The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
139
|
structure length |
139
|
Chain Sequence |
RKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Cell cycle
|
| molecule keywords |
CELL DIVISION PROTEIN ZIPA
|
| publication title |
The bacterial cell-division protein ZipA and its interaction with an FtsZ fragment revealed by X-ray crystallography.
pubmed doi rcsb |
| source organism |
Escherichia coli
|
| total genus |
41
|
| structure length |
139
|
| sequence length |
139
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2000-06-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04354 | ZipA_C | ZipA, C-terminal FtsZ-binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Cell Division Protein Zipa; Chain: A, | ZipA, C-terminal FtsZ-binding domain |
#chains in the Genus database with same CATH superfamily 1S1J A; 1F47 B; 1Y2G A; 1F7W A; 1F46 A; 1F7X A; 1Y2F A; 1S1S A; #chains in the Genus database with same CATH topology 1S1J A; 1F47 B; 1Y2G A; 1F7W A; 1F46 A; 1F7X A; 1Y2F A; 1S1S A; #chains in the Genus database with same CATH homology 1S1J A; 1F47 B; 1Y2G A; 1F7W A; 1F46 A; 1F7X A; 1Y2F A; 1S1S A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
