1F3RB

Complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
257
structure length
257
Chain Sequence
QVQLLESGPGLVRPSETLSLTCTVSGFSLTSFSVSWVRHPSGKGPEWMGRMWYDGYTAYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTRDLYGGYPLGFWYFDFWGPGTMVTVSSGGGGSGGGGSGGGGSDIKLTQSPSLLSASVGDRVTLSCKGSQNINNYLAWYQQKLGEAPKLLIYNTNSLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCYQYNNGYTFGAGTKLELKAAEQKLISEEDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE RECEPTOR ALPHA
publication title The third-dimensional structure of the complex between an Fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor: a combined two-dimensional NMR, homology, and molecular modeling approach.
pubmed doi rcsb
molecule tags Immune system
total genus 54
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2000-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f3rB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f3rB02
2X4TA 3HMXL 4WJ5A 3OJDA 3BZFB 1JK8A 1B3JA 4W6WB 3HPJB 5J4MA 2I5YH 2H9GA 3L5XL 3MRGB 4QRPD 3IKCB 4NPYB 4F37K 1G7LA 2JK5B 4NQCE 1QRNA 3MRIB 2EH7H 1OY3B 5EOQH 1YEJH 3WLBA 2MFNA 1A7NL 3RY6A 3ZHDA 2CK2A 2EDLA 3HCVA 2VAAB 3R06B 2DIAA 5IEHB 4NRYB 4K7PY 3CFCH 2FR4B 4X6DF 4QY8B 1RI8A 2VR5A 4NO3A 1MFAL 2ARJQ 2EICA 4LQFL 2M26A 3VWJB 1ZA3B 5MP6L 1LO5B 3U4AA 1I7RB 3CXHJ 3SPVB 3VFVA 2XWJA 1T7VA 4RFEA 2GI7A 2VOTA 5DK3A 2FD6L 3ARFD 3VXUE 1DANT 3SY0A 1NFIB 3PL6B 5K59E 5KBNC 2R2BA 3NIGF 3HG1B 4MJID 4M7LH 5I15H 1S9YA 2XKUA 4UBDC 4ZQKA 2QL1A 5KG9A 3EDJA 4X7DC 4Q9CA 4ZUWB 3MZTA 4MD4A 2G9HB 4PJGF 2NY1C 1RJLA 4Y4HD 1DLHB 1BEYL 1U91A 3DV6B 4YR6B 2FRGP 1VFOA 5E6YA 3RAJL 2D7TL 2RCSH 1IM9B 3SO3B 4HH9A 2XXCB 3VXRD 3P9LB 5LG1A 1TETH 4ZPTB 2AJ3A 5I74B 2LFGA 1JRHL 1W72L 4HG4K 4XP4L 1IL1B 1QFUL 1ORQA 2R56L 1PVHA 1B0GB 2DI8A 1L0YA 5C0FB 2CO6B 32C2A 1KFAL 3IU4H 4HBCH 1CICD 4QYOA 5EBWB 1VERA 4I2XE 3MCKB 4DCQB 1WISA 5GRVK 3BGFB 4WO4D 1IGFL 1B9ZA 2H32A 4WW2B 3WDIA 2Y07H 5I75C 4PJ8A 2WQ8A 2DJSA 4BK4A 5CZVH 5FHAL 2DJ4A 3VMPA 4DAGH 1UG9A 3FQUB 1NLBH 2IWGA 1KTKE 3HI1A 1CU4H 1KB9K 1VHPA 3QQ4B 3OJ2C 3HFMH 1KJVB 3VXSE 1IM3A 4JKPH 3BO8A 3C9NB 2EDNA 5DRZB 1FFRA 4MJ2A 1MRCH 5I1GL 2P48B 4EN3C 2ARWA 3FB6B 4JLRA 1B6DA 3KLSA 3B5TA 1KEMH 5FA3A 1ZLSL 4O5LH 4NN7B 4FHBD 4CADA 5E6ID 4UQ2B 3V6FB 5DMGD 2F5AL 3O81A 3DX8B 3ULUL 1DDHB 1CD9B 2B1HH 3IS1X 1S5HA 2EYTA 3C2AL 3V0VA 3G5ZA 5FGBC 2UUDH 1NCNA 4RGOH 3FB8B 4LEXL 1XMWA 1QSFA 4NQTA 1RJCA 2FSEA 3VXMA 3O4LB 3KPNA 4MNQE 3UROR 2YPLB 1MCHA 3MV8E 3P4NB 5F7LB 1E4JA 3NIFF 1TTFA 5FGCE 3RNKB 3EOAB 4XPHL 4DKAA 2HFFA 5FYKE 5SX5K 3G6JB 4FZEH 1GOFA 5ACZA 2E7CA 2PW2B 2V2XA 1I1FB 5GXBB 1D5ZA 1AO7D 4D0CB 1WUNT 3MTRA 1WBZB 3MRLA 4POZD 1PAMA 5F9DC 5JLZB 3DVGA 1NC2B 2PCPA 5IP4A 1NCCH 4JFFE 4G6KH 4KKBD 1H5BC 2EIZB 3VXQB 3HI5H 2VLKE 1KGCE 1QHPA 2YUVA 3VG9C 3C5JA 4PGDA 5EU4B 5JTWA 1M05A 4U3XA 4F58H 5MHSE 4R4ND 15C8H 4K8RD 4S1RL 4NHCH 5E8NA 2V5YA 5INCA 1YPZA 5ABDE 1DUZB 4ZXBB 3MLWL 1CG9B 1JNLL 2MOVA 3WXVL 4QTIL 4A6YA 3ARGD 5AD0B 1FNLA 2YPKA 1F11B 3GSXA 4X8JB 1JHKH 2HJKA 1CXLA 1D5IL 1E0OB 1RZ7H 6FABL 2OTUB 4PR5B 3DXAE 3JWOL 4QHKJ 2NY4C 3SDDD 1BJMA 2W9EH 4HC1H 3ZT6A 4KMQA 5IB4A 1CWVA 3QUZD 5HYSB 4J1UA 4PLJC 3D3VA 4PJCB 4Y5VC 3GMRB 4BH7B 5D9SB 3V8OA 4Y1AD 1EZVY 3UTOA 4RAHA 5AEAA 2NQCA 4LMQI 1R3LB 4MDJB 1CGVA 4HCRL 5C0AE 4TTGA 1VPOL 3KPSD 1AR1C 3QG7H 5IMLB 1EO8H 5KJRL 1P4IL 5HHNA 3I3BA 4LAJH 1NGWA 1A0QH 4U6VL 5C07E 4HX1B 4V1DB 5FYJE 5T5FL 1N0XL 4Y5YC 1JCKA 1MHPH 3MV7A 4KUZL 2ILLA 1MY5A 2M8XA 3LKRA 5IVXE 2R2CA 3UEZA 2DL9A 3TNNB 4LLWA 5E56A 3QRFM 2Z35A 3PHQA 1E4XL 3LN5B 1NL0H 4NFDA 2EXWD 5D7IB 5AWNH 3O41B 3U4EA 2JCCE 2BZDA 4YHLL 5AZEL 2YUXA 1ADQH 2R9HD 4HWEH 3HE6B 3S7GA 1UYWL 4FQQA 3HRZA 3GB7B 4G8EA 2HMIC 4MMZC 3BH9B 1E6OL 1KXTB 4N0FB 4LGPB 3W0WA 5E7BA 3GSNB 3OKDB 1NCTA 3T0ED 4C56E 1HEZB 3UBXA 1II4E 1E4KA 4WV1C 4X4YB 5KSUB 4OTXL 1W0WA 3JWDH 2DQCL 3OKLA 3STLB 3GMQB 1RHHB 4UNTA 1A6AB 4LOUC 3AVEA 3BE1L 4XNMB 1UM5L 1MCLA 1ZLUK 1RK0A 4N90D 5C6TL 4QT5B 4QOKB 5GRUH 3ZDYF 1HHGA 5JPNB 3DUUA 2AAVA 4G42B 3EDKA 1S3KL 5ILTH 1T7XA 2DQJL 3RKPA 3GI9L 4PJEE 2NY0B 5EIIA 1G0YR 3DVNA 4KUCD 1RUAL 3O11A 1ZT1A 5ALBL 4DZ8B 4Y2DB 1GIGH 4OFDA 5IBUG 2PXYB 2MTPA 3I6LD 2FL5A 4YXHH 3GRWH 1IRAY 4FQLH 2MNUA 1E28A 3H3PH 4E5XB 4IRSB 2H6PA 4JQXA 1CFQB 2AV1B 3MROB 3TBTB 2EE6A 2NX5D 4P23B 3BHBB 2H3NB 4K55A 5E8OB 5D1QD 4M62H 5HI3C 3CSYB 1KNOB 1WFOA 4I5BB 4QXGH 2PW1A 3O2DH 5T3ZH 2VXVL 5C0CB 4BFGA 1Q0YL 1FSKC 4G80B 1PKQE 2VKWA 3EOTL 3MNZB 5DFVC 1YEEH 1YEKL 4OF5A 2BNRD 3V6OA 1T7ZA 3THML 1YPZF 2C3HA 1CBVH 1MHEB 3WD5H 2EZ0C 5C08D 3FT3B 3E0GA 1CXHA 4K7PH 4M03A 5F1NB 4BSWB 4HK0A 3SE9L 1N8ZB 1F2QA 1OLZA 3MLSH 3V2AR 2Z92A 3RWDA 1P6FA 5F1OB 1WAAE 1YJDH 5DQJA 1WEJL 2NZ9D 4M7JH 4XGZA 4LFHG 1UWGL 2CMRH 2HVJA 1PSKH 2D31A 2IFFH 4G9FD 5BVJB 1UXSA 3WO3B 4HKBA 2KZ1B 4NHUB 5KAQG 3UX9B 4OIAA 4OZIB 4P2QB 2R2HB 1RZ8A 3BVNB 3TZVC 4CN1A 4OCXL 4HUXA 4PRDB 2A83A 4K3EH 3OKOA 4XRCB 1MHHB 5I73B 1SYVA 5IHZB 3RIAK 1EA9C 1RZFL 1JPSH 2YWYA 5F7DA 4U1GB 1A1MA 4HUWA 3U2SB 4KRPD 3LH2L 2UZYB 2DIBA 3LEVL 2Q76A 2WANA 3I6GA 2GY5A 1I3GL 3OKNB 1PG7H 3FT2B 4I18C 9CGTA 3K81A 3MA7A 3RWCA 1BIIB 