1F2ZA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVAAPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2zA00
1KABA 1TQOA 4G57A 2F0DA 2LKVA 3DHQA 4KD3A 2EYFA 4KTAA 4WRDA 2PZTA 2EY2A 1SYFA 1A2TA 4N9TA 4PMCA 1EZ8A 3EROA 3V2TA 1STYA 1A3TA 3P1HA 3RUZA 3NP8A 3TP8A 3HEJA 4LAAA 4DFAA 1NSNS 2F0WA 5I6WA 4HMIA 1EYAA 5ISRA 1ENCA 4HTHA 2EY6A 4K5VA 4QB4A 4NP5A 1SYDA 5CV9A 5F2DA 4ZUIA 3NK9A 1U9RA 2PQEA 3SHLA 4ZUJA 4ID6A 3T16A 2PW7A 4R8NA 5CV5A 3SK4A 2F0UA 4TRDA 1KDCA 1SNCA 5IGBA 4OL7A 1JOKA 4I65A 1JOQA 1F2ZA 3LX0A 2M00A 1AEXA 4PNYA 5IIFA 3ERQA 4RKLA 4ME5A 3TP6A 5IGGA 4HMJA 2PZUA 3NUCA 1F2YA 3TP7A 5IGFA 5KEEA 3S9WA 1TT2A 3DMUA 4K14A 3MVVA 3NQTA 5CV6A 4J6HA 4EQPA 1EYCA 1EY6A 2F0TA 3QB3A 5HURA 1JORA 3NXWA 3SXHA 3D4DA 1KAAA 2F3WA 4ODGA 4N9PA 1EY0A 2SOBA 5EKLA 2WACA 1F2MA 1SNQA 4NDXA 3PMFA 1KDAA 3ITPA 2EY1A 3H6MA 1EY4A 3SK5A 2SNSA 4K8IA 2EYJA 3OMCA 3SR1A 4KY6A 1KDBA 5IODA 1SNDA 3E5SA 1SYEA 1EY5A 5CGKA 4F8MA 2F0EA 5KYLA 3R3OA 3OWFA 5C6AA 2OXPA 5DAUA 5HGTA 5E1FA 4K8JA 5KRUA 5KGUA 4RKBA 5C4ZA 2NUCA 2EYOA 3HZXA 1EQVA 1SYGA 5EKKA 2F0LA 5K5PA 2KQ3A 2EYPA 4IZ8A 5C5LA 5I9OA 5J39A 1SNOA 3MHBA 2RKSA 1JOOA 2PZWA 3U9OA 2OEOA 5CR3A 5I6YA 2EY5A 2EYLA 4YIJA 3TMEA 2F0KA 3C1EA 3MEHA 1EYDA 3MZ5A 5KYIA 5JAVA 2F0NA 2SNMA 2F0VA 1EY7A 4EQOA 2O4XA 5CV8A 1RKNA 5CC4A 4DGZA 2OF1A 5C3WA 5IGCA 2F0IA 5M9OA 1STBA 5CV7A 4KJOA 5J22A 3P75A 1A3VA 2RBMA 5J1ZA 4K2LA 3VA5A 2KHSA 5IOCA 1SYCA 4MIUA 4IALA 4EQNA 5C4HA 3D6CA 4KY7A 1STHA 2PW5A 1STAA 2ENBA 1A2UA 3BDCA 3OSOA 4K6DA 1SYBA 5NUCA 5IGEA 4WORA 4K5WA 5CV4A 2EXZA 2RDFA 4KJNA 3EJIA 4K2KA 1NUCA 2F0GA 1STNA 1TR5A 4H7BA 4KY5A 4QF4A 4E6IA 4NMZA 4F7XA 2HQEA 1II3A 3TP5A 2PYKA 3D4WA 5C5MA 2EYHA 1SNMA 5C3XA 3BDLA 4ZQ3A 1EY9A 2F0JA 3QOJA 5IGDA 4KD4A 3QOLA 2F0QA 1EZ6A 2F0HA 2F0SA 2F0OA 2F0FA 2F3VA 5EGTA 5JOBA 4DU9A 5KIXA 3OMGA 4PMBA 3D8GA 1A3UA 1SNPA 3NHHA 3T13A 3MXPA 1STGA 2F0MA 4KV6A 3SK6A 3EVQA 5DEHA 1ENAA 4NKLA 5I9PA 1EY8A 2F0PA 4QMGA 4S3SA 4EVOA 2QDBA 4KHVA 3C1FA 4B9XA 1IHZA 4IUNA 4B9WA 4DF7A 2EYMA 4J1MA 4K5XA 3SK8A 5E3FA
chains in the Genus database with same CATH superfamily
4G57A 1A0IA 1LTLA 4U673 1Y1WB 3MFYA 2Z4IA 2A73B 2D62A 5I2YA 3H94A 1N33L 4CDDC 2K33A 4ME3A 1BO0A 1K0RA 4HJAA 4IFDI 5JEAH 3KOJA 2ES2A 1XX8A 4Y7NB 3ICEA 3S14H 4ILWA 1K28A 3LX0A 2M00A 4IUPA 4ME5A 4LFAL 2PO4A 3PUXA 5IYDH 4A3KG 1K0SA 3E0EA 1PLFA 3NWSA 2MJ8A 1QZHA 4WJWA 3D4DA 3I4OA 2LSSA 1D8LA 4B08A 1T9HA 1Y1WG 4PZ6A 1I4RA 5E7NA 1QUQB 2JA5B 4KY6A 2Z6BA 1V1PA 2K28A 4JBKA 3RR5A 2OXPA 3M7GA 4N8FA 4DA2A 3CPFA 1LTBD 1HTPA 2NVTB 5J39A 3TZDA 4OONA 4R4IA 5G3LF 1XNRL 3KLRA 3KBGA 2EY5A 1HA5A 3VR5A 3R2IA 1H9SA 5ELBA 3J7AV 4HIMA 3I4MH 3J80i 2C9OA 3UDFA 5M5WB 2F0NA 2KJXA 3I72A 4M1UB 1KC8C 3CHBD 2ZXPA 3ULPA 4GKJQ 2JA8H 1TS2A 3S1RB 5IOCA 1VQ4A 1DJRD 5C4HA 2IX3A 4CDEC 2A69D 2B2WC 2D0OA 2A5HA 2HT1A 3CF5A 3RZDH 3S15H 1VF7A 4GOPC 2XVSA 4FYDA 3QOJA 2R7FA 2YU9H 4JI4L 1CQVA 3WOFA 3MFGA 2R92G 1BQQT 3GTGB 3S1MB 3B6YA 4P75A 2UXCQ 1WTVA 1MJCA 4DR6L 2BH2A 1IZ6A 2PQAA 4J1MA 3M4PA 3KLWA 4RGNA 4KTAA 1O7YA 4YY3Q 1EZ8A 4GKKL 2Z9HA 2TSSA 2K4KA 2N3SA 5I6WA 5JJZA 1ENCA 2F3IA 4JI0L 4IN3A 4DR2L 4BWGB 3I4NB 2PW7A 5ELDA 3L7ZC 4A3LH 4CJ2C 1SR3A 2UXBQ 3PV0A 1YJNA 2A68D 1S5FD 3LNNA 4K14A 3CQZH 2CVRA 2E76C 4GOPB 2Z4HA 4BBSG 4EQPA 5T1IA 2EOTA 4FNFA 2VUMB 1Q1EA 4KLKA 1PH9A 1N32Q 1PH8A 4K8IA 2Q2IA 4IFDJ 1S5CD 3DXJC 3I4NG 1R9TB 2DNEA 4PMWA 5ELNA 1CHQD 1PV4A 3RLFA 5EKKA 1XNQQ 2ICEC 2F4IA 4DK0A 1WTPA 2EYPA 3BZCA 2IJ0A 3HOVB 4UP9A 1A8VA 2OEOA 4XQQA 1KQSA 2NVYH 3MZ5A 1I5FA 1S4ZA 1PYSB 2CWAA 1J9OA 4H0LC 1RJTA 4BY7G 4BXXH 4R4OA 5IP9G 2F0IA 4IUVA 4DK6C 4GN4B 4O0AA 1JMCA 1A3VA 1CFMA 3CMEA 4IOCA 4DR4Q 2RSOA 3S16H 1G51A 3U50C 5JVH3 1MSHA 3D4RA 4DV4L 3K0YA 1GM5A 1VF5C 4E6IA 4F7XA 1MKHA 2L4NA 4DXFA 2Q2TA 3BDLA 1RTNA 3HOVG 1DYQA 2YTYA 1X32A 1HJPA 3BVZA 1EQQA 2RHSB 3FPUB 1ET6A 2H4OA 1I4GA 1JC7A 2RSNA 2L15A 3BZDB 1Z6HA 4C3IB 5I9PA 3OW7A 1I6HB 5EKIA 1IHZA 4IUNA 1U4RA 1XPUA 1KHIA 3NELA 2I46A 3E6ZX 2R93B 5C44B 1DGSA 4KD3A 2PZTA 4RCNA 3ND8A 4RG1A 2VQFL 4L5RC 3ZJYC 1TS5A 3N6RA 3HEJA 4RCOA 1HR0W 4MN3A 1HUNA 4I7ZC 4RAUC 5K36G 5NUCA 3SHLA 3N52A 4LF6L 1HNXL 1SFOB 4HN7A 3GP7A 2JA7H 3H0GG 3M4QA 1JOQA 2HD3A 5JEAJ 1I50B 4RKLA 2JYOA 3UI2A 3CC4A 4C3IG 1I94L 5CV6A 1VQIA 2QF7A 4X64L 3EQLC 4A4IA 2R93G 5C44G 1SNQA 3DM1A 1YJWA 1WOCA 1EOTA 2VZAA 3Q22A 2B2UC 3UE1A 5J3BA 2Z6KC 4DNTB 3AYHB 3CKIB 1Y1WH 2K7VA 1OXUA 4X62Q 2PPBC 5D14A 4A3JB 1JJGA 3VYUA 4HSPA 3HZXA 2VQEQ 1VS0A 5GAGC 1QUQA 2UUAL 2TMPA 4JCVE 4Y7NH 3ZYYX 4C3HB 1HTLD 1WCMG 2F0KA 3BJUA 3C1EA 3FP9A 5GAHC 1AZQA 1VQ5A 3K81C 5KYIA 1EY7A 2N8NA 4EQOA 3KBXA 3MXUA 1Y8OB 4NXNQ 1GJXA 4JI8Q 1GHJA 3RN5A 2NVXB 2B3GA 2BE5C 2ID0A 4IALA 5M3FG 2RQXA 3J7ZC 3KDFA 3CCJA 1STAA 1S5DD 1JE5A 2K5NA 5I2XA 1LM0A 1YNXA 2JA5H 4DNIA 4A93B 1LO5D 1AE3A 3IFTA 4KJNA 4K2KA 4A3JG 2JA6B 1H9KA 2VXWA 4TVAB 4CHTB 4DR1L 2NVTH 4C3HG 2EVBA 1B1ZA 4ZLTF 1J5EQ 1LV9A 2F0SA 3GTMB 3K8AA 3KK7A 3NHHA 3WWVA 1B2TA 1GVPA 1PH7A 1UE5A 4F87A 3EVQA 5M5WH 1XMQQ 1EOVA 1N36Q 2QDBA 1XMOL 4DV2Q 3S1RH 2OQ0A 1B8AA 3DWAA 1SDFA 4A93G 3NBIA 3ONAB 5IP7G 2JA6G 2IY5B 1CKMA 5JJKA 1M90C 5ISRA 3J81j 4O1NA 4LUOA 2EY6A 1X55A 3NK9A 1N34Q 4DV3Q 1PXUA 1CKOA 4B3TQ 1HRJA 5IGBA 1HHVA 1PRTF 4IJHA 2HDMA 1VQFA 2H5XA 1F9QA 1DZ1A 1GUOA 4WFN3 1BCPF 3GTGH 1BXTA 4K0KL 1XTDA 1IW7C 3S1MH 4A3GH 1X56A 1CKNB 1LTTD 1E2VA 1TKWB 1IL8A 2B2WA 3WOEA 2EY1A 1YNNC 3F2DA 1MBYA 1UWVA 2CW0C 3LWEA 3GTJB 1S40A 1ZKOA 4JBMA 4X6AH 4JBWA 1E7ZA 2NBFA 1LTRD 1UUPA 4F8MA 1Q82C 4GOPA 1RTOA 1PH2A 5HGTA 4XQJA 2N88A 3VYSA 2J0TD 4A3BB 5C4ZA 1MD2D 1V1PB 2QILA 3I4NH 2KQ3A 3MHBA 2LMCB 1JOOA 2EJFC 3TMEA 1DD2A 5D3IB 3BYTB 1X3FA 2IPKD 1N8RC 2GVBA 1C4QA 2PNHA 5IP9H 2K50A 3Q0AA 5JPMC 1H9SB 2K75A 3V05A 2VUMH 3W1GA 3PUYA 3VR6A 1GO3E 2FHTA 3VYTA 2DJFC 4JI2Q 1L0XB 1P8LA 3I70A 1PZID 3I4MG 4NMZA 1HZCA 2RVLA 4XDXA 1CZGA 2HUGA 1WJJA 4L8JA 1R9TH 1PTOC 2JA8G 3Q6SA 3I56A 1XXGA 4X3KA 1U4LA 3PO2B 2F0FA 2KCTA 3HOVH 4KHPQ 1EFID 1ESRA 2F0MA 5DM73 4JC0A 2I5HA 4H13C 2X6GA 3BU2A 1SRUA 1U4PA 4YCUA 3C46A 1ET9A 4JI2L 1HCZA 4X66L 2XN9C 1IYVA 1XTCD 2Z1CA 2PNRC 1PA6A 4P2CB 1K8AC 4B3MQ 2ZXRA 5EPLA 3AFPA 3DHQA 5FJ8H 4LFCQ 5GAEC 1H9RA 1KNEA 3HS0C 4ZKCB 1DOKA 3NP8A 2WKDA 4LAAA 3SGIA 1BR9A 1BNZA 2PQAB 5BR8L 4IOAA 3BS1A 3S1QB 2NN6H 4L63B 1UEAB 4R8IA 1SE3A 5CV5A 1VQLA 2NWGA 4DR7L 3L0OA 3PO2G 5FKAC 4BA2I 2EE1A 2ATWA 2JXMB 1D1IA 4OL7A 3A0JA 3S24A 5KEEA 2PMZE 5I4DA 3H09A 3TBIB 5GADC 4LK1C 4TKOB 3QB3A 1PTOB 2L0CA 4C3IH 1TWAB 1EEFD 2I0QA 2K1BA 1I6HH 1K83B 4ZAIA 1NTGA 1E2WA 2HHHL 5C44H 5JPNC 1QCBD 4A3LG 1E3PA 1V1QA 3TSSA 1ML0D 2UU9L 2GA4B 3EN2A 4O2DA 2NUCA 1CSQA 1JQYD 3M9BA 3SE0A 1SFOH 1FNVA 4LF4L 3D6WA 3URYA 2CQOA 3M4YA 1L0YB 1I50H 1X3PA 1R4QB 3GV3A 4X65Q 1GUTA 2A6HD 1I4QA 3BVGA 4J15A 2ENBA 3QJYA 1LABA 3RZOB 3R93A 4DR3L 3I55A 2F0GA 4OGQC 5C5MA 4BXXG 1Y1VB 1EWIA 1BOSA 2F0JA 3CC2A 4DV0L 1Q90A 2F0QA 2JE6I 4LF8Q 2B2VA 4LWCA 3PIP3 1UE6A 4C3HH 1Q7YC 1WVLA 4CJ0B 1NBWA 1JWSD 5DEHA 4OWXB 4ALPA 4QMGA 1B50A 3C1FA 2UUBL 4B9WA 2I07B 3KF6A 4FO2A 3T1HQ 2NVXH 5E3FA 4OWWB 1IYJB 4MHEA 2CHBD 4WRDA 2RDGA 2EY2A 5ELEA 4PMCA 3V2TA 3A8JE 3ND9A 3OIPA 1UAPA 4OXPA 3CCLA 4A93H 5FK9C 4B3SL 5D3DA 4JI7L 1KIXA 1E22A 5C3EB 1Y1VG 3G71A 1NMFA 1D1KA 5IP7H 2JA6H 3CCEA 2MUYA 2R6GA 2L1BA 1Q86C 4OX9L 4G7OC 2PMZB 5IIFA 1ZXTA 4EX5A 3ERQA 3GTMH 4GNXC 4DK1A 4AQYQ 1KL9A 3AB9A 3MVVA 1XJVA 1GUWA 1EYCA 3T4AC 1NMGA 3MXGA 3K80C 2A6EC 3K57A 5FO7B 5IODA 2JA7G 4KHZA 1TXYA 4OELB 3NTHA 1G2TA 2JK8A 2EIFA 1IBKL 5EPJA 1Q8KA 1PDQA 1CKNA 1NE3A 5KGUA 3HP3A 3KUPA 1SYGA 1PH5A 1IXRA 3HG9A 1C48A 1D5XC 1BUVT 1Q46A 2B39A 5I9OA 1B53A 1YHBA 1JWMD 3U9OA 5JJIA 1EU4A 3MEHA 4DN4M 1BVSA 1B3QA 5IE8A 1G291 4PQXA 5ELFA 5CV8A 3CRLC 2DUDA 5KNBA 3UDGA 3VA5A 3L2PA 1V1OA 3NENA 1AH9A 1Z9FA 1STHA 3OSOA 1SYBA 3GTJH 3QWNA 3S2HH 4A76A 4MTNA 5KNCA 2JP1A 1FD7D 2HQEA 1CTMA 1H9JA 1CUKA 3A54A 3KDFB 4A3BH 3S17B 4LJZC 2Z8LA 4OWTB 1EZ6A 4RMFA 4IPCA 3X3MA 3J7AF 5EGTA 4FXGC 1RCVD 1KNAA 1F77A 5KIXA 3TS0A 1VQMA 3KLSA 1B4OA 2JA5G 2F0PA 2B63B 2XIWA 1WTXA 2CWPA 4F88A 1LTGD 3IFDA 3M4OB 4JV5Q 2LXJA 5C4JB 3T56B 2AUJD 1M4VA 4BY1B 3DWQA 4DFAA 5FO9B 1VQEA 1VQOA 4GKJL 5EJWA 4A3DB 1BKBA 1HNZQ 3OPOA 1FYCA 1AE2A 5F2DA 1DXMA 2F1MA 1HNWQ 5C4XB 4A3GB 1D5MC 2HCCA 1HR0Q 1ASZA 2ZM6Q 2OT2A 4JW0A 3PO2H 4HMJA 4CGYB 3CPWA 3PCOB 2B63G 2AQ2B 2C35B 5FOBB 1NNXA 5LMNW 3NPPA 4DUYQ 1EFWA 2G9DA 2E74C 1V9PA 3D31A 3SK5A 1L1OA 2MFIA 4BY1G 1DOMA 3TZUA 1ASYA 1KDBA 4A3DG 2UXCL 2WB1E 1HR0L 2UUCQ 4NB3A 4HR7B 3MWYW 1E1OA 2G5DA 2VW9A 5EQ0A 