E H;  2YTX A;  2N88 A;  2LFN A;  1IBM L;  2WP8 J;  1EQR A;  2JSO A;  3FPU B;  1U0L A;  5KIX A;  1YJN A;  4KN4 C;  1Y1V B;  1HQR D;  2XSC A;  4K6L A;  2Z4H A;  1E22 A;  1QVC A;  2Q2I A;  2I07 B;  2VB2 X;  1VMC A;  2R7F A;  4DA2 A;  1VQ6 A;  5ELF A;  3NEL A;  1EYD A;  2PCF B;  3GP7 A;  5NUC A;  1HZ9 A;  3MTS A;  3M3Y H;  1TKW B;  3TBI B;  5IYC H;  4EGV A;  1SMY D;  4LFC L;  3T53 B;  1ASZ A;  4KKU A;  1VQ7 A;  4A3D G;  2K03 A;  2PNH A;  3G6J B;  3S1M H;  4KKT A;  3PMF A;  1ZYR D;  2FMM A;  4LUO A;  2WAQ G;  2EYP A;  4CDD C;  2MHV A;  1ZEQ X;  4AQY L;  4JCV E;  3SXH A;  4L5T A;  4DR5 L;  2B63 G;  2IT1 A;  5M3M B;  5FLM G;  4IPH A;  4A3J B;  4POG A;  3BVM A;  3HOZ B;  4LJZ C;  2CW0 D;  1PDQ A;  4IN3 A;  1STE A;  5FOB B;  5BR8 Q;  4QCL A;  1GXD C;  1HUM A;  3S17 H;  3BG3 A;  4JI4 L;  1NBW A;  3J80 L;  4LF5 L;  3KLR A;  3K5L A;  4A3K H;  4BXX G;  4A3C G;  5JEA G;  4ZKB B;  1QZG A;  3VYS A;  4LFB L;  3CC7 A;  4QUF A;  4DV7 Q;  3K58 A;  2A19 A;  2OTL A;  1X54 A;  4S3S A;  1QCB D;  2BDN A;  2ZTE A;  2LXK A;  5FK9 C;  4A3G H;  3CQZ H;  1WTQ A;  4DUY L;  3RZD B;  3M9B A;  4B3S Q;  1FYC A;  2NTT A;  2KBN A;  4Q5V A;  2L11 A;  1ZXT A;  2I5L X;  3I4N B;  4KK7 A;  4IOA A;  1H9M A;  1VQD A;  3L3O C;  3M4P A;  3OW7 A;  3FVQ A;  1RD9 D;  5D3D A;  4JOI A;  4B08 A;  4IOC A;  4UAI A;  1C8C A;  3TS2 A;  3STB C;  2VQE Q;  4AYB G;  1NSN S;  3NBI A;  2CH4 A;  3KK7 A;  4O0A A;  1UE6 A;  5CYU A;  1AE3 A;  5DM6 3;  1B4O A;  5I2X A;  4I65 A;  1HNW Q;  2L55 A;  2B2T C;  3K7A H;  3CCU A;  1I4H A;  1RIP A;  4IUP A;  2BOS A;  2X6G A;  5F2D A;  1UWV A;  2HQE A;  5C4X B;  5EKI A;  4Z9C B;  3MAQ A;  5JVH 3;  2ZXP A;  1D1I A;  3U9S A;  4C3I G;  3BYT B;  4JI7 Q;  1SNM A;  4HMI A;  5EQ0 A;  1I50 B;  2EJG C;  2EY1 A;  1IL8 A;  3H09 A;  2BH2 A;  2VUM G;  5EAY A;  1QVG A;  2E5L L;  4H13 C;  3PUX A;  1AEX A;  2E2H H;  1N9W A;  1VQI A;  3B6Y A;  2VL6 A;  4G4K A;  4A3M H;  5I9O A;  3TSS A;  3E5S A;  4ID6 A;  1CTM A;  2DNC A;  3KLW A;  1UNS A;  3CPW A;  1A63 A;  5L37 A;  2UXD Q;  1G29 1;  2QCP X;  2B2U C;  1I3Q H;  5LMN Q;  2Z6B A;  3MWY W;  5IYD H;  4YCU A;  2OEO A;  1GUN A;  4LF8 Q;  4HJ9 A;  5K36 G;  1TQO A;  1HZC A;  4A3L H;  2A69 C;  1FL0 A;  5GAH C;  2R7D A;  4ULL A;  1XMO Q;  2F03 A;  3ITP A;  5DLQ E;  1Y8N B;  4A3B G;  5C3X A;  5M5W H;  3PQI A;  2YTV A;  2B8F A;  1XNQ Q;  3CAM A;  1V1O A;  2H5X A;  2ICI A;  1IW7 C;  5A2Q E;  2QF7 A;  3S1R H;  1YNJ D;  1SE2 A;  1V1P A;  1X65 A;  1PRT D;  3A8J E;  4GN3 B;  2OCE A;  4RGN A;  3H0G G;  3K59 A;  3T1Y L;  1VCI A;  4GKK Q;  3S16 H;  4C1N K;  3NBH A;  4A4I A;  2PZT A;  2ZT9 C;  4A3F H;  4OIK A;  4C56 C;  2EQS A;  3IFT A;  1LUZ A;  1TII D;  3HOU H;  3G7L A;  2K7V A;  4DK6 C;  1I4X A;  3RZO B;  4JI8 Q;  1N33 L;  1E3P A;  4MZ9 A;  3KBG A;  5LHY 1;  3K57 A;  3D4W A;  2WKD A;  1SYC A;  3FHW A;  2MNA A;  3I4M H;  2VS1 A;  1GUO A;  3GTO B;  4AH6 A;  5FO8 B;  4Y7N B;  4XXE A;  1I4R A;  3NWT A;  4DAY A;  5GAD C;  4JI2 Q;  4GNX B;  2V1C C;  1A3T A;  2HUG A;  4DV7 L;  4EQ5 A;  4DAY B;  1KDA A;  1TWH B;  1KDB A;  3K0Y A;  1X9N A;  2MO0 A;  3S2H H;  2JEA I;  1CHQ D;  3PUZ A;  1GUG A;  1TXY A;  2VW9 A;  3IAY A;  1I5F A;  4O1N A;  4N8F A;  1LT4 D;  2G9H D;  2QEJ C;  4B3S L;  1HFG A;  2DY8 A;  2D5D A;  2F3I A;  5C4J B;  4BY1 B;  2CCZ A;  2JJQ A;  2JA9 A;  4PMC A;  3FKI B;  3C1F A;  3NUC A;  3U4V A;  1K73 C;  1JWM D;  4K6D A;  1G2S A;  3O13 A;  2F0G A;  3ND8 A;  5G3L F;  2VQE L;  1VQE A;  3CD6 A;  3PO3 B;  2M9V A;  4X66 Q;  1SE4 A;  