4JGUA 2ENYA 1HQ4A 4JFXA 2O5XL 3NCMA 5TQ2H 5J12C 2O5YH 4YDJA 1B6UA 4QHLA 1UB6B 1QSVA 3MACL 3P11H 3C60C 2FX7H 5GJSH 4RGND 5T1LB 3S96B 5IK3A 4GQ9H 2VIRA 4MMXC 3B43A 4MLSA 4QKXB 3UZVB 4KK9D 3WFEH 3P0YL 4OZFA 3NCJH 3WIFB 2QADD 2JB5H 3MXWL 4IOSD 2AI0H 4WDIB 5SWZE 2Z91B 1DJSA 2W92A 1B0RA 4ZAKA 5JUEL 2PKDA 2X7LA 4OFPA 1R6VA 2WIIA 1HH6B 3ZDZF 5GGVL 5ERWA 1S9VA 4JCLA 1R5WA 2CGRL 5CJOL 1UZ6F 3V5KB 1K8DB 1WBYB 3SJVE 3GGWA 5DT1H 3ULVD 1T2JA 3D0LB 4NN5C 1CCZA 4F57H 3MX0A 5I9QC 1Z9LA 2DI7A 2ESVE 5DJDB 1HHJB 3K4AA 3TH4T 3KWWA 2QQNL 5KVFL 4ZO7A 3OV6A 1AHWB 3V52L 4HEME 4G9DA 5FYLE 4JJ5B 1T1ZB 3RDTB 3H42H 4G43B 3LDBC 1BFVL 3MJ7A 1BBJB 3S35X 3R8QA 3VFTB 5J6HA 1BVKB 4P3WA 2Z4QB 4IMKC 3LQZB 4K94H 1NJ9A 3UPRB 4MSWA 3ZYOA 1QSED 1ZT4B 2A6JB 2VDKL 3OR6B 5LWYL 3IVKA 3ARWA 4X7SH 3SCMC 4JQIH 3OPZL 4OF0A 1CS6A 1KJ2H 5C0GA 2EC8A 2XI9A 3MBEB 4PGEB 1HHKA 1CF8H 5CEYA 4NZTL 3V4PH 1KELL 3QDJD 2EXYD 4MX7A 3CC5B 2VDRH 5DLMH 4UTBL 3DI2B 1Z0MA 2R2EA 3VWKC 4KWUA 4OFIA 4NJ9H 4CRPA 3QEHB 2CDEA 2DQGL 4MD0B 3FN3A 4UDTA 1HILB 1FORH 1LO2H 4PP2B 3UJIH 5K33A 1DVFC 4U1NB 4RNRB 4XPFH 3O45B 2YR3A 4JFDA 5DJZB 1FFOB 5JZ7D 4D9QE 4ODVL 4YIQB 2J4WL 3TA3C 3B6SB 3JWNC 2IGFL 1B2WL 1TNNA 3D48R 4ZUSA 2AXFA 5EUOB 2YA2A 4EUPB 3RVWC 3LV3B 4ZTPL 2ZUYA 3RP1A 1S9WB 4K23L 1FYTB 4A6YH 2IANE 5E00A 3UTTD 2F5BL 2JF1A 1VFAA 4G7VL 3ZTNL 3MJ9L 4UIKH 1HSBB 3KYKH 4EBQH 5ADOL 1U6AL 4FXLA 5GGUB 2QLVB 4CU6A 1IEBB 5C0BE 5INDA 4DGVL 3WO4B 5LXGH 4XNYH 3V4UH 5HGDB 3MA9L 3ALXA 3FOMB 4DEPB 1LK2A 4PS4H 1R3JB 2X4UA 3L3JA 3WNNA 3HMWH 3MRMA 1Y0LB 3QDHA 4L3ED 1PX3A 4JRYA 3TH3T 4IIQA 5DO2C 4U6YB 4XVTH 1RZIA 1A1NA 1KTRL 1IC7H 1EAJA 4ONGH 3QHFL 2F53A 3REVB 4G6JL 3JTTB 4JFED 4LKCB 2X41A 3NPSB 2X42A 5I1EL 2AEPH 2Q6WB 4JQVA 5DK2A 1KLUA 3ZDXF 4OF3A 5F7WC 4X7FC 4NNYA 3QI9C 1IAKB 4HT1L 5CMAB 2I27N 4F9LA 5FO8A 1BQLL 2HT3D 2HH0L 4P2CG 4MS8C 4UT6L 3MREA 3RGVA 1F00I 1FZOA 4I0PB 5IVOA 2ZUWA 5TE6H 1F4AA 2A9NH 3EDEA 2WINA 4YXKL 4ZS7L 3SE4C 4N8VG 4PY7B 2GT9A 1UCTA 3QWOA 1Q0XL 4PJ7B 5CINH 4Z95L 1JHLL 4YFDB 2EIBA 2IH1B 2Y72A 3JV4A 5TF1H 4EQ2A 1CXIA 3BT2L 3PWUB 5TH2B 4NWTH 3CXDH 3PDOB 2VLRB 5C8JB 1FFPB 5FA4B 4Y5VB 1X5FA 2B39A 3ZO0A 5EU6A 3VG0L 5AYUH 1BD2B 4Y8AA 1KCSL 3OAYH 4QRSB 2YD4A 2PO6C 2NLJA 4PRIE 3QEGL 3KHOA 1Z5LA 4PRHB 2C3XA 3SGDI 2MHAA 5DZNA 2CSPA 2Y5TB 3VWJD 1NKOA 5DMYA 3BESR 4H8WH 2ZSVA 5GGSA 4Y4KD 3BAEH 1CQKA 4OCRL 1J1OH 2IMNA 4QRRE 5FIEA 1J87A 2E3VA 1EEYA 3D85B 2NCMA 3P9WB 5SWQB 1KG0A 3O3AA 2M1KA 1R0AL 3PL6D 3ULVL 4LLUB 1DQJB 1INQA 5C71A 4X6EB 3HG1D 3MRQA 2GITA 4FQHB 2IH3A 1XGUA 2JB6A 1CIDA 1MI5E 1JWSB 2N7BA 4P5KB 2AABH 3CZFA 3T09A 2B20A 2VE6A 4OF6A 5GGSY 3L3KA 3QDMB 5HI4C 1BGXH 2ICCA 4JFPB 1I9EA 3WEXB 1YEDB 3UYRH 1IM9D 4NCDA 3M8OH 4AEHH 1NMAL 4HGWB 2C1OA 4FXKA 5L6YL 4LVOC 2BHZA 3GMOA 3DX6A 1PDKA 1U8MB 2E9IA 3LQMA 3OKEB 5BZDB 3QQ9C 3PWPE 1DQML 4MA3A 3ETBF 3RGHA 1F13A 4YE4L 5E03A 5IVNA 5C0JB 4FQJH 1DCLA 5EUKA 4AMKL 5I1HL 1SBSH 4LDLB 4QTHB 3MFFA 2VQ1A 4LLYB 2OJZH 3IU3B 4NZRL 3O2WH 1VDGA 1FNGA 2ERJC 3E3QC 3RI5F 4HPYL 3TH2T 5DD6A 3R4DA 3AREC 3R1GL 3E1F1 3IAGC 2V7HA 3NCEB 3U0WH 3Q6FB 1N2RA 1U8KB 2X4OB 1QG3A 4OKVA 1AP2B 3F58L 3FQWA 2JKXA 1WTLA 3BZ4B 3AFLA 3D1MC 1E6JH 4L8SB 4JFQB 3CCHB 2VDLL 4IS6A 4CU8A 4XVUC 1Y6KR 3X14A 1A21A 1KTLA 4RDQG 1YNTA 4Z7UB 4PRAA 4BUHA 1NAMA 2EDJA 5J1AB 2E9BA 3LD8B 2WBJA 2LTQC 1D9KB 4Y2OA 4WFHE 1SEQL 4ERSH 4KDTC 3OJVC 5F3BB 2HT2D 4KI1A 1RUKH 4OQTL 1AI1L 5E24E 1G6RA 3QISA 4RMTA 4ZUTB 2YHGA 1FNHA 2BNQA 1KBGH 1I9IL 5HYQA 4OGAC 1K8IA 1LDPH 4U2YA 1YY9D 1ZHBB 4NUGH 5SX5H 5JQ6L 1MWAH 1S7RB 3CZJA 3O4LD 3L1OH 4X80L 1T83C 1ZKAA 2NYYC 2YPLD 1LHZA 3LKSB 2H45A 1K6QH 5HGGS 3EFDH 2I26N 1MUJA 1BBDL 2R0LL 4G8IA 4MXWL 1RJYA 3QUYA 4X6BA 5B8CB 4O58L 1IEAA 4OZFH 3GSVB 1RJZB 1RMFL 4R97C 2EYSB 5DEZA 1RZKL 3EW3B 4ZTOH 3V95A 4ZYKB 1OP9A 3SDXA 3QEUB 4FQCH 3BW9B 3QNZB 5C2UB 3PQYA 4OCSH 5E94A 2ZKHH 4ZS6C 3OHXB 1NC2D 2NR6C 2R29L 1N6UA 3WNMA 1U42A 2I9LA 1S7SB 4NUJB 1INEL 1OHQA 4U1JA 5DJ8A 3B2VH 5IW1A 4HIEB 1A4JA 3VRJA 1DANU 4QF1A 2OXHA 3QHTC 4J23A 4D0BA 3ARDB 4NZUL 4KK8C 1K5NB 2G75B 1YY8A 2I07B 4ZXBD 1ORSA 5BZWB 2X1PA 4Y4FB 4NRZA 1K3IA 3C5ZC 1UQSA 3RWEA 1CXEA 1QNZL 2HYMA 4HGKC 4ZPVA 5EO9A 5BRZE 5HHQB 3KDMA 4N0RA 2P44B 2QV2A 2OTWB 3IETB 2I60L 4X8XA 4Q2ZA 1GZPA 4AH2A 3MOBH 5J6GB 5D1ZB 4DUWA 3PNWA 5DTFA 4PJ9C 3H6JA 5ISZA 4J4PD 1VACB 4Y5XB 1MJ7H 1UXWB 1A6UH 5I1AB 1HQRA 3BJLA 4ELMA 4V1DD 3S3SA 5J3HD 5EFIA 1EEUA 1NCWL 1YMMA 5HHXH 2ZPKH 2XZQL 4NM4L 2A6IA 3ZL4H 5IROA 5DDHA 2QBWA 4XBPA 3T0XA 1AKJD 1NUGA 2KBGA 1RULL 2NXZB 3BGAA 3U1SH 4YC2B 3MRKB 3QNYA 5SV4A 2X70A 3GNMH 3WE6A 4XCYA 5IB3A 3PHOB 1UADC 2XFXB 5CAYB 1T1XB 4TYUA 4NQUA 4F7CB 3HE6D 5DJ2B 2YN3A 3C87A 4N1HB 1FAKT 2BC4B 5DQDH 2DM3A 3W39B 2XN9A 4KJPC 4IJ3B 3NCBB 3BGMA 1N7MH 1QA9A 4QRQA 4PGCB 4EDXB 5I6XB 4XXCC 1BZ7A 4X5WA 2YD7A 5FO9B 4BK5A 1ZT7B 3RA7H 4KQ3L 1ZLUH 4PJFB 1YEIL 1LE5B 4GW1A 3GIVA 4PB9L 1M7IA 4OM0L 3NBNA 4JFOB 5EZOH 1HCFX 3SDAB 4J3WA 3QAZC 3EOBA 2FNBA 1A5FL 1DZBA 1V8HA 3ZT5A 2L4OA 1EBPA 4F80A 1OTUD 4LSQL 2XYCA 3JV6A 4KI5F 3BD5A 5IVXF 5D7LE 2YZ8A 5I2IB 3GMNB 1TCRB 3HS0A 4QOKD 5EBLB 3PWNA 3QO1B 3GFUA 2DYPA 5SWSA 1L0QA 4P57A 3AAZA 