3IAYA 5KRUA 5IT9E 2MO1A 2D9UA 3WDNA 5C4XG 4HIOA 3S1QH 1VQPA 4A3GG 4YY3L 4MZ9A 2E5LQ 5AJ3Q 1QVGA 4NW2A 3A7AB 5CC4A 4POFA 5CV7A 4QCLA 4HIKA 4KJOA 5J22A 3G4SA 3D0FA 4LUVA 1PTOH 1TWAH 1SYCA 3F2CA 4XIGS 2O2LD 3EA6A 4G7HC 4KY7A 2UXBL 1K83H 4HCSA 2BOSA 2PW5A 4LMQD 5CBAE 2UXDQ 4GS3A 1EWHA 1PH1A 4P74A 5AJ3L 4JI6Q 1SAPA 2XNAC 3FMCA 3EJIA 1NUCA 1B3AA 1Y8PB 3NTIA 4NXMQ 4JI5Q 1YVCA 1N32L 1H95A 4FXKC 3PUWA 2KUMA 1F9PA 1I3QB 1VQHA 3M7NA 2JSOA 3HOYB 2AWNA 3I4LA 1P16A 2VUMG 1SBBB 3D8GA 4XXEA 1JT8A 3SDZA 1VQGA 2JEAI 1E0BA 2L9HA 5M3MB 1E24A 1IBMQ 1M8AA 5JVG3 1XNQL 3GTOB 1MJEA 1OO9B 4K6LA 4NXML 1KRSA 1BBUA 4R4CA 1RIPA 4A3FB 3HKZB 3CMAA 2VB2X 3RZOH 1EYAA 4DV7Q 1XYIA 1U0LA 3NQIA 3HOYG 4DR4L 2F03A 3M85A 1Y1VH 2KOLA 3GQBA 5M5YB 1IBML 3IL8A 1SMXA 4CKCA 3T53B 1X6OA 4G4KA 5FJ8G 1K73C 2PZUA 3S9WA 1CSPA 2XSCA 5M3MG 3PUZA 4FP5D 2A68C 2Y0SE 4HJ5A 3NBHB 3NXWA 1B44D 1YZ6A 2K04A 3F1ZA 4YHHQ 3EFXD 3I91A 2BE5D 2WAQE 2EJMA 4X3UA 4AYBE 2NN6G 1WTWA 2WB1B 1DCZA 2HQLA 2WIIB 5LHY1 1WTRA 1WTQA 1HFGA 1W6KA 1TS3A 1YNJC 4K8JA 5C3EH 1O7LA 3BDOA 1BF4A 1IL2A 1FNUA 3AU7A 5C5LA 3STBC 2B2VC 4YHHL 4KN4C 1QVCA 4A3CH 1YHAA 1EYDA 1LACA 1UEBA 1O7ZA 3U9SA 4CBVA 4DPGA 3I90A 1MSGA 4DUZQ 2A8VA 3PUVA 2WB1G 2ZTDA 1YI2A 1MGSA 4KKUA 3F8TA 4AH6A 4V190 1RL2A 1GOZA 2F52A 5EAYA 3J81c 1EWCA 4MNOA 4UHVA 4UPAA 2YTXA 1LT4D 1WD0A 4DV5Q 2EYHA 1SE4A 1SROA 3PIPA 3IKJA 3A74A 5ELOA 2OQKA 3GTPB 3Q8DA 4JI3Q 4GNXA 2MNAA 3OOCA 1PFNA 3OMGA 4PMBA 1G91A 3T13A 1A3UA 2SDFA 2JJQA 1PH6A 1TY2A 4X62L 3SK6A 1YEZA 4LF7Q 1C8CA 1JE4A 3VYRA 2B8GA 2RHQB 1V8QA 2FMCA 1IW7D 2VQEL 3J81L 2EYMA 4LUZA 3TP6A 4WJ4A 3F2BA 2LKVA 4BBRB 1SYFA 1YNND 2NZ1D 3FKIB 3RUZA 2CW0D 4NXNL 4JI3L 2LXKA 1V43A 3PIO3 1NSNS 3MEFA 4JI8L 5CBEE 3KF6B 2IHFA 4P71A 2KEEA 4NP5A 1PFMA 4ZUIA 2IT1A 2K5WA 1TWFB 3S17H 2A74C 1JB7A 1HPCA 4KI0A 3NEMA 5AFWA 1CHPD 2Y0SB 1YITA 1WI5A 1O7IA 3OTOQ 4DAYB 1TWGB 4RGOS 3E3XA 3S2DB 2WAQB 4AYBB 2Q8RE 4ODGA 2B63H 2WACA 4GZYC 4QUFA 1J5EL 4A75A 3M4OH 1CM9A 3H6MA 2L55A 3VDYA 3FKIG 1QB5D 3CCRA 5C4JH 1VQKA 1EIFA 2NZOA 4FF1A 5JJLA 1EY5A 5KYLA 3GO5A 4BY1H 1XMQL 1SSOA 4FF3A 1LUZA 5ELCA 1N36L 4A3DH 3TN2A 1TIID 3W3AA 1JR0D 2KBNA 1H9MA 3AFQA 3HRZC 4DV2L 4LF5Q 1CA6A 1NJIC 1NAPA 5FO8B 2F0LA 3Q24A 1PTOD 1DOLA 2X6LA 3CAMA 1PRTC 5C4XH 3W5OA 2F4VQ 1D2BA 4QUCA 3W1BA 2DY7A 1BCPC 4DGZA 2WAQG 1LTSD 4AYBG 3J80c 4GLAC 2Q2HA 3PF4A 1N34L 3PGZA 1U4MA 5C0XG 4DV3L 4X3TA 4Z9CB 3S2HB 2I5LX 4B3TL 2R7DA 3S1NB 2Z0SA 2E2HB 3K6OA 4FF2A 2KENA 1BDOA 5COYA 5A35A 3PSIA 3R2TA 3CCQA 3GTLB 4B3RQ 2B2YC 3E0JA 1KLGD 2PYKA 5IT9c 4J8QA 1NY4A 5EBDA 4DU9A 3ULLA 1PHJA 3C3LA 4H44C 3A5UA 2MP1A 5IY0A 3FVQA 3A55A 3K5MA 3O13A 1K8MA 2OTJA 4DNRB 5IWAQ 1L1OC 1PRTB 4YWKA 2F0DA 4A3BG 4A3IB 4N9TA 1FGUA 1PZKD 2M9VA 5IT9L 2IWHA 1Q81C 1QG7A 2R61A 4Y52H 1UE1A 5BN4A 4DR5Q 3W2DA 1Y69U 1U9RA 2PQEA 4ID6A 3GDEA 2QCPX 3K5OA 1ICFB 5FLXc 3BZKA 1SNCA 1I3QH 1F2ZA 1RODA 3HOYH 4R4QA 3CCMA 1ILPA 3RNUA 5CORA 4FVMA 1FJGQ 4J6HA 1JORA 1QOHA 1GHKA 1KAAA 1YBYA 4UP7A 5M3MH 1AFPA 2ASBA 3GTOH 2XWBB 4KHPL 3M3YB 2CH4W 3MXNA 2RCNA 2Q8TA 2MQHA 1HH2P 2F0EA 4A3FH 2BDOA 4KN7C 1EQTA 3NBHA 5EBCA 1VQ8A 1XPRA 1L1OB 1IYUA 4B3ML 2E2JB 1X65A 2WKCA 4LFCL 3FDTA 5M5YH 1AZPA 4OO1H 2RKSA 1SLJA 2ZTCA 1B7YB 4PG3A 3QG1A 1SE8A 1JCKB 3TS2A 2QGQA 1HXYD 5C3WA 2BDNA 2HDLA 2KHIA 2RBMA 2A19A 3AQQA 5KNDA 4LFBQ 1VCIA 1JWUD 1SJED 1LT5D 2QDLA 1O78A 1LYLA 1FR3A 5DLQE 4LF9Q 1ZEQX 3TEHB 2E2DC 4QGUA 1VQ7A 4QF4A 1NR2A 3TDQA 4C1NI 4TSSA 2EQSA 1A63A 1GUGA 4A3MB 3G7LA 3HFZB 3MTSA 3LGJA 4BA1I 2I5MX 2XRQD 2K5QA 2FFKB 4NKLA 4EVOA 2E8GA 3T1YQ 3K7AB 4DF7A 4HJ8A 3EROA 1G2SA 2A6ED 1HZAA 4X65L 4APVA 4JOIA 4HMIA 4XQNA 4ZCKA 4ZK9B 4AIMA 4K5VA 5CV9A 3CU7A 2DGYA 5CYUA 3FRPB 1ZYRC 1RDPD 2KA7A 2L5TA 5CMDA 3J7A5 3OYYA 3GTPH 1IKMA 4A3EB 2WV6D 2NN6I 5IGGA 4OIJA 3I73A 1B9NA 1AN8A 2K05A 2ZT9C 2XWJB 5T1GA 4M8AA 2F0TA 4QL5A 3P20A 1K9MC 4NDXA 1HZBA 4LF8L 2IL8A 3HOWB 1A15A 1N9WA 3EIVA 4BBRH 1SYEA 1L2FA 3VR3A 5LMNQ 3FKIH 5LL6X 4DAYA 3KJPA 5DAUA 4JYAQ 1C7YA 3HOZB 3J81i 3VA7A 2D0PA 4OEMB 1PVOA 4GLXA 3T1HL 4RHSA 2EYOA 5M5XB 3VR4A 1TWFH 3A7LA 5I6YA 1X3GA 2RCFA 3H91A 5G3LD 5JAVA 1GD7A 2F0VA 1D6EC 1UNSA 2L11A 4OIKA 1TWGH 5HGQA 4HIDA 4XYQA 3UDXA 1N33Q 4JYAL 4RWSC 3S2DH 3HOWG 3J81E 4IUUA 5C3EG 4A3KB 2BH8A 4QY7A 5C0XH 1OTCA 3A5ZB 3CD6A 1A2UA 1QWYA 4ZRZA 4AQYL 2AUKA 5A2QE 3HOZG 1K3RA 2RDFA 4LFAQ 4DXGA 4A3CG 1TS4A 1JJ2A 1X9NA 4ZQ3A 1EU3A 1U5KA 1D5ZC 2F0HA 1BBWA 2F0OA 1PH3A 4R4TA 1VQBA 3MXPA 1W2BA 1ENAA 3OWEB 4KKSA 4DAPA 2DNCA 4S3SA 3I7FA 2WFWA 4GNXB 2R7ZB 1SMYC 4YWLA 1KD1C 1TVXA 3PIOA 2B8FA 1PFSA 4FF4A 3L9AX 2E2HH 3S1NH 4C3JB 3OIQA 1XNRQ 2NVQB 1A3TA 4Q5VA 4L5TA 1FL0A 5TSSA 1AP0A 2WP8J 4PV1C 3CP0A 3AEVA 3GTLH 4QB4A 3SK8A 1S3OA 4RGTA 3T16A 3SK4A 1HZ9A 1OXSC 2Q2UA 3G48A 2XTIA 4PNYA 1PYWD 3CW2C 2VB3X 2YTVA 1SXTA 1TT2A 2XRSD 3DMUA 1SE2A 4LNQA 2NZHA 1K3BC 2R7ZG 2R92B 1VQ6A 3BVMA 3K0XA 4DAVA 1VQJA 4C3JG 1ONLA 1HQRD 3HKZE 2J4XA 3OMCA 4A3IH 4JI4Q 4JG2A 2GVAA 2B2YA 2K32A 2B2TC 4KK7A 1ESFA 1F2LA 5GQOA 3D3RA 2AMCB 1R4PB 4RKBA 2IW3A 4JV5L 2MHVA 3KJOA 1VQCA 5E4XA 4DR6Q 5C0XI 1FNWA 2DJGC 1X54A 2ALYB 3J80E 3ULJA 5LL6S 1CZWA 2SNMA 4GKKQ 1HNZL 1Y8NB 1RKNA 4JPBW 2OF1A 2XGTA 3I3CA 4IPHA 3U4ZA 3H3VC 1HNWL 1WD1A 2ICIA 4K2LA 4JI0Q 2K6AA 4DR2Q 1SJHD 4EQNA 1B70B 2SEBD 2DN8A 2ZM6L 1D7QA 4FXDA 4BBSB 4O42A 1STEA 3MA2B 3M3YH 1PH4A 1E1TA 5CV4A 1QNUA 4YWMA 1EEID 4I7AA 1STNA 4DUYL 4L5SA 2IHEA 1C9OA 2HIXA 3TP5A 2VY3A 5C3XA 4YCWA 1YIJA 2K5DA 4KD4A 2E2JH 2KVMA 1QVFA 1SNPA 2UUCL 4KV6A 1RHPA 4OHJA 3V96A 2R3ZA 2OWOA 1EY8A 1I4HA 1KAWA 3CC7A 1EYGA 1EL0A 4B9XA 3FHWA 2LS01 3JAMc 2E5LL 1TQOA 1AW7A 2A69C 4BY7B 3NSWA 1T5EA 2ZJQA 3CRKC 1LLRD 1QJOA 1PMRA 2K01A 2E75C 5FLXE 1KRTA 3DUZA 2HIVA 2FJ2A 2D2CC 1YNJD 3IRBA 2X69A 1DM0B 4C2MB 4HJ7A 3PO3B 1TWHB 2UXDL 4A3MH 4I65A 4HCEA 3STBD 1GUSA 1TWCB 4JI6L 3JAML 1EIHA 5IGFA 4CDCC 2N55A 4V0BA 2DY8A 1CQFA 4JI5L 1Q8IA 3CCUA 4IO9A 4DV4Q 2PI2E 2VNUD 4N9PA 5EKLA 3K7AH 4IUQA 3X3NA 4CKBA 3PQIA 3K58A 1Q12A 5C6AA 1SN8A 2OTLA 1E2ZA 4CKEA 1GKHA 2QEXA 3TREA 3MXNB 3PO3G 2K14A 2ZTEA 1FGBD 3KLSX 4Q0FA 5CR3A 4YIJA 4A3EH 1KXLA 2VQFQ 4DV7L 5IGCA 1JB3A 5M9OA 1MHWC 3RD4A 3H0GB 4A3FG 3HKZG 1VDZA 1J8IA 3DM3A 3P75A 4XYOA 4LF6Q 1W3SA 3G6JB 3KF8A 1HNXQ 3P7JA 2ZXOA 4XTCS 4K6DA 4RGMA 5HY6A 3HOWH 4JOIC 3DEOA 3GTQB 4OO1G 4K5WA 5C0XJ 1C0AA 2LFNA 3AMUA 3OHXC 5GROA 3ER0A 1WFQA 2CKZB 1I94Q 1K8GA 3HOZH 1K8OA 3U4VA 4X64Q 2E2IB 1EY9A 1IKLA 1CA5A 1J6QA 4UAIA 5M5XH 2HCIA 3DWPA 2F3VA 1JICA 3QIAA 4P72A 1YHQA 1VMPA 4QIWE 1HQMC 3G6EA 2MGSA 1QNKA 1VMCA 2JA9A 1WCMB 3KYHC 1KABA 1TU2B 4RHRA 2ZJPA 4KKTA 2CFMA 1S5BD 2EZVA 5FLMG 4A3KH 1A2TA 1B9MA 2UUAQ 1VQDA 4LW1A 4C1NK 3TP8A 1PYBA 3CCSA 2F0WA 4DUZL 5M3FB 4QQBX 2CQAA 4ZUJA 4TRDA 4ULLA 1HUMA 1JOKA 1PRTD 1F2YA 3E9HA 2VS1A 3QO2A 4HSVA 3NQTA 1PZJD 3FPPA 4DV5L 1BCPD 1EY6A 4UP8A 4IFDG 3L3OC 5A2QL 1EY0A 1Q1BA 1Z47A 2FXQA 2SOBA 1F2MA 2R7ZH 2JQOA 1KDAA 3ITPA 1JJCB 2V1CC 4DR1Q 3SR1A 2O5IC 4C3JH 4LF7L 3R3OA 4ABNA 2NTTA 2NVQH 1X3QA 2QA4A 1HFNA 5IYCG 2BCOA 2K5VA 4N8X1 2J7ZA 2V4DA 1S72A 1I6VC 2BA1A 2N49A 1XMOQ 2M2LA 2IX1A 1RF2D 1I4XA 2PZWA 3K59A 4IPDA 3HOUB 3HOXB 3I8ZA 4HAEA 4BBRG 2EJGC 1QILA 1WTHA 4R9WA 3GTKB 5IYBG 1L0WA 2KCCA 2FINB 4MIUA 2CCZA 2R92H 2K52A 3D6CA 4BS9A 2QW7A 3SEBA 4EQ5A 3MC0B 3OTOL 2IX0A 2NTSA 4H7BA 4K0KQ 2KECA 2KEDA 2Y0SG 1NCVA 1VQNA 3VR2A 3S14B 3QOLA 1HA6A 4C56C 1M1KC 3HOUG 3HOXG 2D5DA 2LY7A 4XT3B 4QIWB 3PF5A 1ILQA 1VQAA 4LF5L 1PFBA 3BYYB 3Q23A 3K5LA 1YJ9A 2KCNA 3OW2A 3TRZA 1SEBD 4CDFC 4K5XA 5H1SE 2AKWB 2YV5A 1IBLQ 2F4VL 4KMUC 2B2TA 4JI1Q 3P1HA 4IUTA 4BBSH 3BG3A 3RN2A 1KLUD 1EQRA 1OXTA 5JEAG 3J80L 2YYZA 1SYDA 4IPGA 4R8NA 2B29A 5IYDG 2G9HD 3H15A 3I4MB 4GN3B 1FVIA 1IBLL 2CH4A 3NUCA 3TP7A 4B3RL 4JI1L 2JA8B 2AWOA 1QE6A 3SXHA 4GN5A 2EXDA 2F3WA 2JEBI 1BCPB 1Q3LA 3QR8A 1OXVA 3HKSA 3KFUA 5DM63 4G7ZC 1EY4A 2EYJA 3K5NA 4BY7H 3E5SA 4UDUC 5CGKA 2AQ1B 3A56A 3RZDB 4L5QA 3S15B 3H3VH 5IWAL 4DKAC 3A8IE 1GUNA 1EQVA 1PTOF 3ERSX 4X66Q 5K5PA 1G8ZD 2YU9B 4L6TB 1X3EA 4C2MH 3PO3H 1TWHH 2QEJC 4DV1Q 4PZ8A 2EDGA 1TWCH 1TY0A 2C5CA 1RD9D 1F9RA 4DV6Q 4DR5L 4A3IG 3RLNA 5EPKA 5BR8Q 5L37A 1KTKA 4POGA 4DAMA 3DLLA 1G6ZA 4EGVA 1LT6D 5FLXL 3C2PA 3JAMi 3R8BA 4DR7Q 3J7YW 2H1EA 4WORA 3GV6A 2NB0A 1FJGL 1G6PA 1EIYB 3RLOA 3NTKA 1EIGA 4DV1L 1EUJA 2L12A 4WJ3M 1II3A 2KHJA 2RDHA 1DONA 3D4WA 4DV6L 4IURA 1A62A 1CT1D 1Y14B 4U68A 1S5ED 1ZYRD 4HJ9A 3UE0A 2HHHQ 1STGA 3CQZB 2A1AA 3JAME 5K36H 2PCFB 1LTAD 2UU9Q 2OCEA 4KHVA 3H0GH 1T5XD 2N78A 4GLVB 1MIUA 2EYFA 1MI2A 2NYZD 2AQ3B 1LT3D 4LF4Q 5LMUQ 4RA8A 1STYA 4YCVA 3GTQH 4IQZA 4ZYSA 5FLMH 1I4PA 2RF4A 4P73A 2R93H 3E9IA 4HTHA 1F9SA 4LFBL 1GXDC 3MAQA 2EPBA 4TQUS 1OXXK 4H02A 2F0UA 1UE7A 2E2IH 1KDCA 3I2ZA 4LF9L 2NVYB 2Q8IB 3U58A 5E4WC 1AEXA 4JVZA 4CJ1B 1XPOA 4R1JA 1Z7TA 3H3VI 5LMUL 1ENFA 4DR3Q 2AHOB 5HURA 1XWEA 2VL6A 2ZJRA 2K03A 2GN5A 3TQYA 4NPSA 4FDBA 3JC66 3PMFA 1WCMH 3S16B 4IFDH 4DV0Q 2SNSA 3F2UA 1SNDA 3NWTA 2PI2A 3LWUA 4A3MG 2MPMA 3A8KE 3OWFA 4HEDA 5DNFA 3T1YL 3T51B 1VQ9A 5E1FA 5M3FH 3RMHA 1NR4A 1ICWA 1A6XA 5IYCH 2UUBQ 4IZ8A 1O80A 1SNOA 4RH6A 2O5JC 4X3SA 2EYLA 4A3JH 4ZKBB 3SVMA 1QZGA 1WYDA 2QKIC 3CXCA 3FEWX 1LTID 3NE5B 4B3SQ 2O4XA 4JI7Q 4IJLA 4OO1I 2P5ZX 2FMMA 1STBA 2RA4A 1CI3M 2MO0A 3K7UC 5J1ZA 2KHSA 5BN3A 3HGBA 4PZ7A 5D65A 1SMYD 3CCVA 5IYBH 4RFBA 4OX9Q 5BN5A 3BDCA 5IGEA 2B2UA 3DEPA 2KCMA 2Z6KA 2EXZA 3UDIA 4A3EG 2K5HA 1TR5A 4DK3C 4KY5A 3KF8B 2BA0A 1SNMA 2JA7B 4JK1C 5IGDA 4QJFA 3GD7A 5JOBA 1W6JA 4XT1B 1BBXC 5LMNL 2JN4A 3HOUH 2A6HC 3HOXH 4MTKA 1CK1A 4JBJA 1WTOA 3EBEA 4UY8C 1IBKQ 2WINB 3GTKH