4YIJ A;  3VYR A;  2ICE C;  1ESF A;  1HR0 Q;  5FLX c;  2E2I H;  1VS0 A;  3C3L A;  3MC0 B;  3QO2 A;  5C44 H;  2YYZ A;  2PI2 E;  4IFD I;  1TWC H;  4POF A;  2VZA A;  2ZTC A;  4J6H A;  2LKV A;  3EIV A;  3HOW H;  1S5D D;  5IT9 E;  2NVQ B;  1Z47 A;  1LYL A;  4JI7 L;  3KJP A;  2SDF A;  1RKN A;  4IUN A;  3K0X A;  3TQY A;  3NQI A;  2AKW B;  2ZTD A;  3ERS X;  4O2D A;  1TWG H;  3OHX C;  1EZ8 A;  4A3E H;  1IXR A;  1TS3 A;  4IFD J;  1HH2 P;  1HXY D;  3KFU A;  4BBS H;  3RLO A;  2VB3 X;  3TN2 A;  1FJG L;  1IBL Q;  2R92 G;  4A3D B;  1DM0 B;  2AQ3 B;  1TWA B;  4B3M L;  1HZA A;  1BCP C;  1K0R A;  2NZ1 D;  4FXG C;  2F0N A;  5FKA C;  4LF9 Q;  3HOX H;  3I2Z A;  1VQK A;  5M5X H;  5ELC A;  1CKN B;  2WAQ B;  5LMN L;  3KDF B;  4EQO A;  1PH6 A;  1VQA A;  1H95 A;  5EKK A;  1O7Z A;  4JV5 Q;  4OO1 G;  1AE2 A;  1PA6 A;  2B63 B;  4JI3 Q;  2RHQ B;  1QWY A;  1J5E L;  3CU7 A;  3J80 i;  2IY5 B;  4JG2 A;  1XMO L;  1QE6 A;  1DOK A;  5E7N A;  2EYL A;  3NEN A;  5ELD A;  4IFD H;  5HGQ A;  5C5L A;  3E0J A;  1X3E A;  1XNQ L;  4LF4 L;  1F2Y A;  3UDF A;  1X55 A;  1RL2 A;  1DXM A;  4RGM A;  2WKC A;  2SOB A;  4KLK A;  4BBR H;  1EUJ A;  4IPC A;  5GQO A;  3N52 A;  1SNC A;  5HUR A;  3PV0 A;  3TRZ A;  1PYW D;  2A6E D;  2K33 A;  3HEJ A;  3KF8 A;  2HQL A;  1MKH A;  4R9W A;  3FPP A;  4DXF A;  3JAM E;  2K05 A;  1X3P A;  4B3T L;  2AHO B;  5JPN C;  3ONA B;  1JIC A;  4DR6 Q;  2F0W A;  2PPB C;  4WFN 3;  3TP8 A;  1R9T B;  3VYU A;  3ULJ A;  3HOZ G;  4JI5 Q;  3M7G A;  1VQP A;  3EJI A;  2LMC B;  1SXT A;  3H15 A;  2A6H D;  1CI3 M;  2UUC L;  1SMX A;  1XPU A;  3IFD A;  2GN5 A;  1PYS B;  4PV1 C;  2L12 A;  2E2D C;  4DV0 Q;  4AYB B;  2CH4 W;  4RMF A;  2UUA Q;  2F52 A;  1FGB D;  2Z6K A;  5C5M A;  1HZB A;  2VQF Q;  4WRD A;  1H9J A;  2LSS A;  1ICW A;  1T9H A;  1MHW C;  4ZCK A;  1JB7 A;  4IJH A;  3ERQ A;  4R4T A;  2KHJ A;  2VXW A;  3P20 A;  1OXT A;  1TR5 A;  1AZP A;  1Q82 C;  2P5Z X;  4JK1 C;  3A7A B;  1F9P A;  4BY7 H;  5KEE A;  3K8A A;  1D5M C;  1CFM A;  1HA6 A;  2D0O A;  5D3I B;  3GDE A;  2KVM A;  4KJO A;  4N9T A;  4C3J H;  4DN4 M;  3Q0A A;  2VUM B;  2X6L A;  5IYB G;  5GAG C;  1UUP A;  1S4Z A;  4JI0 Q;  2F0D A;  1N36 Q;  2K6A A;  1CKM A;  2JE6 I;  4K5V A;  4DV3 L;  2B29 A;  4ZAI A;  1KRT A;  3CKI B;  4K8I A;  4UP7 A;  1CQV A;  4JOI C;  4C3H B;  1SYG A;  5IGF A;  3P75 A;  5EJW A;  5C0X I;  1OXU A;  2NN6 I;  3A55 A;  4IUU A;  2J4X A;  3DWQ A;  1VQB A;  3MXG A;  4HAE A;  3Q6S A;  4G7H C;  2KED A;  2F0Q A;  1AZQ A;  4DU9 A;  1H9S B;  1SJH D;  3VDY A;  2QGQ A;  1BUV T;  1B2T A;  1SYB A;  5KNB A;  3M4O B;  2PQA B;  3I4O A;  2R93 H;  2PW7 A;  5CBE E;  4A3B B;  1IYJ B;  5C0X J;  2EYO A;  3KJO A;  2K01 A;  4UHV A;  2F0T A;  3R3O A;  4RHR A;  4X3T A;  2B2W A;  1WTX A;  2D9U A;  4LK1 C;  1PRT F;  3SVM A;  4GS3 A;  4KTA A;  4QQB X;  3BS1 A;  3DWA A;  3H0G B;  4DPG A;  2JA8 G;  3GTJ B;  1E24 A;  1Z6H A;  2DGY A;  1EIG A;  2Z0S A;  3UE0 A;  4CJ0 B;  5IP7 G;  3J81 E;  2A68 D;  4JV5 L;  2ENB A;  4A75 A;  3S14 B;  4JI3 L;  1SEB D;  1NJI C;  3VR2 A;  1TT2 A;  3OMG A;  4FYD A;  4ALP A;  1W3S A;  3SGI A;  5C0X H;  4U68 A;  1TU2 B;  4DV5 L;  2ZM6 Q;  2NN6 H;  1STG A;  1NCV A;  3ULP A;  2R7Z H;  3PGZ A;  4DR2 Q;  1PTO H;  4NP5 A;  1MJE A;  5M3F G;  1J8I A;  2N49 A;  1GVP A;  1EY7 A;  2BA1 A;  2FJ2 A;  3NQT A;  1Q1E A;  4XQN A;  4HED A;  1N34 L;  4IQZ A;  2ZXO A;  4X62 Q;  3NTH A;  3BVZ A;  2FIN B;  1U4M A;  2SNS A;  1SAP A;  3CCQ A;  1P16 A;  4QF4 A;  1YVC A;  3RN5 A;  2UXC Q;  1UAP A;  4J8Q A;  2RSO A;  3R8B