3OAUH 2BSTA 3CUPA 3V7MA 2APVA 2NY0D 4OM1H 3TCXA 1A7BA 5TQ0H 2FJHA 3MYJA 2YD1A 1A9BB 3NA9H 4NKOA 4Y2DD 3HPLB 3RIFK 4NQXB 3PABB 5EPMB 5H94B 5T3XH 2PXYD 5IW6B 1AGDB 2FJGB 3SDXF 4GKSB 2JJSC 4IRSD 1MH5A 2Q8BL 4LSRH 4P5TB 2BVTA 2ZCKL 43C9B 4X7EC 3IXAB 4NWUH 5EOCH 5CILL 2CK0L 2HWZL 3S35H 5DD3L 4PJBA 4P23D 4M1CD 1N6QL 5D1XB 3QO0A 3LEYL 3ESUF 3GBNL 3GBML 1NLDH 5ESVB 1XR9B 5C0CD 4U1IA 4O9HH 1IQWL 4PJAB 5DGQA 1DN0B 4PRBB 5F9JA 4AENB 3B9KA 2HJLA 5HDOA 1MIMH 5BV7C 4RQQB 5D2NA 1XIWC 2ZP0T 4DVRL 2G5BA 3TBSA 4LLMA 4YDKH 3PUCA 3WSQH 2ZOKB 4XBEL 2HJFB 5DRNA 2Z93B 4N0CD 3T3PE 4E42A 4LNRB 5FB8A 1B4JL 2D3VA 5MI0B 4FZ8L 2DF3A 1G1CA 1AQKH 1XZ0B 3DMMC 3CLFH 4YBLC 4WEBH 4PJHB 4YHML 1MJJA 5H8DA 1JZ8A 1MF2H 1U58B 3CK0L 2AJSH 2FX8H 1HOCA 1QO3B 4R0LA 3VRIA 4ZMAT 4WGWB 4WUKL 5EB9A 2YOCA 3DV4B 4FFYH 3QXVA 2FIKA 2VLJE 3QH3A 2RFXB 1AD0A 4ZUUA 1JUFA 2PTTA 4ELMF 1MFDH 3BXNA 4P2QD 2HRPH 4X4MA 5EOTA 5B21A 4NCC2 3MRBA 4LGRB 1U8OA 3PP3K 4OLVH 1IBGH 4OZGA 5FDWB 2B4CH 3O3DB 5F96H 1TZHB 1IGIH 1NGXA 1CD1A 3K80A 4JZOA 2NNAA 4NQCB 5FM5O 5CP7A 3SBWA 2VWEC 5FKPB 3H9SA 2YD2A 3TPUB 4XCNB 5DSCB 5L2KA 1KB5H 4K3JH 1RZJL 3LQAL 1YJDC 5C86A 4P4KB 3MLZL 3DVFA 3MGOB 1NEZG 2HLFC 4W6XB 4S2SB 3RY6C 5T1DL 4APQB 1ZAGA 3V5HA 1OAQL 3K2UH 3MRRB 1IC5L 3O6FA 2CJUL 3UMTA 3IJSA 4MD5B 4NKMA 3RUGE 2VR4A 3T3MF 5LGJB 3KLAA 1HYRC 1OD7A 4J8RA 2YRZA 5T1LD 2RHEA 2CKBL 1QYGL 2JJTA 1E4WL 3VXUB 5GS0D 1OP5K 1YECL 1ES0A 5SX4H 1ONQA 3QULA 3KYOB 1IT9H 2IAMB 4DVBA 3I6KA 3QIBC 4XXDA 3BP7A 4IOFC 5EBMB 4AM0A 1YQVH 1RSFA 3TO4A 1I8KA 5CEZH 2NY7L 3I84A 1YN6B 4EDWH 2IF7A 3DIFA 4GUPB 1F8TL 3VXNA 1KXQE 1U8PA 1SY6L 1BQHA 4OSUH 2Y9RT 5DJCA 4PJDE 3QCVH 1A1OA 4UMGA 2XOTA 4NJAL 3QEQA 2B0SH 2VDQL 4OGZA 3U0PB 2GTWA 3MLYL 1T4KA 2W9LA 3WJLA 3W9EB 5ITBH 3BPNC 3H0TB 1GC1L 2PR4H 4J3UA 4PJ5E 2XTLA 5HHVL 4N5ED 3AS0A 4XNUH 3CFKB 2LQRA 4OUUB 3N85L 1QOKA 4I2XB 2VZVA 5FO7B 4JO3L 4P5MA 1NAMH 3RDTD 5H2BB 2OCFD 1MCOH 1G9EA 5L88H 2BSSB 3ULSB 1FL5A 4JVWA 3HAEH 4ISVA 2SEBB 3OAZH 3JTSB 5DRWA 3ZKMC 5KS9A 3GSNL 1FLTX 4ALAL 1G6RH 1BAFL 1Y18A 4LSVL 4PJ8C 3VXSB 3WS3B 1S7XB 3PWLA 4QXUH 3WXWL 3NPZB 4GS7C 4RIRB 2VL5A 4OIIL 1KN2L 4NO2A 4WWKD 4U6HB 4PRPE 5HVFB 3DETC 2X4NA 2VISA 3Q5OA 3MBED 4PV9A 2X40A 3FHQA 3BFOA 5KTEH 3FN0L 3PWJB 5IMKA 4AG4H 4AEFA 1DBAH 3HMXA 2C4XA 1TVBA 4L8BB 1F4YH 2R1YA 4U3HA 4IRJA 3TFKD 2X05A 4DGIL 1QBML 4MWFA 1HKLH 4HV8B 5DURB 3S6CA 1ZGLB 2ICEA 1NCDH 1LE9A 5DMKA 4FFWC 2OR7A 3SKOA 4MB4A 3MXVH 2Z31A 2CDGA 1J05A 1KC5L 2YZ1A 2LABA 3GHBL 4LFHD 4MNQB 1ZEAH 4PGBA 1T80A 4TVSa 4LPXA 2W07A 3MV8B 4NN6B 2VRAA 4ACPA 5E4IA 4OZGF 5IB1A 2BNRE 5FGCB 3DYPA 4QCIB 1SYSB 1XGPB 3UTSE 4OV5B 4LVHC 2FX9L 2BMKA 3WN5A 3VFWA 5JOPD 2YBRA 3B3IB 1QLEH 2E7HA 4NQVB 1FYTD 5EDXA 1JL8A 2VABA 5E8PA 3GIZL 1FVEB 5I76B 1V05A 4XNXH 2AXGB 2CO7B 2AK4E 5BO1L 2LVEA 5HI5C 3ZE1F 4A2MA 2HKFH 4F15B 1S9KC 2J5LB 2N4IA 4H26A 4NOBA 3EYVA 2VLKB 1U3HD 1NEZB 4LU5L 4QXWA 5EO0B 3L3IA 3SE3A 3I3EA 4ZOCA 2FECI 2WUCL 1C5DB 5CBEA 2GSIB 4MCZB 3ZKND 4HMEA 4X6CA 3RVUD 3BZEB 2DQTL 2ADGA 1J1PH 4ZFGL 1UENA 4M7ZB 3ECBB 4R90L 4YGAB 3UTQA 1K3ZA 1KB9J 1KLGB 5L8KB 1OGAE 3KPQB 4W81A 4CVZB 4X4XA 3D18B 4Z77B 3DXAB 5DHVA 5GIRB 1WCBB 2DTMH 2OJEB 3TLRA 1MRDL 4GO6B 5C0NC 4Q9RH 1W72A 3RVXD 4GAJL 3NH7L 1GHFL 5GSVA 4OT1L 5FECB 2VXUL 2EKSA 2B5IB 2HN7A 5C0AB 5A2KH 4FQ2L 2BERA 4D0DB 4UOW1 1BFOB 2HTKD 3K1KC 2IQAA 5IEKA 5LQBL 2DMCA 4I0PD 1T3FA 3BN9C 1RIVH 4U1MA 5CGTA 1DE4A 5JHDE 3VFMA 4UT7L 4MYWB 2VQUA 2VXTH 5E8DL 4CJ0A 3AS1A 5DJXA 4DKDC 4YHPB 4AEIL 4UTAH 1HZHL 4KJQC 1N64H 2BVOA 1H3VA 2A74A 1INDH 3AC0A 3TBWB 2B2XH 2FWOA 5HVHB 1YNKL 5KS9F 1M7XA 4MGXA 5IMMA 5DHYB 4P2OB 2VLRD 4NKIH 1GOGA 5GS0L 1HSAB 2JCCB 3BYTA 4Q6YA 5BV7L 1EFXA 1UCBH 1BD2D 4HWZB 4OGYL 3MODH 5JDJA 1R3IH 1MQKL 4JPIB 3FO0L 5F8RC 4PRHD 2WMPA 3QP3A 4W6YB 1T22B 5EU3A 2R15A 3IGAA 5DYOA 4K3DL 4L5FH 4JY5L 3RWIB 3U0TB 4LPYA 5JPMB 4XI5D 4P0DA 1A6VL 2RIKA 4JR9L 1MFEL 3CDGA 4C56B 4XWGL 1KN4H 5DQ9A 4HS3A 3ZSSA 4L8CA 3D85D 5I1CH 2OK0H 4TPRH 3F12B 1ACZA 3GKWL 4G6MH 3QXAA 3OKMA 1EPFA 1MLCB 3BPOC 4GBXA 4WTZA 1E4KC 4GT7A 4HIHB 1KTDB 5F3HB 5J9PB 1G6VK 1FNSL 4OLUL 3GJEB 3QDGB 1GRWA 5A2IH 3MO1B 2Z9TA 1XT5A 4LSSH 3S36L 4X6FB 1A7QL 1HI6B 3CMGA 1XF4B 3QDMD 4TNWF 3E6FA 1D3CA 4OCWL 4XP5H 1GVIA 2ADIA 4JN2A 2W0PA 1RURH 3HZKB 4MCYA 4NQSB 4PJEB 4WHTA 4EVNA 2IBBA 2QHRH 2IG2H 3OXRB 2VJXA 4H8WC 4K9EL 5HGBB 3HLAB 5TF0A 2VUOA 3TT1H 1G9ML 2Y23A 1U92B 2IALB 1P7HL 3F6IA 5A16B 1UJ3B 1JPGA 1DQQA 3K3QA 5E2JA 5HDBE 5B39G 2VDML 5J06A 4KTDH 4ZODA 1JNNH 5J7CC 3UJJH 3V5DB 3FQRB 4NBYB 5KVGH 1EXUB 4M6AA 5MENB 1F4WL 2DL2A 3QAZB 2WWMD 4MJ5B 2GTZA 1ZSDB 3PE9A 4S1DD 4QHUB 2VDPH 2BJMH 4O2CA 3FQTB 2X4RB 1PKQB 1UB5A 5IHBA 4KJWD 5FUCE 4X6CF 4LLVB 1ITCA 3C5SB 1JPFA 2JTDA 5TFSH 4HF5H 4GLRH 2DKMA 3V6OC 4WNQA 4QRPA 4YDLC 4YWGH 3TNMB 2Y25A 4YO0B 3B9VA 3BDYH 4GRLC 3QUKA 2F74A 4NT6B 2OMBA 5F1IA 3VRLE 2GJ6D 3U9UB 3NFPA 2KPNA 3IJHA 1QD0A 5TE4H 1FDLL 5CD3B 2X5PA 4OZHE 3HUJE 1D9KD 4XC3H 1YN7A 1D6VL 2DM4A 4Z78A 1LD9B 4YHKL 5JA9A 1AR2A 3GSRA 3TM6A 4AIZA 4M7LT 1NBYA 2ZG3A 5C0EA 3CH1A 3O8XB 4UINH 5IR1A 4JM2B 1JTTA 2MKLC 1XGRA 3LMJH 4LCYB 5GSRB 4L4VE 3T1WA 4HAFA 3LN4B 