chains in the Genus database with same CATH topology
4G57A 4U673 1Y1WB 3MFYA 2Z4IA 2A73B 2D62A 5I2YA 3H94A 2K33A 1BO0A 4IFDI 5JEAH 1XX8A 4Y7NB 4ILWA 3LX0A 2M00A 4IUPA 4ME5A 2PO4A 3PUXA 1PLFA 3NWSA 2MJ8A 4WJWA 3D4DA 4B08A 1I4RA 2JA5B 4KY6A 1V1PA 2K28A 2OXPA 3M7GA 4DA2A 1LTBD 1HTPA 2NVTB 5J39A 3TZDA 5G3LF 3KLRA 3KBGA 2EY5A 1HA5A 3VR5A 3R2IA 1H9SA 5ELBA 3J7AV 2C9OA 5M5WB 2F0NA 2KJXA 3I72A 4M1UB 3CHBD 2ZXPA 1TS2A 3S1RB 5IOCA 1DJRD 5C4HA 2IX3A 2A69D 2B2WC 2A5HA 1VF7A 2XVSA 4FYDA 3QOJA 1CQVA 3WOFA 3MFGA 1BQQT 3GTGB 3S1MB 1WTVA 4J1MA 4RGNA 4KTAA 1O7YA 1EZ8A 2TSSA 5I6WA 5JJZA 1ENCA 4IN3A 4BWGB 3I4NB 2PW7A 5ELDA 3L7ZC 4CJ2C 3PV0A 2A68D 1S5FD 3LNNA 4K14A 2CVRA 2E76C 2Z4HA 4EQPA 5T1IA 2EOTA 4FNFA 2VUMB 1Q1EA 4K8IA 4IFDJ 1S5CD 3DXJC 1R9TB 2DNEA 4PMWA 1CHQD 3RLFA 5EKKA 4DK0A 2ICEC 2F4IA 1WTPA 2EYPA 2IJ0A 3HOVB 2OEOA 4XQQA 3MZ5A 1S4ZA 1J9OA 4H0LC 1RJTA 2F0IA 4IUVA 1A3VA 1CFMA 2RSOA 5JVH3 1MSHA 3D4RA 3K0YA 4E6IA 1VF5C 4F7XA 2L4NA 4DXFA 3BDLA 1RTNA 1DYQA 1X32A 3BVZA 3FPUB 1ET6A 2H4OA 1I4GA 1JC7A 2RSNA 3BZDB 1Z6HA 4C3IB 5I9PA 3OW7A 1I6HB 5EKIA 1IHZA 4IUNA 1U4RA 2I46A 3E6ZX 2R93B 5C44B 4KD3A 2PZTA 4RCNA 3ND8A 1TS5A 3N6RA 3HEJA 4RCOA 4MN3A 1HUNA 4I7ZC 4RAUC 5K36G 5NUCA 3SHLA 3N52A 1SFOB 4HN7A 3GP7A 1JOQA 5JEAJ 1I50B 4RKLA 2JYOA 3UI2A 4C3IG 5CV6A 2QF7A 3EQLC 1SNQA 3DM1A 1EOTA 3Q22A 2B2UC 4DNTB 3CKIB 2K7VA 1OXUA 2PPBC 5D14A 4A3JB 3VYUA 4HSPA 3HZXA 2TMPA 3ZYYX 4C3HB 1HTLD 2F0KA 3C1EA 1AZQA 5KYIA 1EY7A 4EQOA 3KBXA 3MXUA 1Y8OB 1GJXA 1GHJA 2NVXB 2BE5C 2ID0A 4IALA 2RQXA 1STAA 1S5DD 4A93B 5I2XA 1LO5D 3IFTA 4KJNA 4K2KA 2JA6B 1H9KA 2VXWA 4CHTB 4C3HG 2EVBA 1B1ZA 4ZLTF 1LV9A 2F0SA 3GTMB 3KK7A 3NHHA 1B2TA 4F87A 3EVQA 2QDBA 3DWAA 1SDFA 3NBIA 3ONAB 5ISRA 4O1NA 2EY6A 3NK9A 1PXUA 1HRJA 5IGBA 1HHVA 1PRTF 2HDMA 1F9QA 1DZ1A 1GUOA 4WFN3 1BCPF 1BXTA 1IW7C 1LTTD 1E2VA 1TKWB 1IL8A 2B2WA 3WOEA 2EY1A 1YNNC 1MBYA 2CW0C 3LWEA 3GTJB 1ZKOA 4JBWA 2NBFA 1LTRD 1UUPA 4F8MA 1RTOA 5HGTA 4XQJA 2N88A 3VYSA 2J0TD 4A3BB 5C4ZA 1MD2D 1V1PB 2QILA 2KQ3A 3MHBA 2LMCB 1JOOA 2EJFC 3TMEA 1DD2A 5D3IB 3BYTB 2IPKD 1C4QA 3Q0AA 5JPMC 1H9SB 3V05A 3PUYA 3VR6A 2FHTA 3VYTA 1L0XB 3I70A 1PZID 4NMZA 2RVLA 4XDXA 1CZGA 2HUGA 4L8JA 1PTOC 3Q6SA 1XXGA 4X3KA 1U4LA 3PO2B 2F0FA 1EFID 1ESRA 5DM73 2F0MA 4H13C 2X6GA 1U4PA 3C46A 1ET9A 1HCZA 2XN9C 1IYVA 1XTCD 2Z1CA 2PNRC 4P2CB 2ZXRA 5EPLA 3DHQA 1H9RA 1KNEA 3HS0C 4ZKCB 1DOKA 3NP8A 2WKDA 4LAAA 1BR9A 1BNZA 3BS1A 3S1QB 2NN6H 4L63B 1UEAB 4R8IA 1SE3A 5CV5A 2NWGA 5FKAC 4BA2I 2EE1A 2JXMB 1D1IA 4OL7A 5KEEA 5I4DA 3H09A 3TBIB 4LK1C 4TKOB 3QB3A 1PTOB 2L0CA 1TWAB 1EEFD 2K1BA 1K83B 4ZAIA 1E2WA 5JPNC 1QCBD 3TSSA 1ML0D 2GA4B 2NUCA 1JQYD 3SE0A 1FNVA 3D6WA 3URYA 3M4YA 1L0YB 1X3PA 1R4QB 3GV3A 1GUTA 2A6HD 1I4QA 3BVGA 2ENBA 3QJYA 1LABA 3RZOB 3R93A 2F0GA 4OGQC 5C5MA 1Y1VB 1BOSA 2F0JA 1Q90A 2F0QA 2JE6I 2B2VA 3PIP3 1WVLA 4CJ0B 1JWSD 5DEHA 4QMGA 1B50A 3C1FA 4B9WA 2I07B 4FO2A 5E3FA 4MHEA 2CHBD 4WRDA 2RDGA 2EY2A 5ELEA 4PMCA 3V2TA 3A8JE 3ND9A 3OIPA 1UAPA 5FK9C 5D3DA 5C3EB 1D1KA 2MUYA 2R6GA 2L1BA 4G7OC 2PMZB 5IIFA 1ZXTA 3ERQA 4DK1A 3AB9A 3MVVA 1GUWA 1EYCA 3T4AC 3MXGA 2A6EC 3K57A 5FO7B 5IODA 4KHZA 3NTHA 1G2TA 5EPJA 1PDQA 5KGUA 3HP3A 3KUPA 1SYGA 3HG9A 1D5XC 1C48A 1BUVT 5I9OA 2B39A 1B53A 1JWMD 3U9OA 1EU4A 3MEHA 4DN4M 1G291 4PQXA 5ELFA 5CV8A 3CRLC 5KNBA 3VA5A 1V1OA 1STHA 3OSOA 1SYBA 3QWNA 5KNCA 2JP1A 1FD7D 2HQEA 1CTMA 1H9JA 3A54A 3S17B 4LJZC 2Z8LA 1EZ6A 3X3MA 3J7AF 5EGTA 4FXGC 1RCVD 1KNAA 1F77A 5KIXA 3KLSA 1B4OA 2F0PA 2B63B 2XIWA 1WTXA 4F88A 3M4OB 1LTGD 3IFDA 5C4JB 3T56B 2AUJD 1M4VA 4BY1B 3DWQA 4DFAA 5FO9B 4A3DB 5EJWA 3OPOA 1FYCA 5F2DA 1DXMA 2F1MA 5C4XB 4A3GB 1D5MC 2HCCA 2OT2A 4CGYB 4HMJA 2AQ2B 5FOBB 3NPPA 2G9DA 2E74C 3D31A 3SK5A 1DOMA 3TZUA 1KDBA 4HR7B 3MWYW 5EQ0A 3IAYA 5KRUA 5IT9E 3WDNA 2D9UA 4NW2A 3A7AB 5CC4A 5CV7A 4QCLA 4KJOA 5J22A 1PTOH 1SYCA 4XIGS 2O2LD 3EA6A 4G7HC 4KY7A 4HCSA 2BOSA 2PW5A 4LMQD 5CBAE 1EWHA 1SAPA 2XNAC 3FMCA 3EJIA 1NUCA 1B3AA 1Y8PB 3NTIA 4FXKC 3PUWA 2KUMA 1F9PA 1I3QB 3M7NA 2JSOA 3HOYB 2AWNA 3I4LA 1SBBB 3D8GA 4XXEA 3SDZA 2JEAI 1E0BA 2L9HA 5M3MB 1M8AA 5JVG3 3GTOB 1OO9B 4K6LA 4A3FB 3HKZB 2VB2X 1EYAA 1XYIA 3NQIA 2F03A 3M85A 3GQBA 2KOLA 5M5YB 3IL8A 4CKCA 3T53B 4G4KA 2PZUA 3S9WA 2XSCA 3PUZA 4FP5D 2A68C 3NXWA 1B44D 2K04A 3EFXD 3I91A 2BE5D 2EJMA 4X3UA 2NN6G 1WTWA 2WB1B 1DCZA 2WIIB 5LHY1 1WTRA 1WTQA 1HFGA 1W6KA 1TS3A 1YNJC 4K8JA 1O7LA 3BDOA 1BF4A 1FNUA 3AU7A 5C5LA 2B2VC 4KN4C 1EYDA 1LACA 1O7ZA 3U9SA 4CBVA 3I90A 1MSGA 3PUVA 1MGSA 4KKUA 4V190 1GOZA 1EWCA 1LT4D 1WD0A 2EYHA 1SE4A 3IKJA 3GTPB 3OOCA 1PFNA 3OMGA 4PMBA 1G91A 3T13A 1A3UA 2SDFA 1TY2A 3SK6A 1C8CA 1JE4A 3VYRA 2B8GA 1V8QA 2FMCA 1IW7D 3J81L 2EYMA 3TP6A 2LKVA 4BBRB 1SYFA 1YNND 2NZ1D 3FKIB 3RUZA 2CW0D 3PIO3 1V43A 1NSNS 5CBEE 2KEEA 4NP5A 1PFMA 4ZUIA 2IT1A 2K5WA 1TWFB 2A74C 1HPCA 4KI0A 5AFWA 1CHPD 2Y0SB 1TWGB 4RGOS 3S2DB 2WAQB 4AYBB 2Q8RE 4ODGA 2WACA 4GZYC 4QUFA 1CM9A 3H6MA 2L55A 1QB5D 4FF1A 1EY5A 5KYLA 3GO5A 1SSOA 4FF3A 5ELCA 3TN2A 1TIID 3W3AA 1JR0D 1H9MA 3HRZC 1CA6A 1NAPA 5FO8B 2F0LA 3Q24A 1PTOD 1DOLA 2X6LA 1PRTC 1D2BA 4QUCA 2DY7A 1BCPC 4DGZA 1LTSD 1U4MA 5C0XG 4X3TA 4Z9CB 3S2HB 2E2HB 3S1NB 3K6OA 4FF2A 1BDOA 5COYA 5A35A 3R2TA 3GTLB 2B2YC 3E0JA 1KLGD 2PYKA 4J8QA 5EBDA 4DU9A 3C3LA 4H44C 2MP1A 3FVQA 3A55A 3K5MA 3O13A 1K8MA 4DNRB 1PRTB 2F0DA 4A3IB 4N9TA 1PZKD 5IT9L 2M9VA 2IWHA 1QG7A 2R61A 5BN4A 3W2DA 1Y69U 1U9RA 2PQEA 4ID6A 3K5OA 2QCPX 1SNCA 1F2ZA 1RODA 1ILPA 5CORA 4FVMA 4J6HA 1JORA 1QOHA 1GHKA 1KAAA 1AFPA 2XWBB 3M3YB 3MXNA 2Q8TA 2F0EA 2BDOA 4KN7C 1EQTA 3NBHA 5EBCA 1IYUA 2E2JB 2WKCA 3FDTA 1AZPA 4OO1H 2RKSA 3QG1A 1JCKB 1HXYD 5C3WA 2BDNA 2HDLA 2RBMA 5KNDA 1VCIA 1JWUD 1SJED 1LT5D 1O78A 1FR3A 1ZEQX 2E2DC 4QF4A 1NR2A 3TDQA 4C1NI 4TSSA 1GUGA 4A3MB 3G7LA 3MTSA 4BA1I 2XRQD 2K5QA 2FFKB 4NKLA 4EVOA 3K7AB 4DF7A 3EROA 1G2SA 2A6ED 4HMIA 4XQNA 4ZK9B 4K5VA 5CV9A 3CU7A 5CYUA 3FRPB 1ZYRC 1RDPD 2KA7A 2L5TA 5CMDA 1IKMA 4A3EB 2WV6D 2NN6I 5IGGA 4OIJA 3I73A 1B9NA 1AN8A 2K05A 2ZT9C 2XWJB 5T1GA 4M8AA 2F0TA 3P20A 4NDXA 2IL8A 3HOWB 1A15A 1SYEA 3VR3A 5LL6X 4DAYA 5DAUA 3HOZB 3VA7A 4RHSA 2EYOA 5M5XB 3VR4A 3A7LA 5I6YA 3H91A 5G3LD 5JAVA 2F0VA 1D6EC 1UNSA 2L11A 4OIKA 4XYQA 4RWSC 3J81E 4IUUA 4A3KB 5C0XH 1A2UA 1QWYA 4ZRZA 2AUKA 5A2QE 2RDFA 4DXGA 1TS4A 4ZQ3A 1EU3A 1D5ZC 2F0HA 2F0OA 3MXPA 1ENAA 3OWEB 4KKSA 4DAPA 2DNCA 4S3SA 2R7ZB 1SMYC 1TVXA 4FF4A 2B8FA 3L9AX 4C3JB 3OIQA 2NVQB 1A3TA 4Q5VA 5TSSA 1AP0A 2WP8J 4PV1C 4QB4A 3SK8A 4RGTA 3T16A 3SK4A 1OXSC 4PNYA 1PYWD 2VB3X 1SXTA 1TT2A 2XRSD 3DMUA 1SE2A 2R92B 3BVMA 4DAVA 4C3JG 1ONLA 1HQRD 2J4XA 3OMCA 2B2YA 2K32A 2B2TC 4KK7A 1ESFA 1F2LA 3D3RA 1R4PB 4RKBA 2IW3A 2MHVA 5E4XA 5C0XI 1FNWA 3J80E 5LL6S 1CZWA 2SNMA 1Y8NB 1RKNA 2OF1A 3I3CA 3H3VC 1WD1A 2ICIA 4K2LA 2K6AA 1SJHD 4EQNA 2SEBD 2DN8A 4FXDA 4BBSB 4O42A 1STEA 3MA2B 5CV4A 1QNUA 1EEID 1STNA 3TP5A 5C3XA 2K5DA 4KD4A 2KVMA 1SNPA 4KV6A 1RHPA 4OHJA 3V96A 2R3ZA 1EY8A 1I4HA 1EL0A 4B9XA 2LS01 1TQOA 1AW7A 2A69C 4BY7B 3NSWA 1T5EA 3CRKC 1LLRD 1QJOA 1PMRA 2K01A 2E75C 5FLXE 3DUZA 2FJ2A 2D2CC 1YNJD 2X69A 1DM0B 4C2MB 3PO3B 1TWHB 4I65A 4HCEA 1GUSA 1TWCB 3JAML 1EIHA 5IGFA 2N55A 4V0BA 2DY8A 1CQFA 1Q8IA 2VNUD 4N9PA 5EKLA 4IUQA 3X3NA 4CKBA 3K58A 1Q12A 5C6AA 1E2ZA 4CKEA 1FGBD 3KLSX 4Q0FA 5CR3A 4YIJA 5IGCA 1JB3A 5M9OA 3RD4A 3H0GB 1VDZA 1J8IA 3P75A 4XYOA 3KF8A 3G6JB 3P7JA 2ZXOA 4XTCS 4K6DA 4RGMA 3GTQB 3DEOA 4OO1G 4K5WA 5C0XJ 2LFNA 3AMUA 3OHXC 1K8OA 2E2IB 1EY9A 1IKLA 1CA5A 4UAIA 2HCIA 3DWPA 2F3VA 1JICA 3QIAA 1VMPA 1HQMC 