A;  3AQQ A;  3S24 A;  1PTO D;  1JT8 A;  2LY7 A;  1VQH A;  4FP5 D;  4KHV A;  3SK8 A;  3GO5 A;  3FEW X;  1EY6 A;  5DEH A;  4JI5 L;  3SEB A;  1IZ6 A;  1PVO A;  3HG9 A;  4LWC A;  1M1K C;  1K83 H;  1JOQ A;  1E7Z A;  3W1B A;  1EWC A;  5IOC A;  1M4V A;  4TSS A;  2VQF L;  3UE1 A;  3SK4 A;  1Q8K A;  2F4I A;  3DEP A;  3TDQ A;  1NY4 A;  1QVF A;  1Y1V H;  3KF6 B;  3UI2 A;  5C6A A;  2MFI A;  3E0E A;  1A2T A;  1M8A A;  1G51 A;  3HOY G;  1HRJ A;  1QUQ A;  1WCM B;  2GVA A;  1SE3 A;  5J1Z A;  5FJ8 G;  4H02 A;  4HJ5 A;  1UEB A;  2BE5 D;  2KEN A;  4V0B A;  4LUZ A;  3FKI G;  3GTK B;  1PH3 A;  3I4L A;  3KUP A;  4JI0 L;  2QW7 A;  1HNX Q;  1X6O A;  4GN5 A;  3GTL H;  3J7A F;  3PO3 G;  4GLX A;  2R92 B;  3TZU A;  1VQ4 A;  1WTH A;  4JI1 Q;  3DLL A;  2NVX B;  2TMP A;  3Q24 A;  1JJG A;  4GZY C;  4DNR B;  1BCP B;  4QB4 A;  5D14 A;  2F0E A;  3SK5 A;  2BH8 A;  3ER0 A;  3TP7 A;  2K28 A;  1D5X C;  4DF7 A;  5M3M H;  4A3J H;  1S40 A;  2WAQ E;  1SJE D;  5DM7 3;  3NPP A;  1KQS A;  3D6C A;  3A8K E;  1E1O A;  3HOV H;  5CV9 A;  4DXG A;  1GHK A;  1XPR A;  5CBA E;  2D2C C;  4WJW A;  1U5K A;  2OXP A;  4XT3 B;  2EYM A;  1D6E C;  1CT1 D;  3RR5 A;  4ZUJ A;  1HCZ A;  3EA6 A;  2CWP A;  2BDO A;  2B2V A;  1S5B D;  1XXG A;  3I7F A;  1Y69 U;  1BVS A;  5C4H A;  1DGS A;  3BDO A;  3I70 A;  3F2D A;  3OOC A;  2E2J B;  1BQQ T;  4LUV A;  1P8L A;  3RZD H;  1VQG A;  3A8I E;  4KD3 A;  3WDN A;  3A0J A;  3I4N H;  4KN7 C;  1AN8 A;  1A15 A;  3AMU A;  1BXT A;  2ZM6 L;  2NUC A;  3S9W A;  1JCK B;  4IPG A;  2F0F A;  2XNA C;  4UPA A;  5CR3 A;  1ILQ A;  4OL7 A;  5GAE C;  4L63 B;  4RWS C;  2YU9 B;  3G71 A;  4YCV A;  3ICE A;  5C3E B;  2EJF C;  3TP5 A;  2B8G A;  4XDX A;  5CC4 A;  4DR3 Q;  1N32 Q;  5M5Y B;  1QOH A;  4I7A A;  5JJK A;  5JJL A;  4AYB E;  1MSG A;  5C4X H;  4A93 G;  1X56 A;  3S1N B;  1CKO A;  3PF4 A;  2UXC L;  3D31 A;  1WTW A;  3V2T A;  2FHT A;  5DNF A;  1YJ9 A;  1AFP A;  1DCZ A;  1I50 H;  2E8G A;  1ILP A;  4JC0 A;  4ZKC B;  5IWA L;  4OWW B;  3R93 A;  3DXJ C;  3E9H A;  2RA4 A;  4HCS A;  1YNN D;  2IX0 A;  3OTO Q;  3HGB A;  1EIF A;  4LW1 A;  1PHJ A;  2UU9 Q;  4DR4 Q;  4LF7 Q;  4IUT A;  3RMH A;  2HCC A;  1XMQ L;  4RAU C;  1EY5 A;  1JWS D;  1V43 A;  4QJF A;  3S1Q H;  1JE5 A;  4OEM B;  4X3K A;  3MVV A;  1DYQ A;  5EKL A;  5M9O A;  1WTV A;  1RF2 D;  5LMN W;  3GTG B;  4DAP A;  2JA7 G;  3QIA A;  2Z6K C;  4KKS A;  4G7Z C;  4DK3 C;  5LMU Q;  3A7L A;  1OXV A;  1MIU A;  2CFM A;  5ELB A;  2G9D A;  3S17 B;  2RDG A;  1GKH A;  3CMA A;  3DM1 A;  1QNU A;  3D4R A;  3VR5 A;  4WOR A;  1B50 A;  1CZW A;  3PIP A;  5JJZ A;  4DV2 Q;  5ELO A;  4BA2 I;  3LGJ A;  4DAM A;  2EY2 A;  3H3V I;  2IX1 A;  1EWI A;  1NMF A;  2XGT A;  5IGE A;  2MO1 A;  4PZ8 A;  2L4N A;  3PIO 3;  2IJ0 A;  2Z9H A;  2OT2 A;  4KHZ A;  1EEI D;  1F2L A;  1BNZ A;  2PMZ B;  2Y0S G;  3MEF A;  4RH6 A;  1K3B C;  4C3H G;  5IT9 c;  1OXX K;  4NKL A;  2JA8 B;  2F0P A;  2LXJ A;  3DM3 A;  4K8J A;  3NTK A;  3S2D H;  2R61 A;  3SE0 A;  1VQC A;  4AIM A;  2I46 A;  3C1E A;  1U4P A;  4QUC A;  1C4Q A;  3RZO H;  1WJJ A;  2K4K A;  4P75 A;  1QJO A;  2PZW A;  2N8N A;  5A35 A;  3DHQ A;  1Y14 B;  1G91 A;  3GTO H;  5CV8 A;  2AWN A;  4DKA C;  1UE1 A;  3J81 j;  2VNU D;  3S15 B;  2MP1 A;  3K7A B;  2XVS A;  3T51 B;  2RQX A;  5M3F B;  1B44 D;  3W5O A;  3CF5 A;  1TWH H;  3A54 A;  1O78 A;  4RG1 A;  4PMB A;  2WII B;  2B2W C;  3HRZ C;  1XTC D;  2Z4I A;  2MPM A;  1JOK A;  1V1P B;  3BVG A;  3MFY A;  3GD7 A;  2JN4 A;  3H3V H;  1ESR A;  4CKE A;  1FR3 A;  4ZK9 B;  3CCM A;  4BY1 H;  