3ARFA 3LY6A 5F7HA 1XIWB 1JFQH 4JZJC 5C0IB 3UTPE 4JRXB 4GRWE 4MJIA 2ARJA 4JO2H 1TJGH 1FVCA 7FABH 5IFAL 4ZOEA 5E4EB 4Z6AT 5KVEL 1LEIA 4R96A 2XTJC 4IHOB 2OR9H 4U0RC 5D7SH 1TVDA 1GAFL 2RB8A 4XP6L 3OWEA 4JM4L 1OAKL 2A1WH 3CGTA 2LVCA 4KHXH 4HFUH 3UAJD 2J8UE 1F58L 3PDDA 1E27B 5CP3H 5FUZL 3VXRA 4M8QB 1P5UA 1N59B 2VC2H 2IFGA 4Z7WE 3KPOB 2ZJSH 5EORH 3TIDA 1KUMA 2XT1B 2D2OA 5IV2B 3B2UC 2X4TB 2FH8A 3HNVL 1NCAH 3Q6GH 3FRUA 3I9GH 1I9RL 1X7QA 1CICA 1R3HA 5JO5A 4KK5C 5D7KD 3ARDD 2OSLB 2JE8A 2Q86B 3K0WA 5AAMA 5GGTH 2X4PA 4OCNC 4WO4A 5GISL 5SWZB 1FFNB 1OAYL 4S1QH 4Y4FD 3IAPA 1QRNB 1IGJB 2ZUQC 3QXDA 3ILQD 3WLBB 1Q9OA 1KCRH 3G5XA 5F72S 1XF5B 4UB0L 3LRSB 1QKZH 1U3ZA 4QWWC 2BFVL 1XCTA 2DWEA 2Y7QB 3RL2A 4DQOL 1NGZB 4ZAKC 4FABL 5L0QC 5D71L 1NEUA 3DGCR 4N1CA 5D1ZD 3SJVB 4IEFB 1GH7A 4OI9A 1G7QA 1R5VA 3G6DH 2ID5A 4D9LH 3M07A 2ESVB 1OM3H 1SEBA 1I9JH 3CPLB 4HULB 2XWJB 3X17A 1TIUA 3V0WL 3LKOB 5E6IA 2ITDA 4RFEB 3S34H 3VFPB 4LSUH 4FQXB 2H8PB 4LSTH 4Z0BH 1XGYL 1IVLA 4PREA 5HYFA 2R2BB 3RWJA 3IYLW 4WCYH 2CLVA 1FL6B 3ROOB 5BS0D 1CR9L 2Q3ZA 3G5VA 5B39B 1ED3B 3HMXH 5KG9B 3C6LB 1G7MB 3BWUC 3T0WA 2NXZD 4D8PA 4NSKA 1TVHA 5I8OL 2P8LA 1BWWA 5IKCB 3GMMA 5ICYA 1CFVL 3AB0B 3FB5B 3L5XH 3JSSA 1XFPA 3L95B 1T0NB 3MRFB 4BQ9A 1VESA 1JZ7A 3MZGB 1JIBA 1WFUA 3LSOB 3RX8A 3Q2CA 1A7NH 3TCLB 4PRNA 4G8FA 4XNQA 3WLWD 4TNVF 2APTA 5J13C 3KYNB 3H7LA 3LN9A 1VADB 5I66B 1IEHA 3MBXL 3BEWA 4QHMA 3RJDA 1AO7A 1WIUA 2AQ3A 1EUUA 5DR5L 4Z5RB 1MFAH 3MCG1 5FF6A 2I9TB 5CBAB 4LQFH 5JXAH 5MP6H 4BZ2H 2MMXA 1IQDB 3EDDA 3OG4B 1YC8A 2VERN 1ZTXL 1JMXA 3VI4E 2YC1A 3VD4A 1ZLVK 4LLDB 1NGPL 5DUPL 1CZ8L 3SDAD 4YHZL 4CVXB 2FD6H 5D7JD 3KPPA 3PP4L 4CMHB 4P2RD 1FHGA 2DQDL 1NC4B 1FLRL 3DBXB 4PJXA 2YD6A 5C0RL 5A43C 5IBLC 3VJ6B 3ARGA 4LCIL 3QUXB 3BKML 2ICWA 1JWUB 3UBXG 4HWBL 5KN5B 2IANB 2FIRT 3MRCA 1BEYH 4KHTL 3SDDA 3X11A 1U41A 1OB1A 3RAJH 1RUML 2D7TH 1X5KA 3QUZA 2X2YA 3HC0A 4XCEA 2Y1VA 5C0BB 5DJ6A 2GCYB 3MOQA 4P5TD 4YDIH 4MXVE 4Y1AA 1S5HB 4LVEA 1F3JA 2RJMA 1FZKA 1KCLA 1JRHH 1W72H 3OXSB 5JOFA 5CJQL 4P4RA 3HB3D 3KPSA 1QFUH 3C8KA 3DRTB 5D1XD 4EEEA 2OP4L 1KFAH 2AJZA 4RWYL 3QIUB 3K8MA 4I1NB 3SQBA 1MFCH 4U1KB 3U46A 4LCCA 5DA0B 1KJ2B 3MJ8B 3KPNB 2CRYA 4OBSA 1S7QA 1IGFH 2NW2B 1TXKA 3O6LL 1OT2A 2FJFB 1RFDL 4PB0L 5AZ2L 3HE7A 5FHAH 1EEZA 2YEZA 4IIQC 3MLTB 1AIFA 1S8DB 1NFDA 2ITCB 2X4SA 1EVUA 1GPOL 2C1PB 2BXZA 3FCTB 4R4BB 3Q3GB 3S4SG 4PLNC 3T1FA 3G6JE 4WFFD 4Q6IA 3BPCA 4HKXA 3QBTB 2VLMD 4JQVC 3UO1L 3ZE2E 1TLKA 5HPMB 3KPRD 3O4OB 5I1GH 5HGAA 3DVGB 5GZND 4ZFOB 4IM8A 4TOYL 5HY9A 5EO1B 4F9LC 3NZHL 2A6KA 1U8NB 4NKDA 5DMIH 4ORGA 1HHIA 5CIPA 2F5AH 5F7NC 1T04A 1M05B 3ULUH 3LKNB 4HUMB 4F7TB 5IVZA 4CN6A 3C2AH 4HJ0C 5I8EA 4F7EA 3T0EA 1ITBB 1DBJL 5DJAB 4BJLA 3OBAA 5KW9L 3KPMA 5IGXL 1K2DB 1U9KA 2YPKB 4NQCD 4LEXH 5JW4M 4BSJA 2DLEA 4O2FA 2D0HA 4JPVL 4UOJA 5CGYD 4XWOC 3KS0H 4KGJA 4J1UB 4P4KD 4HIXL 3L7FA 4OZ4A 3ZE0F 4XPHH 4PRIB 35C8L 4ODHL 4APQD 4JKLA 2CXGA 2JIXD 1PEWA 5BQ7B 1OP5H 5HHNB 3TYGL 5IG7A 1NGWB 2GEEA 3IAQA 5E08L 4EXKA 1S7WB 2FEDD 4KVCL 3SQOL 4QRRB 4Y16B 4WTXA 4RAVA 3SDCB 1KCVL 4M5YL 4M5ZL 2B4CC 2E6JA 3VXUD 3SGKA 4HH8A 3CX2A 2AP2A 2CLZA 2V2WB 2IAMD 2NX5A 4H0GA 4WVRA 4LLWB 3FZUD 5D1QA 1MI5B 5C09E 4S1RH 1GGTA 3WIHL 3RNQB 3MLWH 5FGSA 4YH6A 1JNLH 5IESL 3WXVH 4S11A 4QTIH 5GRYA 2A2QT 3KR3L 4MJ6A 3RX5A 1UGNA 3MJ9A 5C08A 3OKKA 5D2LE 3CFEA 3KJ4B 4PFEA 3VH8G 1D5IH 1AGBA 1Q9LA 5TDNA 3CX5K 3BPLB 3JWOH 2D7PA 5CSZB 1A6TA 4YFLF 1MEXL 2GAZB 4GJTB 1FIGL 4OZFG 3HZYA 1TZIB 4NYLB 3G08A 4F3FA 3B9DA 3LEXB 2NY5L 3PWPB 2MQ3A 5E2UL 4ZSOE 4RBPK 4N8CL 3CLEL 5HD8C 1T66D 4WU5B 5EC2A 3W11C 2QQKL 1C5CL 4HCRH 1C5BL 1VPOH 1TQCB 2CXKA 5SV3A 5KJRH 2MPAL 1JPST 1P4IH 2V6HA 3OB8A 5AUMA 4U6VH 4G9FA 4OLYL 1TQBB 4R2GC 5T5FH 3UBXI 1N0XH 1RK0B 4LF3B 4KUZH 2Q7YB 4PJIA 4QLRA 3VXSD 3HN3A 1T6VN 1J12A 3S9DB 4JE4B 2GJZA 5DZOA 3RWFB 4QOKE 2V9QA 3OR7A 1E4XH 2VO5A 5LAXA 5EIIB 1HINL 4U3CA 5CCKL 3O11B 2QTEA 4HEPG 5DFTA 4YHLH 2WNGA 5AZEH 4PJDF 3RHWF 2V7NA 4WU7A 4TQEL 1VFBA 1UYWH 1X5LA 3RWHB 3E2HB 5IWLA 2Q87A 5FEBA 2WBJC 3BH8A 3L5JA 5FOBB 3L7EB 5MEQB 1RD6A 3S4SB 1E6OH 2XZAL 4R4FH 1O7VA 5DURD 3NCYS 5F9WC 1QACA 2HVKA 5FAAA 2WUBL 4I77L 1A6ZB 5IB2B 2OBGA 1I8IB 1T1YB 4MQTB 4MNQD 4GRMA 1D5MB 2AEIT 2DQCH 2HLAB 4I4WB 3MV8D 1K4DA 4KTEL 5E5RB 3BE1H 2X10A 4LCUA 4KI5C 4TSBL 4Z8FH 1M71A 1FGNL 1ZA6B 1UM5H 4QXTB 4XHQA 1KPVA 5KSBE 2CLRB 3ZKXC 5CJ5A 4RAUA 1ZHLA 1N26A 3T4YA 4XH2A 4FQ1L 2FZ3B 1GGBL 4MLIA 3QUYC 5HHOE 4TSCL 3LPFA 5C6TH 4BQ6A 3BP5A 2Z92B 3RWDB 2A9ML 7CGTA 1S3KH 3GI9H 4PD4K 2UY7A 5E1AB 1MREL 1KIQB 1RUAH 1OL0A 5ALBH 3D69B 3G6AA 2IADA 3EFFB 2FHBA 2OLDA 4KUCF 2VLKD 1KGCD 1AGEB 4H5SA 4P46B 1HXYB 8FABB 4K7FA 3DO7B 1G7PA 2FLBT 5MHSD 3BMWA 1P5VA 1ZWIA 1R3KA 3IF1B 1JF6A 3IFOA 5C9KA 3MGTA 5GRJH 4M9OA 4NO0B 1OVZA 2VXVH 2XKNB 1Q0YH 3FQXA 3EOTH 3DXAD 1NMBL 1YEKH 5BRZB 3I6GB 3THMH 3STBA 3MA7B 4NDMB 3D39E 5ETUA 4OFYD 3CDCA 3GZKA 1QSEA 1KPRB 5F7YC 5FKAB 5ICXA 4YNYA 3H9HB 4FNLL 3NN8A 5DZLA 3HR5B 4IRZL 3L3DB 5EWIL 4CJ1A 3IDGB 3SE9H 3GI8L 3S5LB 5C0AD 2IEPA 2UWEE 1EJOL 3W81A 1MWAB 3P77B 5D96C 4Y0GA 5C07D 2P45B 1WEJH 5FYJD 3VH8B 2BOCB 4HFWA 4KV5E 1UWGH 1MAJA 2K7PA 