2MGSA 1QNKA 1VMCA 1WCMB 1KABA 1TU2B 4RHRA 4KKTA 2EZVA 1S5BD 1A2TA 1B9MA 4C1NK 3TP8A 2F0WA 5M3FB 2CQAA 4ZUJA 4TRDA 4ULLA 1HUMA 1JOKA 1PRTD 1F2YA 3QO2A 4HSVA 3NQTA 1PZJD 3FPPA 1BCPD 1EY6A 4IFDG 3L3OC 5A2QL 1EY0A 1Q1BA 1Z47A 2SOBA 1F2MA 1KDAA 3ITPA 3SR1A 2O5IC 3R3OA 4ABNA 2NTTA 1X3QA 1HFNA 2BCOA 2J7ZA 2V4DA 1I6VC 2BA1A 2M2LA 2IX1A 1RF2D 1I4XA 2PZWA 3K59A 3HOUB 3HOXB 3I8ZA 4HAEA 2EJGC 1QILA 4R9WA 3GTKB 2KCCA 2FINB 4MIUA 3D6CA 4BS9A 3SEBA 3MC0B 2IX0A 2NTSA 4H7BA 2KECA 2KEDA 1NCVA 3VR2A 3S14B 3QOLA 1HA6A 4C56C 2D5DA 2LY7A 4XT3B 4QIWB 1ILQA 1PFBA 3BYYB 3Q23A 3K5LA 2KCNA 1SEBD 4K5XA 4KMUC 2B2TA 3P1HA 4IUTA 3BG3A 1KLUD 1OXTA 5JEAG 3J80L 2YYZA 1SYDA 4R8NA 2G9HD 3I4MB 3NUCA 3TP7A 2JA8B 2AWOA 1QE6A 3SXHA 2F3WA 2JEBI 1BCPB 1Q3LA 1OXVA 5DM63 4G7ZC 1EY4A 2EYJA 3K5NA 3E5SA 4UDUC 5CGKA 2AQ1B 3A56A 3RZDB 3S15B 3A8IE 1GUNA 1EQVA 1PTOF 5K5PA 1G8ZD 2YU9B 4L6TB 2QEJC 2EDGA 1TY0A 2C5CA 1RD9D 1F9RA 5EPKA 1KTKA 1G6ZA 4EGVA 1LT6D 5FLXL 3C2PA 3R8BA 3J7YW 2H1EA 4WORA 3GV6A 2NB0A 3NTKA 1EIGA 2L12A 1II3A 2RDHA 1DONA 3D4WA 4IURA 1CT1D 4U68A 1S5ED 1ZYRD 1STGA 3CQZB 3JAME 5K36H 2PCFB 1LTAD 4KHVA 1T5XD 2EYFA 1MI2A 2NYZD 2AQ3B 1LT3D 4RA8A 1STYA 4IQZA 4ZYSA 1I4PA 4HTHA 1F9SA 1GXDC 3MAQA 2EPBA 4TQUS 1OXXK 2F0UA 1KDCA 2NVYB 2Q8IB 5E4WC 1AEXA 4CJ1B 1Z7TA 1ENFA 5HURA 1XWEA 2K03A 3PMFA 3S16B 4IFDH 2SNSA 3F2UA 1SNDA 3NWTA 3LWUA 2MPMA 3A8KE 3OWFA 4HEDA 5DNFA 3T51B 5E1FA 3RMHA 1NR4A 1ICWA 1A6XA 4IZ8A 1O80A 1SNOA 4RH6A 2O5JC 4X3SA 2EYLA 4ZKBB 3SVMA 2QKIC 3FEWX 1LTID 3NE5B 2O4XA 4OO1I 2FMMA 1STBA 2RA4A 1CI3M 5J1ZA 2KHSA 5BN3A 3HGBA 5D65A 1SMYD 4RFBA 5BN5A 3BDCA 5IGEA 2B2UA 3DEPA 2EXZA 1TR5A 4KY5A 2BA0A 1SNMA 2JA7B 4JK1C 5IGDA 3GD7A 5JOBA 1W6JA 4XT1B 1BBXC 2A6HC 1CK1A 1WTOA 2WINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAB A;  1TQO A;  4G57 A;  2F0D A;  2LKV A;  3DHQ A;  4KD3 A;  2EYF A;  4KTA A;  4WRD A;  2PZT A;  2EY2 A;  1SYF A;  1A2T A;  4N9T A;  4PMC A;  1EZ8 A;  3ERO A;  3V2T A;  1STY A;  1A3T A;  3P1H A;  3RUZ A;  3NP8 A;  3TP8 A;  3HEJ A;  4LAA A;  4DFA A;  1NSN S;  2F0W A;  5I6W A;  4HMI A;  1EYA A;  5ISR A;  1ENC A;  4HTH A;  2EY6 A;  4K5V A;  4QB4 A;  4NP5 A;  1SYD A;  5CV9 A;  5F2D A;  4ZUI A;  3NK9 A;  1U9R A;  2PQE A;  3SHL A;  4ZUJ A;  4ID6 A;  3T16 A;  2PW7 A;  4R8N A;  5CV5 A;  3SK4 A;  2F0U A;  4TRD A;  1KDC A;  1SNC A;  5IGB A;  4OL7 A;  1JOK A;  4I65 A;  1JOQ A;  1F2Z A;  3LX0 A;  2M00 A;  1AEX A;  4PNY A;  5IIF A;  3ERQ A;  4RKL A;  4ME5 A;  3TP6 A;  5IGG A;  4HMJ A;  2PZU A;  3NUC A;  1F2Y A;  3TP7 A;  5IGF A;  5KEE A;  3S9W A;  1TT2 A;  3DMU A;  4K14 A;  3MVV A;  3NQT A;  5CV6 A;  4J6H A;  4EQP A;  1EYC A;  1EY6 A;  2F0T A;  3QB3 A;  5HUR A;  1JOR A;  3NXW A;  3SXH A;  3D4D A;  1KAA A;  2F3W A;  4ODG A;  4N9P A;  1EY0 A;  2SOB A;  5EKL A;  2WAC A;  1F2M A;  1SNQ A;  4NDX A;  3PMF A;  1KDA A;  3ITP A;  2EY1 A;  3H6M A;  1EY4 A;  3SK5 A;  2SNS A;  4K8I A;  2EYJ A;  3OMC A;  3SR1 A;  4KY6 A;  1KDB A;  5IOD A;  1SND A;  3E5S A;  1SYE A;  1EY5 A;  5CGK A;  4F8M A;  2F0E A;  5KYL A;  3R3O A;  3OWF A;  5C6A A;  2OXP A;  5DAU A;  5HGT A;  5E1F A;  4K8J A;  5KRU A;  5KGU A;  4RKB A;  5C4Z A;  2NUC A;  2EYO A;  3HZX A;  1EQV A;  1SYG A;  5EKK A;  2F0L A;  5K5P A;  2KQ3 A;  2EYP A;  4IZ8 A;  5C5L A;  5I9O A;  5J39 A;  1SNO A;  3MHB A;  2RKS A;  1JOO A;  2PZW A;  3U9O A;  2OEO A;  5CR3 A;  5I6Y A;  2EY5 A;  2EYL A;  4YIJ A;  3TME A;  2F0K A;  3C1E A;  3MEH A;  1EYD A;  3MZ5 A;  5KYI A;  5JAV A;  2F0N A;  2SNM A;  2F0V A;  1EY7 A;  4EQO A;  2O4X A;  5CV8 A;  1RKN A;  5CC4 A;  4DGZ A;  2OF1 A;  5C3W A;  5IGC A;  2F0I A;  5M9O A;  1STB A;  5CV7 A;  4KJO A;  5J22 A;  3P75 A;  1A3V A;  2RBM A;  5J1Z A;  4K2L A;  3VA5 A;  2KHS A;  5IOC A;  1SYC A;  4MIU A;  4IAL A;  4EQN A;  5C4H A;  3D6C A;  4KY7 A;  1STH A;  2PW5 A;  1STA A;  2ENB A;  1A2U A;  3BDC A;  3OSO A;  4K6D A;  1SYB A;  5NUC A;  5IGE A;  4WOR A;  4K5W A;  5CV4 A;  2EXZ A;  2RDF A;  4KJN A;  3EJI A;  4K2K A;  1NUC A;  2F0G A;  1STN A;  1TR5 A;  4H7B A;  4KY5 A;  4QF4 A;  4E6I A;  4NMZ A;  4F7X A;  2HQE A;  1II3 A;  3TP5 A;  2PYK A;  3D4W A;  5C5M A;  2EYH A;  1SNM A;  5C3X A;  3BDL A;  4ZQ3 A;  1EY9 A;  2F0J A;  3QOJ A;  5IGD A;  4KD4 A;  3QOL A;  2F0Q A;  1EZ6 A;  2F0H A;  2F0S A;  2F0O A;  2F0F A;  2F3V A;  5EGT A;  5JOB A;  4DU9 A;  5KIX A;  3OMG A;  4PMB A;  3D8G A;  1A3U A;  1SNP A;  3NHH A;  3T13 A;  3MXP A;  1STG A;  2F0M A;  4KV6 A;  3SK6 A;  3EVQ A;  5DEH A;  1ENA A;  4NKL A;  5I9P A;  1EY8 A;  2F0P A;  4QMG A;  4S3S A;  4EVO A;  2QDB A;  4KHV A;  3C1F A;  4B9X A;  1IHZ A;  4IUN A;  4B9W A;  4DF7 A;  2EYM A;  4J1M A;  4K5X A;  3SK8 A;  5E3F A; 
#chains in the Genus database with same CATH topology
 4G57 A;  1A0I A;  1LTL A;  4U67 3;  1Y1W B;  3MFY A;  2Z4I A;  2A73 B;  2D62 A;  5I2Y A;  3H94 A;  1N33 L;  4CDD C;  2K33 A;  4ME3 A;  1BO0 A;  1K0R A;  4HJA A;  4IFD I;  5JEA H;  3KOJ A;  2ES2 A;  1XX8 A;  4Y7N B;  3ICE A;  3S14 H;  4ILW A;  1K28 A;  3LX0 A;  2M00 A;  4IUP A;  4ME5 A;  4LFA L;  2PO4 A;  3PUX A;  5IYD H;  4A3K G;  1K0S A;  3E0E A;  1PLF A;  3NWS A;  2MJ8 A;  1QZH A;  4WJW A;  3D4D A;  3I4O A;  2LSS A;  1D8L A;  4B08 A;  1T9H A;  1Y1W G;  4PZ6 A;  1I4R A;  5E7N A;  1QUQ B;  2JA5 B;  4KY6 A;  2Z6B A;  1V1P A;  2K28 A;  4JBK A;  3RR5 A;  2OXP A;  3M7G A;  4N8F A;  4DA2 A;  3CPF A;  1LTB D;  1HTP A;  2NVT B;  5J39 A;  3TZD A;  4OON A;  4R4I A;  5G3L F;  1XNR L;  3KLR A;  3KBG A;  2EY5 A;  1HA5 A;  3VR5 A;  3R2I A;  1H9S A;  5ELB A;  3J7A V;  4HIM A;  3I4M H;  3J80 i;  2C9O A;  3UDF A;  5M5W B;  2F0N A;  2KJX A;  3I72 A;  4M1U B;  1KC8 C;  3CHB D;  2ZXP A;  3ULP A;  4GKJ Q;  2JA8 H;  1TS2 A;  3S1R B;  5IOC A;  1VQ4 A;  1DJR D;  5C4H A;  2IX3 A;  4CDE C;  2A69 D;  2B2W C;  2D0O A;  2A5H A;  2HT1 A;  3CF5 A;  3RZD H;  3S15 H;  1VF7 A;  4GOP C;  2XVS A;  4FYD A;  3QOJ A;  2R7F A;  2YU9 H;  4JI4 L;  1CQV A;  3WOF A;  3MFG A;  2R92 G;  1BQQ T;  3GTG B;  3S1M B;  3B6Y A;  4P75 A;  2UXC Q;  1WTV A;  1MJC A;  4DR6 L;  2BH2 A;  1IZ6 A;  2PQA A;  4J1M A;  3M4P A;  3KLW A;  4RGN A;  4KTA A;  1O7Y A;  4YY3 Q;  1EZ8 A;  4GKK L;  2Z9H A;  2TSS A;  2K4K A;  2N3S A;  5I6W A;  5JJZ A;  1ENC A;  2F3I A;  4JI0 L;  4IN3 A;  4DR2 L;  4BWG B;  3I4N B;  2PW7 A;  5ELD A;  3L7Z C;  4A3L H;  4CJ2 C;  1SR3 A;  2UXB Q;  3PV0 A;  1YJN A;  2A68 D;  1S5F D;  3LNN A;  4K14 A;  3CQZ H;  2CVR A;  2E76 C;  4GOP B;  2Z4H A;  4BBS G;  4EQP A;  5T1I A;  2EOT A;  4FNF A;  2VUM B;  1Q1E A;  4KLK A;  1PH9 A;  1N32 Q;  1PH8 A;  4K8I A;  2Q2I A;  4IFD J;  1S5C D;  3DXJ C;  3I4N G;  1R9T B;  2DNE A;  4PMW A;  5ELN A;  1CHQ D;  1PV4 A;  3RLF A;  5EKK A;  1XNQ Q;  2ICE C;  2F4I A;  4DK0 A;  1WTP A;  2EYP A;  3BZC A;  2IJ0 A;  3HOV B;  4UP9 A;  1A8V A;  2OEO A;  4XQQ A;  1KQS A;  2NVY H;  3MZ5 A;  1I5F A;  1S4Z A;  1PYS B;  2CWA A;  1J9O A;  4H0L C;  1RJT A;  4BY7 G;  4BXX H;  4R4O A;  5IP9 G;  2F0I A;  4IUV A;  4DK6 C;  4GN4 B;  4O0A A;  1JMC A;  1A3V A;  1CFM A;  3CME A;  4IOC A;  4DR4 Q;  2RSO A;  3S16 H;  1G51 A;  3U50 C;  5JVH 3;  1MSH A;  3D4R A;  4DV4 L;  3K0Y A;  1GM5 A;  1VF5 C;  4E6I A;  4F7X A;  1MKH A;  2L4N A;  4DXF A;  2Q2T A;  3BDL A;  1RTN A;  3HOV G;  1DYQ A;  2YTY A;  1X32 A;  1HJP A;  3BVZ A;  1EQQ A;  2RHS B;  3FPU B;  1ET6 A;  2H4O A;  1I4G A;  1JC7 A;  2RSN A;  2L15 A;  3BZD B;  1Z6H A;  4C3I B;  5I9P A;  3OW7 A;  1I6H B;  5EKI A;  1IHZ A;  4IUN A;  1U4R A;  1XPU A;  1KHI A;  3NEL A;  2I46 A;  3E6Z X;  2R93 B;  5C44 B;  1DGS A;  4KD3 A;  2PZT A;  4RCN A;  3ND8 A;  4RG1 A;  2VQF L;  4L5R C;  3ZJY C;  1TS5 A;  3N6R A;  3HEJ A;  4RCO A;  1HR0 W;  4MN3 A;  1HUN A;  4I7Z C;  4RAU C;  5K36 G;  5NUC A;  3SHL A;  3N52 A;  4LF6 L;  1HNX L;  1SFO B;  4HN7 A;  3GP7 A;  2JA7 H;  3H0G G;  3M4Q A;  1JOQ A;  2HD3 A;  5JEA J;  1I50 B;  4RKL A;  2JYO A;  3UI2 A;  3CC4 A;  4C3I G;  1I94 L;  5CV6 A;  1VQI A;  2QF7 A;  4X64 L;  3EQL C;  4A4I A;  2R93 G;  5C44 G;  1SNQ A;  3DM1 A;  1YJW A;  1WOC A;  1EOT A;  2VZA A;  3Q22 A;  2B2U C;  3UE1 A;  5J3B A;  2Z6K C;  4DNT B;  3AYH B;  3CKI B;  1Y1W H;  2K7V A;  1OXU A;  4X62 Q;  2PPB C;  5D14 A;  4A3J B;  1JJG A;  3VYU A;  4HSP A;  3HZX A;  2VQE Q;  1VS0 A;  5GAG C;  1QUQ A;  2UUA L;  2TMP A;  4JCV E;  4Y7N H;  3ZYY X;  4C3H B;  1HTL D;  1WCM G;  2F0K A;  3BJU A;  3C1E A;  3FP9 A;  5GAH C;  1AZQ A;  1VQ5 A;  3K81 C;  5KYI A;  1EY7 A;  