3CXC A;  4MHE A;  4PZ7 A;  3NBH B;  1IKM A;  5EBD A;  2B39 A;  3FKI H;  1W2B A;  2JA6 G;  3F1Z A;  1RTO A;  1LTB D;  4B9X A;  2Q2H A;  3W3A A;  5BR8 L;  2WIN B;  1SFO H;  5IP9 G;  5KYI A;  1HR0 W;  4LMQ D;  3ULL A;  1XNR Q;  3CCL A;  4OEL B;  3ND9 A;  2ZJP A;  3H94 A;  3NSW A;  1LAB A;  2O5J C;  3JAM c;  1I3Q B;  3PO2 G;  1ASY A;  2K5D A;  1O7I A;  4HN7 A;  1K28 A;  3OIP A;  2NVQ H;  3HOY B;  1JB3 A;  3D6W A;  2KOL A;  3W1G A;  4HJA A;  2QA4 A;  1KAA A;  2KEC A;  5D65 A;  4XQQ A;  3OTO L;  1FD7 D;  2UU9 L;  2A74 C;  1KNE A;  4DR4 L;  4JBW A;  2EOT A;  2H1E A;  4FF4 A;  1H9R A;  4A3D H;  1G6Z A;  5IGD A;  1TWA H;  3RD4 A;  5JEA J;  1E1T A;  4FNF A;  4CDE C;  1JE4 A;  2ES2 A;  1HNW L;  2F0S A;  5CV5 A;  2K5V A;  2N55 A;  3RUZ A;  4CDF C;  3AU7 A;  1O80 A;  1Q86 C;  3A56 A;  3K5N A;  4JYA Q;  3K7U C;  1EYC A;  1WD1 A;  3K5M A;  1SN8 A;  1LTA D;  3AYH B;  4CBV A;  3M4Q A;  4X65 Q;  2B63 H;  1B9M A;  5FLM H;  2UUB Q;  1FNU A;  1X3G A;  1WCM G;  1GUW A;  3GTM B;  3V05 A;  2HHH Q;  1X3Q A;  4ZRZ A;  4N9P A;  4HTH A;  3MHB A;  4RCN A;  2F1M A;  4PMW A;  4F8M A;  1C0A A;  1VF7 A;  2F0V A;  4BXX H;  4A3C H;  1STA A;  2F0K A;  5JEA H;  3AEV A;  1KL9 A;  2EYJ A;  3U9O A;  5JJI A;  3D4D A;  1TWF H;  3OW2 A;  2EJM A;  1IBK Q;  1LO5 D;  2C9O A;  2WFW A;  2UXD L;  1PH4 A;  5JAV A;  2K52 A;  1BBW A;  1I4G A;  1V9P A;  3V96 A;  1LTT D;  4LF6 Q;  2K1B A;  3ZJY C;  3GTP B;  4LF8 L;  1Q3L A;  2JA5 G;  1VQ5 A;  3NP8 A;  3UDG A;  1R9T H;  3A5U A;  3NE5 B;  2K5H A;  1A62 A;  1S3O A;  1WTO A;  4KI0 A;  4UP9 A;  5IE8 A;  2IHF A;  1GJX A;  2RBM A;  2RKS A;  4R4C A;  2HCI A;  2CVR A;  3A5Z B;  1HA5 A;  1K8G A;  1LT6 D;  1T5X D;  4R4I A;  1XX8 A;  4B3R Q;  3HZX A;  3J81 c;  1TVX A;  1DOL A;  3KLS A;  4GKK L;  1XTD A;  1VDZ A;  2Q2T A;  4A93 B;  1EOT A;  4JI6 Q;  1FNV A;  2B2V C;  5CV4 A;  2ZJR A;  2CWA A;  4C3I H;  1EFI D;  3CHB D;  3STB D;  3R2T A;  1WOC A;  3KF8 B;  2IPK D;  1LTG D;  4KV6 A;  1U9R A;  4JI8 L;  2VUM H;  4NXM Q;  4HSP A;  1QZH A;  1VQO A;  1Y1W G;  4P73 A;  4CJ1 B;  1B70 B;  1HNZ Q;  4OWT B;  3FRP B;  1ZKO A;  3HKS A;  3MXN A;  5TSS A;  4A3I G;  4JI2 L;  5IIF A;  5C3E G;  1SMY C;  1EIH A;  3I3C A;  4YWL A;  1RTN A;  3I55 A;  1J9O A;  1L0Y B;  2JA7 B;  1L2F A;  1GOZ A;  5J22 A;  2F4V Q;  1WI5 A;  3M7N A;  1TY2 A;  2F0O A;  5A2Q L;  1ZYR C;  2RDH A;  2O2L D;  1Z9F A;  5K36 H;  4L5R C;  3CCJ A;  3M4O H;  4IJL A;  1PH1 A;  4R8I A;  4DV1 Q;  5IYC G;  4IO9 A;  3K6O A;  3QG1 A;  4IUQ A;  4KHP Q;  4EVO A;  3CCR A;  2GA4 B;  4LNQ A;  2AQ2 B;  4A3B H;  4FVM A;  2MGS A;  3AB9 A;  1D7Q A;  4ME5 A;  4YCW A;  3BU2 A;  4FXK C;  5EGT A;  4DV4 Q;  2CW0 C;  5I9P A;  4RA8 A;  5C3W A;  4X66 L;  2JK8 A;  4EX5 A;  3WOF A;  1NNX A;  1MD2 D;  1HR0 L;  1HFN A;  3H0G H;  4CJ2 C;  2A69 D;  5FO7 B;  4QY7 A;  2Y0S B;  3GTJ H;  4R8N A;  4NXN Q;  4JYA L;  3G48 A;  5E3F A;  1QIL A;  2PMZ E;  1WTR A;  3S14 H;  5AJ3 Q;  4X65 L;  5JVG 3;  4RFB A;  3OPO A;  2L15 A;  2WB1 G;  1IW7 D;  1GUT A;  3GTQ B;  5IGC A;  4X64 Q;  1B8A A;  2L5T A;  4BA1 I;  2ID0 A;  5I4D A;  5IGB A;  4OON A;  5CGK A;  5KRU A;  2BCO A;  4A3K G;  2Q8R E;  5ELE A;  2A1A A;  1JR0 D;  5E4X A;  1KDC A;  1I94 Q;  1B3Q A;  1RCV D;  5CV6 A;  3W2D A;  1IBL L;  1JC7 A;  3RN2 A;  1IBM Q;  2XIW A;  1S72 A;  2XN9 C;  3HKZ G;  2F0U A;  1FVI A;  3J80 E;  2G5D A;  4LF9 L;  3TRE A;  4F7X A;  4A3G G;  4XQJ A;  2V4D A;  2FFK B;  1SRU A;  1EY0 A;  2DY7 A;  4LF6 L;  3CRL C;  3L7Z C;  1SBB B;  3OSO A;  3VYT A;  1YHQ A;  1EYG A;  4FF1 A;  3MEH A;  2EYH A;  3LX0 A;  2JA6 B;  3P1H A;  1OXS C;  4TKO B;  3DMU A;  4RCO A;  3URY A;  3TP6 A;  2L1B A;  4OO1 I;  1RJT A;  5JPM C;  1PLF A;  2AWO A;  1ICF B;  1I6V C;  3RNU A;  1R4Q B;  3U50 C;  2UXB Q;  1CK1 A;  3T56 B;  1Y8O B;  4AQY Q;  2AQ1 B;  1F9R A;  4DR5 Q;  1PZK D;  4JI6 L;  3G4S A;  3PO2 B;  2H4O A;  1LV9 A;  4P74 A;  1L1O A;  1EQT A;  1SYF A;  1PH8 A;  3I56 A; 