4LBEB 3KNBA 4JREB 2O61A 3P73B 5IFHL 4OCXH 4FXGA 1M7DB 2FGWL 1MCBA 4B7LA 4ZAKB 5IROC 1SJEB 4P2OD 2WIIB 4PJIF 5L0QB 2DTSA 2K3TA 3LH2H 2XV6B 1Q94A 1Q1JL 3LEVH 3OB0H 5L2JA 5I8CB 1I3GH 1F45A 5FUOL 4AT6A 2XKSA 1SJXA 4IOIB 1YA5A 2E27L 4TUJB 5DS8B 1FAIL 3RL1A 4M61B 2O5XH 3UTTA 1Q72L 3T4AA 2GHWB 1MCJA 1F90L 5FM8A 2AS5M 3D25A 1G7IA 3NTCL 4B50A 3L9RA 4YDVA 3NCCB 4C56D 3EHBD 1HH9A 4JHZA 3VXPB 1U93B 3MACH 1IGYA 1RU9L 3MJ7B 4M3JA 2P4AB 3PGDB 4Q7DA 4YPGA 5DUBB 1YDPA 3RWGA 1FC2D 4ZFZA 1IGML 1DLFL 5D7LB 2E8YA 3P0YH 2EH7L 2R23A 3TJEL 4L3EA 3A67L 3IRZA 5FM5M 3MXWH 4CN4A 2FH6A 1VKXA 1ZXQA 3EGSA 2L7UA 3C2SA 5J13B 5C0GB 3FOLA 1NGYB 3D2UB 5JUEH 2ZSWA 4LL9A 4JFEA 3FFCE 4X9HA 4P3DB 5CEYB 3WV0A 5GGVH 4XMPH 1GOHA 1XF2B 5KSAB 1RHFA 2ADJB 4H25A 4JRWA 5EIVA 5CJOH 2CD0A 5I1DA 2GKIA 2GSGB 2XA3A 1BLNB 5IJVA 4PBVC 3PWVB 1MFBH 4KZDL 3CSPA 1J18A 5EZLB 2EC9U 2QKIA 4NCC1 4ORZC 4PLKD 3GUTA 1EV2E 3BRFA 2QQNH 3QXUA 2R1XB 5KVFH 4Q74A 1C12A 2VNCA 4KPHL 3V52H 3GBLA 1RZGB 4KC3B 5ID1B 3VDBA 5I15L 3BKCL 5DRXB 1BFVH 3GMPB 2HA1A 2NY3C 1HHHB 5CUSL 3BZFA 5CIPH 1XH3B 3HPJA 3UP1A 4BSVA 4DK6A 4AL8L 3MRGA 2A6DB 3IKCA 4NPYA 3B9KC 3VGBA 2JK5A 2DD8L 2RCSL 5D2NC 1NFKA 1P7QB 3MRIA 5K9QG 4HS6B 1VFAB 2VDKH 3P4OB 5HSFA 3QQ3A 1QPPA 3K2MC 5D8JL 2VAAA 3A6BL 3OPZH 3R06A 4ZNCD 3P9MB 1GGUA 3QWRD 4NRYA 5I16B 5JMRA 5FYKL 2F9BT 3IU4L 4HBCL 2FR4A 3RKDC 5E7FA 4NZTH 1KELH 2VLJB 4R0LC 1EHXA 3VWJA 4UTBH 4OF8A 1CGYA 3O8XD 5HDBF 2X4UB 4Y4KA 4JM2D 2RBLA 3SPVA 4TRPL 3TN0B 2DQGH 1DBKL 1BQSA 5J11C 1CU4L 1Q9WB 1L0XA 1NFIA 4DN3L 3PL6A 4PG9B 2WAHA 3TEUA 2F53B 3HG1A 4YBQD 3HAEG 3RVVC 3DTXB 4LDEB 5J89A 4ODVH 1NFDE 3HZVB 5IHUH 3KHQA 4M6OL 1A4KB 4OLZL 3SKUD 2J4WH 3SBWC 3ROLB 3QJHB 2C26A 3U79A 3DUSB 2IGFH 4LRNL 2G2RB 1SVZA 4ZUWA 3V6BR 1JTOA 4K07A 2G9HA 3MNVB 3QIWB 4LVNC 4I8DA 1DLHA 3JVGA 3DV6A 2BP3A 3JBG7 2A0LD 4O5LL 1BZ9A 1IM9A 1JWMA 1I1AD 3P9LA 3RUGB 5CFHA 4I48B 3MREB 3RGVB 5EZIL 3ZT7A 2F5BH 4ZPTA 3ZTNH 3MJ9H 3CVIL 3SEPA 4JAMA 3O6FC 3MUGB 4MA8L 4BELD 1JYXA 3HUJF 1IL1A 4XMLH 1B0GA 5C0FA 3VFOB 4DGVH 5D5ME 4XC1H 3MCKA 2JJTC 4DCQA 1FZMB 1T5XB 1KV3A 5F1SA 5SWZD 4XAWL 4WW2A 5FYJL 3C09B 1OAZL 3SKMB 1LP9A 4LEOB 1BZQK 5BXFB 3TO4C 1UJTA 4KVNL 4ZNEA 4XBGB 3QQ4A 3AY4A 1KJVA 2WLYA 3QHFH 1WITA 4G6JH 3C9NA 1EK3A 4UUJB 3QXTA 3KG5A 1Z5LB 5DRZA 3SJVD 2MHAB 1OTTD 4PJ5B 3UYPA 4BQCA 2ESVD 4HT1H 3WJLC 2Q8AL 3VGAB 4N0UA 3HI5L 1OAXL 1BQLH 1YQ2A 4H1LB 1T20B 3EYOB 4UQ2A 2BVEA 3V6FA 1L7IL 2HH0H 4FQXD 3DX8A 4UT6H 1DDHA 5IB5B 4KKAC 4TTDC 1KB5B 4YXKH 4ZS7H 4OFKA 3T0VA 4LSPL 1H3XA 4QRUB 3C6LD 1Q0XH 3FB8A 3TJHD 4Z95H 1JHLH 3L3KB 4JG1L 4L4JA 1F6FB 1MCCA 3O4LA 2W9EL 5GRWA 4NM8H 2YPLA 3P4NA 2YD5A 3BT2H 2R69L 5D6CB 1IGTB 4IMLB 3RNKA 3VD5A 1OCWL 3EOAA 2GK0B 1NDMB 4FFVC 3VG0H 3MLRL 1BJ8A 2PW2A 1KCSH 4J3XA 3QG7L 1I1FA 1U8HB 4MA3B 4UOW0 3KS0J 4Q0XL 1G7JA 2DWDB 3QEGH 2QSCL 1WBZA 1H3GA 5JLZA 5I18L 1NC2A 5A2LH 1IE5A 2QSQA 2EIZA 4OCRH 3VXQA 4IRJC 3CMOH 2YSSB 4MA1C 2YRLA 5IF0B 5EU4A 4D9QD 5K9QI 1R0AH 2WSKA 3K8LA 3ULVH 1NC4D 1OWWA 1PY9A 3WL9A 1BVLB 1DUZA 3UTSB 4ZXBA 1CG9A 3N06B 5AD0A 1N5AB 3QUXD 5DEFB 3STZB 4M02A 1F11A 4YK4C 1YNTB 5FYKU 2IAND 2OTUA 1NAMB 4KXZH 4PR5A 3WN5C 3NGBB 4HWNA 3QRGL 2AK4B 2Z8VC 3RTQB 2F54A 3HAEB 4NGHL 5HYSA 1NMAH 4PJCA 5DA4A 3GMRA 4BH7A 5D9SA 1I7ZB 5C0BD 5L6YH 2CKBA 5HHME 4GG6A 2YS4A 3X12B 2R8SL 1R3LA 2ZCHH 3ZHLA 4J4PA 1DQMH 5IMLA 3JWDL 2N1KA 3KXFE 4LCWE 5BW7A 2QR0B 4GG8B 3QIUD 4AMKH 4HX1A 4RX4D 4V1DA 4XAKE 1T83A 3N9GL 4NZRH 3SE3C 4OCYH 1S7UB 2HT4C 3QCTL 3S97C 1OGAB 4HPYH 2P5EE 1X5AA 1QR4A 3R1GH 1FCCA 1DQLL 3BP6B 3QUYB 4XNZB 4WW2F 3TNNA 1OSPL 3IXTB 4H88L 3WBDA 1IEAB 1LQSR 1AKJA 2DOCA 4M1DH 1JNJA 1P84K 3LN5A 2MCG1 3F58H 1W0VA 2R1WA 5D7IA 4CNIB 3O41A 4JFYB 1GIGL 3BIAX 4I0CC 1OQXA 5F7KC 1EIBA 2VDLH 2HFGH 3HE6A 2YXFA 4LSDA 1FPTL 1X5GA 1P4LA 1WT5A 2I9LB 1XGTB 2DN7A 4OD2B 3TO2B 1OF2B 4TUOA 5JHDB 3BH9A 5DJ8B 5HYJE 5IW1B 4N0FA 5DD1L 1SEQH 4WUUE 1QLFB 1EHLH 3GSNA 5GZOC 4OQTH 3OKDA 4LPTA 4WW1A 3MPCA 3BUYB 5CZKA 3RVTD 3VXTB 4HS8L 5KSUA 4X4YA 3CFBA 1HYSC 4OLXL 3STLA 2X6MA 1IAOB 4QNPF 1UQSB 3RWEB 1RHHA 4ZFFA 4XT1C 1A6AA 4YFEA 4XNMA 3P4LA 5JQ6H 2W1NA 1EAPB 1YEGL 3BWAB 4X80H 1KEGL 1LGVA 2PYEE 4UQ3B 3OSKA 1A47A 2BHYA 2YD8A 4UV7L 1JE6A 1BBDH 1FE8L 2R0LH 4MXWH 4L1DA 3MLSL 5JPNA 1X9QA 4PRID 5JIKA 4G42A 5D96B 3PNWB 4O58H 2WIMA 1J1XL 4KGLA 1RMFH 3QG6B 4NC0B 4DJMA 3U30B 1WWWX 3G6JF 2H2PD 1RZKH 3ULUC 5J0BA 4WY7L 3EDFA 4DZ8A 3B9EA 4QRRD 4Y16D 4E41E 5EFIB 2PXYA 4KKNA 4AIXA 4Z76B 3SDCD 4LK4A 1ACYL 4E5XA 2R29H 4IRSA 1YMMB 3TVMB 1CFQA 2AV1A 4P9MH 3MROA 1INEH 2XQBL 3D9AL 2A6IB 3AU1B 4P23A 3IFPB 4OLEA 3BHBA 5I1KL 4Q97A 1JGUL 2H3NA 1MFNA 5E8OA 1JPSL 3CSYA 3TBVB 1MI5D 1KNOA 4BKLA 4GBXC 4I5BA 1VCAA 5FYLL 4NZUH 5C0CA 5GS1A 4G80A 3MNZA 4NC1C 3WE6B 2DQUL 4XCYB 3X13B 1MHEA 5A40E 1DBBH 1QNZH 4K71B 5DMJB 3FT3A 1H3PL 5F1NA 3RU8L 1M6OB 3B9AA 1AXSB 1N8ZA 1ZVHA 3PWPD 2I60H 3P11L 4KROC 3KLHD 1LMKA 2GFBB 3BQUB 3ZYJA 4JZNA 3MV9E 1ZHKB 4UIMA 4PJCF 4X98B 1WFNA 3ARQA 1MQ8A 3ISWA 3VFGL 4M43L 3VCLA 1GGYA 3ZYZA 2OX5A 4FG6D 4JDVB 1KULA 5BVJA 2D03L 4Y88A 4MAYB 4KKCD 4OGXL 3MNWB 4R7NA 5K9OA 3UC0L 4OZIA 1LO3L 4P2QA 2R2HA 3JV6B 2DKUA 3BVNA 