2N8N A;  4EQO A;  3KBX A;  3MXU A;  1Y8O B;  4NXN Q;  1GJX A;  4JI8 Q;  1GHJ A;  3RN5 A;  2NVX B;  2B3G A;  2BE5 C;  2ID0 A;  4IAL A;  5M3F G;  2RQX A;  3J7Z C;  3KDF A;  3CCJ A;  1STA A;  1S5D D;  1JE5 A;  2K5N A;  5I2X A;  1LM0 A;  1YNX A;  2JA5 H;  4DNI A;  4A93 B;  1LO5 D;  1AE3 A;  3IFT A;  4KJN A;  4K2K A;  4A3J G;  2JA6 B;  1H9K A;  2VXW A;  4TVA B;  4CHT B;  4DR1 L;  2NVT H;  4C3H G;  2EVB A;  1B1Z A;  4ZLT F;  1J5E Q;  1LV9 A;  2F0S A;  3GTM B;  3K8A A;  3KK7 A;  3NHH A;  3WWV A;  1B2T A;  1GVP A;  1PH7 A;  1UE5 A;  4F87 A;  3EVQ A;  5M5W H;  1XMQ Q;  1EOV A;  1N36 Q;  2QDB A;  1XMO L;  4DV2 Q;  3S1R H;  2OQ0 A;  1B8A A;  3DWA A;  1SDF A;  4A93 G;  3NBI A;  3ONA B;  5IP7 G;  2JA6 G;  2IY5 B;  1CKM A;  5JJK A;  1M90 C;  5ISR A;  3J81 j;  4O1N A;  4LUO A;  2EY6 A;  1X55 A;  3NK9 A;  1N34 Q;  4DV3 Q;  1PXU A;  1CKO A;  4B3T Q;  1HRJ A;  5IGB A;  1HHV A;  1PRT F;  4IJH A;  2HDM A;  1VQF A;  2H5X A;  1F9Q A;  1DZ1 A;  1GUO A;  4WFN 3;  1BCP F;  3GTG H;  1BXT A;  4K0K L;  1XTD A;  1IW7 C;  3S1M H;  4A3G H;  1X56 A;  1CKN B;  1LTT D;  1E2V A;  1TKW B;  1IL8 A;  2B2W A;  3WOE A;  2EY1 A;  1YNN C;  3F2D A;  1MBY A;  1UWV A;  2CW0 C;  3LWE A;  3GTJ B;  1S40 A;  1ZKO A;  4JBM A;  4X6A H;  4JBW A;  1E7Z A;  2NBF A;  1LTR D;  1UUP A;  4F8M A;  1Q82 C;  4GOP A;  1RTO A;  1PH2 A;  5HGT A;  4XQJ A;  2N88 A;  3VYS A;  2J0T D;  4A3B B;  5C4Z A;  1MD2 D;  1V1P B;  2QIL A;  3I4N H;  2KQ3 A;  3MHB A;  2LMC B;  1JOO A;  2EJF C;  3TME A;  1DD2 A;  5D3I B;  3BYT B;  1X3F A;  2IPK D;  1N8R C;  2GVB A;  1C4Q A;  2PNH A;  5IP9 H;  2K50 A;  3Q0A A;  5JPM C;  1H9S B;  2K75 A;  3V05 A;  2VUM H;  3W1G A;  3PUY A;  3VR6 A;  1GO3 E;  2FHT A;  3VYT A;  2DJF C;  4JI2 Q;  1L0X B;  1P8L A;  3I70 A;  1PZI D;  3I4M G;  4NMZ A;  1HZC A;  2RVL A;  4XDX A;  1CZG A;  2HUG A;  1WJJ A;  4L8J A;  1R9T H;  1PTO C;  2JA8 G;  3Q6S A;  3I56 A;  1XXG A;  4X3K A;  1U4L A;  3PO2 B;  2F0F A;  2KCT A;  3HOV H;  4KHP Q;  1EFI D;  1ESR A;  2F0M A;  5DM7 3;  4JC0 A;  2I5H A;  4H13 C;  2X6G A;  3BU2 A;  1SRU A;  1U4P A;  4YCU A;  3C46 A;  1ET9 A;  4JI2 L;  1HCZ A;  4X66 L;  2XN9 C;  1IYV A;  1XTC D;  2Z1C A;  2PNR C;  1PA6 A;  4P2C B;  1K8A C;  4B3M Q;  2ZXR A;  5EPL A;  3AFP A;  3DHQ A;  5FJ8 H;  4LFC Q;  5GAE C;  1H9R A;  1KNE A;  3HS0 C;  4ZKC B;  1DOK A;  3NP8 A;  2WKD A;  4LAA A;  3SGI A;  1BR9 A;  1BNZ A;  2PQA B;  5BR8 L;  4IOA A;  3BS1 A;  3S1Q B;  2NN6 H;  4L63 B;  1UEA B;  4R8I A;  1SE3 A;  5CV5 A;  1VQL A;  2NWG A;  4DR7 L;  3L0O A;  3PO2 G;  5FKA C;  4BA2 I;  2EE1 A;  2ATW A;  2JXM B;  1D1I A;  4OL7 A;  3A0J A;  3S24 A;  5KEE A;  2PMZ E;  5I4D A;  3H09 A;  3TBI B;  5GAD C;  4LK1 C;  4TKO B;  3QB3 A;  1PTO B;  2L0C A;  4C3I H;  1TWA B;  1EEF D;  2I0Q A;  2K1B A;  1I6H H;  1K83 B;  4ZAI A;  1NTG A;  1E2W A;  2HHH L;  5C44 H;  5JPN C;  1QCB D;  4A3L G;  1E3P A;  1V1Q A;  3TSS A;  1ML0 D;  2UU9 L;  2GA4 B;  3EN2 A;  4O2D A;  2NUC A;  1CSQ A;  1JQY D;  3M9B A;  3SE0 A;  1SFO H;  1FNV A;  4LF4 L;  3D6W A;  3URY A;  2CQO A;  3M4Y A;  1L0Y B;  1I50 H;  1X3P A;  1R4Q B;  3GV3 A;  4X65 Q;  1GUT A;  2A6H D;  1I4Q A;  3BVG A;  4J15 A;  2ENB A;  3QJY A;  1LAB A;  3RZO B;  3R93 A;  4DR3 L;  3I55 A;  2F0G A;  4OGQ C;  5C5M A;  4BXX G;  1Y1V B;  1EWI A;  1BOS A;  2F0J A;  3CC2 A;  4DV0 L;  1Q90 A;  2F0Q A;  2JE6 I;  4LF8 Q;  2B2V A;  4LWC A;  3PIP 3;  1UE6 A;  4C3H H;  1Q7Y C;  1WVL A;  4CJ0 B;  1NBW A;  1JWS D;  5DEH A;  4OWX B;  4ALP A;  4QMG A;  1B50 A;  3C1F A;  2UUB L;  4B9W A;  2I07 B;  3KF6 A;  4FO2 A;  3T1H Q;  2NVX H;  5E3F A;  4OWW B;  1IYJ B;  4MHE A;  2CHB D;  4WRD A;  2RDG A;  2EY2 A;  5ELE A;  4PMC A;  3V2T A;  3A8J E;  3ND9 A;  3OIP A;  1UAP A;  4OXP A;  3CCL A;  4A93 H;  5FK9 C;  4B3S L;  5D3D A;  4JI7 L;  1KIX A;  1E22 A;  5C3E B;  1Y1V G;  3G71 A;  1NMF A;  1D1K A;  5IP7 H;  2JA6 H;  3CCE A;  2MUY A;  2R6G A;  2L1B A;  1Q86 C;  4OX9 L;  4G7O C;  2PMZ B;  5IIF A;  1ZXT A;  4EX5 A;  3ERQ A;  3GTM H;  4GNX C;  4DK1 A;  4AQY Q;  1KL9 A;  3AB9 A;  3MVV A;  1XJV A;  1GUW A;  1EYC A;  3T4A C;  1NMG A;  3MXG A;  3K80 C;  2A6E C;  3K57 A;  5FO7 B;  5IOD A;  2JA7 G;  4KHZ A;  1TXY A;  4OEL B;  3NTH A;  1G2T A;  2JK8 A;  2EIF A;  1IBK L;  5EPJ A;  1Q8K A;  1PDQ A;  1CKN A;  1NE3 A;  5KGU A;  3HP3 A;  3KUP A;  1SYG A;  1PH5 A;  1IXR A;  3HG9 A;  1C48 A;  1D5X C;  1BUV T;  1Q46 A;  2B39 A;  5I9O A;  1B53 A;  1YHB A;  1JWM D;  3U9O A;  5JJI A;  1EU4 A;  3MEH A;  4DN4 M;  1BVS A;  1B3Q A;  5IE8 A;  1G29 1;  4PQX A;  5ELF A;  5CV8 A;  3CRL C;  2DUD A;  5KNB A;  3UDG A;  3VA5 A;  3L2P A;  1V1O A;  3NEN A;  1AH9 A;  1Z9F A;  1STH A;  3OSO A;  1SYB A;  3GTJ H;  3QWN A;  3S2H H;  4A76 A;  4MTN A;  5KNC A;  2JP1 A;  1FD7 D;  2HQE A;  1CTM A;  1H9J A;  1CUK A;  3A54 A;  3KDF B;  4A3B H;  3S17 B;  4LJZ C;  2Z8L A;  4OWT B;  1EZ6 A;  4RMF A;  4IPC A;  3X3M A;  3J7A F;  5EGT A;  4FXG C;  1RCV D;  1KNA A;  1F77 A;  5KIX A;  3TS0 A;  1VQM A;  3KLS A;  1B4O A;  2JA5 G;  2F0P A;  2B63 B;  2XIW A;  1WTX A;  2CWP A;  4F88 A;  1LTG D;  3IFD A;  3M4O B;  4JV5 Q;  2LXJ A;  5C4J B;  3T56 B;  2AUJ D;  1M4V A;  4BY1 B;  3DWQ A;  4DFA A;  5FO9 B;  1VQE A;  1VQO A;  4GKJ L;  5EJW A;  4A3D B;  1BKB A;  1HNZ Q;  3OPO A;  1FYC A;  1AE2 A;  5F2D A;  1DXM A;  2F1M A;  1HNW Q;  5C4X B;  4A3G B;  1D5M C;  2HCC A;  1HR0 Q;  1ASZ A;  2ZM6 Q;  2OT2 A;  4JW0 A;  3PO2 H;  4HMJ A;  4CGY B;  3CPW A;  3PCO B;  2B63 G;  2AQ2 B;  2C35 B;  5FOB B;  1NNX A;  5LMN W;  3NPP A;  4DUY Q;  1EFW A;  2G9D A;  2E74 C;  1V9P A;  3D31 A;  3SK5 A;  1L1O A;  2MFI A;  4BY1 G;  1DOM A;  3TZU A;  1ASY A;  1KDB A;  4A3D G;  2UXC L;  2WB1 E;  1HR0 L;  2UUC Q;  4NB3 A;  4HR7 B;  3MWY W;  1E1O A;  2G5D A;  2VW9 A;  5EQ0 A;  3IAY A;  5KRU A;  5IT9 E;  2MO1 A;  2D9U A;  3WDN A;  5C4X G;  4HIO A;  3S1Q H;  1VQP A;  4A3G G;  4YY3 L;  4MZ9 A;  2E5L Q;  5AJ3 Q;  1QVG A;  4NW2 A;  3A7A B;  5CC4 A;  4POF A;  5CV7 A;  4QCL A;  4HIK A;  4KJO A;  5J22 A;  3G4S A;  3D0F A;  4LUV A;  1PTO H;  1TWA H;  1SYC A;  3F2C A;  4XIG S;  2O2L D;  3EA6 A;  4G7H C;  4KY7 A;  2UXB L;  1K83 H;  4HCS A;  2BOS A;  2PW5 A;  4LMQ D;  5CBA E;  2UXD Q;  4GS3 A;  1EWH A;  1PH1 A;  4P74 A;  5AJ3 L;  4JI6 Q;  1SAP A;  2XNA C;  3FMC A;  3EJI A;  1NUC A;  1B3A A;  1Y8P B;  3NTI A;  4NXM Q;  4JI5 Q;  1YVC A;  1N32 L;  1H95 A;  4FXK C;  3PUW A;  2KUM A;  1F9P A;  1I3Q B;  1VQH A;  3M7N A;  2JSO A;  3HOY B;  2AWN A;  3I4L A;  1P16 A;  2VUM G;  1SBB B;  3D8G A;  4XXE A;  1JT8 A;  3SDZ A;  1VQG A;  2JEA I;  1E0B A;  2L9H A;  5M3M B;  1E24 A;  1IBM Q;  1M8A A;  5JVG 3;  1XNQ L;  3GTO B;  1MJE A;  1OO9 B;  4K6L A;  4NXM L;  1KRS A;  1BBU A;  4R4C A;  1RIP A;  4A3F B;  3HKZ B;  3CMA A;  2VB2 X;  3RZO H;  1EYA A;  4DV7 Q;  1XYI A;  1U0L A;  3NQI A;  3HOY G;  4DR4 L;  2F03 A;  3M85 A;  1Y1V H;  2KOL A;  3GQB A;  5M5Y B;  1IBM L;  3IL8 A;  1SMX A;  4CKC A;  3T53 B;  1X6O A;  4G4K A;  5FJ8 G;  1K73 C;  2PZU A;  3S9W A;  1CSP A;  2XSC A;  5M3M G;  3PUZ A;  4FP5 D;  2A68 C;  2Y0S E;  4HJ5 A;  3NBH B;  3NXW A;  1B44 D;  1YZ6 A;  2K04 A;  3F1Z A;  4YHH Q;  3EFX D;  3I91 A;  2BE5 D;  2WAQ E;  2EJM A;  4X3U A;  4AYB E;  2NN6 G;  1WTW A;  2WB1 B;  1DCZ A;  2HQL A;  2WII B;  5LHY 1;  1WTR A;  1WTQ A;  1HFG A;  1W6K A;  1TS3 A;  1YNJ C;  4K8J A;  5C3E H;  1O7L A;  3BDO A;  1BF4 A;  1IL2 A;  1FNU A;  3AU7 A;  5C5L A;  3STB C;  2B2V C;  4YHH L;  4KN4 C;  1QVC A;  4A3C H;  1YHA A;  1EYD A;  1LAC A;  1UEB A;  1O7Z A;  3U9S A;  4CBV A;  4DPG A;  3I90 A;  1MSG A;  4DUZ Q;  2A8V A;  3PUV A;  2WB1 G;  2ZTD A;  1YI2 A;  1MGS A;  4KKU A;  3F8T A;  4AH6 A;  4V19 0;  1RL2 A;  1GOZ A;  2F52 A;  5EAY A;  3J81 c;  1EWC A;  4MNO A;  4UHV A;  4UPA A;  2YTX A;  1LT4 D;  1WD0 A;  4DV5 Q;  2EYH A;  1SE4 A;  1SRO A;  3PIP A;  3IKJ A;  3A74 A;  5ELO A;  2OQK A;  3GTP B;  3Q8D A;  4JI3 Q;  4GNX A;  2MNA A;  3OOC A;  1PFN A;  3OMG A;  4PMB A;  1G91 A;  3T13 A;  1A3U A;  2SDF A;  2JJQ A;  1PH6 A;  1TY2 A;  4X62 L;  3SK6 A;  1YEZ A;  4LF7 Q;  1C8C A;  1JE4 A;  3VYR A;  2B8G A;  2RHQ B;  1V8Q A;  2FMC A;  1IW7 D;  2VQE L;  3J81 L;  2EYM A;  4LUZ A;  3TP6 A;  4WJ4 A;  3F2B A;  2LKV A;  4BBR B;  1SYF A;  1YNN D;  2NZ1 D;  3FKI B;  3RUZ A;  2CW0 D;  4NXN L;  4JI3 L;  2LXK A;  1V43 A;  3PIO 3;  1NSN S;  3MEF A;  4JI8 L;  5CBE E;  3KF6 B;  2IHF A;  4P71 A;  2KEE A;  4NP5 A;  