#chains in the Genus database with same CATH homology
 1BOS A;  4BWG B;  4X3S A;  2ZXR A;  4K14 A;  2K32 A;  3QB3 A;  4CKC A;  2A5H A;  1BF4 A;  3HP3 A;  3BDC A;  1MI2 A;  4V19 0;  1YNJ C;  5KGU A;  1NUC A;  1PRT C;  1I4P A;  4RGO S;  1TS2 A;  2NVT B;  4OO1 H;  1BDO A;  4H0L C;  3I8Z A;  4NW2 A;  5CV7 A;  5IGG A;  3R2I A;  2R7Z B;  5HGT A;  3C46 A;  1BCP D;  5KND A;  1DD2 A;  5JOB A;  3JAM L;  2F0I A;  2EE1 A;  4QMG A;  2EXZ A;  5I2Y A;  2E75 C;  2PQE A;  5K5P A;  1I6H B;  3T4A C;  1X32 A;  1R4P B;  2JA5 B;  1PFM A;  5G3L D;  2NVY B;  1UEA B;  4C2M B;  1IKL A;  3IL8 A;  4IUV A;  3GV6 A;  1C48 A;  3SK6 A;  1S5F D;  2WV6 D;  5FLX L;  2WAC A;  2L0C A;  2LS0 1;  5EBC A;  5FO9 B;  4FO2 A;  1KAB A;  2XWB B;  2RDF A;  2DNE A;  5E4W C;  4XT1 B;  1JOR A;  1VF5 C;  4KY5 A;  5E1F A;  4IUR A;  5KYL A;  1Q12 A;  3DEO A;  1HPC A;  4MN3 A;  4XYQ A;  1A3V A;  3MZ5 A;  1EWH A;  3GTL B;  1BBX C;  1EU3 A;  1Y1W B;  1KLU D;  5CMD A;  4M1U B;  3PUW A;  4A3I B;  4H44 C;  1SSO A;  1B3A A;  1VMP A;  2J7Z A;  3VR3 A;  2O5I C;  3VA5 A;  3TME A;  5KNC A;  3D3R A;  1AP0 A;  5COR A;  4J1M A;  1JWU D;  4HCE A;  1PXU A;  1QB5 D;  3HOV B;  1MBY A;  2PZU A;  1WTP A;  1QNK A;  1A3U A;  1E2V A;  3D8G A;  3BDL A;  2MJ8 A;  3M3Y B;  1B1Z A;  1QG7 A;  3DUZ A;  3SHL A;  2QKI C;  3J81 L;  3S1M B;  1EYA A;  1F77 A;  1SND A;  1PMR A;  2IX3 A;  3I91 A;  4HR7 B;  1DZ1 A;  1T5E A;  2PNR C;  3OWE B;  3EQL C;  5T1I A;  4IZ8 A;  1SYE A;  2WB1 B;  4CHT B;  2F0J A;  1TY0 A;  4OGQ C;  2A6E C;  1ENA A;  3M4Y A;  4O42 A;  4IFD G;  1CQF A;  2QDB A;  4RGT A;  1G2T A;  4A3K B;  1KTK A;  2O4X A;  4LAA A;  4B9W A;  4DK1 A;  1AW7 A;  2A6H C;  4ODG A;  3HKZ B;  3MXP A;  1W6K A;  3PUV A;  2B2Y A;  4A3G B;  3CQZ B;  2JEB I;  4ABN A;  2R6G A;  1ENC A;  3BYY B;  3I90 A;  3H6M A;  2KCN A;  4I7Z C;  2E74 C;  3S1Q B;  3J7A V;  4IAL A;  1V8Q A;  1DOM A;  5COY A;  4RKB A;  1STH A;  1LTR D;  3H91 A;  2CQA A;  2PW5 A;  3BZD B;  1IHZ A;  1Y8P B;  2J0T D;  2L9H A;  1SNQ A;  3VR6 A;  4XYO A;  4C3J G;  1K8M A;  1PFN A;  1PTO F;  2RVL A;  5J39 A;  1RDP D;  1CHP D;  2E2H B;  2M00 A;  4A3M B;  1BO0 A;  5T1G A;  4K2K A;  1KLG D;  1ET9 A;  1D2B A;  1EQV A;  1A2U A;  2EDG A;  3SDZ A;  3KLS X;  3S2D B;  1EY9 A;  1PRT B;  2F0H A;  1JQY D;  1STB A;  4C1N I;  1HQM C;  3VA7 A;  1PZJ D;  2K04 A;  3DWP A;  5EPK A;  5M5W B;  2A68 C;  1A6X A;  1BCP F;  2F3W A;  1LTS D;  5IOD A;  1O7L A;  3S1R B;  1W6J A;  2PYK A;  3E6Z X;  4CGY B;  4HSV A;  1S5E D;  1HTP A;  2AUK A;  3S16 B;  4BS9 A;  3F2U A;  1F9Q A;  3LWU A;  4A3F B;  4CKB A;  2E76 C;  3HOU B;  2XWJ B;  1CA6 A;  4K2L A;  2Q8T A;  1ENF A;  2KEE A;  2HDM A;  5C0X G;  1L0X B;  1SFO B;  4ZUI A;  2NN6 G;  5C4Z A;  2EY6 A;  2OF1 A;  4KMU C;  3I4M B;  2TSS A;  1STY A;  1PTO C;  5I6W A;  3QOJ A;  4NMZ A;  3QJY A;  2EPB A;  1TS5 A;  4H7B A;  4TQU S;  3VR4 A;  1EU4 A;  3M85 A;  3S2H B;  3QWN A;  5BN4 A;  4DAV A;  1PFB A;  2Z1C A;  1NAP A;  3MFG A;  2HDL A;  4HMJ A;  3KBX A;  1KNA A;  1STN A;  4ILW A;  1B9N A;  1U4L A;  1O7Y A;  2IWH A;  4QIW B;  2JP1 A;  1HTL D;  2C5C A;  