1L4IA 2NXYC 3FT4A 4XPTL 2NW3B 4PRDA 5A3ID 5BMFL 2XZQH 4NM4H 2FDBP 4XRCA 2DIJA 1PJ9A 3ARRA 5IHZA 3KAAA 5K9KB 3U2SA 3QFJE 1RULH 1MY7A 2AJUL 3DURB 4O00A 4NKOB 2DQEL 1I1CA 3OKNA 4YHYC 3FT2A 1I7UB 4OZHB 5D7IF 1BIIA 4WFHD 1MH5B 4Z7VE 3T08A 3GSQB 5L9DL 4P3CL 4PJBB 3M1BB 5E6ZA 1O5DT 1UB6A 1RUPL 4N0YH 4FQPA 5E8EB 3B5HA 3P2TA 5DD0L 5T1LA 5I0DA 1HIML 1EJ6A 4KQ3H 4L4VB 1MCFA 3S96A 1YEIH 3ARBB 1VGEL 2FYYB 2XRAL 4UZGA 1H8OA 3EJZD 4PB9H 4Z0XB 4JDTL 3D87B 4GRWB 3MRNB 4OM0H 3B9KB 4U05A 4LGSB 3WIFA 5D2NB 3ARFC 3KVQA 2G5BB 5JW5B 3TBSB 3P0VL 4WDIA 1J8HE 5E2WL 2Z91A 4LSQH 5GJTL 1S5IL 2P8MB 1FNEB 1HNGA 3HNSL 5JW3L 2J8UB 3Q5YA 4UV4L 4J12A 2H26B 3VMNA 3O9WB 1YYLL 3LIZH 3MQIA 4Y4HC 2VDRL 3V5KA 5B3JE 1A3QA 1AXTH 4Z7WB 3TV3L 1I8MB 3HC3L 4NJ9L 2FIKB 1JMZA 4PUBL 3BKJL 2DQHL 4P46D 1JUFB 1FORL 5I1IL 5CJXA 2Q8BH 2P5WE 5DJDA 2YMXL 1HHJA 5MEPA 2ZCKH 5J11B 4F8QA 5CILH 2CK0H 1AHWA 5DD3H 4JJ5A 1JF1B 1T1ZA 1N6QH 3RDTA 3B83A 1NGXB 3LEYH 4GLRI 5CEXB 1AGFB 1CICC 3K4DA 1BBJA 5EN2B 1AQDA 3GBNH 3GBMH 3VFTA 4NO0D 2YUZA 1BVKA 2DQFA 2Z4QA 4WO4C 4HUVB 5L7XL 3LKQB 3PV6B 4M4PA 5BRZD 1IQWH 3DYOA 3UPRA 1FL3B 1ZV5A 4TULL 1CFSB 4D3CL 2QSTA 1ZT4A 2A6JA 4DVRH 5E2TH 3OR6A 2IBZX 4UIKL 2QSVA 5ICZB 4XBEH 3IFLL 3KYKL 1JBJA 1QBAA 1VSCA 2AV7A 3MLUH 2AEWA 4WWKA 4NKMB 1B4JH 1OTSD 3B2UD 4FZ8H 3HI6L 3KLAB 3MBEA 4PGEA 2X4QB 4OFVA 2W0FB 3GDBA 4YHMH 3OAYK 2ZNWA 3CK0H 4R3SB 3MLXL 3CC5A 1U8JB 4WUKH 3LPGA 3QIBA 5E6IC 2A38A 2EDTA 3HMWL 4L8DB 1F3DH 3BP7B 3BMVA 3QEHA 4OD3L 5DMGC 3EYFB 3WYRA 4MD0A 4XMKH 1HILA 4PP2A 5A2FA 3PXJA 1RY7B 4RNRA 4U1NA 4GKZA 2VH5L 4OZIF 4HJGB 5B38B 3GHEL 3O45A 1QR1A 1KPUA 3MYZA 1FFOA 2AGJL 1NMCC 1A1OB 4YIQA 1BF2A 3B6SA 4K2UL 5D93C 4L29B 5ANME 5EUOA 1IAIH 3BUTA 1A3RL 4EUPA 1P4BL 4FN0A 4C4KO 1F97A 1G7HB 2GTWB 3LV3A 2MCPL 4JN1L 3LQAH 4XCCL 3MLZH 3L3GB 1S9WA 1FYTA 1U8QB 2BRRL 1QFHA 5FCUL 1EHAA 4WI2A 5T1DH 3DX9B 1HSBA 1OAQH 1JZ5A 2AVGA 1IC5H 3IB4A 4P5MB 2CJUH 5GGUA 1MCPL 3DX7B 1IEBA 4POZC 4WHYH 1CLZL 3ZKSD 1U3HA 4ISVB 5DRWB 2CKBH 1QYGH 4KKBC 1E4WH 3CH8A 4NQDE 3JV0A 4KK6D 3WS6A 1R3JA 1A7OH 4G5ZL 1YECH 5IHLB 3CXDL 1CDIA 5D7LD 1Y0LA 1JYWA 4JDZA 2V2TB 2WBWB 4R4NC 4K8RC 1YNLL 4U6YA 2F58H 2A73B 1OLLA 4KMTL 1MJUL 1YMHB 2XA8L 1F8TH 2X4NB 1WC7B 4YUEL 3D2UD 3ARGC 3REVA 1GGCL 3JTTA 1SY6H 4LKCA 4YQXL 3MCLL 1B0WA 3O6ML 4NJAH 4WTZG 2Q6WA 5KSAD 3FFDA 3SDDC 2P49B 4PGJA 1IAKA 2FATL 2VDQH 5CMAA 1BP3B 3O3BA 1UA6H 3QUZC 3LAFA 4XTRD 3VI3E 1GC1H 3E3QE 2K1MA 4OB5L 3N85H 4I0PA 3S37H 4JO3H 2Z31B 1J5OL 2CQVA 1KOAA 2B1AL 5DK0B 1BX2B 3IDIB 5IB1B 4LCCC 4UAOC 3AMLA 1FRGL 4YGVB 4PJ7A 4PV8A 1CI5A 5KOVC 1AFVH 4M1GL 3PJSA 2BMKB 3ARUA 3VGHA 4U7SA 4ALAH 3WHXB 1BAFH 4LSVH 5ID0A 3PWUA 5TH2A 3HE7C 1P7QD 1F5WA 3PDOA 2VLRA 5C8JA 1FFPA 5FA4A 3WXWH 3V7AG 2W65A 2IBZY 5GRVL 5DI8B 1EGJL 4LDOB 2EXWC 3IDMB 1BD2A 4Q6IC 4OIIH 1KN2H 4QRSA 4EI5B 5F21B 4GG6E 4O4YL 2XZZA 5K9JL 4FQJL 2R9HC 1SBSL 4M48H 1IZJA 4PRHA 2F19L 4BM7A 2VLJD 2OJZL 3O2WL 2Y5TA 4MQXD 4ZOBA 2VZTA 2V5TA 4R9HA 3TN0D 3EO9L 5HVWA 3P0GB 1KCUH 3D85A 5SWQA 1N3NB 3VFNA 5JMOC 4P49A 3T0EC 5ADPH 4LLUA 4X4XB 4GW5B 4YZFE 4FQHA 1KC5H 3GHBH 1W72B 4C83B 4P5KA 1EHNA 2BHUA 3QIWD 3QDMA 4NBXB 2FX9H 4N1EA 4JFPA 5EUOF 2HN7B 5KAQF 1WLHA 3WEXA 1JRHI 4MNGE 1YEDA 1WIOA 5HTSA 1WZ1L 4Z9KB 4HGWA 3RGVD 2AXHA 4G8GE 3GIZH 1PQZB 1RUKL 3IJYB 1OAUL 1F4XL 4Y19E 3VFMB 3OKEA 3EUUA 4X5XB 5CD5D 4FFZL 3SOBH 3AXLA 5JDSB 5C0JA 1MHCA 1WVZA 4QTHA 1VENA 4LLYA 4LU5H 3IU3A 3SGKC 3GSUB 5C09B 4RRPG 5E9DE 2Z0BA 2FWOB 2BY0A 2WUCH 2ZG1A 1JGVL 2DQTH 3AM8A 1A14L 5D1QC 4LHJB 4ZFGH 4HWBA 3OG6B 1P1ZA 2HP4A 5IFJA 3VGGA 3Q6FA 4HKJB 4R90H 1U8KA 2X4OA 5D2LB 4QHNB 1AP2A 1J0HA 2DI9A 2OQJB 3BZ4A 2UV3A 2Z8WC 1FO0B 5AAWA 4L8SA 1Z0NA 4JFQA 3UXFA 3CCHA 3O3EB 4PJ5D 4ZSOB 4ENED 4GAJH 4Z7UA 3P4MB 1GHFH 5B3NA 2GJ6A 2G60L 5J1AA 4OT1H 2VXUH 4NO5B 4Z7QE 4XVJL 5CZXD 1JV5B 1D9KA 4L8CB 4FQ2H 1CLOL 1OARL 4KAQH 3ES6A 5LQBH 4UT9L 5F3BA 2NZ9C 4GBXB 1MLBB 3VFRA 1CDBA 4UT7H 3ZYIA 4H20L 1KIPB 4YPJA 2XZCL 1P2CB 5E8DH 3MOAL 4ZD3L 1L9MA 5MERB 1CE1L 1WJ3A 1I7TA 1ZHBA 4AEIH 3QDGE 2P8PB 2IQ9H 4JY4B 1S7RA 1H0DA 4F33B 3QPQD 5CWSB 4PJ7F 4JN2B 1YNKH 3LKSA 4PRPD 1CDYA 4X6DE 1TPXB 5GS0H 5BV7H 4KRPC 5B8CA 3KYAA 3RI5K 3GSVA 2DM7A 4OGYH 2EYSA 1NCBL 1MQKH 1TNMA 5IQ9A 4BYHA 4ZYKA 2OI9C 3FO0H 4EOWL 3VGDA 3QEUA 1CIUA 3BW9A 3QNZA 5IUSA 4K3DH 3FTGA 3OHXA 3FO1B 4JY5H 4DOHE 5IWLC 1IKFL 3P40A 3MRDB 1K4CB 5MENE 4JVUA 4FRWA 3NIGE 1LEGB 4JB9H 4DW2L 4JR9H 4XWGH 2CDFB 1KIRB 2OTPA 5T1KB 5TPWL 1Z3GL 4HIEA 3OQ3B 4RGNC 3GKWH 5DUML 1JPFB 3GSWA 3KPTA 3RZCB 4RZCB 1EEQA 1OSZB 3ARDA 4PJGE 3T77A 3ZZ1A 1K5NA 2G75A 3NCYP 3RPIB 3GNML 3UTSD 4L9LB 5KSBB 1FNSH 4XCFH 4OLUH 1SJVA 4GRLA 5BZWA 1B88A 4KK9C 4Y4FA 1IARB 4YHYB 1I3VA 2QADC 5HHOB 4F2MB 3S36H 1JZ4A 3CX5J 1A7QH 4W4NA 3CFJB 1JN6B 2NTSP 3NFPB 1G1YA 3IJHB 5HHQA 4OCWH 5I71B 2AK4D 5F6IC 2WWKT 3RTQD 3W82A 2OTWA 3IETA 5GGRB 4K9EH 2MQ0A 5J6GA 5D1ZA 1G9MH 1UVQB 2HFEB 1JGLH 2VN7A 4RFNC 4Y5XA 2VDMH 4P2YA 1UXWA 5C2BL 5I1AA 3ULVC 3DVIA 4MVBD 5EZOL 3WIHA 1RPQA 4NQEE 1F4WH 4JZJA 1OD9A 4WI6A 2ATPB 4HPOL 1DEEB 5T1MB 1OGAD 3N1PC 1E4XI 1ZMYA 5BS0A 1KENL 2VYRE 4JRXE 4WI4A 2DLGA 3OF6A 1LEIB 4K8RL 3D39B 