1PFM A;  4ZUI A;  2IT1 A;  2K5W A;  1TWF B;  3S17 H;  2A74 C;  1JB7 A;  1HPC A;  4KI0 A;  3NEM A;  5AFW A;  1CHP D;  2Y0S B;  1YIT A;  1WI5 A;  1O7I A;  3OTO Q;  4DAY B;  1TWG B;  4RGO S;  3E3X A;  3S2D B;  2WAQ B;  4AYB B;  2Q8R E;  4ODG A;  2B63 H;  2WAC A;  4GZY C;  4QUF A;  1J5E L;  4A75 A;  3M4O H;  1CM9 A;  3H6M A;  2L55 A;  3VDY A;  3FKI G;  1QB5 D;  3CCR A;  5C4J H;  1VQK A;  1EIF A;  2NZO A;  4FF1 A;  5JJL A;  1EY5 A;  5KYL A;  3GO5 A;  4BY1 H;  1XMQ L;  1SSO A;  4FF3 A;  1LUZ A;  5ELC A;  1N36 L;  4A3D H;  3TN2 A;  1TII D;  3W3A A;  1JR0 D;  2KBN A;  1H9M A;  3AFQ A;  3HRZ C;  4DV2 L;  4LF5 Q;  1CA6 A;  1NJI C;  1NAP A;  5FO8 B;  2F0L A;  3Q24 A;  1PTO D;  1DOL A;  2X6L A;  3CAM A;  1PRT C;  5C4X H;  3W5O A;  2F4V Q;  1D2B A;  4QUC A;  3W1B A;  2DY7 A;  1BCP C;  4DGZ A;  2WAQ G;  1LTS D;  4AYB G;  3J80 c;  4GLA C;  2Q2H A;  3PF4 A;  1N34 L;  3PGZ A;  1U4M A;  5C0X G;  4DV3 L;  4X3T A;  4Z9C B;  3S2H B;  2I5L X;  4B3T L;  2R7D A;  3S1N B;  2Z0S A;  2E2H B;  3K6O A;  4FF2 A;  2KEN A;  1BDO A;  5COY A;  5A35 A;  3PSI A;  3R2T A;  3CCQ A;  3GTL B;  4B3R Q;  2B2Y C;  3E0J A;  1KLG D;  2PYK A;  5IT9 c;  4J8Q A;  1NY4 A;  5EBD A;  4DU9 A;  3ULL A;  1PHJ A;  3C3L A;  4H44 C;  3A5U A;  2MP1 A;  5IY0 A;  3FVQ A;  3A55 A;  3K5M A;  3O13 A;  1K8M A;  2OTJ A;  4DNR B;  5IWA Q;  1L1O C;  1PRT B;  4YWK A;  2F0D A;  4A3B G;  4A3I B;  4N9T A;  1FGU A;  1PZK D;  2M9V A;  5IT9 L;  2IWH A;  1Q81 C;  1QG7 A;  2R61 A;  4Y52 H;  1UE1 A;  5BN4 A;  4DR5 Q;  3W2D A;  1Y69 U;  1U9R A;  2PQE A;  4ID6 A;  3GDE A;  2QCP X;  3K5O A;  1ICF B;  5FLX c;  3BZK A;  1SNC A;  1I3Q H;  1F2Z A;  1ROD A;  3HOY H;  4R4Q A;  3CCM A;  1ILP A;  3RNU A;  5COR A;  4FVM A;  1FJG Q;  4J6H A;  1JOR A;  1QOH A;  1GHK A;  1KAA A;  1YBY A;  4UP7 A;  5M3M H;  1AFP A;  2ASB A;  3GTO H;  2XWB B;  4KHP L;  3M3Y B;  2CH4 W;  3MXN A;  2RCN A;  2Q8T A;  2MQH A;  1HH2 P;  2F0E A;  4A3F H;  2BDO A;  4KN7 C;  1EQT A;  3NBH A;  5EBC A;  1VQ8 A;  1XPR A;  1L1O B;  1IYU A;  4B3M L;  2E2J B;  1X65 A;  2WKC A;  4LFC L;  3FDT A;  5M5Y H;  1AZP A;  4OO1 H;  2RKS A;  1SLJ A;  2ZTC A;  1B7Y B;  4PG3 A;  3QG1 A;  1SE8 A;  1JCK B;  3TS2 A;  2QGQ A;  1HXY D;  5C3W A;  2BDN A;  2HDL A;  2KHI A;  2RBM A;  2A19 A;  3AQQ A;  5KND A;  4LFB Q;  1VCI A;  1JWU D;  1SJE D;  1LT5 D;  2QDL A;  1O78 A;  1LYL A;  1FR3 A;  5DLQ E;  4LF9 Q;  1ZEQ X;  3TEH B;  2E2D C;  4QGU A;  1VQ7 A;  4QF4 A;  1NR2 A;  3TDQ A;  4C1N I;  4TSS A;  2EQS A;  1A63 A;  1GUG A;  4A3M B;  3G7L A;  3HFZ B;  3MTS A;  3LGJ A;  4BA1 I;  2I5M X;  2XRQ D;  2K5Q A;  2FFK B;  4NKL A;  4EVO A;  2E8G A;  3T1Y Q;  3K7A B;  4DF7 A;  4HJ8 A;  3ERO A;  1G2S A;  2A6E D;  1HZA A;  4X65 L;  4APV A;  4JOI A;  4HMI A;  4XQN A;  4ZCK A;  4ZK9 B;  4AIM A;  4K5V A;  5CV9 A;  3CU7 A;  2DGY A;  5CYU A;  3FRP B;  1ZYR C;  1RDP D;  2KA7 A;  2L5T A;  5CMD A;  3J7A 5;  3OYY A;  3GTP H;  1IKM A;  4A3E B;  2WV6 D;  2NN6 I;  5IGG A;  4OIJ A;  3I73 A;  1B9N A;  1AN8 A;  2K05 A;  2ZT9 C;  2XWJ B;  5T1G A;  4M8A A;  2F0T A;  4QL5 A;  3P20 A;  1K9M C;  4NDX A;  1HZB A;  4LF8 L;  2IL8 A;  3HOW B;  1A15 A;  1N9W A;  3EIV A;  4BBR H;  1SYE A;  1L2F A;  3VR3 A;  5LMN Q;  3FKI H;  5LL6 X;  4DAY A;  3KJP A;  5DAU A;  4JYA Q;  1C7Y A;  3HOZ B;  3J81 i;  3VA7 A;  2D0P A;  4OEM B;  1PVO A;  4GLX A;  3T1H L;  4RHS A;  2EYO A;  5M5X B;  3VR4 A;  1TWF H;  3A7L A;  5I6Y A;  1X3G A;  2RCF A;  3H91 A;  5G3L D;  5JAV A;  1GD7 A;  2F0V A;  1D6E C;  1UNS A;  2L11 A;  4OIK A;  1TWG H;  5HGQ A;  4HID A;  4XYQ A;  3UDX A;  1N33 Q;  4JYA L;  4RWS C;  3S2D H;  3HOW G;  3J81 E;  4IUU A;  5C3E G;  4A3K B;  2BH8 A;  4QY7 A;  5C0X H;  1OTC A;  3A5Z B;  3CD6 A;  1A2U A;  1QWY A;  4ZRZ A;  4AQY L;  2AUK A;  5A2Q E;  3HOZ G;  1K3R A;  2RDF A;  4LFA Q;  4DXG A;  4A3C G;  1TS4 A;  1JJ2 A;  1X9N A;  4ZQ3 A;  1EU3 A;  1U5K A;  1D5Z C;  2F0H A;  1BBW A;  2F0O A;  1PH3 A;  4R4T A;  1VQB A;  3MXP A;  1W2B A;  1ENA A;  3OWE B;  4KKS A;  4DAP A;  2DNC A;  4S3S A;  3I7F A;  2WFW A;  4GNX B;  2R7Z B;  1SMY C;  4YWL A;  1KD1 C;  1TVX A;  3PIO A;  2B8F A;  1PFS A;  4FF4 A;  3L9A X;  2E2H H;  3S1N H;  4C3J B;  3OIQ A;  1XNR Q;  2NVQ B;  1A3T A;  4Q5V A;  4L5T A;  1FL0 A;  5TSS A;  1AP0 A;  2WP8 J;  4PV1 C;  3CP0 A;  3AEV A;  3GTL H;  4QB4 A;  3SK8 A;  1S3O A;  4RGT A;  3T16 A;  3SK4 A;  1HZ9 A;  1OXS C;  2Q2U A;  3G48 A;  2XTI A;  4PNY A;  1PYW D;  3CW2 C;  2VB3 X;  2YTV A;  1SXT A;  1TT2 A;  2XRS D;  3DMU A;  1SE2 A;  4LNQ A;  2NZH A;  1K3B C;  2R7Z G;  2R92 B;  1VQ6 A;  3BVM A;  3K0X A;  4DAV A;  1VQJ A;  4C3J G;  1ONL A;  1HQR D;  3HKZ E;  2J4X A;  3OMC A;  4A3I H;  4JI4 Q;  4JG2 A;  2GVA A;  2B2Y A;  2K32 A;  2B2T C;  4KK7 A;  1ESF A;  1F2L A;  5GQO A;  3D3R A;  2AMC B;  1R4P B;  4RKB A;  2IW3 A;  4JV5 L;  2MHV A;  3KJO A;  1VQC A;  5E4X A;  4DR6 Q;  5C0X I;  1FNW A;  2DJG C;  1X54 A;  2ALY B;  3J80 E;  3ULJ A;  5LL6 S;  1CZW A;  2SNM A;  4GKK Q;  1HNZ L;  1Y8N B;  1RKN A;  4JPB W;  2OF1 A;  2XGT A;  3I3C A;  4IPH A;  3U4Z A;  3H3V C;  1HNW L;  1WD1 A;  2ICI A;  4K2L A;  4JI0 Q;  2K6A A;  4DR2 Q;  1SJH D;  4EQN A;  1B70 B;  2SEB D;  2DN8 A;  2ZM6 L;  1D7Q A;  4FXD A;  4BBS B;  4O42 A;  1STE A;  3MA2 B;  3M3Y H;  1PH4 A;  1E1T A;  5CV4 A;  1QNU A;  4YWM A;  1EEI D;  4I7A A;  1STN A;  4DUY L;  4L5S A;  2IHE A;  1C9O A;  2HIX A;  3TP5 A;  2VY3 A;  5C3X A;  4YCW A;  1YIJ A;  2K5D A;  4KD4 A;  2E2J H;  2KVM A;  1QVF A;  1SNP A;  2UUC L;  4KV6 A;  1RHP A;  4OHJ A;  3V96 A;  2R3Z A;  2OWO A;  1EY8 A;  1I4H A;  1KAW A;  3CC7 A;  1EYG A;  1EL0 A;  4B9X A;  3FHW A;  2LS0 1;  3JAM c;  2E5L L;  1TQO A;  1AW7 A;  2A69 C;  4BY7 B;  3NSW A;  1T5E A;  2ZJQ A;  3CRK C;  1LLR D;  1QJO A;  1PMR A;  2K01 A;  2E75 C;  5FLX E;  1KRT A;  3DUZ A;  2HIV A;  2FJ2 A;  2D2C C;  1YNJ D;  3IRB A;  2X69 A;  1DM0 B;  4C2M B;  4HJ7 A;  3PO3 B;  1TWH B;  2UXD L;  4A3M H;  4I65 A;  4HCE A;  3STB D;  1GUS A;  1TWC B;  4JI6 L;  3JAM L;  1EIH A;  5IGF A;  4CDC C;  2N55 A;  4V0B A;  2DY8 A;  1CQF A;  4JI5 L;  1Q8I A;  3CCU A;  4IO9 A;  4DV4 Q;  2PI2 E;  2VNU D;  4N9P A;  5EKL A;  3K7A H;  4IUQ A;  3X3N A;  4CKB A;  3PQI A;  3K58 A;  1Q12 A;  5C6A A;  1SN8 A;  2OTL A;  1E2Z A;  4CKE A;  1GKH A;  2QEX A;  3TRE A;  3MXN B;  3PO3 G;  2K14 A;  2ZTE A;  1FGB D;  3KLS X;  4Q0F A;  5CR3 A;  4YIJ A;  4A3E H;  1KXL A;  2VQF Q;  4DV7 L;  5IGC A;  1JB3 A;  5M9O A;  1MHW C;  3RD4 A;  3H0G B;  4A3F G;  3HKZ G;  1VDZ A;  1J8I A;  3DM3 A;  3P75 A;  4XYO A;  4LF6 Q;  1W3S A;  3G6J B;  3KF8 A;  1HNX Q;  3P7J A;  2ZXO A;  4XTC S;  4K6D A;  4RGM A;  5HY6 A;  3HOW H;  4JOI C;  3DEO A;  3GTQ B;  4OO1 G;  4K5W A;  5C0X J;  1C0A A;  2LFN A;  3AMU A;  3OHX C;  5GRO A;  3ER0 A;  1WFQ A;  2CKZ B;  1I94 Q;  1K8G A;  3HOZ H;  1K8O A;  3U4V A;  4X64 Q;  2E2I B;  1EY9 A;  1IKL A;  1CA5 A;  1J6Q A;  4UAI A;  5M5X H;  2HCI A;  3DWP A;  2F3V A;  1JIC A;  3QIA A;  4P72 A;  1YHQ A;  1VMP A;  4QIW E;  1HQM C;  3G6E A;  2MGS A;  1QNK A;  1VMC A;  2JA9 A;  1WCM B;  3KYH C;  1KAB A;  1TU2 B;  4RHR A;  2ZJP A;  4KKT A;  2CFM A;  1S5B D;  2EZV A;  5FLM G;  4A3K H;  1A2T A;  1B9M A;  2UUA Q;  1VQD A;  4LW1 A;  4C1N K;  3TP8 A;  1PYB A;  3CCS A;  2F0W A;  4DUZ L;  5M3F B;  4QQB X;  2CQA A;  4ZUJ A;  4TRD A;  4ULL A;  1HUM A;  1JOK A;  1PRT D;  1F2Y A;  3E9H A;  2VS1 A;  3QO2 A;  4HSV A;  3NQT A;  1PZJ D;  3FPP A;  4DV5 L;  1BCP D;  1EY6 A;  4UP8 A;  4IFD G;  3L3O C;  5A2Q L;  1EY0 A;  1Q1B A;  1Z47 A;  2FXQ A;  2SOB A;  1F2M A;  2R7Z H;  2JQO A;  1KDA A;  3ITP A;  1JJC B;  2V1C C;  4DR1 Q;  3SR1 A;  2O5I C;  4C3J H;  4LF7 L;  3R3O A;  4ABN A;  2NTT A;  2NVQ H;  1X3Q A;  2QA4 A;  1HFN A;  5IYC G;  2BCO A;  2K5V A;  4N8X 1;  2J7Z A;  2V4D A;  1S72 A;  1I6V C;  2BA1 A;  2N49 A;  1XMO Q;  2M2L A;  2IX1 A;  1RF2 D;  1I4X A;  2PZW A;  3K59 A;  4IPD A;  3HOU B;  3HOX B;  3I8Z A;  4HAE A;  4BBR G;  2EJG C;  1QIL A;  1WTH A;  4R9W A;  3GTK B;  5IYB G;  1L0W A;  2KCC A;  2FIN B;  4MIU A;  2CCZ A;  2R92 H;  2K52 A;  3D6C A;  4BS9 A;  2QW7 A;  3SEB A;  4EQ5 A;  3MC0 B;  3OTO L;  2IX0 A;  2NTS A;  4H7B A;  4K0K Q;  2KEC A;  2KED A;  2Y0S G;  1NCV A;  1VQN A;  3VR2 A;  3S14 B;  3QOL A;  1HA6 A;  4C56 C;  1M1K C;  3HOU G;  3HOX G;  2D5D A;  2LY7 A;  4XT3 B;  4QIW B;  3PF5 A;  1ILQ A;  1VQA A;  4LF5 L;  1PFB A;  3BYY B;  3Q23 A;  3K5L A;  1YJ9 A;  2KCN