2KA7 A;  1DON A;  1GUS A;  2K5W A;  1TS4 A;  3L9A X;  1EEF D;  2BE5 C;  1HUN A;  1D1K A;  5ISR A;  2E2I B;  1K8O A;  5AFW A;  2SNM A;  2NB0 A;  5C44 B;  3EFX D;  1TWC B;  3HOW B;  4XIG S;  1Q8I A;  2F0M A;  1IYU A;  4KD4 A;  2XRQ D;  2IW3 A;  1XWE A;  4DFA A;  4ZLT F;  1NR2 A;  4L8J A;  1EL0 A;  1TWG B;  3P7J A;  4A3E B;  2D62 A;  5LL6 X;  4BBS B;  3ZYY X;  3OIQ A;  3PIP 3;  4EQN A;  1EZ6 A;  1TWF B;  1Z7T A;  3QOL A;  3T13 A;  3HOX B;  1EY8 A;  5M5X B;  4FXD A;  2NTS A;  5EPL A;  1CM9 A;  3Q22 A;  4UDU C;  3OMC A;  2X69 A;  2KJX A;  1ONL A;  4M8A A;  1LT5 D;  3NXW A;  4TRD A;  2RSN A;  2K5Q A;  2B2T A;  2Z8L A;  3X3M A;  3FDT A;  3I72 A;  4G7O C;  4G57 A;  4KY6 A;  4BBR B;  3CRK C;  3K5O A;  3WOE A;  4EQP A;  4ZYS A;  2F0L A;  4DNT B;  1Q90 A;  4F88 A;  1SDF A;  4X3U A;  3OWF A;  5FLX E;  1RHP A;  4C3I B;  4XTC S;  4NDX A;  3LWE A;  2F3V A;  3FMC A;  2EVB A;  1I4Q A;  1E2Z A;  2NYZ D;  2KCC A;  1CA5 A;  1LTI D;  4PQX A;  5DAU A;  5BN3 A;  1SYD A;  4Q0F A;  1ET6 A;  1HHV A;  2B2U A;  1YNN C;  1NR4 A;  1H9S A;  1LAC A;  1D5Z C;  4E6I A;  3Q23 A;  4DGZ A;  2JXM B;  4OIJ A;  1H9K A;  4BY7 B;  4OHJ A;  1XYI A;  4MIU A;  2B2Y C;  4C3J B;  3HS0 C;  1MSH A;  3SR1 A;  4DK0 A;  4KY7 A;  2MUY A;  2IL8 A;  2CHB D;  3NWS A;  1F9S A;  1G8Z D;  3I73 A;  5IT9 L;  1SNO A;  1II3 A;  4RHS A;  3T16 A;  4ZQ3 A;  1LLR D;  1U4R A;  4K5W A;  2EY5 A;  3IKJ A;  2DN8 A;  1JOO A;  2R93 B;  1F2M A;  1IYV A;  1SNP A;  2M2L A;  1FNW A;  3MXU A;  4U67 3;  2NWG A;  3PUY A;  4KJN A;  4FF3 A;  3NHH A;  2Q8I B;  1OO9 B;  1MGS A;  2PO4 A;  3N6R A;  1F2Z A;  5I6Y A;  4P2C B;  1S5C D;  3GQB A;  1GHJ A;  2KQ3 A;  2R3Z A;  1ML0 D;  2AUJ D;  1LT3 D;  2SEB D;  3X3N A;  4L6T B;  1B53 A;  1PZI D;  2FMC A;  1PTO B;  3EVQ A;  3NTI A;  1EY4 A;  1CZG A;  1DJR D;  5EPJ A;  5BN5 A;  3LNN A;  4K5X A;  2JYO A;  3MA2 B;  2EZV A;  4RKL A;  2XRS D;  3C2P A;  3H3V C;  3GV3 A;  4PNY A;  2EYF A;  1WVL A;  4F87 A;  2BA0 A;  4FF2 A;  3J7Y W;  1ROD A;  3ERO A;  3NK9 A;  1Q1B A;  1E0B A;  1K83 B;  2A73 B;  3RLF A;  2QIL A;  1WD0 A;  2NBF A;  1BR9 A;  5LL6 S;  3TZD A;  1E2W A;  2KHS A;  2KUM A;  2N88 A;  2LFN A;  2WP8 J;  2JSO A;  3FPU B;  5KIX A;  4KN4 C;  1Y1V B;  1HQR D;  2XSC A;  4K6L A;  2Z4H A;  2I07 B;  2VB2 X;  1VMC A;  4DA2 A;  5ELF A;  1EYD A;  2PCF B;  3GP7 A;  5NUC A;  3MTS A;  1TKW B;  3TBI B;  4EGV A;  1SMY D;  3T53 B;  4KKU A;  2K03 A;  3G6J B;  4KKT A;  3PMF A;  1ZYR D;  2FMM A;  2EYP A;  2MHV A;  1ZEQ X;  3SXH A;  2IT1 A;  5M3M B;  4A3J B;  3BVM A;  3HOZ B;  4LJZ C;  2CW0 D;  1PDQ A;  4IN3 A;  1STE A;  5FOB B;  4QCL A;  1GXD C;  1HUM A;  3BG3 A;  3J80 L;  3KLR A;  3K5L A;  5JEA G;  4ZKB B;  3VYS A;  4QUF A;  3K58 A;  4S3S A;  1QCB D;  2BDN A;  5FK9 C;  1WTQ A;  3RZD B;  1FYC A;  2NTT A;  4Q5V A;  2L11 A;  1ZXT A;  3I4N B;  4KK7 A;  1H9M A;  3L3O C;  3OW7 A;  3FVQ A;  1RD9 D;  5D3D A;  4B08 A;  4UAI A;  1C8C A;  1NSN S;  3NBI A;  3KK7 A;  5CYU A;  5DM6 3;  1B4O A;  5I2X A;  4I65 A;  2L55 A;  2B2T C;  1I4H A;  4IUP A;  2BOS A;  2X6G A;  5F2D A;  2HQE A;  5C4X B;  5EKI A;  4Z9C B;  3MAQ A;  5JVH 3;  2ZXP A;  1D1I A;  3U9S A;  4C3I G;  3BYT B;  1SNM A;  4HMI A;  5EQ0 A;  1I50 B;  2EJG C;  2EY1 A;  1IL8 A;  3H09 A;  4H13 C;  3PUX A;  1AEX A;  4G4K A;  5I9O A;  3TSS A;  3E5S A;  4ID6 A;  1CTM A;  2DNC A;  1UNS A;  1G29 1;  2QCP X;  2B2U C;  3MWY W;  2OEO A;  1GUN A;  5K36 G;  1TQO A;  2A69 C;  4ULL A;  2F03 A;  3ITP A;  1Y8N B;  5C3X A;  2B8F A;  1V1O A;  2ICI A;  1IW7 