1CD8A 4XZUB 2AJXL 3SKNB 3MRKA 5D4QA 1T6WA 4L1HA 3PHOA 2XFXA 1L6ZA 1T1XA 4HUUA 4F7CA 4FTVE 2UWEB 5DJ2A 3L3HB 4L4TE 1U3YA 3ARZA 5T3ZE 1QHOA 1FDLH 4Z7UF 4EUPH 5JHDD 1XCQB 5MEOB 3TIEB 1D6VH 2IPUG 4HQQL 4JO1L 1SBBA 4TVPH 4YHKH 4PGCA 4A2LA 2RAMA 5FO9A 1ZT7A 5F97E 4PJFA 2EXYC 2GUOB 5H35B 1C16A 1IC1A 1LE5A 2X4PB 2VDOH 4U49A 1CDGA 2VWEE 3NIFE 3CDYA 5GS2H 4JFOA 4KKLD 1QRNE 2FHCA 5D7JA 2OR8A 3WSQL 1XCTB 3I75B 4P2RA 5CKAA 4XPGL 2AJVL 2V5MA 5LGHL 2AKRB 2H32H 2X9XA 1JYNA 5ENWB 5JZ7C 3F7VB 4MA7L 4TSAH 5EBLA 5IFAH 3QO1A 5J1SC 1MVFA 5KVEH 3LS5H 1MF2L 4P9HL 1GAFH 4C54A 4XP6H 1KJ3L 2DLFL 4PD4J 5F1KC 1OAKH 5JNYB 1A9BA 3U36B 1F58H 3HPLA 4NQXA 3PABA 5EPMA 5H94A 5IW6A 1AGDA 2FJGA 4GKSA 4P5TA 4R7DB 1YMMD 2LU7A 43C9A 3TVMD 3RWJB 3IXAA 4LHUD 3NFSL 4FOMA 4Q58C 3QPXL 3G5VB 5IBUB 3NFNB 3GJFK 5D1XA 5I1JL 1IGIL 2F15A 2JJUA 2NY1B 1T2XA 2KUTA 1I9RH 4PLOB 3QUML 5ESVA 5F88B 3GMMB 2Q1EA 1XR9A 2CRZA 1D5BB 5ACMA 3QNXB 1TZGL 1ZVYA 5DJYA 5GISH 1Y6NR 4PJAA 5KVDH 2KKQA 1FH5H 4PRBA 3ME0A 4AENA 3OAZK 1MCKA 1RZKC 1BFTA 3FFCB 3DHMA 2KDGA 3BIBX 4KH2A 4UB0H 4TVPE 2BFVH 4DUXA 2Z93A 4DQOH 4Y7MA 4FABH 3C6SB 4LNRA 2WWKO 4XP1L 4R26L 3BQUD 1XZ0A 2Q7NA 5FF6B 3KPRA 3PDGA 4PJHA 1PGRB 1BHGA 1U58A 1FQ9C 3WFZA 1YUHB 4FP8H 3PF2A 5I75B 4F7MB 4U1LB 3DV4A 3EYQD 2HT3C 3B8YA 3T04D 3U7WL 1KJMB 3LKPB 4MAYD 4HAGA 4J3SA 4WGVB 2R0ZL 1J88A 3ELAT 1PLGL 5IQ7L 3KJ6L 3ZSTA 2QQQA 1XGYH 2DBLL 4RMQA 4PJXB 1J0YA 1U95B 1CR9H 5D72L 4EN3B 5FDWA 3O3DA 1TZHA 4ZO6A 2ICWB 5JXEA 4NQCA 4HZLB 1AC6A 4ETYA 5I8OH 5FKPA 4YAQB 1CFVH 3LZFL 2HAZA 3TPUA 4XCNA 4DWHA 5DSCA 4J6RL 2OL3B 3BD3A 2ICWI 1FG2B 1IFHL 4P4KA 1LNUA 3MGOA 4XCEB 4HUKB 4S2SA 4XNUL 4Z7NF 3OGCA 2A77L 4APQA 2OMNA 3LS4L 3MRRA 2JIXA 3MBXH 3TT3L 4MD5A 1V7ML 5GHWL 5LGJA 4ESKA 4M7KL 4LCCB 4L4VD 3VWJC 3ARBD 4O51B 1FVDB 4Y4KC 1JYVA 1QSFE 3VXUA 1CFNB 4PJFF 1ZTXH 3KYMB 3UTPD 3VXME 4ODSL 3KYOA 3IDNA 3MRHB 3ZDYE 3WUWA 3LOWA 5HGHB 1NGPH 3HE7B 3MJ6A 5DUPH 5EBMA 5ESQB 1CZ8H 1W2KT 3WKNA 4YHZH 4BA8A 1AIFB 3WDHA 1BVZA 1NFDB 3PP4H 3PL6C 3D0VB 4XHJD 1RK1A 1YN6A 1Z9SA 3MLVL 1FLRH 1CXKA 4GUPA 2K9UA 5C0RH 2DLIA 4PTUA 4LCIH 1OPGL 2FO4B 3BKMH 1H5BB 3O9WD 4CDHA 5KTEL 2ORBL 4HWBH 3JVGC 4AG4L 1DBAL 3BD4A 3U0PA 4KHTH 3MMEB 1KYOJ 1DR9A 3VG9B 2C3GA 3SO3C 1M1SA 1RUMH 3W9EA 3H0TA 1NBVL 1C7SA 4MZ3A 3UTZB 5I74C 1Q9KB 5IVZB 3CFKA 4OUUA 4GKNA 3GO1L 5I8EB 2H2SD 4JG0L 2XACC 5D5MB 4F7EB 4I2XA 5CJQH 3D6GA 5FO7A 5FK9B 2VN4A 1YPZE 2PTUA 5H2BA 2OP4H 1NBQA 3T2QA 4RWYH 1U8LB 4I3SH 5C7XL 2LE9A 2NY4B 2F8XC 3CVHB 2SEBA 3DUHA 3JTSA 3BGFC 2PN5A 4WW2C 5CKGA 5ITFB 3O6LH 3VXSA 1WBXB 2VXQL 3WS3A 1RFDH 4PB0H 4PJAF 5AZ2H 1S7XA 2QQLL 1QFWL 1X4XA 2AK1L 3D3VE 3IDXL 3AY4C 1TDQA 1GPOH 4RIRA 4OKDA 5C92A 1WK0A 2HKFL 3L5WB 2NY6C 3T8XA 4Y5YB 2H41A 3FHAA 4TOYH 2Y06L 3PWJA 2WM0A 2X1WL 4PJHF 3MV7E 4NN7C 1G9NC 4L8BA 3SDYL 4QO1A 2BK8A 1LILA 1U3JA 1U8IB 2HT2C 5CLTA 3I85A 1N0LA 2HTLD 1W8NA 5J1TC 3TYFA 3L3OB 2DDQL 2CIKB 1DBJH 1JNHB 4MNQA 5KW9H 2E6PA 3MV8A 5IGXH 4Q9RL 1YY9C 1M4KA 1F6AB 3G9AB 4HXBL 4QCIA 1XGPA 4OV5A 4JPVH 1NDGB 2X1QA 1P7KB 3B3IA 4HIXH 1HNFA 2PNDA 4NQVA 3W0WE 1ZGLP 35C8H 4ODHH 4WFGE 2AEQL 4WV1B 5ACLA 1FVEA 5I76A 2AXGA 5IOPB 1T21B 3BJ91 3TYGH 3X3FL 4JFFA 5AUMB 5E08H 1LO0L 4KVCH 1UZ8A 3SQOH 2VLKA 43CAB 4UTAL 2EECA 4F7PB 1KCVH 3U7YL 1NEZA 1ETZB 3QZWG 4MQ7B 1INDL 4M5YH 5EO0A 4HIIB 2BVQB 4M5ZH 4LNVA 3EO1B 3BSZL 1DQTA 3NABL 1C5DA 2GSIA 4MCZA 4NRXB 1QZ1A 3NIDE 3BZEA 3ZDZE 5K59F 2CIIB 2VLLA 4ZO9A 4YHOH 4B5EA 3UCRA 3ECBA 4NNXB 3OR7B 1RZJC 3LQAC 4YBHA 2EYRB 3WIHH 1KLGA 1UZ6E 3GJFA 4ZXBC 1UACL 5HJ3B 1A7RL 3D18A 5IESH 4Z77A 3DXAA 1WCBA 3AMKA 2OJEA 3KR3H 2BSRB 4LIQL 1C8PA 4OFYA 4HKZB 5HHMB 2IPKB 3CJJA 4G6AD 1MEXH 3V6ZB 1X5IA 1FIGH 1D5XB 2J88L 5C0AA 2I24N 2NY5H 4RISL 5E2UH 2OK0L 4D0DA 2ATKB 3KXFB 4LCWB 4N8CH 1EMTL 3CLEH 5JORB 3F5WB 1FSKB 5C07A 2QQKH 3ZKQD 1C5CH 4J4PC 2Z31D 1N6VA 2MPAH 5BW7C 2Y6SC 3REWB 1JI2A 5IVXA 4NIKB 1AJ7L 5EC1B 5J3HC 4OLYH 2P5EB 3V6OE 1XF3B 4YHPA 4NBZB 4PG2A 1MRFL 1H3TA 4XP5L 4N8VB 1KT2B 3OX8B 3FB7B 5DHYA 1HXMA 4MXQD 1DFBL 4P2OA 5I8KL 4LP4A 3TT1L 1HSAA 2JCCA 3VDCA 2V5RA 2VDNH 3M45A 1U36A 1GC1C 1HINH 2VZSA 4EI5D 3EYSL 4JPIA 2LAGB 1WZKA 1S78D 1ZE3C 3HE6C 4PP1D 1T22A 4H5SB 3MJGX 5HYJB 2ZNXA 4TQEH 4MJ4A 3TZVB 1WT5C 4U6XB 5I30H 4WUUB 3RWIA 5GPRA 1QQDB 3U0TA 2EDHA 5JPMA 5KOMC 3JXAA 3FO2B 4C56A 4CU7A 2J1KA 3NZ8B 3MGTB 1NBZB 1WWBX 5IIEB 4YHIB 1ZS8B 3F12A 3F65A 4ETQB 1T0PB 4X7TA 1MLCA 3S88L 3T65B 2EIDA 3FMGL 4HIHA 3NAAL 2VQTA 4I18B 5F3HA 5J9PA 2PYEB 2XTJE 3GJEA 4GH7B 4KTEH 4NFBA 1I8LA 5J12B 3MO1A 1FGNH 5ICXB 4RMRA 5IM7B 1HI6A 4JHAL 1OTUC 1XF4A 2YWZA 4PYGA 3SO5A 1TENA 5TE4L 3VGEA 1UKSA 3HZKA 4OI8A 3C60B 4PTTB 4FQ1H 4KJYB 1GGBH 4NQSA 4PJEA 4TSCH 2J8HA 3BIKB 4K7PX 4X0KA 3OXRA 5HGBA 5DC4B 3HLAA 5IMOB 2A9MH 2EKJA 4G7YL 2IALA 5K93A 4E41B 2CR3A 1T0MB 3BKYH 5A16A 1UJ3A 4G6FB 1BOYA 2WV3A 1I4FB 1MREH 5JA8B 4Y2DC 2J6EL 1D6EB 4OLWL 4L3CB 2PXYC 5A1AA 3V5DA 4G3YL 3FQRA 4IRSC 1VGKB 5C09D 2X9YA 4XPAL 4RWHA 1SMOA 2P47B 4XB8A 3ZMRA 4P23C 4M1CC 4QHUA 3VA2C 5E99L 3FQTA 2X4RA 4JO2L 2LU4A 4KFZC 4YXLL 1PKQA 4N8PA 3WNOA 2C4FT 2JELL 2KQNA 4LLVA 3C5SA 4MNHA 3ZDXE 4DKEL 1OGTB 5GS1C 1MCRA 