A;  3OW2 A;  3TRZ A;  1SEB D;  4CDF C;  4K5X A;  5H1S E;  2AKW B;  2YV5 A;  1IBL Q;  2F4V L;  4KMU C;  2B2T A;  4JI1 Q;  3P1H A;  4IUT A;  4BBS H;  3BG3 A;  3RN2 A;  1KLU D;  1EQR A;  1OXT A;  5JEA G;  3J80 L;  2YYZ A;  1SYD A;  4IPG A;  4R8N A;  2B29 A;  5IYD G;  2G9H D;  3H15 A;  3I4M B;  4GN3 B;  1FVI A;  1IBL L;  2CH4 A;  3NUC A;  3TP7 A;  4B3R L;  4JI1 L;  2JA8 B;  2AWO A;  1QE6 A;  3SXH A;  4GN5 A;  2EXD A;  2F3W A;  2JEB I;  1BCP B;  1Q3L A;  3QR8 A;  1OXV A;  3HKS A;  3KFU A;  5DM6 3;  4G7Z C;  1EY4 A;  2EYJ A;  3K5N A;  4BY7 H;  3E5S A;  4UDU C;  5CGK A;  2AQ1 B;  3A56 A;  3RZD B;  4L5Q A;  3S15 B;  3H3V H;  5IWA L;  4DKA C;  3A8I E;  1GUN A;  1EQV A;  1PTO F;  3ERS X;  4X66 Q;  5K5P A;  1G8Z D;  2YU9 B;  4L6T B;  1X3E A;  4C2M H;  3PO3 H;  1TWH H;  2QEJ C;  4DV1 Q;  4PZ8 A;  2EDG A;  1TWC H;  1TY0 A;  2C5C A;  1RD9 D;  1F9R A;  4DV6 Q;  4DR5 L;  4A3I G;  3RLN A;  5EPK A;  5BR8 Q;  5L37 A;  1KTK A;  4POG A;  4DAM A;  3DLL A;  1G6Z A;  4EGV A;  1LT6 D;  5FLX L;  3C2P A;  3JAM i;  3R8B A;  4DR7 Q;  3J7Y W;  2H1E A;  4WOR A;  3GV6 A;  2NB0 A;  1FJG L;  1G6P A;  1EIY B;  3RLO A;  3NTK A;  1EIG A;  4DV1 L;  1EUJ A;  2L12 A;  4WJ3 M;  1II3 A;  2KHJ A;  2RDH A;  1DON A;  3D4W A;  4DV6 L;  4IUR A;  1A62 A;  1CT1 D;  1Y14 B;  4U68 A;  1S5E D;  1ZYR D;  4HJ9 A;  3UE0 A;  2HHH Q;  1STG A;  3CQZ B;  2A1A A;  3JAM E;  5K36 H;  2PCF B;  1LTA D;  2UU9 Q;  2OCE A;  4KHV A;  3H0G H;  1T5X D;  2N78 A;  4GLV B;  1MIU A;  2EYF A;  1MI2 A;  2NYZ D;  2AQ3 B;  1LT3 D;  4LF4 Q;  5LMU Q;  4RA8 A;  1STY A;  4YCV A;  3GTQ H;  4IQZ A;  4ZYS A;  5FLM H;  1I4P A;  2RF4 A;  4P73 A;  2R93 H;  3E9I A;  4HTH A;  1F9S A;  4LFB L;  1GXD C;  3MAQ A;  2EPB A;  4TQU S;  1OXX K;  4H02 A;  2F0U A;  1UE7 A;  2E2I H;  1KDC A;  3I2Z A;  4LF9 L;  2NVY B;  2Q8I B;  3U58 A;  5E4W C;  1AEX A;  4JVZ A;  4CJ1 B;  1XPO A;  4R1J A;  1Z7T A;  3H3V I;  5LMU L;  1ENF A;  4DR3 Q;  2AHO B;  5HUR A;  1XWE A;  2VL6 A;  2ZJR A;  2K03 A;  2GN5 A;  3TQY A;  4NPS A;  4FDB A;  3JC6 6;  3PMF A;  1WCM H;  3S16 B;  4IFD H;  4DV0 Q;  2SNS A;  3F2U A;  1SND A;  3NWT A;  2PI2 A;  3LWU A;  4A3M G;  2MPM A;  3A8K E;  3OWF A;  4HED A;  5DNF A;  3T1Y L;  3T51 B;  1VQ9 A;  5E1F A;  5M3F H;  3RMH A;  1NR4 A;  1ICW A;  1A6X A;  5IYC H;  2UUB Q;  4IZ8 A;  1O80 A;  1SNO A;  4RH6 A;  2O5J C;  4X3S A;  2EYL A;  4A3J H;  4ZKB B;  3SVM A;  1QZG A;  1WYD A;  2QKI C;  3CXC A;  3FEW X;  1LTI D;  3NE5 B;  4B3S Q;  2O4X A;  4JI7 Q;  4IJL A;  4OO1 I;  2P5Z X;  2FMM A;  1STB A;  2RA4 A;  1CI3 M;  2MO0 A;  3K7U C;  5J1Z A;  2KHS A;  5BN3 A;  3HGB A;  4PZ7 A;  5D65 A;  1SMY D;  3CCV A;  5IYB H;  4RFB A;  4OX9 Q;  5BN5 A;  3BDC A;  5IGE A;  2B2U A;  3DEP A;  2KCM A;  2Z6K A;  2EXZ A;  3UDI A;  4A3E G;  2K5H A;  1TR5 A;  4DK3 C;  4KY5 A;  3KF8 B;  2BA0 A;  1SNM A;  2JA7 B;  4JK1 C;  5IGD A;  4QJF A;  3GD7 A;  5JOB A;  1W6J A;  4XT1 B;  1BBX C;  5LMN L;  2JN4 A;  3HOU H;  2A6H C;  3HOX H;  4MTK A;  1CK1 A;  4JBJ A;  1WTO A;  3EBE A;  4UY8 C;  1IBK Q;  2WIN B;  3GTK H; 
#chains in the Genus database with same CATH homology
 4G57 A;  4U67 3;  1Y1W B;  3MFY A;  2Z4I A;  2A73 B;  2D62 A;  5I2Y A;  3H94 A;  2K33 A;  1BO0 A;  4IFD I;  5JEA H;  1XX8 A;  4Y7N B;  4ILW A;  3LX0 A;  2M00 A;  4IUP A;  4ME5 A;  2PO4 A;  3PUX A;  1PLF A;  3NWS A;  2MJ8 A;  4WJW A;  3D4D A;  4B08 A;  1I4R A;  2JA5 B;  4KY6 A;  1V1P A;  2K28 A;  2OXP A;  3M7G A;  4DA2 A;  1LTB D;  1HTP A;  2NVT B;  5J39 A;  3TZD A;  5G3L F;  3KLR A;  3KBG A;  2EY5 A;  1HA5 A;  3VR5 A;  3R2I A;  1H9S A;  5ELB A;  3J7A V;  2C9O A;  5M5W B;  2F0N A;  2KJX A;  3I72 A;  4M1U B;  3CHB D;  2ZXP A;  1TS2 A;  3S1R B;  5IOC A;  1DJR D;  5C4H A;  2IX3 A;  2A69 D;  2B2W C;  2A5H A;  1VF7 A;  2XVS A;  4FYD A;  3QOJ A;  1CQV A;  3WOF A;  3MFG A;  1BQQ T;  3GTG B;  3S1M B;  1WTV A;  4J1M A;  4RGN A;  4KTA A;  1O7Y A;  1EZ8 A;  2TSS A;  5I6W A;  5JJZ A;  1ENC A;  4IN3 A;  4BWG B;  3I4N B;  2PW7 A;  5ELD A;  3L7Z C;  4CJ2 C;  3PV0 A;  2A68 D;  1S5F D;  3LNN A;  4K14 A;  2CVR A;  2E76 C;  2Z4H A;  4EQP A;  5T1I A;  2EOT A;  4FNF A;  2VUM B;  1Q1E A;  4K8I A;  4IFD J;  1S5C D;  3DXJ C;  1R9T B;  2DNE A;  4PMW A;  1CHQ D;  3RLF A;  5EKK A;  4DK0 A;  2ICE C;  2F4I A;  1WTP A;  2EYP A;  2IJ0 A;  3HOV B;  2OEO A;  4XQQ A;  3MZ5 A;  1S4Z A;  1J9O A;  4H0L C;  1RJT A;  2F0I A;  4IUV A;  1A3V A;  1CFM A;  2RSO A;  5JVH 3;  1MSH A;  3D4R A;  3K0Y A;  4E6I A;  1VF5 C;  4F7X A;  2L4N A;  4DXF A;  3BDL A;  1RTN A;  1DYQ A;  1X32 A;  3BVZ A;  3FPU B;  1ET6 A;  2H4O A;  1I4G A;  1JC7 A;  2RSN A;  3BZD B;  1Z6H A;  4C3I B;  5I9P A;  3OW7 A;  1I6H B;  5EKI A;  1IHZ A;  4IUN A;  1U4R A;  2I46 A;  3E6Z X;  2R93 B;  5C44 B;  4KD3 A;  2PZT A;  4RCN A;  3ND8 A;  1TS5 A;  3N6R A;  3HEJ A;  4RCO A;  4MN3 A;  1HUN A;  4I7Z C;  4RAU C;  5K36 G;  5NUC A;  3SHL A;  3N52 A;  1SFO B;  4HN7 A;  3GP7 A;  1JOQ A;  5JEA J;  1I50 B;  4RKL A;  2JYO A;  3UI2 A;  4C3I G;  5CV6 A;  2QF7 A;  3EQL C;  1SNQ A;  3DM1 A;  1EOT A;  3Q22 A;  2B2U C;  4DNT B;  3CKI B;  2K7V A;  1OXU A;  2PPB C;  5D14 A;  4A3J B;  3VYU A;  4HSP A;  3HZX A;  2TMP A;  3ZYY X;  4C3H B;  1HTL D;  2F0K A;  3C1E A;  1AZQ A;  5KYI A;  1EY7 A;  4EQO A;  3KBX A;  3MXU A;  1Y8O B;  1GJX A;  1GHJ A;  2NVX B;  2BE5 C;  2ID0 A;  4IAL A;  2RQX A;  1STA A;  1S5D D;  4A93 B;  5I2X A;  1LO5 D;  3IFT A;  4KJN A;  4K2K A;  2JA6 B;  1H9K A;  2VXW A;  4CHT B;  4C3H G;  2EVB A;  1B1Z A;  4ZLT F;  1LV9 A;  2F0S A;  3GTM B;  3KK7 A;  3NHH A;  1B2T A;  4F87 A;  3EVQ A;  2QDB A;  3DWA A;  1SDF A;  3NBI A;  3ONA B;  5ISR A;  4O1N A;  2EY6 A;  3NK9 A;  1PXU A;  1HRJ A;  5IGB A;  1HHV A;  1PRT F;  2HDM A;  1F9Q A;  1DZ1 A;  1GUO A;  4WFN 3;  1BCP F;  1BXT A;  1IW7 C;  1LTT D;  1E2V A;  1TKW B;  1IL8 A;  2B2W A;  3WOE A;  2EY1 A;  1YNN C;  1MBY A;  2CW0 C;  3LWE A;  3GTJ B;  1ZKO A;  4JBW A;  2NBF A;  1LTR D;  1UUP A;  4F8M A;  1RTO A;  5HGT A;  4XQJ A;  2N88 A;  3VYS A;  2J0T D;  4A3B B;  5C4Z A;  1MD2 D;  1V1P B;  2QIL A;  2KQ3 A;  3MHB A;  2LMC B;  1JOO A;  2EJF C;  3TME A;  1DD2 A;  5D3I B;  3BYT B;  2IPK D;  1C4Q A;  3Q0A A;  5JPM C;  1H9S B;  3V05 A;  3PUY A;  3VR6 A;  2FHT A;  3VYT A;  1L0X B;  3I70 A;  1PZI D;  4NMZ A;  2RVL A;  4XDX A;  1CZG A;  2HUG A;  4L8J A;  1PTO C;  3Q6S A;  1XXG A;  4X3K A;  1U4L A;  3PO2 B;  2F0F A;  1EFI D;  1ESR A;  5DM7 3;  2F0M A;  4H13 C;  2X6G A;  1U4P A;  3C46 A;  1ET9 A;  1HCZ A;  2XN9 C;  1IYV A;  1XTC D;  2Z1C A;  2PNR C;  4P2C B;  2ZXR A;  5EPL A;  3DHQ A;  1H9R A;  1KNE A;  3HS0 C;  4ZKC B;  1DOK A;  3NP8 A;  2WKD A;  4LAA A;  1BR9 A;  1BNZ A;  3BS1 A;  3S1Q B;  2NN6 H;  4L63 B;  1UEA B;  4R8I A;  1SE3 A;  5CV5 A;  2NWG A;  5FKA C;  4BA2 I;  2EE1 A;  2JXM B;  1D1I A;  4OL7 A;  5KEE A;  5I4D A;  3H09 A;  3TBI B;  4LK1 C;  4TKO B;  3QB3 A;  1PTO B;  2L0C A;  1TWA B;  1EEF D;  2K1B A;  1K83 B;  4ZAI A;  1E2W A;  5JPN C;  1QCB D;  3TSS A;  1ML0 D;  2GA4 B;  2NUC A;  1JQY D;  3SE0 A;  1FNV A;  3D6W A;  3URY A;  3M4Y A;  1L0Y B;  1X3P A;  1R4Q B;  3GV3 A;  1GUT A;  2A6H D;  1I4Q A;  3BVG A;  2ENB A;  3QJY A;  1LAB A;  3RZO B;  3R93 A;  2F0G A;  4OGQ C;  5C5M A;  1Y1V B;  1BOS A;  2F0J A;  1Q90 A;  2F0Q A;  2JE6 I;  2B2V A;  3PIP 3;  1WVL A;  4CJ0 B;  1JWS D;  5DEH A;  4QMG A;  1B50 A;  3C1F A;  4B9W A;  2I07 B;  4FO2 A;  5E3F A;  4MHE A;  2CHB D;  4WRD A;  2RDG A;  2EY2 A;  5ELE A;  4PMC A;  3V2T A;  3A8J E;  3ND9 A;  3OIP A;  1UAP A;  5FK9 C;  5D3D A;  5C3E B;  1D1K A;  2MUY A;  2R6G A;  2L1B A;  4G7O C;  2PMZ B;  5IIF A;  1ZXT A;  3ERQ A;  4DK1 A;  3AB9 A;  3MVV A;  1GUW A;  1EYC A;  3T4A C;  3MXG A;  2A6E C;  3K57 A;  5FO7 B;  5IOD A;  4KHZ A;  3NTH A;  1G2T A;  5EPJ A;  1PDQ A;  5KGU A;  3HP3 A;  3KUP A;  1SYG A;  3HG9 A;  1D5X C;  1C48 A;  1BUV T;  5I9O A;  2B39 A;  1B53 A;  1JWM D;  3U9O A;  1EU4 A;  3MEH A;  4DN4 M;  1G29 1;  4PQX A;  5ELF A;  5CV8 A;  3CRL C;  5KNB A;  3VA5 A;  1V1O A;  1STH A;  3OSO A;  1SYB A;  3QWN A;  5KNC A;  2JP1 A;  1FD7 D;  2HQE A;  1CTM A;  1H9J A;  3A54 A;  3S17 B;  4LJZ C;  2Z8L A;  1EZ6 A;  3X3M A;  3J7A F;  5EGT A;  4FXG C;  1RCV D;  1KNA A;  1F77 A;  5KIX A;  3KLS A;  1B4O A;  2F0P A;  2B63 B;  2XIW A;  1WTX A;  4F88 A;  3M4O B;  1LTG D;  3IFD A;  5C4J B;  3T56 B;  2AUJ D;  1M4V A;  4BY1 B;  3DWQ A;  4DFA A;  5FO9 B;  4A3D B;  5EJW A;  3OPO