C;  5A2Q E;  2QF7 A;  1YNJ D;  1SE2 A;  1V1P A;  1PRT D;  3A8J E;  4RGN A;  3K59 A;  1VCI A;  4C1N K;  3NBH A;  2PZT A;  2ZT9 C;  4OIK A;  4C56 C;  3IFT A;  1TII D;  3G7L A;  2K7V A;  1I4X A;  3RZO B;  3KBG A;  5LHY 1;  3K57 A;  3D4W A;  2WKD A;  1SYC A;  3GTO B;  1GUO A;  5FO8 B;  4Y7N B;  4XXE A;  1I4R A;  3NWT A;  4DAY A;  1A3T A;  2HUG A;  1KDA A;  1TWH B;  1KDB A;  3K0Y A;  2JEA I;  1CHQ D;  3PUZ A;  1GUG A;  3IAY A;  4O1N A;  1LT4 D;  2G9H D;  2QEJ C;  1HFG A;  2DY8 A;  2D5D A;  5C4J B;  4BY1 B;  4PMC A;  3FKI B;  3C1F A;  3NUC A;  1JWM D;  4K6D A;  1G2S A;  3O13 A;  2F0G A;  3ND8 A;  5G3L F;  3PO3 B;  2M9V A;  1SE4 A;  4YIJ A;  3VYR A;  2ICE C;  1ESF A;  3C3L A;  3MC0 B;  3QO2 A;  2YYZ A;  4IFD I;  4J6H A;  2LKV A;  1S5D D;  5IT9 E;  2NVQ B;  1Z47 A;  2SDF A;  1RKN A;  4IUN A;  3NQI A;  3OHX C;  1EZ8 A;  1TS3 A;  4IFD J;  1HXY D;  2VB3 X;  3TN2 A;  4A3D B;  1DM0 B;  2AQ3 B;  1TWA B;  1BCP C;  2NZ1 D;  4FXG C;  2F0N A;  5FKA C;  5ELC A;  2WAQ B;  4EQO A;  5EKK A;  1O7Z A;  4OO1 G;  2B63 B;  1QWY A;  3CU7 A;  1QE6 A;  1DOK A;  2EYL A;  5ELD A;  4IFD H;  5C5L A;  3E0J A;  1F2Y A;  1DXM A;  4RGM A;  2WKC A;  2SOB A;  3N52 A;  1SNC A;  5HUR A;  3PV0 A;  1PYW D;  2A6E D;  2K33 A;  3HEJ A;  3KF8 A;  4R9W A;  3FPP A;  4DXF A;  3JAM E;  2K05 A;  1X3P A;  5JPN C;  3ONA B;  1JIC A;  2F0W A;  2PPB C;  4WFN 3;  3TP8 A;  1R9T B;  3VYU A;  3M7G A;  3EJI A;  2LMC B;  1SXT A;  2A6H D;  1CI3 M;  3IFD A;  4PV1 C;  2L12 A;  2E2D C;  4AYB B;  1FGB D;  5C5M A;  4WRD A;  1H9J A;  1ICW A;  3ERQ A;  2VXW A;  3P20 A;  1OXT A;  1TR5 A;  1AZP A;  4JK1 C;  3A7A B;  1F9P A;  5KEE A;  1D5M C;  1CFM A;  1HA6 A;  5D3I B;  2KVM A;  4KJO A;  4N9T A;  4DN4 M;  3Q0A A;  2VUM B;  2X6L A;  1UUP A;  1S4Z A;  2F0D A;  2K6A A;  2JE6 I;  4K5V A;  4ZAI A;  3CKI B;  4K8I A;  1CQV A;  4C3H B;  1SYG A;  5IGF A;  3P75 A;  5EJW A;  5C0X I;  1OXU A;  2NN6 I;  3A55 A;  4IUU A;  2J4X A;  3DWQ A;  3MXG A;  4HAE A;  3Q6S A;  4G7H C;  2KED A;  2F0Q A;  1AZQ A;  4DU9 A;  1H9S B;  1SJH D;  1BUV T;  1B2T A;  1SYB A;  5KNB A;  3M4O B;  2PW7 A;  5CBE E;  4A3B B;  5C0X J;  2EYO A;  2K01 A;  2F0T A;  3R3O A;  4RHR A;  4X3T A;  2B2W A;  1WTX A;  2D9U A;  4LK1 C;  1PRT F;  3SVM A;  4KTA A;  3BS1 A;  3DWA A;  3H0G B;  3GTJ B;  1Z6H A;  1EIG A;  4CJ0 B;  3J81 E;  2A68 D;  2ENB A;  3S14 B;  1SEB D;  3VR2 A;  1TT2 A;  3OMG A;  4FYD A;  5C0X H;  4U68 A;  1TU2 B;  2NN6 H;  1STG A;  1NCV A;  1PTO H;  4NP5 A;  1J8I A;  1EY7 A;  2BA1 A;  2FJ2 A;  3NQT A;  1Q1E A;  4XQN A;  4HED A;  4IQZ A;  2ZXO A;  3NTH A;  3BVZ A;  2FIN B;  1U4M A;  2SNS A;  1SAP A;  4QF4 A;  1UAP A;  4J8Q A;  2RSO A;  3R8B A;  1PTO D;  2LY7 A;  4FP5 D;  4KHV A;  3SK8 A;  3GO5 A;  3FEW X;  1EY6 A;  5DEH A;  3SEB A;  3HG9 A;  1JOQ A;  1EWC A;  5IOC A;  1M4V A;  4TSS A;  3SK4 A;  2F4I A;  3DEP A;  3TDQ A;  3UI2 A;  5C6A A;  1A2T A;  1M8A A;  1HRJ A;  1WCM B;  1SE3 A;  5J1Z A;  2BE5 D;  4V0B A;  3GTK B;  3I4L A;  3KUP A;  3J7A F;  2R92 B;  3TZU A;  2NVX B;  2TMP A;  3Q24 A;  4GZY C;  4DNR B;  1BCP B;  4QB4 A;  5D14 A;  2F0E A;  3SK5 A;  3TP7 A;  2K28 A;  1D5X C;  4DF7 A;  1SJE D;  5DM7 3;  3NPP A;  3D6C A;  3A8K E;  5CV9 A;  4DXG A;  1GHK A;  5CBA E;  2D2C C;  4WJW A;  2OXP A;  4XT3 B;  2EYM A;  1D6E C;  1CT1 D;  4ZUJ A;  1HCZ A;  3EA6 A;  2BDO A;  2B2V A;  1S5B D;  1XXG A;  1Y69 U;  5C4H A;  3BDO A;  3I70 A;  3OOC A;  2E2J B;  1BQQ T;  3A8I E;  4KD3 A;  3WDN A;  4KN7 C;  1AN8 A;  1A15 A;  3AMU A;  1BXT A;  2NUC A;  