3QZWB 4AY0A 2A1WL 1NMBH 2DQIL 4NN5B 2R4SL 4J7RA 2DRUA 3N1FC 4C58B 5KSVB 3TNMA 5I9QB 3ET9F 4YO0A 1J7VR 1PX4A 4NT6A 4FNLH 3MV9B 3U9UA 1OW0A 3D25B 5EWIH 1WAAA 3ARTA 5FHBL 3LDBB 3VFSA 1QUNA 5CD3A 2VSDA 2XPGB 1EJOH 1MPAH 3QWRA 1NCAL 1GXEA 4V2BA 1LD9A 1L6XA 4TNWK 4GBXD 5GGTL 4WI3A 2V17L 3EJYD 4HUNB 3MUZ1 3O8XA 4ZFZB 1JGDB 4JM2A 5BVPL 4L3EB 4LCYA 5GSRA 1TTGA 3SCMB 1MAML 1H15B 3QFJB 1ZANL 1VKXB 5C0IA 5IFHH 1WWAX 2FGWH 2DLTA 3FOLB 5I73C 3GRWA 3BEVB 1LDSA 4U1GC 4OBRA 1JGEB 1REIA 2WQRA 5I1DB 4ODTL 5JW4Q 4IHOA 2JCCF 4U1HB 1Q1JH 1FBIH 3VWKB 4Z7VB 1DEDA 5TDPA 5B4MD 5FUOH 4PYHA 4ODUB 1R24B 2E27H 3S34L 1E27A 3O2DA 1DVFB 5CHNB 1FAIH 1I1AA 3VXOB 4M8QA 3GUTB 25C8L 1N59A 4OD1L 1Q72H 3UPAA 1F90H 3KPOA 3NTCH 3DSFL 5TDOB 5IV2A 1G9NL 3TA3B 5T1KD 1RU9H 5IJKA 1V7NL 3BX7C 1KCKA 4JFDE 2FBOJ 1BOGB 3F8UB 3RZCD 4LLQB 2OSLA 2Q86A 4BSVB 5GS0C 1HCVA 1J8HB 1WCQA 3M17A 5SWZA 1FFNA 1IGMH 2PETA 3LB6D 1IGJA 3WHE0 1DLFH 5T33H 3TJEH 2R4RL 3GK8L 5HHOD 1WF5A 3A67H 3QQ3B 1XF5A 4KZEL 3LRSA 4F9PA 1FGVL 1ODAA 4ODXB 2Y7QA 2QJDA 3LCYA 1NGZA 2D7QA 4DN4L 4LARL 1FCGA 4NOFA 1J9CT 3SJVA 4PJEF 1R5IB 5JXAL 4ZDHB 4BZ2L 3IDJB 3DRQB 2P5WB 5FV1L 2ESVA 4Y4KB 3CPLA 4P48A 4O2EB 2XXMB 4KZDH 3LKOA 2RGSA 1PYWB 3VFPA 1FFQA 5CJXC 3WFDL 4FQXA 4N5EC 1UC6A 2H8PA 3IT8D 3WUZA 3WFHB 5ESAB 2WZPD 1AHWC 2AQ1A 4JRYE 3BOVA 4WHYG 4FMKA 4KPHH 5HYSG 1FL6A 3ROOA 3RDTC 1I1YB 5T3XE 5B39A 3F6LA 1ED3A 2F53E 3BKCH 3C6LA 1G7MA 3QI9B 3D39D 5CUSH 3ILPB 4GAFB 4LKXB 5IKCA 4AL8H 3FB5A 1Z9OA 4K9EC 3L95A 1G9MC 1XGQA 1T0NA 1BZ9B 2DD8H 3MRFA 4X7CC 1A6WL 1JWMB 3O2VL 4P99A 2J7LA 4YDIL 3LRGA 3LSOA 1EZVX 3OZ9L 4JAMB 3TCLA 5F7EL 4EIZC 5D8JH 4WWKC 2V5SA 3A6BH 3KYNA 4UDUB 3F7YB 1VADA 2C3VB 1S7TB 2OYPA 5I66A 3MBEC 5FYKH 1WAAF 3TESA 2R0WL 3DGGA 1MFCL 4Z5RA 1JHTB 1K9TA 3I02B 2JJWA 2I9TA 4X99B 3QFDB 5E5MB 5CBAA 1IQDA 2XG4A 2MKWA 5HDQL 1MNUL 4MAUL 4TRPH 3TFKC 1LP9B 4LLDA 4JM2F 1DBKH 2FO1A 4CVXA 3H2WA 4DN3H 2PO6B 1JI1A 1ND0B 1NC4A 3DBXA 5ANMB 12E8L 5EU6E 4OAWB 3VJ6A 1EFQA 4XP9L 5E2VL 3QUXA 4M6OH 4OLZH 1K85A 2NY6B 1JWUA 4LRNH 5HPOA 1N5YL 1T1WB 5KN5A 2IANA 1CL7H 1WGOA 4N0UB 5DMIL 3GJFH 1MOEA 2EE3A 5C0BA 2GCYA 5EZIH 3MR9B 1FO0L 4M8VA 5TE7L 1CK0L 3CVIH 3OXSA 4MA8H 4UBDD 2APFA 5ALCH 4ZUVB 2BRQA 3DRTA 3QCUL 4NQDB 2I25N 3WO4C 3KGRA 4QRTB 3QIUA 4OJFL 1U3HC 2NY1D 4RX4A 4U1KA 1J86A 3MRPA 5DGRA 4TNVK 2BOBB 1KJ2A 4ONHB 5FOJA 4DEPC 5EZJB 3WS6C 3MJ8A 1A9EB 1CQYA 5F7MC 1FJ1B 3ZKNC 2D9CA 2ICES 4XAWH 1MIEL 1S7VB 2NW2A 3DROB 5FYJH 1QFWM 5H37H 3RVUC 1OAZH 4GMTL 4LVOB 2FJFA 3H8NA 4KVNH 3FFCD 2BCKB 3MLTA 1Q8MA 3GSOB 1S8DA 4U31A 4XPBL 2ITCA 5EU7C 2EEAA 2Y36L 2C1PA 2XWBB 3FCTA 4R4BA 3Q3GA 2FBJL 3V79C 1G7JB 3H7BB 3NPSC 5DF0A 5FCSH 1KXVC 5HPMA 3EZJB 3RVXC 3GM8A 5CEZE 1QLRB 4ZFOA 2ERJB 2ZWLT 1SJHB 5EO1A 4LRIA 5D70L 3AREB 2UYLB 2OZ4L 2Q8AH 1AD9B 1U8NA 3V0AC 1OAXH 2P7TA 3VA6A 3QA3B 5F71A 1L7IH 1RIUL 2HTKC 3LKNA 3W9DB 1LO4L 4I0PC 4F7TA 1IGCL 2XWTB 3CU7A 4GMSL 5D6DA 4I3RL 5ELIA 3P30L 3WL9B 4RCAA 1HDMB 1IAII 4OI7A 4EN3D 5DJAA 4LSPH 4YEEA 3SKJL 1K2DA 2XNAB 1GGIL 4LAQL 1Q38A 4JG1H 1EUTA 5HHPB 3WFCL 2LTQB 3S3JA 2VITB 3RJQB 1AGCA 1G0XA 2R69H 3WIIL 2F54B 4JANB 2AJYL 4HG4J 2CKBB 4GG6B 1OCWH 2PTVA 1HN1A 4PRIA 4JFHE 1T2QL 2O93L 3MLRH 4E0RB 2YKLL 5BQ7A 4Q0XH 2IPTL 2VMFA 3Q0HA 2BVPB 1S7WA 2QSCH 2BNQE 4QRRA 4Y16A 5DVOA 1QSZA 5GRZA 3FO9B 3SDCA 1YYML 5I18H 2BSED 1UEYA 3E6HB 4XI5C 4KI5E 3UPCA 2V2WA 3O0RL 2ZUVA 2KL6A 3PGFL 1MVUB 3EO0B 3FONB 3HE7D 4R97B 1AKJB 1MI5A 3RNQA 1W0VB 2R1WB 4AEEA 2Y5EA 3JZ7A 2YXMA 1CT8A 1V3KA 5C9JB 4MNGB 3SDXE 4NC2B 5TGBB 3PQYE 1P4LB 1FZJB 3G04B 4G8GB 5CSZA 2GAZA 1NAKL 4TUOB 4Y19B 3QRGH 1TZIA 3FQNB 4NYLA 4R4FL 4NGHH 3PWPA 3LEXA 4WU5A 2R8SH 4WW1B 5CGMA 1LEKB 3CFBB 1A2YB 3C5ZB 4AQ1B 5JW4N 2P24B 4M6ML 4GW4B 4IDJL 5E9DB 5F44A 5F89B 3UJTL 4ZFFB 1FG9C 3KPLB 5LGKA 2NY4D 4Z8FL 5DJ0A 3SGEH 3HZMA 2WWMC 3N9GH 4S1DC 1I3UA 3QCTH 4LF3A 3FAXA 1UWXK 4YX2L 2Q7YA 4PLJD 2EH8L 4N9GA 4DGYL 4MDIB 3AM8C 4NZDA 1QVOA 4KJWC 1DQLH 4ODBD 4PJ9B 1OSPH 4H88H 1FV1B 3QJFB 4KY1L 3RWFA 3WNLA 1AR1D 2X1OA 1ZVSB 4DZBB 2VKXA 1YEHL 4EI6B 5ISZE 5C0DB 3QB7C 4L8SC 1QP1A 4PPTA 4XVSL 4UU9B 2GJJA 1LWRA 1DSFH 3A6CL 6CGTA 1PZ5A 3OB0K 4M3KB 1FPTH 4ELME 3DWTA 3K74B 1DQDH 1YC7A 3RWHA 1WTGT 3LD8C 3VE0B 1IC4L 4ONOA 1D9KC 5FOBA 3L7EA 4DTGL 1YMME 5MEQA 3S4SA 2PYFB 5GRJL 5DD1H 1CE6B 4BKLB 3NVQA 4ODWB 1FN4B 1A6ZA 4RGMC 5IB2A 1NCUA 4HS8H 1I8IA 1T1YA 4OLXH 3U6RB 4XX1E 5EU5B 1D5MA 2HLAA 2W60A 4I4WA 3IFNL 4HXAL 1EGJA 1S9XB 2K7QA 1ZA6A 4QXTA 4X6DB 2HMID 4K3GA 4JPWL 1YEGH 1KEGH 2CH8A 1J8KA 3HNTL 4PBXA 4U1SB 2CLRA 5T5NF 3HC4L 4HDIB 4UV7H 4CW1B 3VMOA 2FZ3A 1MCIA 3T3ME 1FE8H 2XN9E 1P53A 4BQBA 4JZNB 5B8CC 5DD5L 4UIMB 1ZHNA 3FJTA 4B7IA 1J1XH 4DOHB 3TWCL 3ESVF 3VCLB 4LOUD 4WY7H 2PF6A 5E1AA 3UAJC 1NANH 1KIQA 4Q9QH 3K8KA 3D69A 3EFFA 5DC0A 2IPUK 4R7NB 1AGEA 3DOSA 1QEWB 4EUPG 4BZ1L 5K9OB 2AQ2A 4P46A 1ACYH 3U4BL 1HXYA 8FABA 3OGOE 4WHCA 3DO7A 3AGVA 2E8ZA 3PIQB 4WI9A 3FT4B 4PJGB 2XQBH 3RHWK 3D9AH 3IF1A 1X44A 3BP4B 5I1KH 1JGUH 4S1SL 4UILL 1I3RB 1QBLL 3FRPA 1FC1A 3ARDC 5FYLH 4NO0A 5SWSE 5IT2L 2W91A 2XKNA 4HIJB 4CMMB 4JY6B 2DQUH 5BRZA 4Y4FC 5IBTL 5IW3A 3ILQC 4NDMA 4CDGC 3HHRB 2ZOLB