A;  1FYC A;  5F2D A;  1DXM A;  2F1M A;  5C4X B;  4A3G B;  1D5M C;  2HCC A;  2OT2 A;  4CGY B;  4HMJ A;  2AQ2 B;  5FOB B;  3NPP A;  2G9D A;  2E74 C;  3D31 A;  3SK5 A;  1DOM A;  3TZU A;  1KDB A;  4HR7 B;  3MWY W;  5EQ0 A;  3IAY A;  5KRU A;  5IT9 E;  3WDN A;  2D9U A;  4NW2 A;  3A7A B;  5CC4 A;  5CV7 A;  4QCL A;  4KJO A;  5J22 A;  1PTO H;  1SYC A;  4XIG S;  2O2L D;  3EA6 A;  4G7H C;  4KY7 A;  4HCS A;  2BOS A;  2PW5 A;  4LMQ D;  5CBA E;  1EWH A;  1SAP A;  2XNA C;  3FMC A;  3EJI A;  1NUC A;  1B3A A;  1Y8P B;  3NTI A;  4FXK C;  3PUW A;  2KUM A;  1F9P A;  1I3Q B;  3M7N A;  2JSO A;  3HOY B;  2AWN A;  3I4L A;  1SBB B;  3D8G A;  4XXE A;  3SDZ A;  2JEA I;  1E0B A;  2L9H A;  5M3M B;  1M8A A;  5JVG 3;  3GTO B;  1OO9 B;  4K6L A;  4A3F B;  3HKZ B;  2VB2 X;  1EYA A;  1XYI A;  3NQI A;  2F03 A;  3M85 A;  3GQB A;  2KOL A;  5M5Y B;  3IL8 A;  4CKC A;  3T53 B;  4G4K A;  2PZU A;  3S9W A;  2XSC A;  3PUZ A;  4FP5 D;  2A68 C;  3NXW A;  1B44 D;  2K04 A;  3EFX D;  3I91 A;  2BE5 D;  2EJM A;  4X3U A;  2NN6 G;  1WTW A;  2WB1 B;  1DCZ A;  2WII B;  5LHY 1;  1WTR A;  1WTQ A;  1HFG A;  1W6K A;  1TS3 A;  1YNJ C;  4K8J A;  1O7L A;  3BDO A;  1BF4 A;  1FNU A;  3AU7 A;  5C5L A;  2B2V C;  4KN4 C;  1EYD A;  1LAC A;  1O7Z A;  3U9S A;  4CBV A;  3I90 A;  1MSG A;  3PUV A;  1MGS A;  4KKU A;  4V19 0;  1GOZ A;  1EWC A;  1LT4 D;  1WD0 A;  2EYH A;  1SE4 A;  3IKJ A;  3GTP B;  3OOC A;  1PFN A;  3OMG A;  4PMB A;  1G91 A;  3T13 A;  1A3U A;  2SDF A;  1TY2 A;  3SK6 A;  1C8C A;  1JE4 A;  3VYR A;  2B8G A;  1V8Q A;  2FMC A;  1IW7 D;  3J81 L;  2EYM A;  3TP6 A;  2LKV A;  4BBR B;  1SYF A;  1YNN D;  2NZ1 D;  3FKI B;  3RUZ A;  2CW0 D;  3PIO 3;  1V43 A;  1NSN S;  5CBE E;  2KEE A;  4NP5 A;  1PFM A;  4ZUI A;  2IT1 A;  2K5W A;  1TWF B;  2A74 C;  1HPC A;  4KI0 A;  5AFW A;  1CHP D;  2Y0S B;  1TWG B;  4RGO S;  3S2D B;  2WAQ B;  4AYB B;  2Q8R E;  4ODG A;  2WAC A;  4GZY C;  4QUF A;  1CM9 A;  3H6M A;  2L55 A;  1QB5 D;  4FF1 A;  1EY5 A;  5KYL A;  3GO5 A;  1SSO A;  4FF3 A;  5ELC A;  3TN2 A;  1TII D;  3W3A A;  1JR0 D;  1H9M A;  3HRZ C;  1CA6 A;  1NAP A;  5FO8 B;  2F0L A;  3Q24 A;  1PTO D;  1DOL A;  2X6L A;  1PRT C;  1D2B A;  4QUC A;  2DY7 A;  1BCP C;  4DGZ A;  1LTS D;  1U4M A;  5C0X G;  4X3T A;  4Z9C B;  3S2H B;  2E2H B;  3S1N B;  3K6O A;  4FF2 A;  1BDO A;  5COY A;  5A35 A;  3R2T A;  3GTL B;  2B2Y C;  3E0J A;  1KLG D;  2PYK A;  4J8Q A;  5EBD A;  4DU9 A;  3C3L A;  4H44 C;  2MP1 A;  3FVQ A;  3A55 A;  3K5M A;  3O13 A;  1K8M A;  4DNR B;  1PRT B;  2F0D A;  4A3I B;  4N9T A;  1PZK D;  5IT9 L;  2M9V A;  2IWH A;  1QG7 A;  2R61 A;  5BN4 A;  3W2D A;  1Y69 U;  1U9R A;  2PQE A;  4ID6 A;  3K5O A;  2QCP X;  1SNC A;  1F2Z A;  1ROD A;  1ILP A;  5COR A;  4FVM A;  4J6H A;  1JOR A;  1QOH A;  1GHK A;  1KAA A;  1AFP A;  2XWB B;  3M3Y B;  3MXN A;  2Q8T A;  2F0E A;  2BDO A;  4KN7 C;  1EQT A;  3NBH A;  5EBC A;  1IYU A;  2E2J B;  2WKC A;  3FDT A;  1AZP A;  4OO1 H;  2RKS A;  3QG1 A;  1JCK B;  1HXY D;  5C3W A;  2BDN A;  2HDL A;  2RBM A;  5KND A;  1VCI A;  1JWU D;  1SJE D;  1LT5 D;  1O78 A;  1FR3 A;  1ZEQ X;  2E2D C;  4QF4 A;  1NR2 A;  3TDQ A;  4C1N I;  4TSS A;  1GUG A;  4A3M B;  3G7L A;  3MTS A;  4BA1 I;  2XRQ D;  2K5Q A;  2FFK B;  4NKL A;  4EVO A;  3K7A B;  4DF7 A;  3ERO A;  1G2S A;  2A6E D;  4HMI A;  4XQN A;  4ZK9 B;  4K5V A;  5CV9 A;  3CU7 A;  5CYU A;  3FRP B;  1ZYR C;  1RDP D;  2KA7 A;  2L5T A;  5CMD A;  1IKM A;  4A3E B;  2WV6 D;  2NN6 I;  5IGG A;  4OIJ A;  3I73 A;  1B9N A;  1AN8 A;  2K05 A;  2ZT9 C;  2XWJ B;  5T1G A;  4M8A A;  2F0T A;  3P20 A;  4NDX A;  2IL8 A;  3HOW B;  1A15 A;  1SYE A;  3VR3 A;  5LL6 X;  4DAY A;  5DAU A;  3HOZ B;  3VA7 A;  4RHS A;  2EYO A;  5M5X B;  3VR4 A;  3A7L A;  5I6Y A;  3H91 A;  5G3L D;  5JAV A;  2F0V A;  1D6E C;  1UNS A;  2L11 A;  4OIK A;  4XYQ A;  4RWS C;  3J81 E;  4IUU A;  4A3K B;  5C0X H;  1A2U A;  1QWY A;  4ZRZ A;  2AUK A;  5A2Q E;  2RDF A;  4DXG A;  1TS4 A;  4ZQ3 A;  1EU3 A;  1D5Z C;  2F0H A;  2F0O A;  3MXP A;  1ENA A;  3OWE B;  4KKS A;  4DAP A;  2DNC A;  4S3S A;  2R7Z B;  1SMY C;  1TVX A;  4FF4 A;  2B8F A;  3L9A X;  4C3J B;  3OIQ A;  2NVQ B;  1A3T A;  4Q5V A;  5TSS A;  1AP0 A;  2WP8 J;  4PV1 C;  4QB4 A;  3SK8 A;  4RGT A;  3T16 A;  3SK4 A;  1OXS C;  4PNY A;  1PYW D;  2VB3 X;  1SXT A;  1TT2 A;  2XRS D;  3DMU A;  1SE2 A;  2R92 B;  3BVM A;  4DAV A;  4C3J G;  1ONL A;  1HQR D;  2J4X A;  3OMC A;  2B2Y A;  2K32 A;  2B2T C;  4KK7 A;  1ESF A;  1F2L A;  3D3R A;  1R4P B;  4RKB A;  2IW3 A;  2MHV A;  5E4X A;  5C0X I;  1FNW A;  3J80 E;  5LL6 S;  1CZW A;  2SNM A;  1Y8N B;  1RKN A;  2OF1 A;  3I3C A;  3H3V C;  1WD1 A;  2ICI A;  4K2L A;  2K6A A;  1SJH D;  4EQN A;  2SEB D;  2DN8 A;  4FXD A;  4BBS B;  4O42 A;  1STE A;  3MA2 B;  5CV4 A;  1QNU A;  1EEI D;  1STN A;  3TP5 A;  5C3X A;  2K5D A;  4KD4 A;  2KVM A;  1SNP A;  4KV6 A;  1RHP A;  4OHJ A;  3V96 A;  2R3Z A;  1EY8 A;  1I4H A;  1EL0 A;  4B9X A;  2LS0 1;  1TQO A;  1AW7 A;  2A69 C;  4BY7 B;  3NSW A;  1T5E A;  3CRK C;  1LLR D;  1QJO A;  1PMR A;  2K01 A;  2E75 C;  5FLX E;  3DUZ A;  2FJ2 A;  2D2C C;  1YNJ D;  2X69 A;  1DM0 B;  4C2M B;  3PO3 B;  1TWH B;  4I65 A;  4HCE A;  1GUS A;  1TWC B;  3JAM L;  1EIH A;  5IGF A;  2N55 A;  4V0B A;  2DY8 A;  1CQF A;  1Q8I A;  2VNU D;  4N9P A;  5EKL A;  4IUQ A;  3X3N A;  4CKB A;  3K58 A;  1Q12 A;  5C6A A;  1E2Z A;  4CKE A;  1FGB D;  3KLS X;  4Q0F A;  5CR3 A;  4YIJ A;  5IGC A;  1JB3 A;  5M9O A;  3RD4 A;  3H0G B;  1VDZ A;  1J8I A;  3P75 A;  4XYO A;  3KF8 A;  3G6J B;  3P7J A;  2ZXO A;  4XTC S;  4K6D A;  4RGM A;  3GTQ B;  3DEO A;  4OO1 G;  4K5W A;  5C0X J;  2LFN A;  3AMU A;  3OHX C;  1K8O A;  2E2I B;  1EY9 A;  1IKL A;  1CA5 A;  4UAI A;  2HCI A;  3DWP A;  2F3V A;  1JIC A;  3QIA A;  1VMP A;  1HQM C;  2MGS A;  1QNK A;  1VMC A;  1WCM B;  1KAB A;  1TU2 B;  4RHR A;  4KKT A;  2EZV A;  1S5B D;  1A2T A;  1B9M A;  4C1N K;  3TP8 A;  2F0W A;  5M3F B;  2CQA A;  4ZUJ A;  4TRD A;  4ULL A;  1HUM A;  1JOK A;  1PRT D;  1F2Y A;  3QO2 A;  4HSV A;  3NQT A;  1PZJ D;  3FPP A;  1BCP D;  1EY6 A;  4IFD G;  3L3O C;  5A2Q L;  1EY0 A;  1Q1B A;  1Z47 A;  2SOB A;  1F2M A;  1KDA A;  3ITP A;  3SR1 A;  2O5I C;  3R3O A;  4ABN A;  2NTT A;  1X3Q A;  1HFN A;  2BCO A;  2J7Z A;  2V4D A;  1I6V C;  2BA1 A;  2M2L A;  2IX1 A;  1RF2 D;  1I4X A;  2PZW A;  3K59 A;  3HOU B;  3HOX B;  3I8Z A;  4HAE A;  2EJG C;  1QIL A;  4R9W A;  3GTK B;  2KCC A;  2FIN B;  4MIU A;  3D6C A;  4BS9 A;  3SEB A;  3MC0 B;  2IX0 A;  2NTS A;  4H7B A;  2KEC A;  2KED A;  1NCV A;  3VR2 A;  3S14 B;  3QOL A;  1HA6 A;  4C56 C;  2D5D A;  2LY7 A;  4XT3 B;  4QIW B;  1ILQ A;  1PFB A;  3BYY B;  3Q23 A;  3K5L A;  2KCN A;  1SEB D;  4K5X A;  4KMU C;  2B2T A;  3P1H A;  4IUT A;  3BG3 A;  1KLU D;  1OXT A;  5JEA G;  3J80 L;  2YYZ A;  1SYD A;  4R8N A;  2G9H D;  3I4M B;  3NUC A;  3TP7 A;  2JA8 B;  2AWO A;  1QE6 A;  3SXH A;  2F3W A;  2JEB I;  1BCP B;  1Q3L A;  1OXV A;  5DM6 3;  4G7Z C;  1EY4 A;  2EYJ A;  3K5N A;  3E5S A;  4UDU C;  5CGK A;  2AQ1 B;  3A56 A;  3RZD B;  3S15 B;  3A8I E;  1GUN A;  1EQV A;  1PTO F;  5K5P A;  1G8Z D;  2YU9 B;  4L6T B;  2QEJ C;  2EDG A;  1TY0 A;  2C5C A;  1RD9 D;  1F9R A;  5EPK A;  1KTK A;  1G6Z A;  4EGV A;  1LT6 D;  5FLX L;  3C2P A;  3R8B A;  3J7Y W;  2H1E A;  4WOR A;  3GV6 A;  2NB0 A;  3NTK A;  1EIG A;  2L12 A;  1II3 A;  2RDH A;  1DON A;  3D4W A;  4IUR A;  1CT1 D;  4U68 A;  1S5E D;  1ZYR D;  1STG A;  3CQZ B;  3JAM E;  5K36 H;  2PCF B;  1LTA D;  4KHV A;  1T5X D;  2EYF A;  1MI2 A;  2NYZ D;  2AQ3 B;  1LT3 D;  4RA8 A;  1STY A;  4IQZ A;  4ZYS A;  1I4P A;  4HTH A;  1F9S A;  1GXD C;  3MAQ A;  2EPB A;  4TQU S;  1OXX K;  2F0U A;  1KDC A;  2NVY B;  2Q8I B;  5E4W C;  1AEX A;  4CJ1 B;  1Z7T A;  1ENF A;  5HUR A;  1XWE A;  2K03 A;  3PMF A;  3S16 B;  4IFD H;  2SNS A;  3F2U A;  1SND A;  3NWT A;  3LWU A;  2MPM A;  3A8K E;  3OWF A;  4HED A;  5DNF A;  3T51 B;  5E1F A;  3RMH A;  1NR4 A;  1ICW A;  1A6X A;  4IZ8 A;  1O80 A;  1SNO A;  4RH6 A;  2O5J C;  4X3S A;  2EYL A;  4ZKB B;  3SVM A;  2QKI C;  3FEW X;  1LTI D;  3NE5 B;  2O4X A;  4OO1 I;  2FMM A;  1STB A;  2RA4 A;  1CI3 M;  5J1Z A;  2KHS A;  5BN3 A;  3HGB A;  5D65 A;  1SMY D;  4RFB A;  5BN5 A;  3BDC A;  5IGE A;  2B2U A;  3DEP A;  2EXZ A;  1TR5 A;  4KY5 A;  2BA0 A;  1SNM A;  2JA7 B;  4JK1 C;  5IGD A;  3GD7 A;  5JOB A;  1W6J A;  4XT1 B;  1BBX C;  2A6H C;  1CK1 A;  1WTO A;  2WIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...