3S9W A;  1JCK B;  2F0F A;  2XNA C;  5CR3 A;  1ILQ A;  4OL7 A;  4L63 B;  4RWS C;  2YU9 B;  5C3E B;  2EJF C;  3TP5 A;  2B8G A;  4XDX A;  5CC4 A;  5M5Y B;  1QOH A;  1MSG A;  3S1N B;  3D31 A;  1WTW A;  3V2T A;  2FHT A;  5DNF A;  1AFP A;  1DCZ A;  1ILP A;  4ZKC B;  3R93 A;  3DXJ C;  2RA4 A;  4HCS A;  1YNN D;  2IX0 A;  3HGB A;  4IUT A;  3RMH A;  2HCC A;  4RAU C;  1EY5 A;  1JWS D;  1V43 A;  4X3K A;  3MVV A;  1DYQ A;  5EKL A;  5M9O A;  1WTV A;  1RF2 D;  3GTG B;  4DAP A;  3QIA A;  4KKS A;  4G7Z C;  3A7L A;  1OXV A;  5ELB A;  2G9D A;  3S17 B;  2RDG A;  3DM1 A;  1QNU A;  3D4R A;  3VR5 A;  4WOR A;  1B50 A;  1CZW A;  5JJZ A;  4BA2 I;  2EY2 A;  2IX1 A;  5IGE A;  2L4N A;  3PIO 3;  2IJ0 A;  2OT2 A;  4KHZ A;  1EEI D;  1F2L A;  1BNZ A;  2PMZ B;  4RH6 A;  4C3H G;  1OXX K;  4NKL A;  2JA8 B;  2F0P A;  4K8J A;  3NTK A;  2R61 A;  3SE0 A;  2I46 A;  3C1E A;  1U4P A;  4QUC A;  1C4Q A;  1QJO A;  2PZW A;  5A35 A;  3DHQ A;  1G91 A;  5CV8 A;  2AWN A;  2VNU D;  3S15 B;  2MP1 A;  3K7A B;  2XVS A;  3T51 B;  2RQX A;  5M3F B;  1B44 D;  3A54 A;  1O78 A;  4PMB A;  2WII B;  2B2W C;  3HRZ C;  1XTC D;  2Z4I A;  2MPM A;  1JOK A;  1V1P B;  3BVG A;  3MFY A;  3GD7 A;  1ESR A;  4CKE A;  1FR3 A;  4ZK9 B;  1IKM A;  4MHE A;  5EBD A;  2B39 A;  1RTO A;  1LTB D;  4B9X A;  3W3A A;  2WIN B;  5KYI A;  4LMQ D;  3ND9 A;  3H94 A;  3NSW A;  1LAB A;  2O5J C;  1I3Q B;  2K5D A;  4HN7 A;  3OIP A;  3HOY B;  1JB3 A;  3D6W A;  2KOL A;  1KAA A;  2KEC A;  5D65 A;  4XQQ A;  1FD7 D;  2A74 C;  1KNE A;  4JBW A;  2EOT A;  2H1E A;  4FF4 A;  1H9R A;  1G6Z A;  5IGD A;  3RD4 A;  5JEA J;  4FNF A;  1JE4 A;  2F0S A;  5CV5 A;  2N55 A;  3RUZ A;  3AU7 A;  1O80 A;  3A56 A;  3K5N A;  1EYC A;  1WD1 A;  3K5M A;  1LTA D;  4CBV A;  1B9M A;  1FNU A;  1GUW A;  3GTM B;  3V05 A;  1X3Q A;  4ZRZ A;  4N9P A;  4HTH A;  3MHB A;  4RCN A;  2F1M A;  4PMW A;  4F8M A;  1VF7 A;  2F0V A;  1STA A;  2F0K A;  5JEA H;  2EYJ A;  3U9O A;  3D4D A;  2EJM A;  1LO5 D;  2C9O A;  5JAV A;  1I4G A;  3V96 A;  1LTT D;  2K1B A;  3GTP B;  1Q3L A;  3NP8 A;  3NE5 B;  1WTO A;  4KI0 A;  1GJX A;  2RBM A;  2RKS A;  2HCI A;  2CVR A;  1HA5 A;  1LT6 D;  1T5X D;  1XX8 A;  3HZX A;  1TVX A;  1DOL A;  3KLS A;  1VDZ A;  4A93 B;  1EOT A;  1FNV A;  2B2V C;  5CV4 A;  1EFI D;  3CHB D;  3R2T A;  2IPK D;  1LTG D;  4KV6 A;  1U9R A;  4HSP A;  4CJ1 B;  3FRP B;  1ZKO A;  3MXN A;  5TSS A;  5IIF A;  1SMY C;  1EIH A;  3I3C A;  1RTN A;  1J9O A;  1L0Y B;  2JA7 B;  1GOZ A;  5J22 A;  3M7N A;  1TY2 A;  2F0O A;  5A2Q L;  1ZYR C;  2RDH A;  2O2L D;  5K36 H;  4R8I A;  3K6O A;  3QG1 A;  4IUQ A;  4EVO A;  2GA4 B;  2AQ2 B;  4FVM A;  2MGS A;  3AB9 A;  4ME5 A;  4FXK C;  5EGT A;  2CW0 C;  5I9P A;  4RA8 A;  5C3W A;  3WOF A;  1MD2 D;  1HFN A;  4CJ2 C;  2A69 D;  5FO7 B;  2Y0S B;  4R8N A;  5E3F A;  1QIL A;  1WTR A;  5JVG 3;  4RFB A;  3OPO A;  1IW7 D;  1GUT A;  3GTQ B;  5IGC A;  4BA1 I;  2L5T A;  2ID0 A;  5I4D A;  5IGB A;  5CGK A;  5KRU A;  2BCO A;  2Q8R E;  5ELE A;  1JR0 D;  5E4X A;  1KDC A;  1RCV D;  5CV6 A;  3W2D A;  1JC7 A;  2XIW A;  2XN9 C;  2F0U A;  3J80 E;  4F7X A;  4XQJ A;  2V4D A;  2FFK B;  1EY0 A;  2DY7 A;  3CRL C;  3L7Z C;  1SBB B;  3OSO A;  3VYT A;  4FF1 A;  3MEH A;  2EYH A;  3LX0 A;  2JA6 B;  3P1H A;  1OXS C;  4TKO B;  3DMU A;  4RCO A;  3URY A;  3TP6 A;  2L1B A;  4OO1 I;  1RJT A;  5JPM C;  1PLF A;  2AWO A;  1I6V C;  1R4Q B;  1CK1 A;  3T56 B;  1Y8O B;  2AQ1 B;  1F9R A;  1PZK D;  3PO2 B;  2H4O A;  1LV9 A;  1EQT A;  1SYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...